5J13C

Structural basis for tslp antagonism by the therapeutic antibody tezepelumab (medi9929 / amg-157)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
209
Chain Sequence
QMQLVESGGGVVQPGRSLRLSCAASGFTFRTYGMHWVRQAPGKGLEWVAVIWYDGSNKHYADSVKGRFTITRDNSKNTLNLQMNSLRAEDTAVYYCARAPQWELVHEAFDIWGQGTMVTVSSASTKGPSVFPLAPCSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPQTYTCNVDHKPSNTKVDKTVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and antagonism of the receptor complex mediated by human TSLP in allergy and asthma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Thymic stromal lymphopoietin
total genus 44
structure length 209
sequence length 221
ec nomenclature
pdb deposition date 2016-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j13C02
3CGTA 4WEUD 4GT7A 4UNVA 3AM8C 3TYFB 3IDMA 1CU4H 1RJCA 4YHNA 3FT3B 1YECL 3LRSB 3RPKA 3ECBB 2KQMA 4X5LA 4NSKB 4UQ3B 2DQTH 3UYRL 1R3HB 5IMMA 2CIKB 2OL3L 3MROA 1UACH 2VNCA 3RWCA 2F19L 4GRWF 3KXFE 3OTTA 5I1EL 5IB2B 4X4XA 4W70A 1U3HA 4F7MB 3VD7A 2XACC 4PRPE 4PRHB 2AEIT 1NMCB 5CSZB 1UH3A 2XTJB 3WIFA 3DVNA 5LGJA 3FQWB 3ILPA 1P84J 1M1SA 4PJHB 1EFXB 2JJVA 3C5JB 3WXWH 5DGRA 1RK1A 1J10A 1HSAB 4YC2B 5JA9A 1NLDH 3MTRA 1UKQA 2XN9B 5GGRA 1RHFA 4OGXL 4OCRH 4JZJA 1LO0H 3OXSA 5CFHA 1N8ZB 3MUZ1 2Z93A 4WUKL 1F13A 4PY8I 5D5MA 2ZG1A 3MGTA 4RCAA 3MNZA 3MBXL 5MENE 2E7CA 3CUPA 1LEIA 4JLRB 1J5OL 4WHYG 4P2QB 3D0VA 3FO1A 5GZOC 1A2YA 5CINL 5DK3A 4GRLD 1IKNA 4HC1H 1CXKA 2E7LC 1YEHH 3L3KA 3VE0B 1LE5B 1NL0L 4TOYL 1MVUA 4O51B 2V5SA 1F6AB 2PYED 3VRJA 1SQ2N 3O8XA 1IRAY 3HUJE 1K9TA 1WITA 3MLSH 4POUB 4KKAC 3G04B 2MNUA 4NUGH 3EDFA 4H20L 3GMQA 1UB6A 3WNMA 2AK1L 3VWJA 5I0DA 4FQQA 1Z0MA 2PTUA 1JBJA 3LS4H 4G6JL 4TSBH 4Z7WF 1IM9A 1JRHI 5TPWL 1A21A 35C8L 3SKMB 5AG9A 2BSSA 1XGPA 1A1OA 3VG0H 4F9PC 1Q9KB 1N0XL 5C0IA 2DWDB 1E28A 5FYLL 4PJAA 1WEJH 2DQJL 5H94A 4LPWA 1NUGA 1ZE3C 3BIBX 3FFDB 4YO0A 3H3PL 4W6XB 1IAOB 3A6CH 1WAAF 4OKVA 1EHXA 3S5LB 2G75A 5KSAD 1O7SA 2HAZA 1EXUB 1BBDL 2IEPA 5DMIH 5EO1B 2BCKA 3DX6A 4FQPA 2F54B 5DUPL 3QULB 1ZHBB 4YHZH 3WNPA 1MCOL 5ICXA 3QDGB 1DDHB 2YC1A 4XNZB 1FYHB 1CFQB 4XC1L 1RULH 3ARDD 4K8RL 1P7QA 3RVWC 3OJDA 4OLEA 3RIAK 4XMLH 3CNKA 3GMRB 4AM0B 1NFDA 4C59B 4APQA 5SWZB 5T3XE 1MIMH 2MCPH 2Y07L 3P0VH 4PV8A 3BMVA 5GHWL 3VH8G 1VB9A 1S8DB 5DSCA 3MLYH 5IBUG 4PY7A 4KQ4H 1U92B 3MMEB 4K3GA 5GJSH 4XPFH 3D2UA 2VRAA 2OBGA 3FT3A 4Y4HB 4JZJC 3TH2T 1WZMA 4NO3A 5HYSA 3LZFH 2R1XA 1QSED 4OTXH 4ONFH 5GS0C 2CD0A 5JLZB 3RKDD 2PTVA 1MI5B 4HIHA 2P8MA 3LY6A 3U9PL 3NZ8B 4JO3H 4YDJA 4LHJB 1INDH 1UCBL 3Q6GH 1PD6A 2NZIA 5E8NA 2Q7NA 4YHLL 3B2UC 2NY1D 1AKJB 3PF2A 2UWEA 2VLJE 3F8UB 1UA6H 5IB5A 4BA8A 5GRZA 3VD9A 4S1RL 2EDQA 3VXQB 1DQDL 3PGDB 3L6FB 4NDMB 1T7VA 2XZZA 3WL9B 4LGPB 3EFFB 5A2FA 2ICES 3CFDA 1MREL 3C5JA 1NGZA 3QI9B 2EDKA 4KJYA 2E6QA 2HVJB 4K3JH 5IVZA 1C16A 4WHDA 1GAFH 2BVYA 2AV7B 1NJ9A 2FSEB 3TN0C 4GRMB 5EOTA 1P4IL 1XR9B 1RJZB 4K94H 4HULB 1JNLH 3MNZB 3RPIA 1WBZA 2APTA 1TQBB 5EIQA 5B39B 1YMMB 4TNWF 3T8XA 2O5YL 2EYTB 3ZE0F 1IKFH 3MGOB 2DIBA 4GW5B 4HEME 1DLHA 2UWEF 4LVNB 3RKDC 4TQEL 5D7JD 5FHBL 1R0AL 4M3KB 3KYOB 4JN2B 4ZFOA 3KPOA 3BN9C 1MRCL 4XH2B 4M61A 3GKWL 3DTXB 5IV2B 3KPQA 1KF9B 4Z78A 2HFFA 4HIJB 4XVUC 4L8BB 4Z9KB 2NY3B 2BDNH 3BPCA 3UC0L 5L0QC 3MBEA 3NCJH 1E28B 1P7KA 1NAMB 3SGDI 4ZUUB 4OLVH 4RFEB 4EIGB 1J11A 3ZE2E 3BFOA 4QO1A 4Q9RH 1IM3A 4HLZG 4CDHA 2R2HA 1M7DB 1SEBB 1GCFA 4I0PD 5I75C 1CL7I 4Z77B 3CH8A 3DRQA 5I16A 4P2QE 5CAYB 2C3GA 5C9KA 1F4XL 2EZ0C 3N1QC 3T1FB 1G6VK 3RDTA 3GJEB 3MLZH 5IVNA 4APQB 3MCKB 1NFDF 2ZSVB 4N5UA 4KQ4L 1T2XA 2XG4A 3FQUB 2ARJA 4WUUB 5BRZD 1IC1A 2V5YA 5IHUL 4PRPA 4M9PA 2DQIL 2YD3A 2BOCA 3TCLA 3GMNB 5J57B 4NO3B 4OLZH 3R8BB 5IEHA 4R4BB 1BZ7B 3RWDA 2Q3AA 3NFSL 1MAJA 4OD1L 3SCMD 2BY2A 4W81A 5DDHA 4LCWE 2XY2A 3L3DA 2V17H 5M95B 1KEML 4ODHH 3HR5B 8CGTA 2R2EA 3VXOA 4EUPB 1VFUA 1G84A 1DZBA 5A1AA 4CADB 3VRLE 3WNNA 3K1DA 4F9LC 4G6AC 1D6VL 5BS0A 1RIHL 5E94A 1ZT4B 4YDIL 3WSQL 2ICWB 2IAMC 5DK2A 1YEEH 4XNYH 3QPXH 2OQJB 4UIMA 4AEHL 2F53A 3ARGA 5E9DD 1PKOA 1NC4D 5BV7H 3WIFB 4C57C 1P6FA 1MCWW 3U7WL 1OCWH 1OF2A 4WEBH 2FX8L 3VU2A 3P73B 1CDGA 1FO0H 2AEQL 2SEBB 2ZSWA 4HV8B 2N56A 2Z35B 4RISH 3O3DB 2AJXH 2R4SL 3DI2B 5JUEL 4I1NB 2DLHA 4BQ8A 3B6SA 3SDXF 1GGUA 3LIZH 5D96B 1ES0B 3VXMD 3OB8A 4OF0A 1D5ZA 2VLKB 1YY9C 3V8CA 4KI5C 3QEGL 3QIBB 5C70A 3A6BH 4DW2L 2R8SH 1KC5L 4F37K 5JQ6L 1F6AA 3U4BH 4S10A 4UDTA 5E4IA 4JZNB 4P59L 1QKZH 1JHKL 1JZ7A 1RZKL 2NNAB 1FPTL 2Y4SA 5GRUH 3TFKC 3OKNB 5IFHH 1NUDA 2PW2B 4LSTL 3S7GA 4QRPB 4ERSH 4HX1A 3SE3A 2R2BA 4K71C 3G6JB 1IEBB 4U6XB 4EKXA 2JIXA 3BZ4A 2R23B 4KFZC 2IGFH 2PO6C 4OGAD 2R69H 3S34L 5HTSA 2VKWA 4OSUH 4M8QB 4E9LA 1LK2B 2C4FU 5J13B 5E2WL 3MREB 1KLGB 1JPGA 4GXUN 3G9AB 5I15L 4YR6B 4L4TB 3VH8A 2C3VA 3ARRA 3BGFB 2G75B 2J6EL 4HFUL 4HXBL 2X4UB 3FN3A 2O61A 2VYRE 2R9HD 4KHXH 5DRZB 1PFCA 2GIYA 5E6YA 2XWBB 5A2LH 4XAWL 3RDTD 4ZTOH 5HGBB 5DFWH 1U8PB 1INQA 3PE9A 4U3CA 4X4ME 4KUZL 1PYWB 4FRWA 2IPKB 5FAAA 4OCXL 4DGVL 4AM0A 1FORL 1BX2B 2FO4A 3MA9L 4DWHA 1AP2B 1T83A 2B1HL 2GUOA 1HWGB 4FMFA 3VXPA 5L2KD 1E4KC 1RJLB 5CGYD 5T1LA 4WHYH 1CLYH 