5J1PA

Lassa virus l protein cap-snatching endonuclease. bound to two manganese ions
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
169
Chain Sequence
b'GMEEDIACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILTLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKTVNISLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
source organism Lassa mammarenavirus
molecule tags Transferase
total genus 61
structure length 169
sequence length 171
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1pA02
5J1PA 5J1NA 4MIWA 3JSBA 5IZHA 4I1TA
chains in the Genus database with same CATH superfamily
4WK3A 3QIPB 1P9YA 1S99A 1TL7A 5AXLA 2VA2A 1NHUA 2A1BA 3D9BA 2DITA 2MQPA 3ICLA 2NYHA 3QJJA 2GVZB 3ZTSA 2JX2A 3OL8A 2OELA 1TKZB 4OYBA 1IM4A 3C14B 1RCXB 4NLTA 4R0JA 1TQLA 3NNHA 3GPAA 2P9GA 1DHMA 3MMCA 4ZCMA 2APOA 4WBFA 2VQFJ 1X5PA 2CNOB 4HYKA 1BQXA 3Q8UA 4DPXA 4LF9F 1NDKA 3B54A 3LGNA 1KDNA 4DL3A 2XSJA 5L9XA 4BLGA 1TKXB 3IR6B 4P7VA 4EZ9A 5M2UA 2QZ8A 4URQU 1NSKL 1J2VA 4J9UE 2Z0GA 4NXNJ 4ECUA 3IRWP 5IT4A 1NKEA 2XC9A 1CULB 4MT1A 2AX1A 2X51A 1RHQB 1SQGA 4QYZK 3A8JA 1U1MA 2NSBA 3N5BA 2FJEB 3F56A 1F2GA 4HKQA 4IYQA 4DFMA 2CZ9A 1O5JA 1U6BA 2UVUA 2PT0A 3UD3P 3J7Z5 2AWZA 1RWXB 5A0YB 1TKTB 4O3NA 3LWLA 1RHMB 4A8OA 1UZDA 1MN7A 4X66F 3RRHA 3HI9A 2E1MC 1Z1ZA 5ETLA 3KYLA 2PO4A 4N41A 3UD4P 2C2DA 2GVDA 2JDJA 4M5LA 3UCZP 4LF1A 3KLFB 2NXEA 1JLBA 3M7VA 3MM6A 1HWLA 2BE2A 3RR8A 1HNWJ 1RTDB 3BGFA 1VQPS 3R2CJ 1R27B 1N54B 3DOMA 4P72A 3T6JA 1C0TB 1PILA 1T11A 1T02A 1WACA 5I3UA 1LEOA 4I2PA 1EX8A 2YKNB 3IG1A 3AH6A 4N8OA 5CYQB 1WEYA 3H5SA 5F9LA 1X5TA 3TO8A 4CLLA 4YOEA 4I2QB 1VQOS 3UVJA 4F3QA 4JBCA 4NLGA 1S6QB 2V4JB 4CYUB 3AODA 3EGWB 5L46A 3W65A 3R5JB 2O66A 2WSEC 3T1YJ 5ETPA 1UJ5A 2VZ9A 1D09B 4LR9A 1U0SA 3CD0A 4NLYA 3V4IB 2HFZA 3BF4A 1QY7A 3MM8A 3HJVA 