5J1EB

Crystal structure of a hydroxypyridone carboxylic acid active-site rnase h inhibitor in complex with hiv reverse transcriptase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
428
structure length
405
Chain Sequence
b'GPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 DOMAIN
publication title Design, Synthesis, and Biological Evaluations of Hydroxypyridonecarboxylic Acids as Inhibitors of HIV Reverse Transcriptase Associated RNase H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 405
sequence length 428
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j1eB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eB03
2WOMB 5KT3A 3KNAA 5L1JA 1QAJA 2ZD1B 3HVAA 4F4XA 2VG6B 2ILYA 3DLKA 1HQEA 3FSIA 3H98A 1C0UB 3UR0A 3G6XA 3DOKA 1NHVA 4ECXA 3NBPA 3KK1B 4TY8B 4ECTA 3GYNA 1DTQB 1Z4UA 3LP0B 1S6PA 3PW0A 3NKYA 3BJYA 5EDWA 3DDKA 5KFGA 3H5YA 1N4LA 3PW4A 1DLOB 1S9GA 2WONB 3KLHA 3QGHA 2WB4A 1MU2B 4Q0BA 4ED3A 1N56A 1T03A 3MR2A 1JLGB 4NLDA 3C6UA 4YMEA 2YNIA 3RB0A 4I2QB 3ITHA 3KHLA 4ED7A 4RW8B 3MR5A 4U6PA 3KK2A 4KHMA 2IM0A 2YKMA 3FDSA 4YR3A 4R5PB 3LAKA 4NRUA 3GV8B 4MK8A 4K4YA 4JV0A 4MIAA 5DLFA 1TQLA 2W8LA 4O3SA 3CDUA 2FLNA 1LW2A 1GX5A 3PZPA 2OPSB 4IG3A 2BRKA 4NLXA 4QWAA 4K4WA 3KMSA 2VA2A 2V0NA 1T05B 2UUWA 4K4SA 1NNDA 3KLGB 4RUCA 4WXWA 4EBCA 1RA7A 5C42B 4RW6A 3Q8SB 1HNIB 4IH7A 4KO0B 4MH8A 4KV8B 4ZP6A 4QW8A 5L1KA 4RW7A 4LSNB 4RUAA 1IKXA 4ECUA 2C2RA 1S0OA 2J6UA 4ZVFA 2E9ZA 4K4UA 5D3GA 1HYSA 4O4GB 3DLGB 5KFAA 4DL6A 1WNEA 5KFWA 2I5JA 1JLCA 1JKHB 2VG7A 3DLKB 3LANA 1HQEB 4WE1A 5KFRA 3UPFA 3M8QA 2IJFA 3MEGB 5F8GA 1S1WA 3NAIA 3LALA 3DOKB 1S10A 3NBPB 1W25A 2RKIA 2UUTA 4Y2CA 1FK9A 2ILZA 5EWGA 4EBEA 1T3NA 3QZ7A 3H4BA 3BSCA 3Q8RB 1S6PB 3V6HA 2D7SA 4NLWA 1RA6A 3EZUA 3PHEA 4DEZA 1S4FA 3EPIA 2AX0A 1JX4A 1S9GB 3KLHB 1QAIA 1HQUA 4Q0BB 5KFUA 2IA6A 2R8KA 1T03B 3JYTA 4JV2A 5KT4A 2J6SA 3IGVA 3C6UB 4K4TA 2YNIB 3T5JA 3ITHB 4ECYA 5KFDA 4ID5A 4ZVHA 2C2EA 1LWFA 3HKWA 2XI2A 5F8HA 3DMJA 2ASJA 3RB4A 4PWDA 4ECRA 4KE5A 4URSA 1LW2B 5HP1B 4IG3B 3FFIA 4NYZA 2OPPA 3MEEA 4FBUA 2D3ZA 2UVUA 1HNVA 5KT5A 4GC6A 3PW5A 4G1QA 3KHGA 2V9WA 2V4RA 2W7PA 3OL7A 4IH5A 4RW6B 2XI3A 2GIQA 3FQKA 4FS1A 4RW7B 2JEGA 4TY8A 1IKXB 1RTIA 5JUMA 4O44A 3OHBA 3DRRA 3IG1A 4KFBA 2UVRA 1JLAA 5D3GB 2OH2A 5DG8A 1SV5A 1S9EA 5KFIA 4RNNA 2I5JB 1D0EA 2FJWA 2HNZA 1JLCB 1IM4A 2CJQA 1IKWA 3RAQA 2VG7B 1S9FA 1TVRA 2YNFA 2YNGA 3M8QB 5HLFA 3MF5A 1S1WB 1C1CA 3KOAA 1NHUA 3DOLA 2RKIB 2XWYA 1FK9B 1S1XA 1JLBA 3V4IA 1XR5A 2W9AA 3GIIA 5KG0A 3CWJA 1JLFA 2R2UA 4TYAA 2WTFA 4NRTA 5T14A 1HQUB 2ASDA 3JYTB 2HWIA 1S1UA 2VA3A 4RZRA 1VRUA 1RYRA 1TL1A 3M9NB 3I0SA 4ID5B 4Q8EA 1LWFB 4YP3A 2C28A 5FDLA 2C22A 1IKVA 4ZHRA 3IRXA 3CO9A 2W7OA 3DMJB 1TP7A 2AGPA 1RYSA 3I5AA 1SUQA 4XPEA 4PWDB 2HWHA 4NLSA 1RTDA 4DL3A 2FVRA 2JLEA 2OPPB 3MEEB 1K1QA 4IRDA 3CJ3A 4LQ3A 4TYBA 3DLGA 3CJ2A 1HNVB 3HVWA 1JKHA 4G1QB 5KFFA 5KG4A 4NLPA 4RW9A 3H40A 5KG7A 2D41A 1TV6A 3NAHA 4ZP9A 3MEGA 3FRZA 2IJNA 4EBDA 2ASLA 1RTIB 4O44B 4FBTA 3DRRB 5KFYA 3IG1B 4KFBB 1SH3A 1JLAB 4LQ9A 4F4YA 3QIDA 4ECQA 1R0AA 4IR1A 1SV5B 1S9EB 2B6AA 1RT2A 4EYIB 2HAIA 3SFGA 2HNZB 4H4OA 1IKWB 5KFBA 5L1IA 1RT3A 1TVRB 2YNFB 2YNGB 5HLFB 4QWEA 1C1CB 5F8MA 1VRTA 4PUOB 3SFUA 3DOLB 5KFPA 1S6QA 1S1XB 1JLBB 3V4IB 2WRMA 3SI8A 1JXLA 4ED6A 1JLFB 4I7FA 1ZTWA 3PJWA 4HYKA 1J5OA 1S0NA 4ZPBA 3NGDA 5L1LA 5HP1A 5J2QA 4NLYA 3DM2A 4MIBA 4NLVA 3EPGA 2BRLA 1S1UB 1VRUB 4ZPCA 4O3OA 1TL1B 2I1RA 3I0SB 3T5LA 1TL3A 4QPXA 5FDLB 1IKVB 4ZHRB 3IRXB 5KG6A 2GIRA 5KFNA 5F8JA 1SUQB 1QUVA 3GV5B 1RTDB 4TY9A 1RAJA 4ECSA 4IFYA 4ED2A 3E01A 3MTKA 5DGBA 5F8NA 3PR5B 3KJVA 2D3UA 4IFVA 3HVTA 4RW9B 4WZMA 3I5BA 1TV6B 4J9LA 4Y34A 1ZTTA 4ZVEA 2YNHA 1SH2A 4X2BA 5KFQA 3OL6A 5KFJA 5I42B 4F4WA 1YVFA 4XPCA 3KHRA 1R0AB 2WCXA 4WFZA 3BQ2A 2IMWP 2B6AB 3LP2A 1RT2B 4NLQA 2XGQA 3DLEA 5I3UA 3GILA 4H4OB 3OL8A 5EWEA 4RU9A 2JEIA 1C0TA 1RT3B 4IQXA 4G3IA 3DRSA 1VRTB 4K4VA 3HHKA 1QE1A 3OLBA 1HARA 3DRPA 3G6YA 2W9CA 1S6QB 4NLOA 2EC0A 3PR4A 2XC9A 4TQSA 3PVXA 4NZ0A 4I7FB 1TKTA 1HMVA 2R8HA 1J5OB 5K14A 2FVSA 3H5UA 4KHRA 3IS9A 5J2QB 2OPQA 3DM2B 4DL2A 3BSAA 4EO8A 3RAXA 1TKXA 2AQ4A 3KLVA 3TVKA 3PW7A 3G86A 5KFOA 3OSPA 1TL3B 2FJVA 3D28A 4RNFA 4J9RA 4M94A 4ZVGA 5KFEA 5KFKA 5KG2A 1MMLA 3TQ1A 4IFYB 2W9BA 4TQRA 3E01B 3BQ0A 3CDWA 3H2LA 4NCGA 5L9XA 3KJVB 2V4QA 4IFVB 1RT4A 3HVTB 5J2MA 1XR7A 3I5CA 5KFXA 4ZMMA 1C1BA 1KHWA 3RB6A 3CJ4A 4IRCA 2YNHB 3BGRA 4QWDA 4F4ZA 1EETA 4J9PA 4J9SA 2HNYA 2IAJA 4TLRA 4GC7A 2F8EX 1K1SA 3RBEA 4URQU 4JUZA 4IRKA 2RDIA 4MK7A 2BQ3A 3N6NA 4ED8A 5CYQA 3LP2B 2B5JA 3DLEB 5I3UB 1UWBA 5HBMA 1C0TB 3N6LA 2IC3A 3DRSB 2FVQA 2ZE2A 5J2NA 1C2PA 4ECVA 1CSJA 2ALZA 2JC0A 1QE1B 3DRPB 2W9CB 4H4MA 2IM2A 4QWCA 2FVPA 5C5JA 3FQLA 1HMVB 1TKTB 3OSNA 3CDEA 5K14B 3IS9B 4F50A 3QO9A 1KLMA 4KAIA 3KMQA 5KFZA 2OPQB 2FLPA 3I0RA 5DGAA 1TKXB 1S1VA 5EUHA 4NLGA 5KT6A 2R8GA 5EWFA 3Q8PB 2JEFA 4ECWA 4Q8FA 1ZETA 4DL5A 3C6TA 1T94A 1RT5A 1IKYA 5I42A 1BQNA 1LWEA 2RF2A 5CYMA 1U09A 5J2PA 4Y3CA 3UDLA 4IG0A 5DLGA 1RT7A 2W8KA 1LW0A 4NCGB 3VQSA 1LWCA 3M9OB 4J9NA 1JIHA 4QWBA 1RT4B 5J2MB 4ZPAA 3QYYA 1C1BB 