2D9QB 4X5XB 3EYVA 4RMVA 3CXDH 4NNPH 4TUJB 5LGHH 2D7OA 4BFBD 3KYKL 1RIVL 4ZMAT 3FAXA 3U0WH 4EXKA 2GJJA 3IXTA 3Q5YA 4JFEA 3VG9C 4QXGH 4RA0C 1NCWH 4P23A 3H42H 5C0GB 1U95B 3DUSA 4C83A 5F7NC 1XZ0A 2FLRT 4TULH 1GGCH 2CKBL 4LVHC 4PTUA 1YEEL 2PR4H 3BYYA 4PGDB 4MDJB 2YK1H 5EUOF 4ZODA 3AS2A 5C8JB 3T0EA 3X14B 3A6CL 2JJSA 4A6YL 1RZIB 4ZO8A 4DZBA 2YPKB 5CP3H 1FNSL 1WZ1H 1HH9B 3X3GH 4JAMA 4MJ6B 4QXTB 1AJ7H 5MENB 2D7TH 2IANB 3QDJA 4Q9CA 5J9PA 4XTRD 2VDOH 4HXAH 3TV3L 2FRGP 1TCMA 1F4WL 2FATL 3DETC 1KCSH 3SKOB 4JG0L 3LMJL 3LEYH 1P69B 3O6MH 4UINL 3DYOA 5BW7A 1TPXB 3BYTA 3HN3A 3UBXA 4W4OA 3QBTB 1FNGA 3KS0J 4K7FA 1RFDL 1BEYL 2WBJA 3BH9A 3STLB 1UH4A 1ZT1B 3QUXB 1MHPH 1II4E 1ZHLB 4J8RA 2FLBT 4RRPA 1HSBB 3T8XB 3O3AB 1KPUA 5F9AC 5CJ5A 1QKZL 2R56L 3C6SB 4M1DL 4YEEA 5JO5A 4U1IA 4Y19E 3BP6B 3CDGB 4TOYH 3OAUL 1TZHB 2X70B 7FABH 3BIKB 1KNOA 3D25B 4BSWA 3C6LB 3DROA 4IRSD 3GMLB 43CAA 1T89A 3NPZB 1J0IA 1ORQA 3BEWA 5ESQB 2NYYD 2B4CL 4OUUB 4G7YH 4RQQB 4BZ2H 2Z8SA 4WU5B 2JIXB 3BZ4B 4PS4L 3TH4T 5C6TL 5F71A 5GS2D 4CVXB 2IG2H 4LSSH 3LS4L 2VLRD 1YY8B 4BH8B 4N8VG 3D9AH 3L3OA 4WEMB 3WHE0 4QTHB 3VWKD 5J1TC 4O58H 5E5UB 2ZKHH 1CLZH 4QRUA 1T0MB 1A02N 1YNTA 2IFGA 3EO9H 3P11H 1C8PA 1JCKA 2OZ4L 4OZHA 1NBQA 3O3BA 4XVJL 2AXGB 3TO4B 1ZGLA 4R7DA 3EYOB 4IOIA 4P5TA 4XTRC 5D5ME 3LZFL 1PLGH 5IJKA 1E4JA 4OCYL 5KAQG 3K7UA 5I18H 2BK8A 3DX8A 2J7LA 3P0YL 5HYJE 2HLAB 3MLVL 5E6IA 3VFNA 4OZHE 4LCCB 4OBSA 3UZQA 1WCQA 3TO2A 4Y2DC 4YHLH 1IKFL 2MCPL 2XKSA 3BHBB 4GAYA 4HGKC 5EU6D 2PW1A 1RIUL 3FB6A 4UV4L 3ET9F 3L5XL 3MQIA 3W0WD 2VDLL 1QLEL 5IQ9A 3DXAD 3QT2A 3W39A 1I8IA 1YJDH 1CS6A 4ZD3H 12E8L 3HNTL 5I1LA 4P9MH 1F3JB 1AXIB 1A14H 3VXSB 5J6HB 3QXUA 2PNDA 4FABH 2NX5D 1TVDA 3FQRB 1OAQH 5KSBB 3QIUD 4J1UA 5E00B 3RUGA 1MY5A 3E6FA 1FE8H 4LIQL 2E7HA 4TYUA 5D2LE 3ZYIA 4X5WA 5DI8B 1BAFH 4RGOH 3DVFA 1UB5B 3ESUF 4LFHG 1K8IB 4XBGB 5DWUL 5H37H 2YZ8A 5ECJE 1CVRA 1UM4L 3MRJB 1MJ7H 2HFEA 1N0XH 2BNRA 2EDDA 4KRNA 1ZV5A 3KPSB 2BHUA 5I8OL 5DK2B 1F58L 2EDOA 5E1AB 1T1YB 3F62A 1N7ML 5LAXB 3BRGC 3N50A 1XGTA 3SKOA 3QCTH 1NBZA 5ID0B 2P5ED 5HI5C 2AEPH 3E1F1 3J7HA 4XPGL 4YHYC 3QJHB 5C2BL 5FYJU 3PABB 1FNGB 5EU4B 5I30L 5HYQB 4JFOA 1Y0LB 1TQCC 1S3KL 2HTKD 1K8DB 2OK0L 3MRNB 3G6DH 3ZL4H 4FP8H 1RVFL 3HG1E 1JMZA 1L4IA 3MRGA 1E27A 4HKBB 2VLJA 5AUMB 4M6MH 4AJ0A 1U8QB 4Q9RL 1T1WA 1VA9A 1QHOA 2QSVA 3S4SA 3Q1SL 2RB8A 3E2HB 3FCTB 3MLWL 4FZEL 4BSWB 3FHAA 1AD9B 1WBYB 5E6ZA 2EDWA 4P3CL 1UC6A 3EJYC 1Q9OB 2YBRA 4M5ZL 1DVFC 1ZEAH 3ZDZF 5FOJA 2P46B 1F6LL 5IHBA 4PJ9A 4YDIH 5A3ID 4G8GD 2NXYB 4OIIL 4UTAH 4XZUA 2DF3A 3BDYH 4U1GB 3DPBA 1GGTA 4WI8A 3UO1H 1ZT7B 1KELH 4P23D 4EDXB 3QCUL 4YPGB 5D1QA 4PJGF 5IESH 2OTWA 4NZRL 1JGUH 4KJQD 1M05A 3VDCA 2XNAA 5GS0L 1MNUH 4HT1L 4L4TA 3VH8B 2FIRT 4UB0L 4DKAA 2WWMD 2PN5A 4YHOL 4JO1L 1BQHA 4YZFF 1KENL 3TBSB 1CLCA 4R3SA 3LKQA 4X6CA 5MI0C 4PG2C 5DJ2A 1CU4L 5JDJA 4LAJH 1GH7A 4Z8FH 2F5BL 1X6LA 3LKPA 1SEQL 5IJVA 3MNWB 5C7XL 5EFIA 3TBWB 5F6HJ 3HC4L 3AY4C 1YN7B 4ODSH 5D1XB 3QNXB 1ZHKB 4NRXA 3C8KA 1AE6L 4M43H 3VFUB 1VGKB 3EIFA 4PD4J 1DR9A 4K3EH 4EXPX 3SY0A 1J8HE 5FO7B 3PQYE 5AD0A 2DMKA 1EUUA 4G43B 5FUOH 4PGEA 3BN9D 5AWNH 1OCWL 1CDYA 4L3EA 3BP5A 2YD6A 1F4YH 4KRLB 4WWKB 1VEMA 4Q0XL 2BVOB 1UKTA 1LO0L 4HS3A 4X8JB 5F1IB 2YEZB 5BV7C 3SE8H 3GSOA 2UUDH 2X4SA 1U95A 3WXWL 4PJFB 4OM1L 4OZ4A 3S34H 5E2WH 3QI9D 4M1GH 5GGSY 2CKBB 1OLZA 3IDJB 2CK0H 1MHEB 4ORZC 4HKZB 1UWXH 3V0VA 4LPYA 2BY3A 2Q7YB 3OPZH 1KJ3H 1BECA 1KLFA 2QQLL 3FHQA 3C9NB 3BPLC 1JL8A 5I1HH 5ESAA 3K2MC 5GRUL 2QQQA 3ALWA 4L3ED 2VE6A 3RZCB 4M48H 4Y7MA 2W60B 4QF1B 1QSEB 1FL3B 1NCUA 1KB5H 4PRAB 2V5TA 2WBJB 3GSNH 2DI9A 5TFSL 2VAAA 3OF6A 2R8SL 1FLTX 3KLAB 1HSBA 2C1PB 5T1LD 3TYGH 1RU9L 2OI9C 5HHMB 3H3PH 3O2DH 1G7JA 1XIWC 3FO9A 3ZKND 2G2RB 4D3CH 2X2YA 4OZGB 3CDYA 1J86A 4UQ2B 5E2TL 3ZDYF 5FYLH 4LAQL 5EU6B 5DHXB 1NC4A 4PV9B 3UCRA 4I2XA 1Q9OA 3WO3B 3RVTC 5IB2A 1MF2H 2V9QA 3KYMA 2Y36H 3U4AA 1A3RH 1HKLL 3CFJA 1JPSH 4KMLB 5H37G 4K8RD 3NACH 5HY9B 3IAPA 3QFDB 1RZ8B 1W0VB 3VFPB 1LILA 4XCEA 3TA3B 5BMFL 4E41E 3FFCD 1ZVHA 2E9IA 4Y4FC 4LNRB 2VDKL 2BX5A 1GGIH 2J8UE 4NQVB 2V2TA 4PJAF 1A22B 2ITDB 1KLUA 2UV3A 3GNMH 5I1GH 1QBMH 1Z3GL 5JHLL 4QRUB 4HGWA 1LMKA 3GIZL 4N1HB 4XC3L 3QUZC 4WTZA 4OZHB 4QT5A 4AH2A 3O3BB 1ZHNB 4ELMF 4NRZA 5I2IA 4Z95L 3D0VB 3FO1B 4FQXD 4Q74A 5BRZA 4OF5A 4IMLB 2Y7QB 2HJKA 4LQ1A 3VI4E 3I6KB 3DX8B 3HRZA 2CJUH 2EDBA 3LKPB 2DQHL 4IS6A 3QQ4A 1OM3L 4M43L 1HHHA 1KCKA 1CXHA 4LASL 3CIQA 2NZ9C 1S5HB 1ZXQA 2I27N 1QNZH 3N1GC 4WVRA 4KJWC 1XF4A 2IQAB 2W9DL 2YMXH 3VFUA 3VXSE 3BAEL 4NQDA 4X6DF 4X6EB 2PYEE 1DQML 3TWCH 3G5ZA 4XX1E 1KXVC 2VKXA 3PGFH 3ULUD 2QHLA 5GHWH 3W39B 1YYMH 2GSGA 4R4FH 5E95B 1S7UA 2VO5A 3UTPE 3HFMH 3NCMA 5I1KL 2CLVA 3H0TB 2WIMA 3HZVA 4OM1H 2NY4B 2APWA 1YEDA 3C5ZB 3GI9H 3U7YL 3DX9A 1FGNH 2C1OB 4U1NB 4QXGL 1S7TA 2UUDK 3QUZD 5MEND 4O58L 3RNKB 4Y4FD 1JRHL 3B43A 5F8QC 1JTPA 2CR6A 3MV7A 1JZ3A 4ZUVB 4UDUB 1A4KB 2H32H 2J2ZA 4GXVL 5JXEA 1RZKC 4NN5C 3WFBL 5F1KC 4P3WA 3GB7B 1ORSB 4WFHD 3QUZB 4KI5E 1CFNB 3H9YA 1ZANH 1EVTC 3ZSTA 5EC1A 5I8EB 3D0LB 4OCNC 3O6FD 2I07B 3EYSH 2A6JB 1KEMH 2WM0A 3C5ZD 4LU5L 4ODHL 1R0AH 4I18A 4JG1L 