1FERA 3EUNA 3EGZA 4RX6A 2RH3A 4A48A 4OIXA 1YVFA 2B8QA 1N33J 2CJAA 3NWRA 5KT3A 3E51A 5LOQA 1RU2A 3TWZA 2ATCB 4C9DA 3AD8C 3U27A 1BQNA 2VV5A 1G6BA 2WAQD 5BJRA 1N36J 3TW0A 2YWEA 2V67A 5LXYA 2PN6A 3FSYA 2VHGA 3B82A 4OI4A 2VC0A 4LIWA 1HNZF 3SDEA 5HJYA 3GYGA 1UZHA 5KFKA 5HMYA 1NHVA 3R7BB 1DARA 3FFIA 1LOUA 3HO1A 3M2RA 3OTEA 1JJHA 2DBBA 2HHQA 1UJ6A 4AD6A 2QA2A 2UUCF 5HLFB 4AL5A 4FS1A 1VQYA 2GW8A 5D0RA 3BYRA 4C8LA 4N47A 2VFRA 3BZQA 2NXJA 3TA1A 2KJWA 1WC1A 2KDOA 2ZBPA 1KSPA 4M63A 2B5JB 5D4PA 2E5GA 2XS5A 1RBLA 3JSRA 2WVFA 2R2RA 3OD2A 1YX2A 2CQ2A 4CP5A 4JV5F 1AT1B 4HACA 1D1UA 4IH5A 2MHNA 4F0HA 3PV8A 3IM9A 4N76A 3FQLA 1N5YA 4A46A 2R7UA 4OHWA 4LRAA 4XPCA 1Q82T 3TX8A 1SVDA 2BOAA 4X66J 1TMJA 2NLWA 3AAWB 3CJ3A 2VFVA 3ADAC 1Y11A 3KNGA 3X1LB 1N4LA 3CEDA 3LP1B 5DG7A 2CKWA 2WBRA 2NUHA 4MK9A 3NS7B 3HFVA 2KH9A 3PFEA 4I7FA 1IJFB 4KRWA 2KFNA 2FB0A 3HSJA 1FX2A 1WKKA 2NREA 5A8WA 5J1EA 3QNWB 3CCVS 5L1KA 5GADI 1N88A 3FZBA 3D6FB 4MK8A 1N56A 1X4CA 3MFIA 1CQNA 4LFBJ 1U49A 1XNQJ 3I32A 5H9EJ 5M2PA 4TYAA 4ED2A 2QIFA 1ZTWA 4DPUA 3OL9A 3F41A 3BSNA 1LXJA 4O0NA 4XAKA 1RU1A 2HRYA 3H42A 2VONA 2DNHA 1T9YA 2DNOA 4NCGB 2UVVA 2KZZA 3WZ0A 4K4YA 2AV5A 2RDJA 1PKUA 4PKDB 3VTIA 2L9DA 4DBQA 3ONQA 4M94A 4DUTA 1VHIA 1ULRA 3ITHB 3G8TA 1CJUA 3AJDA 4X4QA 4ECRA 3M9NB 2R7TA 5ETMA 2ZHOA 2N4CA 1J5EF 1EQMA 1VK8A 2IRXA 2YKMA 4FN5A 4F0KA 3V6HA 1WHYA 1RTZA 2H54B 3GV5B 2GJ2A 4P74A 4ECZA 2GQ2A 3IGVA 1RISA 1CC8A 1VRUA 4ED6A 1RT5A 4DFJA 1UAWA 1MWQA 5KFLA 3H7HB 1RHRB 2Y9HA 4ZVEA 2YBVA 1U24A 1HD0A 2GHPA 3JQKA 2LA4A 1K8AT 3D7SB 3DOKB 3KUEA 4RNFA 3DRSB 4NRUA 3CJ5A 3AOCA 1BY9A 4DR1F 1UMJA 1IKWB 2XMKA 2UXBJ 5C2CA 2J7WA 2ZE2A 4O4GB 1H6KX 1JLFA 4DS5A 2VICA 3GONA 2DR8A 1SJ4P 2X1AA 3D5MA 4WP9A 3UO0A 2HNYB 3TAQA 2RQ4A 3SV4A 2V2KA 1LQ9A 4M95A 1F3VA 2UUCJ 1EQ0A 3FMBA 1TELA 2XZTB 5HP1A 2F5GA 2HYIB 