5KFCA 3T19A 3BGRB 3LP1B 4PQUA 4O3RA 2R2TA 1EETB 1REVA 4M95A 2ATLA 4RW4A 4NLUA 2HNYB 2IAJB 3CJ5A 1JLEA 4B3OA 2E9TA 3ISND 2WK4A 4WZQA 5DG7A 2JEJA 1RTHA 1KHVA 3H5XA 4J9OA 5CYQB 2FJXA 4YQWA 2O5DA 3CIZA 3IN5A 2B5JB 1RT1A 4QW9A 5KFLA 1UWBB 5HBMB 2R8IA 3ISNC 4IDKA 1EP4A 1JLQA 3M8PA 3CJ0A 4EYHB 4JV1A 2IC3B 3QGGA 3MR6A 2BQUA 1N48A 3GQCA 2ZE2B 3QLHA 5J2NB 3H5SA 3M9MB 3GIJA 3KLIA 4TXSA 2IBKA 2BANA 3V6DA 2ZKUA 4MKBA 4H4MB 1OS5A 1S49A 2IM3A 2QV6A 4WFXA 4WYWA 1D1UA 3OLAA 4J9QA 3NMAA 3QIPB 2VG5A 3DYAA 4YR2A 5DG9A 3QO9B 1KLMB 5KT7A 3MEDA 3I0RB 1S1VB 3KLFA 4Q44A 3BSNA 4ZPDA 5F8IA 4ECZA 3JSMA 4Y2AA 2XGPA 1SH0A 2AGQA 2HNDA 4LSLA 3C6TB 4IR9A 1RT5B 1IKYB 3LAMA 1BQNB 1LWEB 2RF2B 5CYMB 4HKQA 5J2PB 3E51A 3GV7B 4IG0B 2B43A 1RT7B 2JC1A 1LW0B 4RNMA 3DI6A 3H4DA 1LWCB 4EO6A 2E9RX 1FKOA 2C2DA 4Q43A 3Q8QB 4PQUB 3CVKA 3QZ8A 4O3NA 1REVB 1TKZB 1I6JA 4RW4B 4TN2A 2FVCA 4IH6A 1JLEB 4B3OB 4R0EA 5HROA 3GIKA 3MR3A 5F8LA 3TAMA 2OPRA 2GC8A 5C24A 2IM1A 1RTHB 2AX1A 3D5MA 2AU0A 4ICLA 5C25A 4MK9A 5KFMA 1RT1B 3G6VA 4IDKB 3OHAA 1EP4B 1JLQB 3M8PB 1N5YA 1HPZA 1RTJA 4R8UA 5KG5A 3BR9A 2DPJA 2WHOA 4I2PA 1S48A 4ZP7A 5DQHA 3UQSA 3QLHB 3KLEA 2R2SA 4IKAA 3MFHA 3BSOA 3KLIB 4RNOA 4DL7A 1RDRA 3MECA 4URGA 2BR0A 2BANB 3V6DB 3QGIA 3T1AA 2BE2A 5KFTA 2UVVA 1FKPA 2VG5B 3DYAB 4DG1A 5DQIA 1N6QA 4NLRA 3KHHA 4DL4A 3MEDB 3BQ1A 1S1TA 3KK2B 5KFSA 2YKMB 2HMIA 1DTTA 3KLFB 2XCAA 5J1EA 2RDJA 1S97A 1BQMA 3KK3A 3V81A 3T5HA 1RT6A 5KG3A 2YKNA 3LP1A 4MFBA 3JSMB 4ED1A 4KKOA 4PUOA 4IOBA 1GX6A 2WOMA 4MKAA 4KSEB 4OL8A 4ZP8A 2HNDB 2ZD1A 4LSLB 5KT2A 4Q45A 4J9MA 4EEYA 2VG6A 3V6KA 5KFHA 4O4RA 1C0UA 3BREA 4O4GA 3DI6B 4KBIA 3KK1A 2XCPA 2UVWA 3NL0A 1DTQA 2QE5A 3PJXA 3LP0A 1FKOB 2CKWA 4WYLA 2R8JA 2R2RA 4WFYA 5JXSA 4FS2A 4H54A 1HYSB 2AGOA 1DLOA 4K4ZA 2DPIA 5HROB 2WONA 1MU2A 4WE1B 3TAMB 2OPRB 4O3QA 5C24B 3N6MA 1JLGA 3QIPA 3GIMA 5DQGA 4ICLB 4I2QA 5C25B 5KFVA 2J6TA 2AWZA 3V6JA 4RW8A 4K50A 5KG1A 1N5YB 1HPZB 1RTJB 4R8UB 3MFIA 4I2PB 4R5PA 3KLEB 3MECB 4U7CA 2OPSA 2BE2B 3PW2A 1FKPB 3ICLA 4DG1B 4O3PA 1N6QB 3T5KA 3OL9A 1T05A 2W9BB 3KLGA 1XR6A 4KB7A 4NLTA 5F9NA 5C42A 1S1TB 1HNIA 2HMIB 4KO0A 1DTTB 4KV8A 3H59A 5F9LA 4ED0A 3RBDA 4LSNA 4XO0A 2BQRA 1S0MA 5J1EB 3RB3A 4K4XA 1BQMB 4RNHA 3KK3B 3V81B 1RT6B 4WXOA 3FFIB 2YKNB 3IGNA 4MFBB 4YR0A 4J9KA 2FLLA 4KKOB 1TKZA
chains in the Genus database with same CATH superfamily
2ROGA 3HVAA 1NAQA 4M63A 1X7VA 3DLKA 1OPZA 2OFGX 1NHVA 3KK1B 5LJ3Y 3GYNA 3IR6B 5A2QU 5LMUF 3EDQB 3VVUA 3DDKA 4L3NA 4LFCF 2QLBB 4UT4A 5K20B 2WSCC 2XHWA 1OWXA 3VGSA 4IG3A 4ILMA 4AL7A 4CH1A 4B3RJ 2ZHBA 5IT9Y 2PIIA 4ZVFA 4ES1A 3P8BB 4DL6A 1FXDA 1I94J 2IJFA 1FWLA 1VQ9S 4USWA 2FJEB 1ZZNA 2YNIB 5IWAJ 2Q1LA 1F2HA 4KT0C 4DPWA 4CO3A 4XDCA 1FXRA 3OFEA 2OPPA 3W64A 4B9LA 4MKYA 4GKKJ 1QTMA 2CJYB 2H3EB 3FQKA 4KFBA 5T7LA 2UUCJ 5DG8A 4C98A 1U1PA 1NB7A 4LVOP 1XERA 4C0HA 3DU5A 4TYAA 4RUHA 1JXEA 4X65F 4JYAF 2XQCA 2R4FA 2MQPA 1TL1A 2LXFA 4LIRA 2C22A 3OTDA 2HPUA 3IRXA 1YJ7A 2I38A 3IM8A 1RTDA 1XMBA 4WFBQ 2V4JB 4TYBA 5LMNJ 5KFFA 5KG4A 3EMTA 2O67A 1YDLA 4ZN1A 2ACMA 1N33J 1FWKA 4P7VA 2EFOA 2R7OA 3SFGA 3SSQA 2V8PA 4DFKA 1UVNA 3RW7A 1N54B 3IO1A 3J81j 1WC4A 3NNCA 1S1UB 4GKJF 3NS5A 2RQKA 2XLIA 3R5AA 1P27B 2PMZD 4OZLA 1TV6B 1B70B 3HMJG 2CZ9A 4LBIA 5KFJA 2WCXA 2JJ4D 4OHWA 3BO4A 3MMAA 3BR8A 3F73A 2DRAA 1UP1A 1RHRB 2U2FA 2A0FB 1TKXA 3KLVA 3CCQS 4N76A 1TL7A 2A2CA 1K44A 2LVWA 4NWBA 2UXBJ 3OXLA 3T1YJ 4KH0B 1H2VZ 4IRCA 1IJEB 4J9SA 2DRDA 4B3RF 1R31A 2ZHOA 3N6LA 4N47A 3RBXA 1ZS6A 1C2PA 3DLJA 4AL5A 1QE1B 1DFDA 1I94F 2FLPA 2SXLA 2QYCA 4QBUA 2EG2A 1UL3A 3AB2B 2QA4G 5CYMA 2CRLA 1KOOA 3GFZA 2CG4A 3AFGA 4LF7J 2HNYB 4PABA 2AP6A 5LT5A 3AJ1A 3AJDA 4I0WA 2VHGA 1IVZA 2DKOB 2GJIA 4QW9A 1T7PA 4AFFA 2IVFB 3GQCA 3T3FA 3V6DA 2ZOGA 3OPKA 3ILJA 2AF6A 4YR2A 2ZH4A 2BKPA 2KXFA 2XMWA 4K2JA 1U7LA 3BO2A 2CQCA 3PKYA 2HNDA 1Q1KA 5DDOC 2I2YA 4P7TA 3W3SA 5HANA 3J7A1 2V50A 1JLEB 4C0BA 2F4VJ 2CQ4A 4KJIA 5LMNF 2CJAA 1RB0A 2GMJA 4JV2A 4HI1A 3QLHB 4RNOA 3U1MA 4ATNA 4URGA 3AY0A 2BE2A 3O2IA 3MD1A 2PMHA 3B4MA 2DNMA 2BJ7A 4RL1A 5KG3A 2DR7A 1Q5VA 1IBMF 1N8RT 4PCQA 2ZD1A 1MMNA 1KBRA 4RR5A 4DPYA 2UVWA 1PJ6A 2DIVA 5LSRA 3NGTA 2GVZB 1QAYA 3M8ZA 3R1HA 2OPRB 2W4DA 1RHJB 5KFVA 2QEXS 2D9PA 3QNWB 2WVCA 3S6EA 2XYGB 3BYPA 2HVEA 1SXLA 4ZDNA 1X4EA 2KZMA 1TR0A 5CAAA 4J9KA 3TP2A 1EIYB 3QT5A 3BKFA 1A7GE 4DS5A 4Q5VA 3BBFA 1EQMA 3UNGC 2QGFB 1CULA 2I6WA 1Q8IA 1GX5A 2XY6A 5AJ3J 1HL6A 2VFTA 4K4WA 2V0NA 2J9CA 4WXWA 2MXYA 3M8SA 1U6BA 1HNIB 2BM0A 2M4MA 2E9ZA 5CD4H 3AA9A 3Q2SC 5G0RA 4U96A 4BWJA 1R43A 3LALA 2RKIA 2ILZA 4DDFA 1U02A 3Q8RB 3V6HA 1PKUA 4NLWA 3ZFVA 3BYRA 3TA2A 1S72S 4Q0BB 3M30B 2Q66A 3UN2A 2M2BA 4C4WA 1FFWB 3EUNA 2HVIA 1YI2S 5GADU 2Y9HA 4KE5A 2D74B 2Y1LB 2HFVA 2D3ZA 1NJIT 2UVUA 2YWGA 3CJ8A 1I3OB 2G9OA 4IH5A 3ZZTA 1FWPA 3D68A 2MKYA 1KNZA 3Q8UA 4O44A 1SV5A 1S9EA 4OJ3A 2HNZA 3B82A 2JFKA 3MF5A 4JI7F 2W9AA 3EYZA 5D4OA 4FVCA 5T14A 4IUFA 2HBYB 2F4VF 5THWA 1VS3A 4P6QA 3M2UA 3NOCA 2CNLB 2IA0A 1KN6A 4USVA 1IBLJ 4A8FA 2CA9A 1IKWB 5KFBA 2YNFB 4M5HA 4LR8A 2HHXA 5L38A 5DZ6A 1YKWA 3M7VA 1S1XB 4OLPA 3H2UB 4NL5A 4UOHA 3EPGA 2BRLA 2CPJA 