1ZWIA 1JPST 5KW9L 4KHXL 5CGYC 4D0BB 2BSTA 1U91A 3MYJA 4NC2B 1JN6B 4I0PA 2D03H 4Y4HA 3QQ3A 1I1FA 3BH8B 2PXYC 3BIAX 3D39A 4MQTB 3OR7B 3PHQA 4UMGA 5EIVA 4PRBB 1E27B 4Z7VB 4HBCL 2YD2A 4JKLA 1LO5A 3EDDA 1J7VR 1MPAL 4HIHB 5KS9A 3MO1B 3WFCH 1PJ9A 2JB6A 3MRFB 4ZXBD 3KPLA 4LSPL 4EN3A 3IRPX 3HMXA 1BD2A 5E08H 1U36A 2RBLA 3AS1A 4U1SB 1RJYA 5FM4A 1A7PL 2DYPD 2DM2A 4FTVA 2IG2L 1UYWH 5IM7A 1IQWL 2FR4A 4R2GC 4MB5A 2VLMD 2OTWB 4KZEL 4QOKA 4X6CE 5CEXB 5I1AB 1B0GA 1QEWB 4NO5A 5JQ6H 5F7EH 1T5WB 4WHTA 2J4WH 5D7LA 4DN4H 4JQIH 3P4OB 4CN1A 3D2UD 4K3HA 2Y7QA 2EYTA 5F1NB 3WEXB 1S7WA 2FBOJ 1A64A 2YPVL 5K9QG 5T33H 1CGTA 4MHHG 4QXWA 5D7LE 2DQFA 3DMMB 4QRRD 3SGKC 1Z9MA 3S3JA 1XH3A 4BH7B 5GXBB 1YQ2A 1C7TA 2QADB 5E99L 4WV1C 1WAAA 4WO4C 1HXYB 3RIFF 5BVPL 2DDQH 1EFQA 3MLWH 3Q1SH 4KK8D 3TT3L 4M62H 4HW6A 3VXMB 5DD1H 1EO8H 1SJXA 5FUCC 5T5NG 4U3XA 4XBEH 1QR4A 5C0FA 2Z91A 4J3TA 1CXEA 3BP5B 2VDNH 3RIFK 1P7KB 4G8EA 4KZDH 5D1XC 1X5YA 3OG4B 3IU3B 4WFHE 3PP3K 4Y16B 5F96H 4L8CB 4XAKD 4PLOB 5AZ2H 4J3OC 4WY7L 1YNLH 5KVDH 3HMXL 1AR2A 1M7IA 1V7NH 4WW2A 3OQ3B 3P77A 4HS8L 4YWGL 4WU7B 5E6IC 2R2HB 4PJFA 2ZPKH 3SGJA 2BNUB 4C58B 4HDIB 4ZOCA 2HRPH 5C07B 1HNFA 1OY3B 1J8KA 5I8OH 3CX5J 4KAQH 5IMOA 3BD3A 1KGCE 3FQNB 4Z7NE 1EV2E 1IGFL 3RWJA 4KMQA 4ZO7A 3NIGE 4G9FB 4R2GD 4UOJA 4UT7H 5EBWB 1JNJA 4B5EA 4GKZB 2Z8RA 3X3FL 1MSPA 5GGUB 4LSUL 3WS6A 3KYKH 1EZVY 3SKNB 1RZKH 4JZOB 4YXHH 4Q9BA 1RIVH 2QR0B 2P5WB 5TDPB 1OT2A 4PR5A 3DBXB 4U1GC 4Z7UF 1NCWL 2F5BH 3ZL4L 3V6ZB 5MERA 4LK4A 3B3IB 3L5IA 4Y2DD 3QSKB 4QF1A 4KTDL 1AQKH 4YHKH 4LQFH 1DQQA 4WO4D 2C3WA 3UPAA 2EH7H 4ZNCD 2C9AA 3JV6A 5LWYH 4PJIB 3KXFA 3WHXA 1B9ZA 5D1XD 2WWKO 3TZVA 2NY6D 2UY7A 1BJMA 4RBPK 4UB0H 4APQD 4GBXA 5JIIA 2NY5L 4NCDA 1KCSL 2YD8A 3BGMB 5JOPE 5HJ3B 4GW4B 3CH1A 2ZP0T 3DURB 2VISA 5JW4N 3SN6N 4CJ0A 1TITA 4L5FH 1BBDH 4P5MA 5DMIL 2CUHA 3PIQB 5CMAB 1TQCB 4F7EA 2XWJB 1OGAA 1HHGA 4WUUE 4HWZB 2DLFL 2BC4A 4HQQH 4LNRA 1INEH 3WJLC 4NNXA 5IWLC 3BQUB 1RK0B 2R56H 5IMKB 4N0RA 5HYJA 3SDXA 2EICA 3IT8D 3QHZL 1ZHNA 1JGVH 5DEFA 5J3HC 5LVEA 1DBJH 4UUJB 2OTUB 3NFNB 4X6DB 3SE9L 5FO9B 3RX8A 1TJIH 2VXSH 4N1CA 1IGJA 5EC2A 2HTKC 4ZS6D 2XN9E 1DFBH 4NCC2 4AY0A 5IOPB 2F8XC 4P3DA 2NY6B 5MEOA 4OTXL 3FAWA 3OMZA 5DQDL 1WIUA 5AZEH 3O2DL 4D3CL 1Q72H 4WTXA 4LLYA 3HC4H 1FORH 3MV8A 1H5BB 2NY6C 5EOCH 3O9WB 2VJXA 3JSSA 3VMPA 3H6JA 2QJDA 1T83C 4GG6B 4KTEL 4PJ8A 5GS2H 1QLRA 4PJBB 2WUCH 3NACL 3VGAC 3QCVH 1UM5H 1ZVSA 2APXA 1BOGB 4P57B 4ZPVA 4MAUH 4PJEB 3QUYA 3VRIB 3E8UH 4HXBH 5C07A 1S78D 2OXGA 3IJSB 2G9HA 4LCCC 2OZ4A 3TFKD 3FQNA 1JUFA 4P9HC 4P23C 2OX5A 4QRSA 2ZCKH 3KPSD 3U4EA 4OLYH 4DTGH 3KHOA 3MR9A 1RU9H 3NCEB 3MV11 4PJ7E 1F00I 5CGTA 2YK1L 3CVHL 5D2NB 1IFHL 3TO4C 4LF3B 5I1DB 4I18C 3P3YA 1SMAA 3VFVA 1AGCA 4X6BA 2GTWB 3U36A 1FNEA 1CFNA 4G6FD 4P9ML 1RUKL 3NABH 4OZGF 4ZUTA 1CGVA 2DTSA 1AGEA 1RPQA 2NTFB 2XOTA 4M00A 3R06A 3S96B 5I74C 3S8WA 4JCMA 4GJTB 2HMID 3X13A 4Y4HD 4KQ3H 5CUSH 4PJGA 1U3YA 3S37X 4L9LA 4XGZB 3V6BR 1SEQH 4M4RA 2V2WB 5DYOA 3C6LC 3SE3C 3GM0A 3SHSA 5I1JL 1K4DB 3MRPB 2NZ9D 1P2CA 2NLJA 4JFHD 4FS0A 2M2DA 3SO3B 1J1XH 1MI5E 4EI5C 3T2NH 3ARDB 4KK6C 2CRMA 4ODVL 4HKJB 2OL3B 1I85C 2VB5A 3QDGD 3REVA 2OZ4H 2AQ3A 1AO7A 3RVUD 4HUUA 1RAMA 5CIPB 2LAGB 1F42A 3HG1D 2DQGL 3DVNB 4F7MA 4KROB 2E6PA 1JP5A 2FIKA 4MJ6A 5MENA 1G7IB 2ITCA 4LLUA 5DMYA 4JDZA 3X11B 1JHLL 1YJDC 2ARJQ 5SV3A 4GO6B 3ROOB 3OKKB 1G0XA 1OD7A 4PJCB 1A7QL 4LP5A 5DJZB 1BVKB 1EFXA 1FH5L 4U33A 3OF6D 3TESA 3EYUL 1H8NA 2GCYB 1VACB 5DVMA 1RZFH 3TBVA 2W59A 3KR3H 5CEXA 4KPHL 1JK8B 2I9LA 2JE8A 5HDBF 2VXSL 3ARXA 1A14L 1BZ9A 2XA8H 4V2CB 3NFNA 4NKIL 3JUZA 4DKFL 3QEHB 3PWUB 5GZNC 2BVEA 4NQDD 3I3EA 3LKSB 1UWEL 2PUQT 1AXSB 4ZXBB 1HXMB 2IFFH 1DBMH 1MJ8L 1WTLA 3U0TB 1EGJL 2Y72A 1ITCA 1TMCB 1R24B 3F6IA 4OCWL 1FL6A 1UB6B 4MNHB 2OSLB 4XNQA 1Q9LA 4GKSA 2QADC 2N7AA 1T6VN 2H6PB 4OUUA 1HK6A 2W0LA 4Y1AB 1ZANL 4U0QB 5A2IH 3U7AA 1MFDH 1RIHH 3TVMD 2YPLB 2VXQL 5L6YH 3NBNA 2K9UA 1YY8A 1OGAD 4ONHA 1I9RL 1AFVL 2R4RL 3B9EA 3OSKA 5IBLD 3CLFL 4QTHA 3LKOA 4LCUB 1FFNA 3IU3A 4LSVH 4J4PA 2BVTA 4FQIL 4JHWL 1LGVA 1ZA6A 5KJRL 2W92A 3PL6C 2DIAA 4GBXD 3L5HA 3D1MC 3V52H 3BKJL 1D7FA 4CRPA 4FQXC 5HI4C 4P2CG 1XF5A 3B8YA 4HS6A 4IJ3C 4OV5B 2VLME 3JV4B 1G0DA 5GIRB 1NCBH 2X4TA 3BGFC 4X99B 4D94A 4CMMB 5LBSL 5I19H 4M5YH 5AWNL 1OP5K 4DKDC 2WIIB 4JZOA 4P4KC 1ZGLP 1TCRA 4RGNC 4UBDC 4DGIH 5C09B 1HDMA 1FGVH 1VADA 3IF1B 4P4KB 2AEPL 4PJHE 3CFKB 3WN5C 3N1FC 4U1MA 5FEBA 2VLLB 4QHMB 3RFZC 3K74B 1YEIH 1EBAA 2ED8A 1XT5A 5GISH 3M1BB 5C0EB 3L9RA 1A7NL 4JFDE 3MRPA 2GY7B 2PXYB 2W91A 3RUGF 4LLDA 4OZIA 4KK5D 5D1ZC 4HUXB 1FNLA 5I6XB 4ZPTA 3UDWA 4HUWA 3QPXL 4QHUA 3NH7L 1DE4B 5KVDL 3T4YB 2ZCHH 4U6YA 4K7PY 4XC1H 2I25N 5C0BB 5SX4H 5F97E 1C5CL 4WDIB 1V3KA 5KZCD 1TFHA 3SJVA 4YHMH 5DS8B 3BOVA 3WKMH 3WS3B 1FG9C 3ARSA 5I66A 1BGXL 3FRUA 4KAQL 2F58L 1A3QA 3MRDB 3O41B 2H45A 4LLQB 2ATPA 2VLJD 4Z0XB 2JJTA 4TVSa 2MOVA 4OZFH 5HBBA 4G8IA 4P2OC 1U8LA 4GAGL 4HK0B 3RVVD 2GTZA 2MWCA 5JHDA 3QUYD 1QA9A 3NCBB 2WP3O 3DXAA 2A6DB 2AVGA 3ARYA 2FZ3A 4H8WC 2D31B 4Y0GA 3FO0L 4Z0BH 5K9OB 4JM2D 4ELMB 2VZ1A 2P5EA 2ICEA 4BSJA 3CXDL 1HYSD 3QDJE 3MFFB 