3I31A 3RRGA 2WVBA 2FDNA 1RT2A 2XMJA 2XYPB 3BBFA 1W26A 1YZ6A 5AE3A 4DL6A 1WF1A 1FWKA 2XSFA 4DR6F 3Q23A 2EXUA 2BZ2A 2ZC3A 2IJFA 3PCOB 2K1RB 5B09A 5IT9Y 1YJVA 2ZFHA 2VOOA 3L3CA 4X64F 1NKCA 4YY3F 2K3KA 1QAIA 3V6JA 1KEKA 2QFJA 4ZVQB 3BPSP 1YITS 4RBUA 4X4TA 1VIXA 2EK1A 4WE1A 4ED5A 5B0CA 1FTRA 1LW0A 2RHSB 3OV7A 3N01A 3W5ZA 4NRTA 4WJBA 2HBRB 4WZMA 1AA1B 1RT7B 1Y5NB 3OL7A 4Y65A 1SIZA 1B3TA 2LDYA 3P5TL 2AKWB 3DMJB 2HZCA 5FJ4A 1TVRA 5KTQA 4FPRA 3FJ2A 1PAEX 2VU5A 3HDSA 5FDLB 4USHA 1VQ9S 5I42B 4ZJOA 2E5LF 3FC9A 2MQNA 2G2YA 3VAIA 2A2CA 4MH8A 2GHVC 3MUMP 4NYPA 1S72S 1HBUB 1N52B 5H9EK 2K2PA 2OLWA 4LFCJ 1PC5A 2EEYA 2HLUA 3KTQA 3C46A 4ZVSB 4QU6A 5F8GA 3JSYA 1OSDA 1OSCA 2QSFA 4DUYF 2MLXA 4O23A 2J7UA 4MYTA 4ER8A 1Q78A 3DU5A 1GX5A 2NQPA 1Y7PA 5HATA 4W4MA 4YDXA 1S6PA 2HHHJ 1JWWA 2YKOA 3SCJE 2JLEA 4CWBA 1XQIA 1J5EJ 4LF8J 2FHKA 2FVPA 5DRKA 2CJYB 2OUGA 4I69A 2MB0B 3G82A 4XTTA 4DX5A 1SCJB 1M1KT 3D4JA 4KGVB 4KKOB 2FIUA 2YQ3A 2MKJA 1XMBA 2CQIA 2V69A 3QRRA 2R2SA 2IHR1 1JLGA 3FK4A 3JQMA 2DHHA 2HQDA 1KN6A 1WELA 4B9UA 3ENWA 4DQQA 4IQXA 3PKMA 3PJXA 4P9SA 4NOHA 2CNNB 1U02A 3D3CJ 3DGPA 2WOMB 2VG5A 1TUVA 3D28A 3K57A 2ZBRA 2VBZA 3QYYA 2RKIB 1KR4A 2A18A 4ETZA 3UDEA 1IKVB 3K58A 4DR1J 2XEXA 2ZWPA 5LSOA 1FRJA 3H90A 3E3XA 3MPUB 3GIMA 3B4MA 2RRBA 2EBGA 4AXJA 5KFWA 3BDPA 1LWEB 1VR6A 2HMIA 2Q6BA 1N5QA 2Z2YB 4LQ3A 3PJ9A 2DNNA 4JI3J 4ED8A 4KHRA 2I6WA 1HQUA 3BGUA 1VFJA 1C1CB 4B3RF 1QSSA 2CQ4A 2PFDA 2XYGB 1F1BB 4TN2A 3VVTA 3OR1A 1HARA 1NDLA 3UCGA 1CEZA 3B6BA 1BXNA 5F8IA 3ZNJ1 4NA2A 2UP1A 2J8AA 1WF0A 2QX0A 4QR2A 2F4VJ 1TV6B 4DL5A 2VUGA 2AIRB 3AA9A 3OVSA 2XULA 3MEEA 1L3VA 5LT5A 4C8KA 2GS8A 2KJVA 1NZ8A 3MCNA 4DF4A 4LRFA 1M0SA 4DFKA 3C6UB 2QC3A 4ZA1A 3J80U 2W7OA 5F0WA 3WHIA 5HANA 4M5DB 1EJ7L 1WI6A 1JLQB 1DTQB 3OBIA 1IKXB 1U09A 4KY3A 1UP1A 1KOOA 1UVNA 3KUHA 3R5GA 