1KQSR 1T3OA 2F8MA 1TL3A 2AHOB 5KFNA 1Q78A 3HSDA 1N0VC 1RAJA 4M5GA 3N4WA 2FHJA 2QYGA 1NPPA 2LFVA 4WZMA 4J9LA 3HLUA 1ZTTA 4A8SA 2B8PA 3OTEA 3A12A 1UFLA 2IMWP 1R0AB 4YUDA 5I3UA 2F5GA 5SUHA 2QLXA 1UVLA 2O1PA 2HHWA 3DRPA 2C2ZB 1J5EJ 3W8PA 2N82B 4RBVA 3W9JA 4J9RA 3BB5A 2KL8A 4ZVGA 2Y1RI 3MZIA 3DDIA 2Z57B 3ULHA 2GVDB 3D66A 4I6YA 3WIUA 1UCNA 1Q7YT 2GHVC 2N4DA 3NOGA 1NPKA 2EBGA 2JVOA 3AOBA 3D3BJ 2BW2A 4ECVA 1CSJA 2JC0A 3FCWA 3KKFA 3OVBA 1TTHB 2NXNA 3FBCA 3G71S 2DJWA 4F3MA 3R3TA 4P71A 4ZITA 2GW8A 4Y2KA 2CVIA 4B9VA 1T94A 1QD1A 1LWEA 1U09A 4LR9A 4NI2B 4M5MA 1C1BB 3AAWB 1WJ9A 2IAJB 3W2VA 4B3OA 2JEJA 5HVGA 5D8HB 3UWTA 3TVYA 4AXJA 3OQ2A 4PR6A 4HACA 2FY8A 3F41A 4ITSA 2YY3A 2WBMA 4QIFA 5B0BA 2JX2A 1SL0A 2KTQA 3QO9B 3N79A 3E3XA 2WVFA 3FVYA 3PM9A 2KT2A 4ECZA 1Q5YA 4USKA 3LAMA 1OYEA 1HHTP 2B43A 1LW0B 4K0KJ 2WZ1A 1FKOA 4Q43A 2CQIA 3H25A 3RR7A 5HN0A 2XMUA 3TAMA 2KYZA 4DV4J 3BBCA 2WHOA 1VJWA 2FHKA 2M52A 1EB0A 5KFTA 1Q86T 4RLEA 2A2DA 2EC2A 2Z0GA 1HR0J 3R5JB 1N0UA 4ZP8A 3QFHA 1VI7A 3QT8A 3GJRB 4ZPTR 2VICA 1U47A 1HLWA 5HQMA 3PO4A 2AYMA 3G9CA 1HD0A 1XNQF 5A8WA 2CJXB 3R97A 3R5DA 2V6AA 1GNKA 1N5YB 2LEPA 4JI1J 2MGZA 3SV4A 4U8VA 1N6QB 2N7YA 1XR6A 5C42A 4KO0A 1DTTB 4OV6A 4MAKA 2A10A 1UA1A 5H9EK 1GK8A 4DV0J 3BDEA 2DH9A 5GAGI 3DC2A 5D0GA 4A46A 4QU7A 4CO4A 2XMKA 3PW0A 2PGCA 4OZ3A 2VONA 5KFGA 1JWWA 4ED3A 2WONB 1N56A 1GXLA 4RW8B 1NKBA 1FDDA 4CP5A 4DSJA 4HVZA 4OYWA 2VQEJ 2IDLA 1CJTB 4B9MA 2IBOA 2FIUA 3Q8SB 2AW0A 3W5XA 3DLGB 1M1HA 5KFAA 2I5JA 1RBOB 5L46A 1WG1A 3M8QA 1NKEA 5D4PA 2PC6A 4ZVRB 2HAFA 3EZUA 5KOXA 1XMOJ 1SQFA 2IA6A 3N28A 1T03B 2G0CA 4DUZJ 1HHSA 3K0JA 2C2EA 2XI2A 4WK1A 2RHQB 3NXZA 3HHLB 3MUVP 1FTCA 3OTCA 1IWAA 2DISA 4QYRA 4DR5F 2GIQA 4F36A 1FRMA 1JNRB 3Q8VA 4XAKA 3FC9A 3UNYA 2RIJA 2XG8A 1XR5A 3G82A 4WKYA 1SPBP 4RWXA 3B6BA 4HHHA 3GONA 4K0KF 2VA3A 2AEJA 1CS4A 3BGFA 2HGMA 2PE8A 4DLGA 2DY1A 1O8BA 1QDUB 1VOMA 3MM6B 3MEEB 3X1LB 1HNVB 3MM7B 3FRZA 4EBDA 1KVIA 4FBTA 5KFYA 1JLAB 3EVWA 4H4OA 2NLWA 4ZS6A 2CQ2A 4UQTA 3TJAA 2DRBA 4DV7J 3ET6B 2F9DA 5FDLB 2GIRA 2R7RA 2X7IA 2YKAA 1QUVA 4LR7A 3GV5B 4DR3J 4AUKA 5CA5A 4XDDA 3DCAA 1U0SA 5KFQA 1M5PC 1RWNB 4TLQA 2GX8A 2OLWA 4P2XA 5ETLA 2VC1A 2H9ZA 1CC8A 4M5DB 1DJ0A 4YDDB 1NMEB 4DV0F 1YGYA 1QVFR 1Z1ZA 3TQEA 4KYZA 3K5LA 3RAXA 3L7OA 3PW7A 4MTPA 5B0AA 3O3LA 4ZLPA 4ELUA 2VBZA 3E01B 3BQ0A 1RT4A 5HJYA 1EETA 2B7BB 1K1SA 4OHYA 5CYQA 3GFXA 4L72B 2E1MC 3G6ES 1PG5B 3ZTPA 2QLFB 1JJ4A 2GHWA 3NWGA 3OSNA 2AT1B 4L73A 4F67A 2E44A 4O0NA 4TNOA 3QGPA 4Y3CA 3UI3A 5DLGA 4Y2IA 1Q8LA 3G96A 3G2XA 2Z2YB 5J2MB 4NZ7A 4LFAJ 4JP8A 3RU0A 4QYZJ 3VAKA 5BXIA 4LMZA 2WK4A 2XMJA 1FVQA 1KHVA 2A18A 3CNQP 4X4VA 4EYHB 1E6YA 4OYXA 3D2WA 3AD7C 3SEOA 4LRCA 2VKZG 4ILRA 2IM3A 5ETMA 2RQCA 3DYAA 3GG0A 1X4HA 4KY3A 1WF2A 2BEFA 2DHAA 3Q23A 3POTB 4EO6A 3RAMA 2ZUAA 3FBBA 3OUYA 1OY8A 4USUA 1RAGB 2IY5B 2Z4PA 3MR3A 2IM1A 3QMQA 3EJMA 4MK9A 1RT1B 1HPZA 5KG5A 3J7ZT 2R7VA 3RUBL 1CVJA 4DQIA 1BXNA 4P2FA 4PXCA 3AQOA 1WC0A 4DV7F 2MQMA 3THTA 4C8KA 2GMLA 3V81A 3JSMB 4Q45A 3IWXA 2VG6A 4B3TF 3IFEA 4KBIA 3MR7A 3LP0A 2R2RA 4DR3F 2CFXA 2N4CA 5C25B 2VPXB 2AWZA 3V6JA 1URNA 3C15B 3R6GB 3CCUS 4OX9J 1R8CA 2Q3PA 3AXKA 1EQ0A 1NZ8A 1T05A 5F9NA 1S1TB 5KOWA 2JRSA 5J1EB 4GO7X 1UW4A 4RNHA 4UZCA 5E33A 4KKOB 3EVOA 2K1RB 3H98A 3BV8A 4TY8B 1GT8A 4N7TA 4CLFA 1EHWA 4NLDA 2BW7A 1TFWA 4NEYA 3TA1A 3M6UA 3MR5A 3D3CJ 2IM0A 2KJWA 3LAKA 5LL6d 2COLA 1PYSB 2W8LA 4DF8A 2M3DA 3EM1A 4F4AA 2MKKA 2P9GA 4OI2A 2UUWA 4KR0B 3I56S 1OJ4A 3EX7B 2VJUA 5CD4A 4LSNB 4ED4A 2J6UA 2L08A 3GCXP 1RADB 1EJ7L 2MLXA 3HHEA 3LANA 2M8HA 4J37A 3NBPB 3GMGA 4EBEA 5E0OA 4C8LA 3DGVA 2MQOA 3SCJE 1JJHA 3H0PA 2HHHJ 3IGVA 2RD5C 2AJQA 2WB1D 4LRAA 2ASJA 2KRBA 4B3MJ 1SQEA 2IRXA 2HK3A 5KT5A 4G1QA 1SVDA 2CPFA 4PYAA 1RE1B 1NZAA 2XNQA 1NKCA 4KHPF 5CQGA 2YNGA 1C1CA 1GMUA 2XWYA 1FK9B 4X4TA 3I96A 1Y5IB 2WTFA 3C16A 3AODA 4IQMA 2Y8WA 2RQ4A 5ETPA 1IKVA 5JVHQ 1SKSA 2FGOA 2VOPA 3KFWX 3DLGA 4IYQA 4RW9A 3SBMA 3CCJS 2JFDA 4F4KA 2ZM6F 3P5BP 3DRRB 4MYTA 1RT2A 1WORA 3O8WA 1YRUA 3SFUA 3V4IB 1QTNB 1XTZA 2GQCA 5E3QA 3MD3A 3ZNUA 4NA3A 2UXCF 5HMWA 1ZPVA 1R0BG 4PWUA 3MAAB 4LF4F 5KG6A 2C2OB 1IBKJ 4P2MA 1VQLS 1KKHA 4HL9A 1VCTA 3UD3P 4V19J 3IXQA 2DR5A 2EXUA 3HJFA 3HX9A 3QJLA 8ATCB 1D3WA 1OO0B 1KTQA 3US5A 2HGNA 3U1NA 1NJWA 4PQAA 4DN9A 4X4SA 3MM6A 4A4JA 2OPQA 3MM5A 2LEBA 3BSAA 5GAHU 1AZSA 3ADAC 2NXJA 4OI6A 5KFOA 3NP5A 3IMQJ 4GVBB 3CDWA 3WC2A 4BCAA 4NOHA 4NMXA 3KG0A 4C0OC 1OQ6A 2W2MP 4OYBA 4K2XA 5HSPA 5BR8J 2W9CB 1X9WA 1KDNA 2BBEA 1UEKA 3CDEA 3IS9B 2F40A 3SCIE 4JI3J 1IR0A 2WVBA 2BX6A 3UVJA 5EWFA 3L7PA 5K8OA 2ZH8A 4OJHA 3M6XA 2HHHF 4LFBF 3WQPA 2Z56B 2VDIA 3UDLA 1TAQA 5J2PA 4AD6A 4QWBA 2LU2A 4ZPAA 1T8EA 4B3MF 1REVA 3IP0A 4J9OA 2P6TA 5KFLA 5HBMB 3MR6A 5F3ZA 4F2SA 2GAHC 2IBKA 2QV6A 1UJ5A 1VRQC 3NMAA 4U9RA 1PC5A 1FF2A 5KT7A 3I0RB 1OY9A 5CABA 1S1VB 4DUYF 1FFGB 2MQQA 1V3SA 3W8GA 4LF6J 1TMMA 3T6BA 3H4DA 4JI8F 3HCXA 2K7KA 3MWBA 3G8QA 5HROA 3L7UA 5KFMA 3LTOA 3OHAA 4R8UA 4CDIA 4YEAA 3KLIB 1B7YB 1NSAA 3OD2A 4DL4A 2YKMB 2HFSA 1HBMB 3NS6A 2ZOFA 2YKNA 4C2MA 4MFBA 4PUOA 4CTAB 2C2MB 2LCWA 4ZCIA 3CEDA 5KFHA 1I51B 2MKIA 