4YWGH 4LQFL 1T1XB 1J05B 4XCNA 1CT8A 1PX4A 4ZUWB 4XCFL 5C0AE 4TNVK 1MCDA 4M7LT 4Z8FL 2BRRL 4E0RB 2BNRD 2X9YA 2MQCA 1YNKL 1M71A 1QTYT 4TPRL 4E42B 4NHCH 3CFCL 4G9DB 4M61B 4OKDA 4LSUH 2Q6WB 5A2KH 2QQLH 2XKNA 3BZFB 3PDOB 4PJ9B 5SX5H 4C4KO 2DYPA 3W5NA 5I1HL 5KVEH 3QWQB 3VWKA 1K2DB 3ULSB 3CFBB 1NEZB 2CLZA 1HQ4B 1R5WB 5CSGA 1LP9E 4MJIA 5IIEB 5KSAC 1NLBL 2A73B 3GSNB 2X7LA 3LPWA 1JZ6A 1KB5B 4XCYA 4H0IA 1OD9A 1ZLVK 3DHMA 5JOFB 5D7IB 2ADIA 1RMFL 1V7NL 3VWKC 3NMEA 4HS6B 2V6HA 3P9LA 1Z5LA 4GH7B 2AJZA 2W07A 4DEPC 1YEGH 1MHPL 5T1DL 2HH0L 4J3XA 1U8KA 4EDWL 4RDQF 2BERA 3KYAA 4PJDE 4KKLC 2Y36L 1AI1H 4QHNB 3C8KB 5IB4A 5TQ2H 3EDKA 3MLRL 5CZVH 1S7SA 3MRQB 2J5LC 1QP1A 4UILL 1CL7L 1MRDL 4NPYA 5C92A 3IDNA 1CQYA 1WWBX 5C9JA 5F3BB 2Y9RT 4Y19D 4XNMA 3UTSB 4W4OC 5JIHA 5F7MC 1U8MA 5JXED 3LQZB 1FHGA 2WBJC 32C2A 2GJZA 3GIZH 3L3DB 4XC3H 5BZWA 5CJOL 3BUTA 5FOBA 5F7WC 2R2EB 1OPGH 1UM5L 1D6EB 4I4WA 5C0JB 3MJGX 1NCDH 2D9CA 1FN4A 4AQ1B 2JTDA 2BVQB 1WVZA 3N06B 5CEZL 3DLQR 4Y2OA 2ARWA 4HIXL 3MRCB 3MA7B 2Q7YA 4AMKH 1KT2B 4OFKA 4JFQA 1OW0A 3MV9D 4JG0H 4LHUA 4Y5YC 1XGRB 3SDAA 4XP4L 1K5NA 2HVKB 1E6OL 1H5BC 3C9NA 3K0WA 2HRPL 4N5ED 3OKOB 3H9ZA 3O11A 4KKLD 3BPOB 5EZJA 3T4AA 2X1WL 2PCPB 2BZDA 1NCCL 1LD9B 3QI9C 5F7YC 2EE3A 4U31A 3W5MA 5FF6B 3MRMA 5BV7B 4YUEL 5FFLA 5K9OA 3CVHA 3PV6A 3D3VA 4D9RD 1D5ZB 4IM8A 1OAXH 4OQ1A 1CFVL 1DBJL 4HKXA 4G6JH 4OZFA 4KQ3L 5CUSL 1CBVH 4YAQA 2JJSC 5T3XD 1B90A 2OP4H 5FDYA 3EFDH 5EU6A 1J87A 4YHKL 3SKUD 1EBPA 1I1YB 5FB8A 3MCLH 3P2TA 2YHGA 1EEZA 3QUML 2NW3B 2R39A 1T0NA 3O4OC 3WFBH 3MFGB 5HY9A 4GW1B 4J4PC 1G6RA 4IEFB 3MLPA 5IGXL 3GMMA 3TBYB 4KGJA 4NC1C 2ADJA 4JDTH 4XPAL 4OAWA 3OKYA 2D0GA 1CLZL 4YLQT 4EVNB 1EH9A 1I85A 2FJFA 3EO9L 3WDHA 1Q0XL 4N5EC 1DN0B 3K2UH 3PHOB 5EH1A 1FFPA 1GVIA 4TVPE 2DTML 4JPKL 2KKQA 2GK0B 2VZOA 1I7ZA 3UAJC 1DN2A 3RX5A 4D0CA 1S3KH 4HIEB 4KUCD 1KIPB 2O61B 4F7TB 1YEKH 1HN1A 3DIFA 1I9EA 3ARBC 1I7RA 2XWBA 3PGCB 1DQMH 4P9HH 2MHAB 5LXGH 4X4ZA 3CFIC 3B9VA 2NX5B 2JB5L 1WJ3A 4XPTH 4MZ3A 1TNMA 1VADB 1RZGA 1C08B 3IF1A 2FH6A 3K80A 5KVFH 1W0WB 1EGJH 1WFNA 3E2HC 1J18A 3RHWF 1WICA 2CLRA 5C9JB 3LKRA 1D5BB 3LRGA 5CD3A 3GSVA 2AS5M 3UJJL 3IXTB 3EOYG 3QNYA 1KJVA 3W0WB 1IGFH 3O3EA 4HWBH 4CL7A 5DUBB 4BKLA 2ZUSA 4YFEA 3NGBC 4LRIA 3V7AE 3PWLA 2PXYA 2KZ1B 4XX1G 1MFBL 1BREA 4KJWD 4EI6B 3GDBA 3T0VA 3JTSA 1I1AA 1JYWA 4NN7B 1TTUA 1GIGH 1OGAE 4QNPE 4WFFD 4K94L 1DE4A 1A7OL 4KZEH 3KNBA 2MMXA 2EEBA 1JHLH 2D3VA 4UIKH 3QJFB 3NCYP 2E27H 4PB9H 3SGEI 4JRXD 1HH9A 4RAHA 1A7QH 4JY4A 4R9HA 3IKCA 2IFFL 4DZBB 3QPQC 3Q48A 2ICWI 5IMLA 4JANA 3MRDA 2DDQL 2VABB 3GMOA 3T4AB 3VD3A 5B38B 2VZ3A 3BP7A 5F89A 4ENEC 2YUVA 4NQCE 1JZ2A 2V7NB 1U93A 2VLRB 4HH9B 1SYVA 3DMMC 3WDJA 3LB6C 2JIXD 2ORBL 4TUKL 1ONQB 4JJHA 3GBMH 2PETA 5BXFA 3DSNA 1LEIB 1A7BA 1YPZE 3BPOC 4LLWB 4NO0A 4LKCB 1FZJB 3V5HA 1CFQA 2JLLA 3ZDXE 2CIKA 1KPUB 5D2LB 1DBKH 2YD7A 1FV1B 5J4MA 1PAMA 3MO1A 4YGVB 1J05A 3PWPB 2R0ZL 3QDMA 3P4NA 1HHJB 1KV3A 2NY2C 1J8HD 4AENA 3PP3H 1TLKA 3N1MC 1XGQB 2Y6SD 4K7PL 1MJ8H 4K94C 4EN3B 3KYNB 4U1HB 5HVGB 1NSNL 2VR9A 4HXAL 2EIZB 3U9UA 3AAZA 4MLSA 4XXDA 2YR3A 4F7PA 1QRND 1QRKA 1CIUA 3BPNB 4H1LB 1MRFL 2WQRA 1CR9L 3SKMA 1OL0A 3BN3B 1AGBB 2GQHA 4NNYB 4JGUA 5C0IB 1GAFL 2A6IB 4GRWE 1T4KB 3EO1A 3I9GH 4UNTA 2VITB 3HLAB 3ILQC 3NIFE 2QKIA 4JLRA 3WLBB 2OMBA 1QR1A 3BJ91 3TNNB 4O2FA 3FFCA 2P7TB 1H3UA 3B4NA 2VDRL 1I1AC 3CLEL 1SVCP 1AHWA 3D18A 1PZ5B 3EZJB 4XVTH 4AIOA 2EH7L 1HEZA 3B9KD 1YN6A 4YHPA 3KXFD 1F11B 3ZYJA 3TT3H 3WE6A 1U8KB 4DEPB 2WUCL 3EYQD 3VA2C 3HPLA 1HI6B 1P9MC 5T1KB 2AJVL 3WS6C 4XCFH 4MNQA 1QLFB 1JI2A 5BO1H 3SCMA 1X5XA 2BRRH 2J88L 4URTB 3VXRE 3PJSB 1HQRA 4K23H 4JFFA 4OI9A 4CU7A 5ICYA 4WI9A 3O3EB 1KJ2B 1AQKL 3TIDB 4F7CB 1DLHB 5IQ7H 3VD4A 2A77L 1GZPB 3UTSA 3DV6A 3EHBC 4JN1H 1FZKB 5GGTA 3RUGB 1IAIH 5JW5A 2EDEA 5BZWB 5BVJB 3S5LA 1NGWB 3EUUA 4PG2A 3RNQB 3HE6C 3F12B 4IDJL 5C0BD 3QULA 5T3ZE 3O6LH 4ZOEA 1S9KC 2BFVL 1DTUA 2NY4C 4F37F 1KJ3L 3S3PA 3ULUH 2X10A 3DGGA 1PG7L 3EJJX 4GMTH 3MRJA 4ISVA 4HPOH 2Z8VC 3VXNA 1F3DH 3DVGA 5GGUA 4OLWL 1AD0A 1U3JA 4JFQB 4QRTA 2BRQA 1RUPL 4Z5RB 2VDQL 4FXKA 5DQDH 4JCLA 3GMOB 3VFWB 1T66C 2P5WA 5FA4B 1MQ8A 2L7UA 3WFDL 3WFZA 1WAAE 1MLCB 3ARFA 1QOKA 5JORA 3WO4B 1GOGA 3H9HB 4KK9C 5JDSA 1A1NA 1H3XA 4OD1H 3FONB 5E4EB 3SGKA 4QXUH 5HYQA 5HYSB 2VL5B 3MRGB 4RGND 4UBDD 3PHSA 1EO5A 1YMMA 2X4PA 3REWB 3MRNA 4Z7UB 3DXAE 4N0FB 2XIDA 4XNXH 2B5IB 1FLRH 2A83B 3DV4B 3ETBF 1ROWA 1YNKH 5FUCE 2Z4QA 5IFJB 1EZVX 1R5VB 5KVGH 2UWEB 5DMGD 5INCB 3QIBD 1A6WH 4OLYL 4DTGL 1RUMH 3EO0A 4ZSOB 3RWFA 3I02B 3GUTB 1B0RB 5HJ3A 1N7MH 3CH1B 5EOCJ 2JJTC 2NW3A 4Y4FB 4P2OA 3L5JA 1S7VB 1AXTH 1CF8L 3PWPE 4ZUSA 2FX8H 2ZCKL 5EU6E 4NC1E 4RAUA 3CPLB 2YUZA 4HIIB 1IAKA 3DARA 3U46A 1TENA 2A6IA 1MWAB 1YPZB 4U2YA 1CG9A 4P2OD 3QEQD 5IB1B 5HD8D 1MWAL 2AGJL 5EZLB 1A5FL 2E7MA 5J1SC 4LMQE 1SBSH 3W82A 1DQJB 3EOBA 5DEFB 2OI9B 4HBQA 1RMFH 3UP1A 4JVWA 3HC3H 2X41A 1QBBA 4XI5D 2NX5E 1OHQA 4Q6IC 4FZEH 1Q8MA 4F2MA 3BRDA 5L2KE 1HEZB 1HYSC 1AY1H 2W9DH 2YMXL 4PJIF 4LPCA 4XP6H 3HCVA 2R15A 2R0WL 1IKNC 4I0KA 3GGWB 2DJSA 4LPVA 3MLRH 4U2ZA 4G42B 1FZMB 4IJ3B 2HJFB 4FQXB 4Y5YA 4LBEB 3SCMB 