4Q0BA 2V94A 2OFHX 4NASA 4KHMA 2QA1A 3HKZD 2KHCA 1UFKA 4EZ6A 3IM8A 2CPHA 4PYDA 2IM0A 5H1SV 2BM0A 3CJKB 2XTJP 2YNIA 4ZP7A 3IBFB 1CJTB 4MK7A 2IVMA 2C2RA 2X3DA 1S59A 3J81j 1YTYA 3QLHB 3CCLS 2E5LJ 1JLEB 2CIMA 3KK2B 2HEKA 3MAAB 1RKJA 5HK4A 5L9NA 2AD9A 5E3RA 3GLJA 1ZTTA 5FIIA 1RTIB 1JB0C 5H9FJ 1LW2B 1RTHB 3VAFA 5ITHA 1IQTA 2W2NP 1DTTA 3C16B 2NR0A 1FKPA 2WW4A 3BN4A 3MMBB 2MZSA 1Q5YA 5J2PB 5GAGU 1RT1B 4F50A 1KQSR 1GMWA 7AT1B 2DPJA 1FK9A 1M5VC 2KRBA 3W9IA 3TVKA 4B3OA 4LF7J 2WONB 1Y3KA 5CZXA 5IM0B 1N5TA 3N6MA 1RT4B 3W5XA 2AU0A 4OZ3A 3ZZRA 3HHLB 3PY8A 4PPDA 4M5NA 4Z7YA 3HT3A 4RW6B 1OS5A 1VS3A 3QFWA 1KVJA 1X9SA 1K1SA 1RAEB 5D4NA 2DNYA 2J5AA 1VQ7S 2HZAA 4DR7J 2RS8A 4LQ9A 4PXBA 5LSLA 2R7RA 2GAHC 3DLKB 2ZNYA 1KS2A 1H0HB 1LFWA 1S1UA 3OTOJ 4H4MA 3M30A 5G0RB 5K8PA 1S9EA 2JH3A 3IAM9 5SUHA 1JLCB 2BX6A 3QGPA 4NLRA 1XMOJ 3TI0A 3ZZOA 1WJ9A 2CPIA 3NMRA 3QT7A 1WHXA 3QBCA 4IH6A 4DV1F 5DM7Q 1GMWD 1Q86T 1Q79A 2IIHA 4D3HA 3HVRA 1WSRA 3NOGA 3V81B 1HBOA 5EHHA 4EK2A 2UUAJ 3KHHA 4JV0A 5DZ7A 2GIQA 1FO1A 1X5SA 1CJKB 1SC1B 4ES3A 4LBHA 4NLOA 2M0GB 3KLIA 2IC3A 3MTJA 1V3SA 1T7PA 1LWXA 2XWXA 1Q16B 4PABA 3LP0A 2EPIA 2HIQA 2QL9B 5E2QA 5KFNA 1DLOB 4BS2A 2HVZA 5D78A 3A8EA 4JI0F 1UPMB 3WBZA 4TLRA 1S4FA 4G1QB 1VJQA 2VKZG 1VI7A 2DB1A 1WOOA 4Q2MA 4KB7A 1S5ZA 4QCLA 2Q3PA 4DR4F 4PQUA 1K9MT 4ITSA 2AT1B 2XO6A 4GKJF 4ZPBA 1CSJA 3KMQA 3MF5A 1VQKS 4O3RA 2WW8A 4HI2A 2D3UA 1FEEA 4KHPF 1U1RA 1MROA 1X8DA 2JC0A 2KM8B 3DN9A 5KFDA 3PW7A 2LFVA 5F8NA 3FKBA 3JSMA 5IQ6A 3NCPA 3T6BA 2JEJA 3R5AA 2J0WA 4Y34A 5GAHU 2QA4S 3R5CA 4PRFA 4R8UA 3PR5B 6FD1A 4ALZA 1MU2B 1RT3B 2WHOA 1Q8LA 4CH7A 1DY3A 3DYAA 1X4BA 3QWUA 3H2LA 4IFYA 4KGXB 1VDHA 1UEUA 1B0TA 5CHCB 3QJLA 2QLFB 2AJ0A 3MAHA 3GU0A 3H4BA 2EFVA 5DGBA 4DX7A 3AB2B 3QIDA 5KFAA 3JTOA 3THVA 2FLLA 4KPYA 1GH8A 1XERA 2K8GA 1RWUA 4ZKAA 4ZHRB 3DLLQ 