3D1QA 5IM0B 1UKUA 4FS2A 2I0XA 2YH0A 3OR1B 2UV8G 2DITA 2DPIA 4F0HA 3CJSA 3SZ2A 3OXFA 1ELOA 1URRA 1RWXB 2XM3A 3PYEA 1NU4A 3JQKA 4JI0F 3KLEB 3HO1A 2IHR1 4U67Q 3KLGA 2OSQA 2XSJA 5B09A 3RB3A 1RBLA 5A8RB 4LF9F 2EKNA 2FLLA 3W66A 4DF4A 4QIVA 4QR0A 2LQJA 2XZWA 3DOKA 2K3KA 2G1DA 2QO3A 3NKYA 1DLOB 2LP4A 1TK8A 3QGHA 3K5NA 3ITHA 3KHLA 3HFKA 1LWXA 3QFWA 1PC4A 2J0WA 2VASA 3N9UC 3UCGA 3NGKA 1VR6A 4DR1F 4KV8B 1IKXA 2N7CA 5D3GA 1RLDA 3MUMP 4JI3F 1S7HA 5KFRA 3MI7X 3ZZOA 4N8OA 5I3QA 1FDNA 1LXJA 3K17A 3NWRA 3A8JA 2OP5A 3OXGA 1X9MA 3PNIA 5KFUA 2DGUA 2R8KA 3VVTA 3ELHA 1XWLA 1LWFA 3HKWA 2XNRA 4CLTA 3DMJA 1FA0A 2XS7A 1WEYA 4XK8C 4NXNJ 3TUIC 5EN1A 3MM8A 1HW8A 3IR7B 1QVGR 4RW6B 4RW7B 3D67A 2CUYA 4TY8A 2C3PA 4FZVA 3DU6A 5GADI 4WK3A 1D0EA 1VQYA 1IM4A 1SCJB 2VG7B 1S9FA 2DB1A 3HHLD 4ID8A 4LF6F 2DXEA 3F56A 3HD1A 3CD5A 3IBFB 2HWIA 1VRUA 2HK2A 4ZIVA 4RU2A 1RYSA 1FRKA 4XPEA 1IJFB 1D8ZA 4ES2A 4DSKA 4NYPA 2J8AA 4X62J 2UU9J 5ETTA 1CJUB 3K59A 1PO6A 4LUBA 1RTIB 4F4YA 4IR1A 2DNKA 2OD6A 2PMWA 1OPIA 3PX4A 2V8VA 1JLBB 1F5CA 2IIHA 2AYGA 5EX3A 3K5PA 2LMIA 3CCLS 1FCAA 4ZJLA 1CLFA 3MUTP 1KEKA 2ZH7A 1ITPA 1H2TZ 3NG8A 4TY9A 3MMBA 3IA0A 2HRUA 4FF4A 4DFMA 1PBUA 4ANEA 2ZDPA 2V68A 1VC0A 2B6AB 1U6ZA 3DLEA 3R7NB 2RAQA 1MG7A 1RT3B 4DMZA 4PG5A 1ACMB 5CZXA 2GO8A 5IV3A 3M6WA 4MMOA 5JJBA 2B9EA 5M2UA 4ETZA 3BKUA 1ICEB 3GG1A 2PFFB 5KG2A 2Z8QA 4MIWA 3THPA 5L9XA 5KFXA 2HVHA 3I5CA 1CQNA 4YY3F 1L5UA 1BUXA 2ZJQQ 2C1EB 4P10A 4J9PA 3FRYA 4NASA 3LPYA 1X9SA 5DRKA 1UTAA 4AQYJ 2R7SA 3I6PA 3AOAA 1I1GA 4QWCA 2FVPA 4FDFA 3H20A 1B3TA 4EFAC 5EUHA 3H42A 1FDAA 4OZNA 1N32F 2VU5A 3C6TA 1FRHA 2YX4A 4PPZA 2RRAA 1RT5A 2EI5A 1YJRA 1SJFA 1X5PA 3WIVA 5KFCA 1DQ8A 4UQGA 4RW4A 3UDCA 1NK0A 1JJ2R 3RZAA 4ZOSA 1V3ZA 3CIZA 1YJVA 1NDLA 2R8IA 2YKQA 4OZJA 2IC3B 2BQUA 1MN9A 3TZXA 2XTJP 2ZKUA 4H4MB 3TWZA 3QIPB 2HFNA 3L4BC 3R5BA 2XMTA 1W2IA 2OELA 4OQJA 4DZ6A 1E6VA 4K59A 4C8MA 5LJ5Y 1H72C 2AGQA 1IKYB 1BQNB 1RLCL 2RF2B 3DI6A 3OFFA 1S6OA 4PQUB 2MLZA 3HP6A 4R25A 3GIKA 2PD1A 2Q43A 3HI9A 2YPYA 4ICLA 2NS1B 2EKYA 3UQSA 1RDRA 5MAOA 1FKPA 3K7RA 2F7VA 5DQIA 1PYOB 2JLGA 3MEDB 2HMIA 2WBRA 3CCTA 4LSLB 4J90A 3CF5Q 5D0HA 1C0UA 1VIOA 2XCPA 1DTQA 3G87A 4UOCA 2YXLA 4DFJA 1HHQA 2J0SD 1YBAA 4K4ZA 1RKIA 2RNEA 3J80Y 1FI4A 4PG7A 1HNZF 2LA4A 4I2QA 2FHJD 3PCOB 3TAPA 2W4PA 1KQFB 4EZ9A 1LK5A 1HWJA 2HW3A 4DG1B 2GA7A 2EFVA 4Y2MA 4C48A 1DQ9A 3W2WB 3G6XA 2G0IA 3QQCD 1NDKA 3PHTA 4OI4A 4WBFA 4DV6J 1MU2B 1EZZB 1ZOTA 1U1QA 2YKMA 4A8YA 2MSTA 5HJXA 2FD2A 5B7WA 3LQVA 4QQBA 1B7FA 5A6PA 4M5IA 3FCHA 1ZBTA 1S0OA 4FNIA 3KDNA 2VF3A 2G0JA 1FEHA 4O4GB 3OR1A 3GR1A 4L76A 3QZ7A 4A48A 3MOZA 4DEZA 5KTQA 2W25A 3JYTA 1X4DA 2V69A 4B9NA 1GXTA 1OY6A 2D1CA 3DGPB 3SV3A 2V4RA 1NO8A 2XYPB 3OL7A 1FJGF 2GQQA 2AJ2A 4A47A 1NK5A 3CJKA 3U02A 4KGKA 1S1WB 1TELA 3HSJA 3AXMA 4X4PA 4QYZK 1RAIB 1JLFA 1HNWJ 2B9YA 1HWKA 1HQUB 2ASDA 3M6VA 5IT9U 3MTJA 1D09B 4CNZA 2XO7A 1MNEA 4KQZA 2CDQA 1RU2A 1RISA 1XC9A 4IRDA 2FDNA 3G4SS 1D9FA 5KG7A 1OQ3A 4DU7A 5D4NA 3T6JA 1B4SA 1WD6A 2CZ4A 4WWSA 2E5JA 4WU3A 4O23A 1VRTA 2DNHA 3SSSA 1F2GA 1M90T 3I4PA 4XTTA 2HS4A 3SI8A 1PAEX 3LUYA 5DDRC 2F65A 4O3OA 3I0SB 2HQFA 1SUQB 3MTKA 4I56A 3I5BA 4Y34A 4DSLA 2YNHA 1YBTA 1WEXA 1CBKA 5I42B 3HT3A 3I31A 4NLQA 2XGQA 3OL8A 4X66J 4A8WA 2CQ0A 1S57A 1UJ4A 1UWAA 4TQSA 4JI6F 2L9NA 2K06A 4DQSA 4DL2A 3JTOA 1FRLA 2DR6A 3CCVS 3J81Y 4DV5F 1QSLA 2VQFJ 4NXMJ 4FF2A 4DV6F 1QM9A 4ZPVR 4EU0A 3ZXWA 4IFVB 1XR7A 4NE9C 4DV1J 5SZTA 1PJ7A 1VQPS 1SJ3P 4DZDA 4CNYA 2V8GA 4URQU 1M1KT 1SC6A 3LP2B 2B5JA 1M1GA 1UWBA 4P73A 1FFSB 2ZE2A 1Y10A 3M32B 1R6YA 1Q8KA 5C5JA 1JXVA 1HMVB 4DSEA 3KMQA 1RACB 2XYHB 1WWHA 2R8GA 2OHDA 1ZETA 9ATCB 1GEHA 4DR2F 3CJRA 2W9BB 2ZWPA 1KRPA 1RT7A 1LWCA 1CJKA 2DTJA 3FEZA 1A0OB 4QOTA 1GMVA 2DH8A 5AXKA 2UXDJ 1WC6A 4MKVA 5J2NB 3HHDA 4J9QA 3W60A 1KLMB 3BO3A 3KLFA 5CZVA 2W01A 4N77A 4JI4J 1P1LA 1SH0A 1NXIA 3GV8B 2UUAF 2JC1A 3DOMB 5DM6Q 4CM2A 1U4BA 2Q6BA 3NRBA 2AX1A 2PEBA 4IDKB 3OR2B 3MPYA 1JLQB 2BJEA 2R2SA 3BSOA 2DNOA 4F2RA 1F3FA 2ASYA 1SC4B 3GIRA 2BUNA 4NLRA 3M8YA 1WSRA 1S97A 4MYUA 4DR6J 1Y7PA 4ZVOB 4EEYA 1U8WA 1P9YA 3PTWA 5B0GA 3NY0A 2F63A 1FTRA 2HLTA 1D9DA 2ZDOA 2IVYA 4O3QA 4F7VA 4MJKA 5C24B 1JLGA 3QIPA 1RAHB 5DQGA 2QL9B 1U1LA 2FUG9 2HLUA 2CPYA 2FC8A 3I82A 4FP9A 3IAM9 4DL0C 2CADA 4M5LA 1BLUA 1NDCA 2J9EA 2NYHA 1S77D 2ZBQA 4QIGA 4ECTA 4D3HA 3EXYA 1S6PA 1VBXA 5ITHA 3ZTSA 3BN4A 3E2EA 3H5YA 2WB4A 3W61A 2RSQA 3C6UA 4NCAA 3W5YA 2XS5A 4ED5A 1NCLA 1V5VA 4O3SA 2YQ1A 3ENVA 2P9CA 5DDQC 2CQDA 1BQXA 4ZP6A 3LF0A 2C3YA 1FT8A 3GFYA 4M1KA 3MGJA 1M5HA 1SKRA 2AYBA 2QJ3A 3EPIA 3KLHB 3PDNA 2OIHA 1CG2A 5E3AA 5A0YA 3LWMA 3QAUA 4NA1A 4PWDA 3KG1A 2BJ3A 2W7PA 2QL7B 2QA4S 5JUMA 2OH2A 1FVSA 2GCFA 4F04B 1PIEA 3BPSP 1TVRA 5HLFA 2CIMA 3NEKA 4WP3A 3DOLA 5A76A 4JI2J 5KAKA 4HHJA 1DBDA 2VL1A 2PT0A 3CGIA 1ZAWA 5K9FA 3HK2A 1AW0A 1HBOB 2RE1A 2DNRA 4XIUA 2HIQA 2B8QA 3QIDA 2LDYA 2CWKA 1RWKB 2QT7A 1YZ7A 2NPIA 1SIWB 4V1Ak 3M1VA 1J5OA 1R7IA 2AIRB 1X4GA 4PPDA 4X4RA 3QATA 5F0UA 4OHXA 8AT1B 2VD3A 2YX1A 4LF5J 2VBXA 4I68A 2EFPA 2G2OA 2ADBA 4YFUA 4F4WA 2KDOA 2CAJA 4GO5X 1H2UX 2DYAA 1R8AA 1KC8T 4UF4A 