3LS5H 1AI1L 3BPLB 5EUOA 4N8CL 5KSAA 5GS0D 3CXHK 3MJ7A 4L3CB 1AQDA 4JRYA 4ZSOE 3JWOH 5HGAB 5J12C 2KDGA 2R1WB 2UWEE 4LEXL 3QIUC 3ABZA 5D93B 3ALPA 4HS3B 4X8JA 5B22A 3QIBA 2H26A 5IW6A 2P24A 2KQNA 3GSOB 1I1CA 1T6WA 1UJ3B 3KR3L 5F1IA 1JIBA 2VDOL 1BQSA 1A6ZA 3AB0B 1H0DB 4L4JA 3NTCH 3RGVA 1HH6B 4JPIA 2H2SC 4QRPA 5ITFB 2WK2A 3JBG7 2J6EH 4ISVB 1ZT4A 2X1OA 4ZQKB 1NEUA 5E2UH 3RWEA 1JWUA 3QJFA 3GJEA 2OQJA 3LHPH 4UIMB 4JO3L 4YBQC 4ZS7H 3G5YB 1VHPA 3QXVA 3JV5A 4Y5XB 4IMKA 4RNRA 1MLCA 3ARFB 3ZE2F 1UA6L 2FECL 3V4UH 2IAMB 2WINA 4TSAH 3S88H 1NGYB 4HMCA 1F3DJ 5A16B 2COQA 5EU3A 2P48B 1G7HB 2HT2C 2PF6A 4U0RB 5B39G 3QRGL 2VE6B 3ZKXB 2FD6H 5F8RC 1MIML 3EGSA 3KPPA 4PP2B 5E8OA 2HT4C 4WW2F 2X6MA 4OCWH 5KBNC 3O3DA 1BD2D 4RX4D 5KN5A 4S1SL 3NH7H 1S9VA 1CLYL 4PJFF 3Q6FA 3JWNC 1P1ZA 2IH3A 2HP4A 5ACZA 1T89C 5FYJD 3WYRA 4LLWA 4NO0B 4J6RL 3PQYD 5HHVL 5CJQH 1VFAB 2CKBH 4PBWD 1JV5A 1FO0A 1TJHL 4NCC1 1CFVH 1CDJA 1H3PL 1OGTA 1D5MA 5D7JB 3FO9B 4MD0B 5E94B 4UDTB 4RMWA 4V2BA 3ARWA 2AKRB 2NNAA 1KSRA 4GAGH 4FZ8H 3LRHA 5BQ7B 2MQ0A 3ARED 3HI5H 3M17B 3UTQA 3TYFA 4APQC 5EDXA 4RIRA 1OP5H 1B4RA 1BOYA 1U6AH 2FHCA 3EJYD 2R2BB 2UZIH 2I5YL 1X7QA 4KUCF 1LWRA 1IILE 4GAJH 4IOSD 5JQHC 1MREH 5DFVD 2GITB 5E9DE 4KY1H 3EOAB 3VRLF 3F58H 5JNYA 1EGJA 5CEZH 2R0LH 4ODWA 3RWIA 3SDYH 3TJHC 1DQLL 3WLBA 1ES0A 4FN0A 4L4VB 1F4AA 1BZ9B 3H9SA 3QR2A 2EEAA 4O00A 4HJGB 4NM4L 1U8IA 2HT2D 3T0EC 1P9MA 3VFSB 1AXSA 2JB5H 4ZXBA 1IQDA 2Q86B 2M1KA 2HJLA 4R96A 3NAAH 4IRSA 4G42A 2AK4D 1J0JA 1FZMA 1RZJC 2LTQB 4X98A 3IS1X 1BF2A 3DYPA 5KVMC 3TLRA 3TGXA 2FWOA 3MRLA 5IEKB 3B2UD 2J1KA 1BD2E 1MLBA 3RIAF 3VI3F 2OR8A 3IDGA 1QPPA 4LDLB 3WIHH 4F9LA 5F6HI 2D7NA 1LK2A 1NBVH 1QSVA 3QRFM 3C5ZA 1BZQK 3L1OL 1UZ8A 3FQTA 4ELKB 3GSWB 3MV9B 4YR6A 5L88L 5J11C 3T0BA 3QFJB 2EH8H 3R8QA 3RNKA 4UIKL 2M8XA 1NGXB 5DZOA 5FGCE 4PGDA 3QG6A 5EO0B 4YNYA 1YMME 43C9A 4JKWA 3TN0B 4ALAL 1SMOA 1NANH 2Y5TA 4NZTH 4OF7A 4IHOB 5TE4H 1XGPB 4TSAL 2CIIA 4TN9A 4MJ4A 1Q0YL 3FN9A 3QDJB 5J9PB 2DQTL 1TJGH 4OV6F 4AIZB 1N5AB 4BYHA 3RI5F 1GZQB 3G5XA 3ZLQC 1QRNA 1RIUH 3BD5A 3UC0H 1MEXH 1VKXA 3O2VH 2WUBL 5JDSB 5GGTL 1OPGL 4Y2DB 4LRIC 1I1FB 3BH8A 1W0YT 4EEEA 4JFXB 1HIMH 2YXMA 3UROR 2W9LA 1T20A 1T2JA 4OD3H 2FO1A 3MSPA 3M45A 5IB3B 1BM3L 3LRSA 4HAGA 1TXKA 4JFZH 3GSQA 4XNUL 5GS3A 5INDA 3FOLB 1WC7B 2CRIA 1PX3A 5DJXB 3BWAA 3B5HA 3QDMD 1W72A 4Y4HC 2CUMA 2H41A 3IDUA 2AJXL 3QXAA 1HCVA 4HK3N 2WV3A 1H9VA 4X7TB 1C5BH 4MQSB 5E2VL 3UJIH 4K8RC 4RZCA 5BQ7A 1F4XH 3H7LA 3IJYB 4OCRL 1T2QH 2B20A 4GOSA 3I6GA 5DRNA 3GMLA 43CAB 3VFGH 1HOCB 1WTGT 3TH3T 3CMOH 1JYVA 4U05A 3BUYA 3MODH 4U1SA 2FECI 4P59H 3FO2B 5LGJB 4HGMA 1T21A 1E6JL 3FQWA 3ILPB 3K8LA 5BV7L 5C1MB 3V4VL 1GRWA 4ODBD 1A7OH 4M7ZC 4B41A 5E5MA 2PTTA 2BY1A 3MJ9L 1UFUA 1XGUA 4WFFE 5LJYH 4FQ1H 3BH9B 4WFED 2F74A 1W8NA 2BNRB 1CFTB 1MPAH 1NQBA 1IARB 3EFFA 1MCEA 3MOAH 2NQCA 3RA7H 2OJEB 2OL3H 1YEFH 3C6SA 4WW1B 5EBLA 1JWSA 2ICEB 2A6KB 4UILH 3C2AH 3QI9A 4QRRB 1VDGA 1EJ6A 2FJHA 2G60H 3LQMA 1JF1B 2RFXB 4MXWH 1Z9OA 5SWQB 2VXVL 1CT8B 4M6ML 4P46A 2WBKA 5EOTB 3BHBA 4GAYB 4PJ5E 3BGAA 1A9BA 1FCCA 1K6QL 2CXGA 4ETQB 1ZTXL 1EIBA 1BIHA 2AXFA 1W72L 3MV01 5KSVB 2WZPD 3ZMRA 1YQVH 3O6KL 4XMKH 5DK0B 3U6RB 3L3OB 4O9HH 4HKBA 4JRWA 3C8HA 5AUMA 2HLFD 3F7QA 5I17A 4LSRH 4MJIB 1PKQA 2GJ6B 4I77L 3UJTH 5IIEA 4L8CA 3OR6A 5DEZA 4ZFFB 4EJ1C 4NKMB 4NT6B 2BXYA 1MHCA 4LRNH 2NY0B 3GHEH 5C0CA 4JKMA 1JGLL 1K8IA 1NDMB 1A7RH 4HT1H 2FYYB 2AJUL 4WV1B 3SOBH 2NCMA 3KPMB 1DUZB 4C56D 3QG7L 5ID1B 5HI4D 4OLWH 3MUJA 4PV8B 2DN7A 3TYGL 1NBZB 1KIQB 5J89A 5D7KE 5SWZA 4A6YH 4GXUM 1U42A 5D5MF 1A9EB 2AJYL 4XXCA 4PR5B 1MUJB 4V1DB 5D1QC 4MGXA 3MRQA 4RBPH 3M8OH 5C09D 2UZXB 5KN5B 3AREA 1S9VB 4QXUL 1G9NL 3DRTB 2A74B 2IMNA 3KXFB 4U49A 5F21B 2Q8AH 4QGYA 5I15H 2ZUVA 4UINH 1NC2D 1A6AA 1QUNA 3WBDA 2ZSVA 3MXVL 4KVCH 1BFTA 1AIFB 2E7LA 5B4MD 1F4WH 4RZCB 1VGEH 4UT7L 1FNHA 2X9WA 4UTAL 5E7BA 1WBYA 1FN4B 1QBML 5FGRA 2B8OT 4FFZL 1JNLL 1AGFB 2IGFL 1NGZB 5JMRA 5CS7A 3IU4H 3IJHB 3PUCA 2W0FA 3QXWA 1J0KA 4NBZB 1CN4A 3V4PL 5K59F 4HWZA 4KJYB 3FMGL 1V05A 3TEUA 2XWJA 3MLXL 1HHGB 3BQUA 3BT2L 5D2LF 2BC4B 4JKPH 4V1DD 3CU1A 3GIVA 1I3UA 2QHRL 4JFOB 1OARH 1K4CB 5T1MB 3SDAD 4LHUD 4G7YL 4BZ2L 2R1YB 5JNYB 4RWHA 2OJEA 2BNQE 3D3VB 1MCHA 3ARGB 3U9PH 1ZS8A 3TWCL 4OIAA 1BFVH 3J8F7 4KK9D 4PJCE 2RFXA 3BE1L 3DYMA 5FECA 5C08E 3RGVD 5E03A 5I1KH 4NO2A 4QTIL 1V8HA 15C8H 5F93C 2F5AH 4KDVA 4NN5B 4D9RE 3G6JF 1D9KB 3DTXA 5IV2A 3KPQB 4PJ7B 1WZKA 3U79A 2ESVD 3BKMH 3MCG1 5CCKL 4LPXA 1ZLWK 4XNXL 3LDBB 4JREC 5I71B 3BO8B 4FFYL 1WCBA 5DJCB 5FCSH 5CBEB 2ADJB 3DWTA 1P4IH 2DICA 4KK8C 1S7XA 3AGVA 5C08B 4PLJC 4M93C 2XZQH 2VDRH 3P0YH 1G7QA 4M1GL 3NN8A 3QIWD 3ZHLA 4G8GE 4CU8A 2BNQB 4LCWB 1CTOA 4GG6E 1BOGA 4Z95H 3C87A 3SDAC 1I3RB 1LK3H 5EUKB 5ISZA 2EDTA 1J1OH 4YK4B 3QFJA 4RGMB 1IL1A 3HPJB 3ZDZE 4G3YH 4CVZA 2GSIB 3NPSB 4Z77A 2CKBA 4KWUA 3BZEA 3G6JA 4OGYH 25C8L 2YD9A 3FB5A 4N0UB 1MAML 1CE1L 2VERN 4GRLC 4BSVA 4TVPL 2ZUTA 4LHQB 3FQUA 4AG4H 1YN7A 1RUAH 3MCKA 3MREA 3RVXD 1DBKL 1KLUB 1EDQA 1A1MB 2EDLA 3M07A 5TQ0L 1TZIB 3THML 4X0KA 1EO7A 3D85B 4PS4H 5DLML 3TJHD 3AU1B 1A47A 1IAIL 1C08A 1X4XA 5EBMB 