1WEZA 3PEHA 2DY9A 2XM3A 4EUVA 4LSLB 3WX4A 4QPTA 2C42A 3SIPB 4UW2A 4Y2MA 2HW3A 3GIKA 1S0VA 2HFSA 5H9FK 5IWAF 1UVIA 2JEIA 2JLFA 5KFVA 5THWA 4KE5A 3PDNA 5IV3A 1OY8A 4OMFG 3M8PB 3A3NB 4Z37A 1NAQA 2J7KA 4OYZA 4B3MJ 3I0SB 1UJ4A 3DI6A 5B08A 1J5OA 3P45B 2VG7B 2ZC4A 3GJTB 5HSPA 3J7ZT 1YKWA 2M9KA 3OR2A 2M70A 2RNEA 4OYMA 4RKUC 5HBMB 2RT3A 5HQ8A 1HBNA 4L3NA 3BKTA 4OI2A 2K3IA 3H8YA 3CCRS 3THTA 1NCLA 2CDRB 4ZPVR 3JAMY 4ZP8A 3KLEA 4XK8C 4DPOA 4JI5F 1H2VZ 1XIQA 1HIYA 3RB3A 1H74A 2R3VA 2O1PA 3LALA 3U02A 4OI3A 4Q8EA 3R6GB 2E9ZA 2M5YA 2QA4G 2OO4A 2R2TA 3ZTOA 3EE3A 2YWKA 3TEGA 2IYGA 1UA0A 4XO0A 1REVA 3B4DA 3VGVA 2AEJA 5D0EA 2OI2A 5CYJA 2AJ1A 1KP6A 2RSQA 4ES2A 2MSTA 3CCJS 3OFHA 4ANEA 4LVOP 4A8MP 3TUJC 4NL5A 1EIYB 3K5LA 1U47A 3D6TB 4O0IA 4OFZA 2K06A 4HLBA 1RLCL 2X3GA 2AGOA 1FVQA 4HHJA 3EZUA 4RPFA 3GQCA 4JI0J 4ZPTR 1SXLA 5HN0A 2FVRA 3W2WB 2ACMA 3W2VA 3VZIA 4DR4J 4NCAA 2DJWA 3VAKA 2PEHA 1GTHA 4X4NA 3S6EA 1S9GB 3F44A 1VHFA 3SSRA 4M5KA 4K2JA 3KHRA 1UWBA 1HNXJ 1RTDA 4ZIWA 5D4LA 3F0NA 1S1WA 4ZPAA 4C0OC 3T1AA 5D3GA 1CVJA 3H2UB 4K8RA 2IRUA 2FYXA 1C1BB 3VGSA 4J5OA 1IQZA 1K47A 2MJUA 4XPEA 2NZ4A 2LU1A 3J81U 3U1NA 2E9RX 3RG6A 5F8JA 2ZOGA 3M2UB 3GMGA 1XJWB 2VBXA 2GV1A 1ZOTA 4A8SA 4KQZA 2IBKA 3K5OA 2CG4A 1FI4A 2AZ3A 4RWXA 1KVIA 2XHCA 4IG0B 4DV6F 4U9RA 4AQYF 4YS2A 4C3LA 2XNQA 3BGRA 4ELVA 3OJUA 2W4DA 3VAJA 4UOFA 1G3OA 2FZGB 3V4IA 3IR5B 2DHSA 1WTBA 3JAMU 4WU2A 3WX8A 1BD6A 2O3DA 2HVHA 2HBZB 4FP9A 5JVHQ 2V2ZA 4N7TA 2CJKA 4WYWA 3KHGA 5HI7A 4OJHA 2KYXA 4A8KA 1J27A 5K8NA 2N3LA 2YTCA 4AL7A 1DAXA 4WP3A 2NPIA 3D2WA 4ZS6A 4C8MA 1N32F 1VC0A 2HRTA 5LMNF 2L41A 4QWCA 1YRXA 1BMQB 5KG6A 4F4YA 1KVKA 4J9OA 3MEDB 1WF2A 4ZP6A 2KYZA 3IO1A 1VMBA 2VOPA 2FLNA 1VQSA 2LQ8A 4XDDA 3PO5A 3UN5A 2RMLA 2NPFA 4QWBA 2IVFB 5DGAA 3OTCA 3EM1A 1BHNA 3FDSA 4J9NA 2CVEA 4F26A 1WEXA 3IBCB 1OY6A 