2DNYA 1WI8A 1LFPA 5EGYA 4P2SA 2NREA 2EC0A 3MM9A 2B4OA 1N52B 4I7FB 3H2VE 3VAGA 2M0GB 4DLEA 3DM2B 3CDAA 2R7XA 2AQ4A 2CPZA 4F0KA 2UV8A 4I4BA 1QUPA 4RNFA 5A8KA 1DHMA 4F8RA 3HSGA 4A8KA 4UUXA 4NCGA 2Q79A 1M0SA 3BGRA 5GAHI 2JH3A 1U0HB 3FJ2A 2DNZA 2LECA 2BQ3A 2HFUA 2MPUA 4A8OA 4CT8A 2LLZA 3DRSB 2FVQA 1B0VA 1LK7A 2NXCA 3QT7A 2GQ2A 2L41A 3SQGA 3Q86A 2E66A 3QJPA 4DSFA 1DRZA 2M9KA 5I42A 2RUGA 4FF1A 2JWNA 4UZBA 2WW4A 4ELTA 4CLLA 3CJ5A 2E9TA 5DETA 3DKDA 2CQ1A 4RPFA 2FJXA 4FPRA 2KM8C 3VAHA 1W7WA 4B08A 1EP4A 3M8PA 1FD8A 1VQ8S 3M9MB 4TXSA 4TVAB 2HHSA 4GVLA 1TUWA 4DR4J 3RYLA 3B54A 5I3PA 3PYDA 4ZPDA 2AD9A 3VWSA 3RBZA 1YWXA 4TU9A 4UY85 2BACA 3HZGA 3PX0A 2ZJPQ 2QN6B 2B9XA 2ALZA 4YHHF 2X51A 4QZVB 3M2RA 3N5BA 1JQGA 4P75A 4IH6A 4R0EA 2DNNA 1RTHB 1PJ5A 3W5ZA 2WVEA 3FNNA 4X4OA 4WP9A 2O66A 2BANB 2ZFHA 3W7BA 5DZ7A 2CPDA 4C3LA 3AH6A 1RXOB 3EXCX 1BQMA 3WZ0A 1RT6A 2PO4A 4IOBA 1IM6A 3T1HJ 1FNXH 3TEHB 3IWLA 3BREA 3PJXA 1HYSB 3O6QA 5BYSA 2B4VA 4PAAA 5I4MA 3T41A 2ATCB 2GJ2A 4C3MA 4OI1A 4AT1B 1SIZA 4DV2F 2D3O1 3VGUA 4I2PB 1WG5A 4Q7AA 4WIQA 1MROB 3ENWA 3ICLA 1UEUA 3OL9A 4DJBA 4KB7A 4X64J 5F9LA 3RBDA 3H59A 2OFHX 2GGPB 2JHEA 5AXLA 2BOPA 2HQCA 2WOMB 3C46A 3TANA 1HQEA 3UR0A 1HBUB 2OSRA 3ENAA 3KWMA 1Z4UA 4N8NA 3SDEB 3PACA 3BJYA 3R1LA 1N4LA 3MCMA 1S9GA 1YRXA 1RWPB 4J9VA 2MJUA 1Q4RA 2H51B 1F5BA 1X4AA 4R5PB 4NRUA 4HT5A 2EWHA 4ZVTB 3HFZB 4ALZA 1NUEA 3WC0A 2C2RA 1HIYA 1WKKA 4CLKA 7FD1A 4CCHA 3W9IA 4KPYA 2F8HA 3KDOA 5F8GA 1T9TA 3OTBA 1BWEA 1XQIA 5GAEU 1RWWB 2AX0A 5H9FJ 1QAIA 2KO1A 2KG1A 4ID5A 2CJ9A 3VAJA 4V19X 5AXMA 4URSA 3O1LA 1LW2B 1TZ0A 4NYZA 3NGSA 2V9WA 3M2VA 2ZVIA 3DDNA 2XB2D 3IG1A 3SSRA 1D9AA 4RNNA 2ZBPA 1RTZA 1JLCB 2KFZA 3HSZA 2E7VA 2J8SA 4DPXA 1NK8A 4FXDA 3C14A 4ZCMA 2MZ1A 1WTBA 3M9NB 1HWUA 2C3OA 2CYYA 4NLSA 1QJHA 2DGQA 3BGLA 2FVRA 1K1QA 1KOHA 4L74A 1NJYA 3PYGA 4WU2A 1NK7A 3VTIA 2VBYA 4LQ9A 5IWAF 1WKLA 3D7SB 3MMCB 2DR8A 5E5NA 4CLZA 3QRRA 4P9SA 1XMQJ 4DV3J 3AJ2A 3EICA 1S6QA 4OLOA 2IPOB 4GKKF 4USTA 5GVQA 1ZTWA 4ZPBA 2HHVA 4RKUC 1U48A 5ETRA 2KFNA 2UUCF 3LH2S 3MAQA 1NRKA 4ZHRB 4ECSA 4IFYA 2RUSA 1Q81T 4NA2A 3KJVA 4B17A 3BEGB 1XEZA 3M8RA 3PRBA 2Z2ZA 4CLPA 1N88A 4UOGA 4X64F 1Y00A 1J2VA 2Q6CA 5CH7B 4C7QA 2ZKTA 1VQ6S 1T02A 3N0VA 4WJBA 2IVMA 2FZGB 1U6FA 5J2QB 1NK4A 1N33F 1M5SA 3UO0A 4C8YA 5HO4A 4EWTA 1U25A 4M94A 4ZKAA 2K2PA 4NEZA 4ZLLA 2LDIA 2V4QA 3D0IE 3HPOA 3HVTB 2ZBIA 2NSCA 1HBNB 1O0PA 1F9EB 3ZZ0A 1C0TB 2QA2A 2BZ2A 3SYZA 1GTHA 2H65B 1Z2LA 1SKWA 1VBYA 1TKTB 5K14B 2ZWOA 1YG0A 3ZO7A 3ZTRA 2MDAA 1AXQA 4IG0A 4CWBA 3CCWA 4C6AA 4J9NA 1RHKB 2AV5A 3SQOP 3T19A 4O3RA 3TARA 4NLUA 3GU0A 3ISND 4FXWA 2XLJA 1NSQA 3H5XA 2QSWA 4CI0B 3PEJA 1W2BR 4WCEQ 1PSDA 1L3VA 3JQJA 2UXBF 3CE8A 2ZOMA 3LWLA 3T1YF 5DG9A 3IM9A 2BYCA 1NJXA 2Y0BB 3QJJA 2BABA 1T9VA 1H74A 3P96A 1U45A 1DAXA 3A1YG 4D3GA 1H7WA 4I6WA 3QZ8A 1VQSA 1CEZA 2L9WA 2CNNB 5F8LA 5IT4A 4F02A 1G6BA 1RTJA 2HHUA 1NEEA 2BR0A 3R7SB 2DGTA 2VG5B 4LF7F 3BQ1A 2GAGC 5AXNA 3OV7A 2YTCA 2RT3A 3KK1A 3TW0A 2AGOA 3B78A 5E7OB 1M5VC 2Y3YA 1KFDA 4UUWA 2FHMA 3CD6S 4C97A 1X5SA 2G2ZA 5F0WA 4CH7A 3MECB 1ZM4A 3CUNA 3BPDA 4O3PA 2MKHA 2HZVA 3X3UA 2BOAA 3S1TA 3TJ9A 3KK3B 4NPOA 4PXDA 4E2FB 1UEVA 1LQ9A 4AL6A 2C42A 1AYEA 4WPAA 3GE9A 1HQ2A 2IRYA 1GQEA 2IMOA 5HAOA 4C8ZA 2E5LJ 2YNIA 3TO8A 2HIYA 2LEAA 2OEJA 1FESA 2ROEA 2OPSB 2OD4A 3DHWC 2XS2A 3NMRA 1Y11A 4K4SA 4OZ2A 2LXUA 4EBCA 4W4MA 1HYSA 1WNEA 4USJC 3DLKB 1U2RA 1S79A 3H4BA 1T3NA 3PHEA 3FMBA 1Q79A 4RO0A 5DO2A 1AUSL 5B0DA 2D3OR 2VB6A 3ZZUA 4X4NA 5CXTA 3RB4A 5HP1B 4IG3B 2V4JA 4FBUA 2MQ8A 4OJGA 1HBUA 3TUPA 2XI3A 4ZA1A 1K0VA 2KFYA 5KFIA 4NCBA 3RAQA 4OMFG 3G8SA 5AJ3F 2UUBJ 3UE2A 2R2UA 2VC0A 1S1UA 4RZRA 1JB0C 5CYJA 3L09A 3MOJB 2A3JA 1H73A 4DL3A 1S99A 2OPPB 4J9UE 3GZ7A 3TUZC 3J7YU 2CPXA 1TV6A 4A8QA 3FBFA 2DNPA 1LEOA 1UMJA 3SCLE 4KFBB 5T7LB 2X1GA 2E29A 3RGIA 1LFWA 1TK0A 4HH0A 2BDPA 3VR1A 3JSYA 4PYDA 3TVZA 3EGWB 3C2PA 3RRGA 2XZTB 1RHMB 4B3SJ 3PJWA 2RU3A 4HYKA 4NLYA 2DO4A 3ZZZA 1TL1B 1Z2ZA 3Q22A 3IRXB 1F60B 1RTDB 3EDRB 5F8NA 1L3TA 2HZCA 4KIAA 2M5YA 3FCVA 4MT1A 1FE0A 4X2BA 3OL6A 3CDBA 3PX6A 4OI0A 2LXIA 4CLYA 2JEIA 3A13A 4USMA 4G3IA 3EZOA 3PFEA 6FDRA 1QE1A 4P52A 2FVSA 4JV5J 4DR7J 2PA3A 1IBLF 1APSA 2ZNYA 1XN9A 3BGOP 1X8DA 3D28A 4IOAQ 1RWMB 1IQZA 4TQRA 4CZCA 4J5OA 2P6SA 3H90A 1NDPA 3VQTA 3R9LA 3ILIA 2HNYA 2GHPA 4W92B 4JUZA 2VPYB 3N6NA 3GLJA 3HULA 3MMAB 3RR8A 3I87A 4EI2A 3FQLA 4Q2LA 2FJDB 1TKXB 4NLGA 5F3TA 4Y00A 1QY7A 1TL7B 4R0JA 3AB4B 2JL9A 3VQSA 1J5EF 4OYPA 2VDHA 4OHVA 1WACA 1WEZA 1JLEA 4ILLA 1ZZFA 3QLHA 4HDGA 1GFWB 3TNVA 5M2PA 4ENOA 4I69A 5HQLA 3PFOA 1R6VA 2MLYA 5ETOA 2HYIB 1U1MA 2DGXA 4Y2AA 3OVSA 2B4PA 2QL5B 1TU0B 2OJ3A 1RAFB 5CYMB 3CXCR 2QMUB 3U27A 2GVZA 4CLWA 4W98A 5EX0A 1VHIA 2OPRA 5DS7A 3D5MA 5C2GA 3OFGA 3WBZA 2HHPA 2GO9A 3BR9A 5DQHA 2Z58B 3V6DB 2YPZA 5B0CA 4LFCJ 3TX0A 2I9SA 2W24A 4ED1A 2QRRA 2HNDB 3NNAA 3JTPA 3OTOJ 1H38A 2QFIA 1RAAB 2IRUA 2VH7A 3NL0A 4K7QA 4DS4A 1GMWD 4WFYA 2EEYA 2APOA 4C11B 1WDTA 1S7IA 2DHGA 3ZZRA 5L39A 2CJBA 1IXKA 4YB1P 2V2KA 4CO2A 2NR0A 1S4EA 1VBKA 2KVIA 2BE2B 3HD2A 3IAS9 1HNIA 2B51A 4ED0A 3EWGA 5IQQA 5ETQA 4DV4F 4JV5F 