5I73B 5TH2A 1AGEB 2FBJL 5F72S 5E24E 2YD4A 4LCIL 3SJVD 3BP4A 4YZFE 4O2CB 1QFUL 4LARH 3HZKA 3RZCD 4UZGA 1CGSL 3DX7B 5E8PA 3PGFL 3QQ9C 4KV5E 4H8WH 3FOMB 5DUBA 4BKLB 2EDYA 2UYLA 2EXYD 4G6ML 1KTDB 3PWNA 5KVEL 2IPKA 4N8CH 3OKMA 1KCVH 2FDBP 1DVFD 4XMPL 4WEBL 3L7FB 1CZ8H 1T7WA 4R7NA 3V5KA 3CLEH 1IT9H 1UGNA 3ARDA 2QEJA 4RGOL 5CBAB 1I8MB 1N64H 3BEVB 3G6AA 3S36X 4POYA 1EMTL 7CGTA 3D69B 5I1IL 1G7IA 2ITCB 2NY3C 1TZGH 1ZSDA 4W4NA 4QRQB 2YUXA 1YEDB 1Q94B 2L7JA 2FJGA 2OR9L 4JDZB 4NZTL 4HPYH 3X11A 1KYOK 4DCQB 5IW3A 4JDVA 5IP4A 3RZCA 4U7MA 4WWKD 4HZLB 5DR5H 1UXSB 1GHFL 3X12A 1HZHH 1F5WA 1FL3A 3O9WD 3GJFK 5E8DH 5F6IB 5DTFA 5I9QC 2X4OA 1SYVB 4YHIA 2AI0H 3I75A 4L3EE 3U83A 5ELIA 4FA8A 3FB8A 3ULVH 3RZCC 4HMDA 5FYKL 3MUY1 3IYLW 2WQ8A 3I3DA 1FZJA 3QPQD 2OS7A 2DBJA 3QQ9D 4JAMB 2FL5B 4HHAB 5CWSA 1CF8H 4FQLH 4UV7L 3HI6H 5GSVA 1BBJA 3HI1A 3QAZB 5I8EA 5JW3L 2VQ1B 2BHYA 1ZLWH 1MJJB 4U1KA 5DJ8A 1AC6A 3D48R 3GSRB 4MXVF 3OKNA 4NHCL 3JWDC 4PLNC 3AROA 2PW2A 3KLHC 1R5IA 3CZFB 3T08A 2DI7A 4CVUA 4ZS6C 4D0BA 1W0VA 1R24A 3SJVE 1RY7B 4Y1AA 2DBLH 5DC9B 4I0PB 1FVCB 4ZFZB 4ZYKA 2CGRL 3FJTA 4ODUB 5B21A 3EYUH 4UOW0 5D7LD 3MLTB 3LPFA 2OTPA 2EKSB 2DM4A 3BW9B 5DWUH 4NNYA 1U8NA 1UM4H 5E9DA 5A43C 4WWKC 5HI5D 4Y8DC 2XRAH 2E8ZA 2Y6SC 2XZAH 1U3HB 4KRPB 1ZA3B 1ORQB 5LGKA 3CMGA 1KXQE 2YSSA 3BZEB 2AK4B 3MJ8B 1RZ7L 3MV7B 1Q9WB 3TM6A 4PJHA 5SWZE 2E8YA 1IEAA 3HRPA 2XV6B 4ONGL 1QFOA 3MRHA 5TF1H 3CZJA 1U3HD 3JV4A 5GIRA 5HGBA 2IPTL 4M6OL 3WD5L 5IM7B 1XF4B 2IQAA 3IRZA 3DECA 3SBWC 5CILH 1BJ1J 3C60D 4NGHH 1GL4B 1C7SA 1JHKH 3TVMA 2GUOB 5HHPA 4S0TD 4NP4H 2ZUXA 3EFDL 4WNQB 5FGCB 3ARVA 2EIBA 2JCCA 1A9EA 2NY5H 4Y4KB 4P4KA 5CP7B 5HHXH 2ENYA 4HBCH 3TPKA 5IF0A 3LQAH 5ICYB 2AV1B 2WUBH 4I48B 4MQ7A 1JN6A 4F7CA 2XPGB 1FFQA 4TRPH 5FKAA 4I3RH 5HI3D 2ZPKL 5EZOH 2AQ2A 1FYTB 4OSUL 2DLFH 2V7HA 3KPNB 2MCG1 1I3GH 5EU7E 4EOWL 4A2LA 3X14A 4KHTH 3VWJB 1S9WA 3IDIA 5I1IH 2YPKA 2DAVA 3G6AB 4OI7A 1WUNT 4M5YL 1KCLA 1E6JH 1NKRA 5F3HB 2NY1B 3L1OH 5FV1L 5JHDE 3FRUB 2Z91B 4LP4A 5IESL 4H25B 4MAYB 1EAPB 4PUBL 3NCCB 4NZRH 5DD5H 3ARQA 2IWGA 2BSRA 1UEYA 4WTWA 4Z7VE 5FA4A 3VXSD 2BVPB 4K3EL 4J6RH 3G5VA 1V5JA 5D2NE 4G7VH 2XI9A 2XY1A 3OXSB 1NGPL 2E3VA 5ADPH 5DHVH 1DEEB 1K4CA 5T1MA 1U91B 5EOQL 4NN6B 2P45B 2IBZX 3HZYB 2B1HH 3QUKA 3D39B 5AZEL 3IFNH 1OSPL 4MNGA 3QDGA 3I2CH 4WJ5A 3KPSA 1ZHLA 5E1AA 4QEGA 1WISA 3WEXA 5C7XH 3L3KB 2OP4L 3VE0A 4NOBA 1U8OA 1NFDB 2CRYA 3EDJA 1K6QH 1WT5A 1KG0B 4U1IB 1PQZB 4AEIH 3OKLA 3DROB 3LDBC 1CDIA 2VQTA 2HN7B 2PO6A 4QHLB 3OPZL 3D2UB 3JWOC 2VDPL 5I76A 1KCRL 1A6UL 3K1KC 2Y06H 3LD8B 4LCWD 2OXHA 2R0LL 4XHJD 4YXKH 1MFNA 2ZCLL 2QTEA 4OQTH 4QYOA 5GGRB 4MCYB 5DQ9B 4HSQA 1L0XA 5IBUB 2LV4A 4HIIA 2DYPB 1YEJL 1S7XB 3D85D 3S35X 1UM6H 1MWAH 2AGJH 5B8CB 5SWSB 4FXGB 1QO3A 3ARGC 4NYLB 5TE6H 3RWHB 5DMGC 5JR1H 1QD0A 4Z76A 5IROC 3MXWH 2W0KA 3FFDA 3GHEL 4HQQL 3Q0HA 4NWUL 4PJ8C 1IAOA 3CC5A 3VXRB 2E6JA 2YSSB 4WU7A 1I8KB 1WFTA 4R7DB 2YBRB 4J12A 5DHVA 1OWRM 4WFGD 3NTCL 2XQBL 3DJ9A 1JMXA 4PRID 4YIQA 5GRWA 3O8XB 4ESKA 5T3XL 3TO2B 4RFNC 3KPRE 3HFML 2O5XH 1YY9D 1M4KA 2G5RA 4HWUA 4LDEB 4NKDB 4DVBA 3GMQB 3OB0K 1MQKH 4Z18A 1S5IL 2ICCA 2H1PL 1WIPA 1TZIA 5GGSB 4WFEE 2K7QA 1HYRC 4X0KB 2VR5A 4X7EC 1QFWM 2EYRB 4NRYA 2XFXA 4HG4J 2WBWB 4GRWB 1OAKH 4XI5C 5FV2A 3BDBA 5L8KB 4RRPG 3HZKB 3IKKA 3KLSA 4MQXC 3RGVC 4CMHB 1FDLH 1KN2L 2J8UB 4RMTA 2P49B 1JFQH 3E6FB 3A67L 4E41B 2P8MB 1FNFA 4N0YH 4XH2A 2EO9A 2FEDD 4PRHD 4MA1B 4XVSH 2HFEB 2HFFB 1U8JA 2E27L 4PB9L 3AFLA 3IU4L 3O45B 3I9GL 3V6OE 2D0FA 3T2OA 5B8CC 5KW9H 1EHAA 4LLVB 1GGIL 1KTKE 2Y25A 3P9MA 4OCYH 1MCQA 3K8MA 4HLZH 3IAGC 4L8SA 5KG9B 1T04B 1C16B 3BAEH 1EJOH 1N59B 4H5SA 2MPAH 4F58L 1QLEH 1MCPL 1NGYA 4NQXB 4U6HB 5C0DB 3B3IA 1QSFB 5FK9B 4FFYH 3W11D 3AMKA 4Z7NF 2VLRE 4DAGL 4X4YB 1BQUA 4QGTA 3UYRH 3NIGF 3SDXB 4A2MA 2F53E 2WANA 5F9JA 1OTSC 2VIRA 3HR6A 3C2SA 15C8L 2J88H 5HHQB 3CVHB 2L4OA 2FX9L 4PRIB 5HHOD 1AR1C 1BFVL 3LN5B 2CDGB 5DQJA 1G6RL 3CX5K 4MXQD 3VXQA 2IALB 4ZUTB 3JVGA 4WUUA 1PVHA 3S36L 5FB8B 4H88H 4NC0B 4O2EB 3ZT7A 3CZFA 3MACH 4FQ2H 1IBGL 4DUXA 1BIIA 1BP3B 1LVEA 5J06A 1NLDL 2GI7A 4JY6A 4PGBB 5F7UA 4JFPB 2I60H 4XWGH 2LABA 2VQUA 1L9MA 2NY1C 3OBAA 3HZMA 1J1OL 1CICA 5CEYA 3EOAA 4G3YL 4PJEA 4R26H 3DETD 1Y6KR 5FGBC 2G5BB 1P4LA 3RHWK 1M05B 3KHQA 1R3JB 3W9DB 5ANMA 2R0KH 3RBSA 1CGSH 3MGOA 2OL3A 3WXVL 3TC9A 3TPUB 1HILB 1R3IL 3LKQB 4M7ZB 4X6CB 5F96L 1QQDB 4ZFGH 3MJ8A 4L8DB 3NFPA 4F7TA 5K9QI 2PYEA 1HHIB 3QEQA 3WN5A 5TQ0H 4NHUB 3ROOA 5EFIB 2Q86A 2A0LD 3BISA 3QIWA 3D39D 4Q97A 2B1AH 2H9GB 4X98B 2VLKD 3C09C 4FTVD 4Z78B 4MJID 3PGCA 4GKNB 1LEGA 2FWOB 3MRLB 1HHKB 4BFEA 1Z6JT 2Q8BH 3P9WB 3VFRA 4U4BA 3GMNA 3LH2H 2AK4E 1FDLL 5FCUH 2LVCA 4FQHA 2DQEL 3O6FA 4X80L 1GGBL 1GC1L 1C12A 3FL7A 3HRZB 1OLLA 4L9LB 1AH1A 1UVQA 1AGDB 3PV7A 3RY5A 1BM3H 4JFZL 1J1PL 5DJ6B 1QBAA 5JZ7D 3VXOB 3UTZA 3BKJH 5AAMA 5D72H 1J8HB 4UAOC 3SQOH 1G7LB 5DURD 4MNHA 1JZ4A 1VFMA 3V0VB 5HYFA 4IDLA 1I1RA 5GS0H 2X4RB 2WLYA 4XMLL 5HGHA 3QA3B 1KEGH 3ZHKA 5F3HA 4QCIB 1X5IA 4IHOA 1YDPB 4TTGA 1ZAGA 4NUJA 4CN6A 4XP1L 3KPRB 2A9NL 5F1OB 4S1DD 4XCCL 4I0PC 1OQXA 1UCTA 3DX9B 3GKWH 5KANI 2IADA 4PJDA 4GLRH 