2L48A 3IFEA 3TANA 4RU2A 4LFAF 1TK8A 2BQRA 3MI7X 3BREA 2BANA 4XDCA 1NJXA 2Z4PA 5KG5A 1A9NB 5DLGA 2W8KA 1RTJB 1Y0HA 1RWOB 3TJ8A 3Q8SB 3I6PA 3HD2A 1HPZB 3LTOA 3CJ8A 1WSVA 4UUXA 1HI0P 4LF4J 4X4PA 1TUWA 4IKAA 2JSXA 4X62J 5F8LA 4YUDA 4PUOB 1HNVA 2KI2A 3B78A 2VC1A 1RWWB 2IVYA 2OPSB 1YQHA 2V34A 1HWJA 4C98A 1U8WA 2AW0A 1DJ0A 2HGNA 1IBCB 1RWKB 5JUMA 2G0CA 3I5BA 1MSWD 3CJ0A 4BWJA 2I1RA 3JYTB 3QAUA 5D6GA 2EC0A 4KT0C 3MUTP 1XN9A 3CJ2A 2DKOB 4DV4F 1D9AA 1DBDA 4RZRA 3HCXA 4RW7A 3MXHP 2ZBQA 4IG3B 1WNEA 5DS7A 5HMXA 1GEHA 3K5PA 1IJEB 1SKSA 4GVBB 2AEFA 1NMEB 2EC2A 2Y8WA 1CC7A 3RTVA 3R1LA 4LVNP 2IM3A 4RNHA 2ZWOA 2CXEA 2RE1A 1JK9B 2KG1A 3PVXA 2J0SD 2DY1A 2I2YA 1LWFA 4DR3F 1WC4A 4CLWA 2F8MA 2H4YB 3N0VA 3V6DA 2UXCF 1FDAA 1U0HB 2C2OB 2DXFA 3OQ2A 3BKFA 2FJBB 1A6LA 2W8LA 1HR0J 2M3DA 1NPPA 2OPRB 2LKZA 2J6SA 2ATLA 3DM2B 2DNZA 3W1YC 2DISA 2B6AB 2OAUA 5B0DA 4QWAA 3Q89A 4ZCKA 4F0MA 3M1VA 4QIWD 3EYZA 3H5YA 4I6YA 3Q8VA 4RNOA 2C2KB 3C15B 1QE1B 3CDUA 4IFVA 3RBEA 2MKKA 3RAXA 4TY8A 1OYEA 5HQMA 1PBUA 2QGFB 2JZ5A 4HH0A 3UW1A 4AT1B 3OTBA 3DLGB 4M5HA 3MECB 3NKYA 3MM9B 3TEHB 4CO1A 2W2PP 2MTLA 2LVWA 2E1PA 4ID5B 1R0AB 3DDKA 1V3RA 3PFOA 4LF6F 1FFGB 1LWCB 2WTFA 4UZCA 3D3BJ 4LJMA 2CAJA 2J6UA 3IAS9 2C22A 3A3OB 3CSKA 3FUYA 2XYHB 5DG9A 3I5CA 1FRHA 2DCUB 2WBMA 2FJWA 3NL0A 3ENQA 1G2EA 5KFPA 1YSJA 4KSEB 3TZWA 1TTHB 1FTCA 5ETOA 4O44A 2W01A 4MKAA 1HYSB 4KC5A 2H51B 4CTAB 2OMLA 4K0KJ 2F7VA 4DN9A 5DLFA 3UFCX 4CO3A 4OI0A 5BYSA 3D1HA 1Q4RA 5HVFA 5HAOA 4ECYA 4C0BA 5A8KA 4H54A 3AB4B 3BYPA 2UXDF 3NBPA 4LRCA 1L3UA 3DHWC 2CQHA 2W9BB 3TQEA 4J9LA 4EO8A 2D41A 3OVAA 1U1KA 1XR6A 5C25A 1T95A 4O3OA 4OHXA 4JI1F 3KOAA 4YN3B 4DHVA 3E01B 2RUGA 4TU8A 3QSYB 2R7QA 4ETXA 1VC5A 2X1BA 1IBLF 4ANDA 1HFEL 1JLAB 4MKVA 3J7YU 3DMJA 4LREA 1O51A 3MR5A 3L7OA 2FLOA 3U1MA 2ZBCA 4OZ5A 4DX6A 1JIHA 4K4XA 