3FFIB 1VQKS 4DR7F 2ZD1B 3BH7B 2ILYA 5J1NA 1X0FA 2D69A 1HFEL 1AUDA 2EW9A 1KS2A 2J0QD 1HR0F 3PIPQ 4Q0BA 3M30A 2E7XA 2XBPA 2KT5A 3FSXA 5HVHA 2CNOB 4Y0FA 2VA2A 3RRHA 2EK6A 4K5RA 1NSKL 4RUAA 4HEA9 2KVQE 4JI1F 5GMEA 2GMHA 2YWEA 2QZ8A 3D1OA 3I9ZA 3NS7B 1WHYA 2B9WA 1SKUB 2MY8A 3A4TA 3GYGA 2QMWA 1NK9A 1RGVA 1F9HA 1CULB 3GFHA 2XULA 3D9BA 1ZM2A 1JNZB 3AA8A 4OI3A 3HXMA 1H98A 2W2OP 4Y65A 4GKJJ 4DI6A 5G0RB 2CJQA 1VDHA 1IKWA 2YNFA 2CQHA 4UTGA 2VQEF 2RKIB 1S1XA 1RBAA 4Y28C 3GIIA 5KG0A 3CWJA 2H48B 3R2CJ 1VQNS 1JMTA 1SI9A 3TRGA 4YP3A 1L3KA 3CO9A 4U95A 2E5GA 1WF1A 3I5AA 2HWHA 4ANDA 4G1PA 3LA0A 2JLEA 1N5VA 4DCJB 1Y9OA 5B0EA 2EVZA 4ZP9A 2J9DE 2DVIA 2CQGA 1XMOF 4O44B 3CO0P 4ECQA 4DUZF 1R0AA 1SV5B 1S9EB 2HAIA 3BS9A 2HNZB 2MZJA 5L9NA 1YIJS 5F8MA 2ZC4A 3PG9A 1JXLA 4ZK7M 4LIWA 3OTOF 3TYTA 5L1LA 5HP1A 2X1BA 4ZVUB 1YZ6A 5FIIA 3LO3A 3M2UB 4NMLA 3GB0A 2GVDA 3H8YA 1MWZA 3KTQA 3S01A 2VBWA 1N34J 2ZBCA 1S0VA 2FTRA 6AT1B 4NLOA 2DNQA 4FN5A 2C2KB 2RRNA 4OYMA 1B99A 3G86A 1TL3B 3NLCA 4BDPA 1I5OB 2I8EA 4NI2A 5ETNA 4ZMMA 1C1BA 3RB6A 2YKOA 3P4UB 5JMNA 4F25A 4CM0A 2IAJA 2P2CB 3DXSX 4B9UA 2MZRA 5I3UB 3PKMA 3PYFA 1S12A 3R2DJ 4CRJA 3DRPB 2PI5A 3M4XA 1H0HB 3QO9A 2O01C 2V8HA 3QWUA 4Q8FA 3WX4A 3RW6A 2ZBRA 1LW0A 1SBRA 2Y0SD 3MXHP 2VFVA 5LSLA 1BMQB 3ONQA 4ZPWR 3IN5A 1IBMJ 1WTFA 2MB0B 3GIJA 1MWQA 5H9FK 3ZTOA 2VIHA 1ZM9A 3NGRA 3P49B 1QLNA 1LWEB 3GV7B 1R8HA 2VFUA 3SCKE 4WTYA 5FD1A 5DM7Q 2RH3A 4ZCKA 4TN2A 3W2VB 5IT0A 5IC6B 4B3OB 3DRYA 2IYGA 2DPJA 1N5YA 3BBBA 4HACB 5ETSA 3A3NB 2UVVA 3FUYA 1N6QA 4LFAF 2M8DB 3BH6B 3EZ5A 5KFSA 2A6OA 1DTTA 2QA1A 1M5KC 1LKZA 2WVDA 1ZM3A 2O3DA 5KT2A 2FLOA 4U7UD 4O4RA 1FKOB 2R8JA 1T11A 4C8NA 4NYOA 2WONA 3TAMB 2H5EA 4RW8A 4KPCA 4LRDA 1P6TA 1N34F 3PW2A 1CJTA 2CDRB 3K57A 2FB0A 4ES3A 2BQRA 4K4XA 3IGNA 5KT3A 2LQ8A 4ECXA 2FYXA 3K5OA 2HSEB 4PXEA 5ETKA 3NCRA 1T03A 3TX8A 2KKHA 5A8WB 4YMEA 3RB0A 4RWWA 1KQKA 2LU1A 4U6PA 4USHA 4FPIA 3FDSA 2CZVC 3HHLA 4ZJQA 1HD1A 4MIAA 3AHPA 2MGZB 2M70A 4JI7J 4NLXA 4LF8J 1YITS 2E1CA 2DBBA 1PILA 1RA7A 5C42B 3DLLQ 3QRPA 4KO0B 2XSFA 4W90B 4CO5A 3THVA 4K4UA 3J80U 3SXLA 3GTYX 3SIPB 4OX9F 4C11A 3UPFA 4ZVPB 3MEGB 1TUVA 2JVRA 1EAYC 3IR5B 1W25A 1P8GA 1WC1A 1TK5A 5ADZA 2VOOA 1VQMS 3JAMY 3EGZA 2N3OA 4ZVHA 5LOQA 2E5HA 3A8EA 1HW9A 2OMLA 3FFIA 3MEEA 5GAEI 1HNVA 2W1BA 3KHGA 3GWCA 1YTYA 3MM7A 5IOLA 1XJWB 3GJSB 1JLAA 2I5JB 3M8QB 1HI0P 3I9V9 2CNKB 1XBWA 2DHSA 3CSKA 3HHLC 1WG4A 3VZIA 1RYRA 3ET6A 2ROPA 5FDLA 3QSIA 4DUTA 5ETVA 2PN6A 2BKOA 2V2VA 1NBEB 3VGTA 3UR3C 3H40A 1RHQB 3TR5A 3D6MB 3Q83A 4RBTA 1Q95G 3NAHA 3C8YA 3KJQB 2J5AA 3BDPA 3D6HB 3CMQA 1H7XA 2J9DA 1K73T 4M5DA 1CPZA 3G82B 4DCPB 2HEKA 3NGDA 4HTIA 2C3UA 1CS4B 4OX7A 3HM9A 3B8HA 3SMZA 4E8UA 2CVEA 1H3DA 2YQ0A 2B0GA 3E01A 4ZLJA 1YJNS 1KVJA 1R8PA 2D9OA 1LXNA 1FKAF 2V67A 3JTNA 1NK6A 2V8DA 2R7UA 3BQ2A 3TAQA 1H6KX 4H4OB 3C19A 1FO1A 2VJVA 3QAEA 3ILOA 3MPDA 1WELA 3NGUA 2AJ1A 4RX6A 1SJ1A 1BC6A 5KFEA 1MMLA 2VFSA 1QAXA 4DQQA 5J2MA 1PGZA 3CT9A 1MSWD 4LF8F 3CTRA 5IXUA 2MQLA 4ED8A 3T9ZA 2MTLA 3D54A 1ZAVA 3ENQA 1IBKF 2K3IA 4OJ1A 2IM2A 2QLJB 4OX8A 1AB8A 5LSOA 2JEFA 2LA6A 2KG0A 2Z2LA 1OSCA 3M05A 3POTA 2XMVA 5FLXY 1RT4B 1AROP 3ZC4A 3QYYA 3LP1B 1EETB 2ATLA 4I67A 2KH9A 3Q89A 5CYQB 1RT1A 3J81U 3PRDA 4F26A 7AT1B 2CQ3A 1UVJA 1S49A 1SB6A 2HS3A 3KNGA 2XMMA 3AOCA 1VJQA 4CLSA 1XNQJ 3JSMA 5IC4B 3MMJA 1TFYA 5BR8F 1WOOA 3W1YC 4DBQA 2EPIA 2EFGA 2GC8A 4FYVB 2DNGA 5C25A 3G6VA 5D15A 3AT1B 3C15A 1E6YB 3O5TB 2DIUA 4IKAA 4TKTA 4DL7A 2CPHA 5A2QY 3VAFA 3LGHA 4JOUA 3T1AA 3DYAB 2X1AA 5BYQA 2VFRA 1S1TA 5J1EA 2MKSA 1U1NA 2W2NP 4KKOA 1NH8A 2K1RA 1Y3KA 3J7AN 1O6XA 1NSPA 4LF2A 1N5SA 2CKWA 3HKZD 3OUYB 5JXSA 2H4WB 1KSPA 2GIFA 1KQGB 3FSYA 3I32A 3OW2R 1HPZB 5LM7E 1Y4ZB 1EKSA 4C3KA 4OZ1A 2AEMA 2XLKA 4LSNA 4BS2A 2PI4A 3FKBA 3V81B 3DLBA 1QSYA 2VG6B 3VALA 3C3LA 3JSRA 3NBPA 4DX5A 1D8YA 3LP0B 3GJQB 4DR5J 1PCAA 5EDWA 3QSYB 1UZDA 5K8NA 3TEGA 1BWVA 3N5FA 2NUUG 1K47A 3HT0A 5IQ6A 1HWIA 2CPIA 4CLUA 3CJTA 4Z2XA 3V2UC 1T05B 2HQIA 4N41A 3UN3A 5L1KA 3DN9A 4PG6A 4ECUA 3TZYA 3DRXA 5KFWA 1WHWA 1X4FA 2GNKA 2UUTA 1FK9A 4ZJOA 3QPIA 4DCOB 2OI2A 2HFOA 2KRRA 2WW8A 1JX4A 2V34A 2HVZA 4YN3B 1U2CA 1UW9A 2DGSA 2VKRA 3UN5A 3AQPA 5HMXA 3RJMB 5F8HA 4ECRA 1ROFA 5CCMA 4LSZB 3Q0AA 4GC6A 3BGUA 4QIEA 4X84A 3K5MA 1NPRA 1TL4A 3DRRA 2FZKB 2HQGA 2H54B 3KYLA 2Z30B 4A8MP 1G1XA 1MLAA 2YWHA 3HDSA 2LQBA 1SJ4P 1PBAA 3V4IA 1RKJA 5B08A 1VQOS 2NXEA 3MAAA 4Q8EA 3GSIA 2FC9A 2K8GA 3UFCX 3UW1A 1RI7A 3HVWA 2OKQA 4G1QB 4NLPA 3GP9A 3MEGA 2ASLA 1TKDA 1SH3A 1CQMA 1FRIA 5J1PA 4CO1A 5L1IA 5HMYA 2YNGB 1SQGA 1C1CB 3J7YI 2B4UA 5KFPA 4NXNF 4S0MA 1WC5A 1UVMA 2E7WA 3C16B 1VQ7S 3LW5C 3CC4S 3W62A 1IKVB 1IWGA 3LPEA 4GVBA 1P1TA 2EK1A 4RW9B 1Q0NA 1S5ZA 2BA9A 1YVFA 2HHTA 1RT2B 3ETOA 4RU9A 3DNCA 3R8YA 4IQXA 3UCZP 3OLBA 2W9CA 4I1TA 4X62F 2UU9F 4ZN3A 2R8HA 4KHRA 4KC5A 3IS9A 3TOQA 2E5IA 2CPEA 1FJ7A 2QC3A 2KXHA 1U26A 1F6TA 3MPVA 1VMBA 2LKZA 1GAOA 2HWTA 1T95A 2RVJA 1KHWA 3CJ4A 1TAUA 4TLRA 4GC7A 3VZHA 3ZNJ1 2RDIA 4AE5A 5HBMA 5C2CA 4FYDA 1KD1T 1RWOB 4N56A 2V63A 3MHYA 1XNRJ 2M7SA 2POKA 3PXGa 3OT9A 5KFZA 2OPQB 3MM5B 3I0RA 2XEXA 1S1VA 5E3CA 