5TF1L 1S7TB 3EW3B 2AXHA 3P73A 4MA3B 4DKEL 4H26A 1MOEA 1HIML 4X4YA 2CGRH 2P4AB 4BQBA 3ES6B 4XNUH 4R8WH 2R29L 3WFEL 3B6SB 1A4KA 2C1PA 3F7RA 4RMRA 3ZTJH 3IFOA 3SGJC 3V5HB 4EUPA 2HA1A 2G2RA 1IGTB 1YEIL 4XXCC 5HVFB 3OKDB 1GYAA 5GISL 1NCAH 2E7BA 5D2LA 1U2CA 3MOBL 1NC2A 1B2WH 2C3HA 1SM3L 2P1YA 3L5WB 4MXWL 3PWPA 3GNML 5E6ID 5SV4A 2F58H 5IKCA 4JFHE 2X05A 4OB5L 4EOWH 2X1PA 2ZCHL 4X8XA 3BUYB 1I9IL 3CAFA 2H6PA 4Y4KD 2BHZA 3HE6A 3OXRA 1G9ML 3FO2A 5E1HB 1I7TA 4NN6C 1IAIM 4ODXA 2VL4A 4R26L 5IMMB 3HAEB 1S78C 4G6AD 5BOPA 3QQNA 1CZ8L 1TJIL 2XZAL 5GS1C 3T3ME 4JRYD 5DJ0A 2VUOA 1WQVT 4C56A 4JFYA 3VGHA 2VITA 5F9OH 4JPVH 1LDSA 1QR1B 4JHAL 4U6YB 4IMLA 4QT5B 4FQCL 3TIEB 4KDTA 4I5BB 3WS3A 2H32B 3ARBD 4P2RD 1Q1JL 4DN3H 3BKML 2IANA 2XKUA 5EOCL 4ZG1A 3I6KA 1Y6NR 5TFSH 2BXZA 3U30C 5F88B 3VWJC 3MRKB 3CU7A 3AM8A 4PYGA 2V17L 1SJVA 4L4VD 4EZMA 2DIJA 3R0MA 5FHAH 3LH2L 5HHXL 3S4SG 2CK2A 1KUMA 4N0UE 1CLOL 4IRJA 2F19H 3L95B 4HJ0D 4OF8A 4OM0L 5D5MB 5T5NF 3RL2A 1VGEL 4AL8L 1R3LB 5JMOC 4MDIA 5D7JC 3V6FB 4I3RL 4ORGA 5HYEA 5ENWB 1MVUB 2VLLA 3V9FA 2CLVB 3H0TA 5JOPD 1G1YA 3M8OL 1A3LL 1BQLH 1OARL 1CD8A 3W0WE 5TDNB 1KNOB 1GZPA 4PLKC 5L0QB 4XPBH 1PG7X 1YMHB 2DBLL 2GT9A 2C5DC 3WLWD 2CDEA 3SEPA 1OSZA 3SE4C 1QSEE 1NCCH 4XHJC 3H7BB 3L3GB 3HAEH 3PDOA 1P4BL 1T22A 1E4KA 1LHZA 4K55A 5DVOA 4KRPC 3S88L 1FPTH 1U3HC 3CVIL 5DT1L 5I8KL 3T2PA 4NZDA 1MCCA 4FQJL 3VFOA 5H94B 1Z9LA 1WFOA 2WAHA 3JTTB 3QEUB 2DQCH 2CXKA 2OJZH 4TSCL 3NFSH 4U1LB 3KPRD 3MYJB 4S1SH 1OB1A 2MTPA 4F57H 5D70L 5GGQL 3IDMB 4YHNB 1BFSA 5HHVH 2MFNA 3ARFD 3MCLL 5D8JL 1UJ3C 5EBWA 3U7YH 2VN4A 2VWEC 4NQUA 1IGTA 4LCCA 3MXVH 4DOHB 5FA3B 3H8NA 3DMMD 3PHQB 1IZJA 5GSRB 4NQEB 1DLFH 2EDJA 5IFJA 2IH1B 1CGUA 1S9XB 5GJSL 5J12B 1XF1A 3BE1H 2CDGA 5DQJB 4OJFL 1S8DA 2A9ML 3MGAA 4PJHF 1RZJH 3P30H 5C0BA 3PQYB 4XRCA 25C8H 4WHCA 1AGFA 3ZO0A 1MCIA 1CE1H 4EI5A 5IBLC 3MZGB 4WGWB 3FB7A 3GMPB 3QDHA 1T7ZA 3PWJB 4Y19B 3LN4B 3HAEA 4WI2A 1WLHA 3NZ8A 1S7QA 5ITBH 3TZVB 3IS0X 1E6OH 4MWFA 4OLXL 5CZKA 5FOBB 3CFBA 2ESVB 4KVNH 4CKVX 4XBGA 4YDJB 3QUXA 2FEDC 1IC7H 4QOKB 4PREB 3SKJH 2W38A 5KTEH 1D9KD 3CUPB 4JR9H 1NMAH 1DQJA 3EOBB 4OT1H 4JRXE 2NR6D 3QDAA 4RWYH 1JNHB 2VZVA 5IVXF 4M62L 2F15A 4NM8L 2QSQA 2Z92B 3MA7A 4KKBD 3W81A 5J0BA 4L8DA 2FGZA 1T1XA 1CK0H 1FZOA 4N0YL 2OLDA 3C09B 4I8DA 3EYQC 4F2MB 4LSTH 4ONFL 5C0AA 4JFEE 3F5WA 1RK0A 3QWOB 4PTTA 1M71B 1OW0C 2XG5A 2AAVA 1QSFD 3W11C 2YXFA 4G9DA 1OAKL 5C08D 3AXLB 3ROLA 1OOAA 3FQXA 2ATKA 3WKNA 2C4XA 2H1PH 3VXMA 4P4RA 5ENWA 4X9IA 1UT9A 3BO8A 5I1JH 1LDPH 5E70A 2IQ9H 3OV6A 3R1GL 3I3BA 5BJTA 1T1WB 1QFUH 4LARL 3MLYL 4MCZB 4TUOB 3QHFL 4DVRL 5HVWA 2I60L 2YPLE 4P3DB 5MEOB 2NY0C 3EYOA 4IOIB 4P5TB 2XTJD 1K85A 1H0DA 1IQWH 4UU9B 3TNMB 4ZO6A 1EK3A 1I1YA 4AMKL 4JHWH 3DO7B 1A6ZB 3P9LB 2V2XB 1J8HA 1GHFH 5J7CC 5T3ZH 3FFCE 2NR6C 3VFNB 3ARGD 2F53D 1QPXA 1YEJH 3HA0A 4ZQKA 3T0XA 5B3JE 1KTLA 2JJUA 5HGDA 4DGYL 3FB5B 4N0UA 3VD5A 3UMTA 2R9HC 2MKWA 3OJDB 3S97C 2YZ1A 1LP9F 5HYJD 3SDAB 4KXZI 4UT9H 1E0OB 3DBXA 4N90D 5EZIH 5FHBH 1G1CA 5H35A 5F7FA 1OB1B 3OAUH 3K81A 3IJSA 2Y23A 1FAIL 4N9OB 2AJ3A 1A6TB 3C60A 1I4FB 2X4NB 5FYJH 1CBVL 3B83A 4QOKE 1MI5A 4XNMB 5ACZB 5E00A 3MRMB 5EU5A 1INDL 1JE6A 1JV5B 1I3VA 3UTSE 3JWDH 2A0LC 2P8PA 4YFLF 3OKDA 5IHUH 1D6EA 3FCTA 3HNVL 1P5UA 3PQYA 4LPUA 1NCNA 4R7NB 3V5KB 4CN4A 3SDCB 4K3JL 5CBAA 2HVJA 2GJ6D 3BEVA 4WO4A 3TCLB 3CFDB 3LN4A 4GRMA 1BZ7A 1ZLUK 1N2RA 2EDXA 2AV7A 5JPNA 2AJUH 1SY6A 5FM5O 3WUWG 5HDLA 5IMKA 1XR9A 5JZ7C 3D3VE 1J0HA 1LO3L 1X7QB 4YPGA 4OZ4B 5B39A 5JXAH 1OP3K 4PREA 4XNYL 4C56B 5FF6A 3P0GB 1KPRB 3ULVD 1K3ZA 4DQOL 1QBLH 1EHLH 4JPWL 2E9JA 3RWIB 4WIQA 5D1ZA 3KNBB 5C0RH 5JW4R 1OAQL 2ZOLB 5K93A 4OFYD 4LFHD 4L29B 4NJ9H 5E56A 3S4SB 1NEZG 4C56E 2H32A 4S1QL 1OF2B 3FO0H 2LU4A 3WNOA 5GSVB 3PXJA 4PTTB 4I3GA 1BJ1H 4MXQC 2ZSWB 1JGEA 3TZVD 1RD6A 5DD0H 3ROLB 9CGTA 3MV8B 1MRCH 4HUNB 2N1KA 3FQXB 1F58H 1NCAL 5D1XA 3QNXA 4HV8A 3BPCB 4ZNEE 2EIEA 4P4RB 5L7XH 4IRSC 4L8BA 2CQVA 2NY2B 4NGHL 5T1DH 3GSUB 1I75A 3ZZ1A 2A2QT 2HWZH 3D87B 4GS7C 4I3SL 4EDWH 6FABH 4PJEE 1ZVYA 4MAYD 5D1QB 4PJ8B 1P84K 2VH5L 4PG9A 4TUOA 1IVLA 3HMWH 3IDGB 4N8PA 4GMTL 4XVJH 3CSGA 4Y1AD 3QEGH 4R97B 3HAEG 1NC4B 3EJZD 4D8PB 4R8WL 5F70A 1HHJA 1ED3A 3MRIA 3OZ9L 4XPGH 1BGXH 3T65B 4LLMA 1XGQA 2RGSA 3PWPD 3QIWC 4HCRH 5D6CB 5C09E 5F9WC 3C5SA 5ALCH 3VMOA 4JFDD 4G8FA 1IEBA 4U6XA 1YECH 35C8H 5CEZE 3QEQE 3LKOB 4LCUA 2HFTA 1NAMH 2NTFA 2APFA 5BO1L 2BOCB 1KN2H 1KLGA 5C0BE 1H3WM 1A6TA 3C60B 4NRZB 1WWCA 2LTQC 1C1EH 1QRNB 4NN7C 3EZ8A 2BP3A 2NXZD 3R0NA 4JQXA 3RVXC 1T7XA 2NPLX 4M7JH 2GJ6E 4CBPA 3PP4H 1IC4L 4EIZC 5FYKU 3GSQB 5INDB 5DJXA 2Q87A 4MA7H 2ZCLH 3PNWB 3VWJD 2CDFA 3PWLB 4MHHI 4NQEA 4JQXC 4G5ZH 4B0MM 3IDJA 3UTTB 1G7PB 4MAYC 1HDMB 3QFJD 4X5XA 3IDIB 3CFKA 3STZB 4NWUH 3VXPB 4PJ5B 2CO6B 1EUTA 3U2SA 1CE6B 1Q0YH 1F45A 1IAMA 4K2UL 5EA0L 4HCRA 4MAYA 1PG7H 4MNQD 1UWGH 2EIDA 1FO0L 5HI3C 5C0GA 4XXDB 5ILTL 4HUVB 4HPOL 1PG7W 3RWGB 3WIIL 1FZKA 3U82B 4ERSL 2GCYA 1R3HA 3V0AC 2FX7L 3MRRB 4BJLA 3VJ6A 4LVEA 2PTTB 5MP6H 1NGWA 5TF0A 4QNPF 4AEEA 1DBAH 1XIWA 3Q6GL 3KLAA 3MUHL 3QUKB 3GFUA 4Z7OF 1XGUB 3S37H 1JK8A 1A3LH 3IGAB 3T0ED 