1AZSB 4PRFA 5KT6A 3MCNA 5A6WA 2L9DA 4DL5A 1U1KA 4FYYB 3TJ8A 4F3QA 2R2TA 2G13A 1Y5NB 2RJZA 3MPWA 1Y5LB 3H5SA 4EK2A 3KLIA 4B3TJ 4MKBA 1B0TA 2RS2A 2J7UA 2QG9B 1X60A 1HBMA 4Q44A 3BSNA 2MHEA 1NHKL 3JXOA 3UVJB 5F8IA 4CTAA 4AQYF 4RBUA 1IBCB 5J2PB 1L3UA 1WUUA 1UFKA 2YWKA 5GMDA 5IM0A 1REVB 1TKZB 4UY8T 3MCSA 1QSSA 4P72A 4WIIA 2B3TB 4ZVSB 3KLEA 1V6HA 2MZQA 3TA0A 1VLOA 3W63A 2MZSA 1UPMB 1CJVB 2ZNZA 3KG4A 2HQDA 1R8BA 5A8RA 3T5HA 3LP1A 4MKAA 4KGVB 1AT1B 4J9MA 3V6KA 3G8TA 4ANCA 4X4QA 1ZYQA 4WYLA 2KYXA 1HI1A 1DLOA 5HROB 1YSJA 4WE1B 1K8AT 4R8UB 4BWMA 4FXVA 4GMKA 2AKWB 4U7CA 4QJVA 4BC9A 1HA1A 4KV8A 2YKNB 4MFBB 1DURA 4PUOB 3FMWA 2HRYA 1REGX 3V4MA 1KP6A 1VHFA 4J7CA 2J76E 4OIXA 3HHNB 1RJJA 4OFZA 1M5OC 5RUBA 3TZZA 4ED7A 4KHPJ 4YR3A 1MW7A 3CDUA 2AJ4A 3PZPA 1U1OA 3ZTQA 4LREA 3KMSA 4U7UK 3KLGB 4RW6A 1HNXJ 4WFNQ 2NQPA 2XWXA 2XSJB 4RW7A 1XNRF 2DD8S 1VISA 2VG7A 4DSIA 3NAIA 3DOKB 2FZCB 2W2PP 4EMDA 4IOCQ 2VPWB 3IWNC 2ZM6J 4QR2A 2IFXA 3ITHB 5KFDA 4E98A 1WOSA 2ACYA 4B9SA 3N01A 3Q24A 4YB5A 2A6MA 3ZZYA 1ZA2B 2UXCJ 1CJUA 2DNLA 3JS9A 1IKXB 1RTIA 2R7WA 5D3GB 2ZH6A 2HS0A 4LF4J 2OEKA 2X3GA 2HBZB 1X5TA 1JLBA 4DQRA 4Q2MA 1DARA 5CCLA 1UVIA 4EGLA 1LWFB 3EVMA 3S7RA 3DMJB 4OZ5A 1G3OA 3MM8B 1WHVA 1SC3B 2D41A 3K89A 4OZ0A 1Y0HA 4LJMA 1Q16B 3BN7A 2B6AA 4EYIB 3P6YC 4FKXA 1IN0A 2CG8A 2JOQA 1RT3A 4QWEA 1PYTA 5D4LA 1DZ5A 2F1FA 4ED6A 1S59A 4ZLNA 3H7HB 1VRUB 4U8YA 2Y1JA 4QPTA 2FQQB 5D78A 2GJFA 3CULA 1K9MT 4UOFA 1KR4A 1GTEA 2QLWA 3ETMA 4H4KA 4IO1A 1HNWF 1T0TV 1HI8A 2AMCB 5HQ8A 2WSFC 1BE4A 2PFDA 4KTQA 1ZH5A 5F41A 1N5QA 3L95X 4LFBJ 4K4VA 3G6YA 3PVXA 3KUEA 4NZ0A 1HKAA 2HQ3A 5G4DA 4Z7YA 2OO4A 4DWIA 3UD5A 2AJFE 4G6VB 2ZZTA 3TQ1A 3MMBB 2PA8D 1TL5A 2E1AA 1BHNA 2W7AA 4HI2A 2EFNA 5AE1A 4G65A 2OMOA 4F4ZA 2V2QA 2Y8YA 3BKTA 2CXEA 4DUYJ 1X4CA 2FJBB 3DLEB 4C8OA 1HNXF 2IC3A 2DHHA 2BJ9A 1U24A 4DU8A 2FGCA 3WX8A 2ZZMA 4H4MA 2NPFA 4YDXA 4JI8J 4Z37A 2MMYA 4KAIA 1Q7LB 5DGAA 1RABB 3MURP 1B0PA 2NZCA 5K5MA 3R5CA 3CPWR 4H4KC 4X66F 1RCOB 1SJRA 1IKYA 1BQNA 2RF2A 1TMJA 1JIHA 4KGZB 2P8IA 4PQUA 1RQ0A 2KXNB 3CD0A 4YQWA 2O5DA 2VQFF 4NXMF 3T9NA 4K5SA 3CJ0A 4G1IA 5AE2A 1ZA1B 2ZC3A 3HJVA 3QRQA 4WYWA 1JJCB 2OTLS 4DV1F 1UETA 1MWYA 2UP1A 3PV8A 3MEDA 3CCMS 4J91A 4LSLA 3C6TB 4JI0J 1RT5B 4HKQA 3E51A 1VK3A 5DDPC 5E3PA 3CVKA 4KGXB 4RW4B 1F5AA 4DPTA 4ZCLA 4LF9J 1NH7A 4OX6A 3JB9k 3MFHA 1FNMA 1ZAXA 1VYAA 4DG1A 3KK2B 3W2WA 1RZMA 4LT6A 4LRBA 1UJ6A 2B7CB 3AD9C 3F0NA 2UXDF 1E6VB 2JZ5A 1OIAA 3BM7A 1FNOA 3DI6B 1FXLA 2QE5A 1R89A 3PO5A 4H54A 4DR1J 4QR1A 2ZJRQ 1MU2A 3CCRS 1VLYA 1W26A 2UZAA 3GIMA 4JI4F 4ICLB 1RWVB 2J6TA 2KT3A 3MFIA 2AEFA 3C66A 1Q82T 3K8WA 4PG8A 4NX9A 1FKPB 1RCXB 2AZ1A 4NLTA 1WSVA 3F44A 2HMIB 4ELVA 3Q2TC 2XMAA 2YVSA 4O4GA 1TKZA 3KNAA 5L1JA 4F4XA 1C0UB 1DTQB 3A8KA 4LRFA 2HHQA 3RTVA 1FD2A 1FX4A 4I2QB 1CJVA 2WSEC 4I6AA 4DR6F 2HBRB 3OVAA 1VQ4S 1VC6A 4K4YA 2V2ZA 4MK8A 4JV0A 2OUGA 3I55S 3DGPA 4TU7A 1V9OA 3OJSA 5K8PA 4QWAA 2BJ1A 4RUCA 3CMAS 1RAEB 4DN0A 5HL7Q 2KB2A 2XY7A 4ZIWA 3B4DA 1JKHB 5LXYA 4WE1A 4OHZA 1S1WA 1S10A 3S8SA 5EWGA 5HVFA 3JQMA 1S4FA 2MYFA 1HQUA 3AD8C 5KT4A 4K4TA 2OTJS 2Y1IA 1U2FA 4BBYA 1F1BB 2R7TA 3U1LA 1WI6A 2DK2A 3D1HA 3PW5A 3FK4A 1YRTA 1MN7A 1UPPA 5BJRA 1C4CA 2DCLA 1T9UA 3KOAA 3HVRA 3CD7A 4P74A 2DGOA 4QCLA 3JYTB 3L3CA 5E41A 3NCQA 3I0SA 2BMBA 3CJQA 2C28A 2ZH1A 2GS8A 1SUQA 1FHTA 1F3VA 1T9WA 4JI5J 3CJ2A 5AT1B 4LBPA 1NLKL 2J7WA 4AYBD 4RUBA 1Q8BA 3K8VA 3CJKB 1A6LA 4DPUA 3MCOA 2MEWA 1TUGB 1BD6A 2R3VA 3FZ2A 1YX2A 1FEEA 1VFJA 1JLFB 4YY3J 1UFWA 2MY7A 5HK4A 4BHQA 4PZVA 4QPXA 4HLBA 3KUGA 5BYRA 4ED2A 5U47A 2DY9A 3OFHA 3PR5B 5M2RA 4JI2F 4IFVA 2RMLA 3ILLA 1SH2A 2DGVA 4FYWB 4DXLA 4XPCA 3KHRA 4WFZA 3LP2A 1YJWS 1N32J 4DQPA 3FBEA 5LXRA 3CMES 3K58A 1VRTB 3M32A 3LGMA 2BJDA 2XC9A 3CC2S 1HMVA 4DX8H 3MAHA 4EO8A 1S6UA 2MZTA 5KFKA 1RU1A 2W9BA 2X3DA 4E0DA 3HF5A 1FE4A 2K7JA 1EARA 3FEXB 2YNHB 4QWDA 4QIWD 3D4JA 4DFPA 3RBEA 4MK7A 3VHQA 4FNHA 2NYIA 1IUJA 1KVKA 2VV5A 5J2NA 2DXDA 3VGVA 3TZWA 4BLGA 4NZ6A 1A9NB 3D0GE 4LF5F 1KLMA 1B64A 2CWXA 4WTOB 1CC7A 3A8IA 4HR2A 3DOMA 2MKCA 3EGNA 4ERDA 4WZQA 2B5JB 1UWBB 3ISNC 4IDKA 3OR2A 1JLQA 3R27A 3VF0B 2RDDA 2ZE2B 4EUVA 1OS5A 4WFXA 1D1UA 3CCES 1FERA 5L8RC 4USIA 2U1AA 1HNZJ 2ERRA 4CIOA 1X31C 4K8RA 1KONA 3M8WA 1RT7B 1LWCB 3J7Z5 1CJKB 3KJFB 4JI5F 4I64A 1U49A 5D77A 5FJ4A 1OSDA 2KZZA 2DHXA 5C24A 4M5KA 4IRKA 2FPHX 2DT9A 1J27A 2MSSA 2YWWA 1VQ5S 3KHHA 2CJKA 2HURA 2ZZNA 3KLFB 5HATA 4CO0A 5K8MA 1GX6A 2DGWA 2LQ5A 1WHXA 4DR4F 3EGVA 3OBIA 3FGVA 5C7PA 4K50A 5KG1A 4OV1A 1L3SA 1AA1B 1WC3A 2RB7A 5D0RA 2NSBA 3W65A 1HWLA 2XZDB 4CH0S 1YLXA 3D0HE 3GYXB 4OYZA 3FSIA 2NUHA 4A8XA 2ZH2A 1VC5A 2YBVA 2H4YB 3PW4A 1BY9A 3KLHA 1VBZA 1ULRA 1JLGB 2HBQB 1FJGJ 5E3RA 3GCWP 3KK2A 4KHMA 5H1SV 2F3JA 4KH1B 5DLFA 3T1HF 2G4BA 2ABYA 3FZBA 1N36J 1AFIA 1XIQA 3UD4P 5DJBA 4YB6A 3WHIA 4MH8A 1UAWA 5GMKa 5T41A 4F3OA 4WP8A 3NCPA 2VZ9A 1KLNA 2HRTA 2LYVA 4Y2CA 1SC1B 1S6PB 2R9LA 3GJTB 3C6UB 4GRSA 3MEKA 3EE3A 2IDEA 2BJ8A 1PAUB 1NM2A 4IO9Q 2HKEA 4WFAQ 2PDAA 4FKYA 1HBOA 5HMZA 1ZPWX 1U1RA 4FS1A 3OHBA 2DR9A 2OEMA 4CYUB 2M88A 3BF4A 1VK8A 2EG1A 2BE7D 1C4AA 1KFSA 1NHUA 2ZEJA 2G2YA 1S76D 3PRVA 1SJQA 3E8OA 3IBWA 2RU9A 4FVMA 2HVDA 5A0YB 1RK8A 4LBHA 2PEHA 1TP7A 1O51A 2OGUA 4PWDB 2QIFA 2CQBA 3CJ3A 2BXJA 1JKHA 1G2EA 4JI6J 3VAMA 2IYIA 4DV5J 2BE9B 1RAOA 1LV5A 1R3NA 1TVRB 5HLFB 3DOLB 4B9TA 4TU8A 1UVKA 2WRMA 4I7FA 5B0FA 1IR2A 3DM2A 4MIBA 4LF1A 4ZPCA 3I4HX 2KJVA 2BV3A 3T5LA 2X1FA 4JB8B 5F8JA 3VCDA 2H1YA 1V3RA 5DGBA 1Q53A 2ZH5A 2YX7A 4ZVEA 1U0HA 1R0CB 2GZOA 1SL1A 2R7QA 2C2DA 5EWEA 4DR2J 2JSXA 3DHXA 3DRSA 1V5IB 3ZZPA 2IJRA 4QU6A 3HHKA 1HARA 4M5JA 2JNJA 3LOUA 3M1VB 1J5OB 3H5UA 5HI7A 3QBCA 3DLHA 3TVKA 6FD1A 2FJVA 1P9QC 5EHHA 1XMQF 3DXBA 4DV3F 2R42A 2J0XA 2DCUB 1UA0A 5JVGQ 2F8EX 1N36F 2DEJA 2KHCA 3U7JA 3KUHA 1FJCA 4HTJA 1FRJA 4N5SA 1GH8A 2DXFA 3CW2C 1U8SA 4PG4A 2UUAJ 3MM9B 3CB4A 2KM8B 2ADCA 2OAUA 2FHOB 3Q8PB 2BM1A 4ECWA 2QTWA 5A8KB 1EKRA 2W8KA 4NCGB 3M9OB 2NCKL 3L9ZA 5E2QA 3BGRB 5IZHA 2JDJA 1GXUA 3NNHA 5DG7A 1RTHA 3P5TL 3CC7S 4JV1A 2ZUGA 2DO0A 3QGGA 1GMWA 5IFMA 2BANA 3P45B 3SQGB 3PJ9A 2XY5A 2F4FA 4PKDB 2XGPA 4RNMA 1FDBA 2J7KA 3GPAA 3Q8QB 4O0IA 1I6JA 2FVCA 5CHCB 8RUCA 2ZHAA 1EP4B 3M8PB 4C9DA 4I2PA 1VIXA 2E1PA 1MROA 4PXBA 9RUBA 2ALYB 3A3OB 2NZ4A 2RS8A 4JBCA 2RDJA 2GGPA 4M5NA 1RWUA 2WOMA 3CIMA 4KSEB 2YKPA 4UW2A 2FJAB 3SDEA 1RP5A 3M2RB 1UZHA 2VODA 1FJEB 1WOPA 3R7BB 3N6MA 1KWMA 2ZH9A 4R5PA 2MKJA 3R5GA 4L3KA 4CQ1A 1RUSA 2AJ0A 5GAGU 4ETXA 3T5KA 1O5JA 4CT9A 2EFQA 4XO0A 2KHDA 1BQMB 1RT6B 1QAJA 3QWPA 3ISZA 3TI0A 2F9JA 3UDEA 5D0EA 3KJNB 1OYDA 4BC7A 1OMSA 1X4BA 4PEOA 3MR2A 5AE3A 1BGXT 2XHCA 1TQLA 2KU7A 2FLNA 1LW2A 4L75A 2BRKA 1T9YA 2WAQD 1NNDA 1SL2A 2PSZA 2G1HA 4IH7A 4QW8A 4RJVA 3VAIA 4HH1A 1DQAA 4DOZA 4DX6A 1NB2A 1JLCA 1EX8A 1HQEB 2DH7A 2VUGA 4HHUA 3BSCA 4PWWA 1NJZA 2D7SA 2FY1A 4HDHA 1RA6A 2RRBA 1T9XA 1S9GB 3WDOA 2J6SA 1JK9B 3UDVA 3T5JA 4ECYA 4OYOA 1N5TA 1X5OA 2GV1A 3IRWP 4ER8A 1VGYA 4OYIA 1FRXA 2QFJA 2ZH3A 4EZ6A 1YJTA 2QSFA 1X0PA 4ZVQB 3LGNA 2JEGA 3IBCB 1G7CB 2E5LF 2UVRA 2VPZB 2HFZA 2FJWA 2DEIA 3MMCA 2MHNA 2KI2A 2L48A 2V9KA 1F0XA 4NRTA 1WDDA 3K2YA 2B56A 3RRKA 5IV4A 4ID5B 4ZHRA 3QT6A 2W7OA 2AGPA 5D6GA 4FYXB 4LQ3A 3PIOQ 2E1RA 3M2VB 1K0TA 2IJNA 4YS2A 2LQ9A 3IG1B 4FF3A 3JAMU 2GFFA 1R27B 3JSBA 2XO6A 3PY8A 2P5VA 3HFVA 5IS2A 1YQHA 5J2QA 3C14B 4NLVA 1YJUA 1YK9A 3W9HA 2I1RA 3V5RA 1IQTA 1DY3A 5H9EJ 3IC1A 2MJNA 4CYUA 4YOEA 1LOUA 4DX7A 2UUBF 1AFJA 2D3UA 3HVTA 4M8LA 1FX2A 2HGLA 1HBNA 3GILA 4WKRA 1C0TA 1YHQS 2EBEA 1S6QB 3PR4A 1KTVA 4DPOA 1TKTA 3DFEA 3CCZA 1YBUA 5K14A 2P9EA 3OSPA 2YH1A 5LMUJ 3VV2B 4IFYB 3H2LA 2AZ3A 3KJVB 2QMXA 4B3SF 2A1BA 4HT7A 4X4UA 2ZITA 3GSDA 4YHHJ 3P3DA 4F50A 2C3MA 3BZQA 4LVNP 2YQ3A 3MDFA 2BVZA 3OJUA 3GR0A 2NXUA 1Y3JA 3UCUP 1IR1A 4M95A 2HG4A 3R6LB 2CQPA 1N48A 3KXDA 2RILA 3OLAA 2C2NA 2VG5A 3Q8YA 1RHUB 2H5JB 2V94A 2RHSB 3RG6A 4AXIA 2H5IB 4DV2J 2W4CA 3MPUB 4IR9A 2HZAA 1S0NA 4IG0B 4X65J 4JYAJ 2E9RX 4O3NA 2L3MA 2AU0A 4KRWA 3A3PB 4B02A 1LNQA 4YB7A 2BKNA 4ZP7A 1S48A 2YWFA 3D6TB 3MECA 4WF9Q 3QGIA 5MLCV 5FLXU 2AYEA 2V5HG 4OYAA 3CCSS 2QX0A 2XCAA 3PEHA 2N3LA 2W2QP 3KK3A 4Y6IA 1F9FA 4OL8A 3HZEA 4KGMA 1MMDA 1XK8A 3TUJC 1YJ9S 3O44A 4F0MA 1RTJB 2Z2MA 1G4CA 4Z7CA 1WF0A 2MQNA 3D6FB 2OPSA 4L6V3 2KN4A 2JLFA 2ZVSA 4DHVA 7FDRA 2RQMA 1S0MA 3FEYB 1RSCA 4WXOA 1WKJA 4YR0A
chains in the Genus database with same CATH topology
2ROGA 1UEVA 3HVAA 1NAQA 3FMWA 4M63A 1LQ9A 1X7VA 4QIVA 4QR0A 3DLKA 2LQJA 2HRYA 1OPZA 2XZWA 4AL6A 2OFGX 3DOKA 2K3KA 1NHVA 3KK1B 2G1DA 5LJ3Y 3GYNA 3IR6B 3V4MA 2C42A 2QO3A 5LMUF 3GE9A 3NKYA 1VHFA 2IRYA 1GQEA 2IMOA 3DDKA 2J76E 4L3NA 1DLOB 4OIXA 4LFCF 1TK8A 3QGHA 3HHNB 4C8ZA 1RJJA 4OFZA 1M5OC 3K5NA 2YNIA 3ITHA 3KHLA 3HFKA 4ED7A 3TO8A 2WSCC 2XHWA 1OWXA 4YR3A 1MW7A 1PC4A 2LEAA 2J0WA 1FESA 2ROEA 2VASA 3CDUA 2AJ4A 3PZPA 2OPSB 4IG3A 2OD4A 3DHWC 3N9UC 4ILMA 4AL7A 1U1OA 3UCGA 2XS2A 3NMRA 3NGKA 3KMSA 4CH1A 4U7UK 4K4SA 3KLGB 2LXUA 2ZHBA 4EBCA 5IT9Y 4DR1F 4RW6A 4WFNQ 4KV8B 2XWXA 2XSJB 2NQPA 4RW7A 1XNRF 1IKXA 2DD8S 2PIIA 4ZVFA 2N7CA 5D3GA 4ES1A 1HYSA 4DL6A 1FXDA 3MUMP 1WNEA 4JI3F 1S7HA 4USJC 2VG7A 3DLKB 5KFRA 3MI7X 3ZZOA 2IJFA 4DSIA 4N8OA 3NAIA 1U2RA 3DOKB 5I3QA 1VQ9S 1FDNA 1LXJA 1S79A 3H4BA 1T3NA 2FJEB 2OP5A 3OXGA 3PHEA 1ZZNA 1X9MA 3PNIA 3FMBA 5KFUA 1Q79A 2DGUA 2R8KA 4IOCQ 2VPWB 5DO2A 3IWNC 4QR2A 5B0DA 2YNIB 2IFXA 2D3OR 3ITHB 2VB6A 5KFDA 1XWLA 3ZZUA 1LWFA 3HKWA 4E98A 2XNRA 4X4NA 2Q1LA 2ACYA 4B9SA 3DMJA 1FA0A 2XS7A 3N01A 4KT0C 1WEYA 4CO3A 5CXTA 4XK8C 3RB4A 5HP1B 4IG3B 4XDCA 1FXRA 3OFEA 2OPPA 2V4JA 3TUIC 3Q24A 4FBUA 5EN1A 4YB5A 3MM8A 1HW8A 3ZZYA 4B9LA 4MKYA 1QTMA 3IR7B 1QVGR 4OJGA 1HBUA 4RW6B 2XI3A 2DNLA 3FQKA 4ZA1A 4RW7B 4TY8A 1IKXB 1RTIA 2C3PA 2R7WA 1K0VA 4KFBA 4FZVA 5D3GB 5T7LA 2ZH6A 5DG8A 3DU6A 5GADI 2KFYA 2HS0A 4C98A 5KFIA 1U1PA 4WK3A 1NB7A 1D0EA 1VQYA 1IM4A 4LVOP 4NCBA 3RAQA 1XERA 2X3GA 2VG7B 1S9FA 4OMFG 3G8SA 2DB1A 3HHLD 1X5TA 5AJ3F 1JLBA 4ID8A 3UE2A 4C0HA 4DQRA 4LF6F 3F56A 3CD5A 2R2UA 3DU5A 4TYAA 4RUHA 2VC0A 4Q2MA 1JXEA 4X65F 1DARA 2HWIA 1S1UA 5CCLA 1UVIA 4RZRA 4JYAF 1VRUA 1JB0C 2R4FA 2MQPA 1TL1A 5CYJA 2LXFA 4LIRA 4EGLA 4RU2A 3L09A 1LWFB 3MOJB 3S7RA 2C22A 3OTDA 2HPUA 3IRXA 1RYSA 3DMJB 2A3JA 1FRKA 2I38A 4XPEA 1RTDA 4OZ5A 1IJFB 1D8ZA