1MJUH 1JNHA 4M7LL 3RTQC 1Q0XH 2ZNWA 5FUOL 4NNPL 4AEIL 4UQ2A 4PP1D 3F7YB 3LKNA 4M7KH 3U48A 2Q76A 5HGGS 5SX5K 4YH6A 4Z0XA 3QO1B 3SPVA 4H8WL 4XP5L 5IT2L 4PJBF 5TDOB 2M26A 4K7FB 2YN3A 1T5XB 4P46C 3HPLB 1CFSA 4J8RB 2YPLA 4M1DH 3ARFC 2DTMH 4JPKH 3GK8L 1YPZF 3OR7A 3QUMH 1JF5A 5K9KA 3JVGC 5TGBB 2R23A 2P5EB 1ZLUH 3ULVF 4N0FA 4TSCH 4M8QA 2YWYA 1NCBL 2JB6B 2Z31D 2Z4QB 3O0RH 4HFUH 3FTGB 1SJEB 3GJFA 3OX8A 4S2SB 4DAGH 4JM4L 3TNNA 3BIKA 2OR9H 4HC1A 4O2FB 3OR6B 4IMKC 1P4BH 4XPBL 1TNNA 1G9MH 5DHVB 3RU8L 4XBPA 2HFGH 1RK1B 5BW7C 4XAKE 2ZKHL 5E2TH 2UZYB 4DZ8B 1DJSA 4MNQE 5LG1A 4PP1C 2VR4A 1MI5D 2J8HA 3HUJB 4KC3B 3VXNB 4JM2A 3MYZA 1SJHA 1DL7L 1HWHB 4PRIE 2HG5A 1BX2A 1YPZA 3LN9A 5I1AA 3NIFF 4TUJA 1F4YL 5DC0A 4U1MB 1FJ1A 5FIEA 5FYLE 3CCHB 4FFVC 4JQVC 5A40E 1EXUA 3BQUD 1I4FA 3CSYB 3VCLA 3LS5L 4H88L 1JFQL 2A1WL 1IGMH 4I77H 3UJTL 1KULA 3SDDB 5ICXB 5KVGL 1T3FB 3HE7C 5HHNB 3LEYL 1FVDA 1PSKL 4PRBA 4P48A 4WI6A 1CLOH 2VDKH 1O0VA 5C8JA 1KCUL 4OCSL 1G0YR 1N64L 1L7IL 1PY9A 1YJDL 5INCA 1FNSH 1WZ1L 3T0EB 4ZS7L 1A1OB 4NKOA 4IOFD 3ZT5A 1OM3H 2DWDA 5DS8A 4NPYB 5T3ZD 1X5FA 2MQ3A 3K2UL 4KKNA 5CP3A 5T3ZL 2ATPB 4HUVA 1F3JA 1J0ZA 1DANU 4L3AA 1EVUA 5EPMA 2YA1A 1NUFA 1M7IB 4NWTL 3Q5TA 3PL6D 4JR9L 4YQXH 3HB3C 4HDIA 3QQ3B 3N9GL 4Q9QL 5E8NB 3MUGA 1P5VA 1ERNA 4POZD 1QFWH 3GIVB 3AVEA 3NCJL 1KPRA 4HF5H 2VL5A 4J3VA 1QA9B 2ICWJ 4U1JB 4I9WE 2AXJA 2P8LB 1PY4A 3REWA 4CW1A 1LO5B 2ZOKA 1LO4L 2EXWD 1YUHA 3UTTD 4O51A 4OB5H 4AT6A 12E8H 3HNTH 3LQAL 2E9WA 1FRGL 2O5ZL 1HNGA 1A7NH 2DQFB 2AJSL 4M6NH 5E4EC 5ID0A 3G08A 4PJ9C 4MB3A 3BEWB 4PY7B 2VZTA 5KVFL 2OK0H 3C6LA 5MERB 3V6ZA 4U3HA 2PCPA 1FVEB 3FZUD 5ESQA 2NXZB 5ICZA 1AO7E 3OGOE 1OTSD 4PRPD 1DLFL 3CPLA 3PV6B 3F7VA 5CBEA 1P1ZB 3K46A 3K8KA 1N0LA 1RUQH 3ZKXC 4PJAB 2H8PA 4U0RC 4F3FA 2APVA 1Q1JH 2C7UA 5IB1A 2I5YH 1HQ4A 1PLGL 5CEYB 4M93B 1JGDA 1VPOL 5EZLA 1PDKA 1NFIB 5CJ8A 1CDUA 5F1NA 1TTFA 2F54A 1KYOJ 4S11A 1LO3H 5I71C 1F8TL 2DKSA 1LEKA 3BXNB 2DWEA 4D0DA 3WDIA 1OTUC 1SBBA 3D3VD 3UO1L 1DDHA 4DZ8A 3AY4A 4MJ5A 4EBQL 3E3QC 2F5AL 3NFPB 4YE4L 3FN0H 3HUJA 1ETZB 4KVNL 4JM2B 1D9KC 1MRDH 1RJZA 2FJFB 4Q2ZA 1EAJA 3FB6B 4KDTC 4BSVB 4S1QH 2A77H 2X1QA 5IQ9B 1AHWC 3AMLA 1EEYA 1FJ1B 4IBLT 5D1QD 2ZUQB 3WJJA 3GRWL 3NAAL 2J6EA 4LCYA 3AS0A 5TH2B 3B5GA 4M9OA 4L3CA 2WSKA 3BP4B 5IVOA 4TRPL 4L4VA 1PSKH 1MCRA 1N6UA 3O6LL 2EEDA 4JHZA 2Q1EA 2XXMB 3JV6B 5HDOA 3TBSA 4OZIF 2AEQH 3WNKA 3SCMC 2XQYG 3T77B 4PJIE 5KOMC 3V6OC 4DUWA 1V7ML 3RDTB 1WSST 1BMGA 1UB5A 3B9DA 5DD6B 2NY0D 5F44A 4J3WA 5ERWB 4FP8L 3ARPA 4DK6A 4PGCA 5IB5B 4QHKI 5GRJL 2GAZA 5TE6L 1NMBH 3KJ6H 3PGDA 1MVFA 1RZGB 2AW2A 2VTFA 1EHNA 3K3QA 4NKOB 2UZIL 4P2YA 1YEGL 3VGBA 5LAXA 2X4RA 1W0WA 3AS3A 3DURA 2BVQA 4DN4L 2DKUA 3PDDA 2A9NH 4RGNB 1XGRA 1T1YA 5BCAA 3JUYA 1JPTL 1VCAA 5HHME 3I84A 3V79C 2I26N 2ZNXA 2HVKA 4CAGA 4PYHA 3FQTB 1EHLL 2D4DA 3QDGE 4LKXB 3U4BL 1L7TH 2A38A 1ADQL 3VJ6B 4Z7QF 3EGSB 5E8OB 4MS8D 5JXAL 5L2JA 2EC8A 4OJFH 5BVPH 5F9DC 5DJYB 5IR1A 2ICWA 3B9KB 4GW5A 2NMSA 3EYFB 3QCUH 5DUML 3ULUF 3BI9X 1X6NA 5KZCB 4LEOA 4PRNB 2OTUA 3IKCB 3BKCH 1VSCA 4HJGA 4CJ1A 3A0OA 1X4ZA 4OLUH 4ZFOB 2AJVH 4ZAKC 3MLUL 4R96B 4P5MB 3TP4A 1G6RB 4M48L 3X3FH 3O6ML 1R5IB 3FT2A 4YGAB 2I24N 1A5FH 1JVKA 5DDHB 4PJFE 4ACPA 4ZYKB 3JWDL 3AUVA 1E4XL 4JFXA 4YXHL 1RFDH 2NY4D 4K9EC 2DLIA 4OT1L 5IB3A 3T1WA 4NNXB 1CDCA 4HH8A 1I7TB 1FVCA 4NOFA 4ZFZA 5F9OL 1PZUB 2OMNA 3SO5A 1KELL 4FNLH 1UWGL 4X9HA 4JZNA 4J7RA 3ZKMD 3WIIH 1XGYH 1LEKB 8FABA 3KYMB 5CGMA 4MZ2A 3CFJB 3ZTNH 3JWOL 1QVOA 4F8TA 2F53B 1CXLA 2IPUG 3RVVC 2ADFH 1RZ8A 3VFPA 2D7QA 5LKNA 3NGBB 3NOIA 3ARTA 3QG6B 4HIEA 4TULL 2V2TB 1T21B 1BFOB 2MHAA 1BVKA 2VC2H 3VFVB 2ADGB 4KROC 5K33A 3VDAA 3KWWA 1EEYB 4BUHA 2G60L 4E5XB 4YDLC 4Q6IA 4JGMA 3WCYA 3OHXB 4DVRH 4PRPB 4PRHE 5TJWK 3LEXA 4LAQH 4WNQA 3NCYS 3RL2B 2A9MH 4WI7A 3HS0A 2Z9TA 3RI5K 1NGQH 2CO7B 3CSYA 2DD8L 5MEQA 4JO4H 4KGLA 4N9GA 2YKLL 4I48A 4MQ7B 3WHE1 1ULVA 3Q5OA 3V2AR 1HHHB 5FUZH 4OD2B 4LEXH 2D7TL 4Z7WA 4PRDA 1U41A 3RJDA 1MELA 2RR3A 3BKYH 3EJZC 3QQ4B 3QHZH 2GT9B 4HX1B 4LASH 1QFPA 1OSZB 4M7LH 3L5XH 1K3IA 4LF3A 5I1DA 4LIQE 3UPRB 2LVEA 1IAII 1JPTH 4HKZA 4JM4H 3VI3E 4JY4B 5DO2C 1JZ8A 4GQPH 1HQRB 5KSUA 2QSCH 3DSFL 3W9EB 1ZGLM 1TVBB 2DS4A 4TTDD 5D7SL 4H25A 3QZWA 4Y5VB 5D2NC 3R06B 4M02A 5D6DC 1YEKL 3O4OB 4F9PA 1QHPA 2NY3D 1XZ0B 4NKMA 3WLWC 1XCQB 5ITBL 4CUCA 4Y2DA 5DJYA 1QNZL 3IETB 5F7DB 3MV7D 2LU3A 3BRFA 5H8DA 3DNKA 3TN0D 2EKJA 2VXVH 4UDUA 4CW1B 3QUZA 3LQAC 4EN3C 3VW3H 2X40A 4QRTB 4YDKL 1WZLA 5DRWB 1RZJL 3P30L 3VFWA 1AP2A 1HXMA 3OG6B 4GAFB 5SWSE 3OKLB 3QCVL 2FEEI 2FJHB 3KPSE 1C1EL 4PV9A 4FQ2L 3MACL 1H15A 4CNIA 1L0QA 3BDXA 1UZ6F 4R90H 2LFGA 1I9JL 1GIGL 5ICZB 3FRPA 4B50A 1W8OA 3S35L 4DQOH 1KXTB 5DVLA 1CGWA 3O0RL 4GXVH 4F7PB 5J11B 1Z3GH 5JHLH 5JPMB 4UT6H 1YEHL 3T2QA 1DP0A 1XEDA 3BVNB 1QO3B 1U9KA 1A6AB 4X6FB 4MWFB 2VZUA 4AH2B 3RWCB 8FABB 5I1CH 1TZHA 2X70A 3BT2H 4JO2H 1NFIA 3QWRA 5A3IC 1WBXB 4P0DA 3F58L 3KPLB 1I7UA 3RRQA 5E2JA 4GMSL 4JJ5A 2V5MA 4IS6B 3UDWC 2B2XH 1NDMA 1BFOA 4ZD3L 3TJEH 1OAUL 2YA0A 1PZ5A 3VFMB 1BAFL 3WE6B 3KWWB 1L7IH 2HWZL 6FABL 5M94B 4FXLA 1WIOA 2J5LB 1YN6B 5T5FL 3IXAA 4YHPB 1DUZA 3NZHL