2QMWA 3FBEA 3CJRA 4WIQA 1X0PA 4WXWA 2B0GA 2H5EA 4JB8B 1TAUA 2RDIA 2M8HA 4I67A 4ENOA 5KFXA 2HS3A 1NZAA 3MOJB 2NXCA 5IT0A 2MGZB 4X65J 1C0UB 4KFBB 3R1HA 1L3KA 2G13A 2QN6B 2OJ3A 4IO9Q 3EMTA 3SBMA 1PYTA 2VDHA 2XI2A 3DRRB 4Y28C 4HTIA 1HBUA 3D6HB 1VBKA 1WKLA 2IMOA 3MD3A 1RAAB 3NY0A 1OWXA 2WVEA 1S0OA 3BDEA 1I94F 1EP4A 1ZETA 1W7WA 1DQ8A 1EB0A 2DGSA 1QJHA 3EDQB 2CJ9A 1RCOB 2ZNZA 3BQ1A 1V5VA 3Q8QB 4HEA9 1E6VA 2GX8A 1XNRF 1YZ7A 2GCFA 1YDLA 4PEOA 3W63A 4DQPA 2PI4A 3C66A 2KO1A 1VQNS 4K4WA 4NEZA 4B3SJ 4J9VA 1RYSA 1O6XA 1PYOB 1X31C 4LF6J 4IOBA 1ZBTA 2DRDA 4ZITA 4ZVFA 3HKWA 2ROEA 4RW8A 3AQOA 3OXFA 2HHXA 4DCJB 2RIJA 1MMDA 2I8EA 4DV2F 1JXVA 2HNDB 4YHHF 2ADCA 2W24A 2SXLA 2VPYB 3QT8A 5CABA 4ZP9A 3D67A 3KJVA 4DG1B 2OP5A 3JSBA 3GR1A 3HHLC 4F67A 1SKRA 1PC4A 1N8RT 2DGUA 4HHUA 1NEEA 1SL2A 1WKJA 2R7OA 2DGXA 2DNLA 1T0TV 2DTJA 5IC4B 1M5KC 1ELOA 4WFBQ 5EX3A 1UFLA 3I56S 2MKYA 1ZZNA 2QL7B 1R0BG 4J91A 4EBEA 4DEZA 4A8YA 3M6WA 3TVZA 4JI2F 3I0RA 2J9DA 1B99A 3A8IA 2ASYA 4F4XA 4B3TJ 1T9WA 1MN9A 2YNGA 1S1XB 2XY5A 2UV8G 3CB4A 1V3ZA 4DZ6A 3Q2TC 1KLMA 1B0VA 4M5JA 4ZVOB 2LQ9A 4ELUA 3M8QA 4LF5F 5KG0A 5K14B 3ETMA 3MUVP 2ZHBA 3K2YA 2R9LA 3HLUA 4LSNA 4NE9C 2HWIA 3IRXA 1IKYB 2A10A 1RK8A 2R8HA 1GXTA 2OPPA 4JI4J 4QZVB 2FHMA 2CQ1A 1H38A 4WKRA 3MR3A 4MKYA 3PM9A 4KJIA 2DNGA 2VG6A 4R5PA 4JYAJ 1ZAXA 2IBOA 1RAJA 2CVIA 1TL7B 3OUYA 2B4VA 3D54A 1CBKA 3G8QA 2UU9F 1C4AA 2JC1A 1RP5A 2RF2A 3BGLA 3PX4A 4NMLA 1YK9A 3HT0A 1AUDA 1OMSA 1M5OC 2DNPA 3MMCB 1HWKA 2E5HA 4Y2KA 2Y1LB 2XNRA 4JI6F 4C11B 3MMAB 2KM8C 4OYPA 3NAIA 2D7SA 2XSJB 3NGSA 2V8HA 2LXUA 1RXOB 1YRTA 2HSEB 3BKUA 2VIHA 4RL1A 2XLIA 1TU0B 3ZNUA 2BQUA 1ZA2B 2F65A 2OTLS 2D1CA 3CXCR 3RB6A 1R43A 1S48A 3TZXA 2QO3A 1W25A 3M2VA 3LANA 2KHDA 4NPOA 4FKYA 1HMVA 1NK6A 3NS6A 3UDVA 2LQ5A 4FF4A 2R4FA 3H40A 2DRBA 1NPKA 4G3IA 4DUZF 5F9NA 2KFZA 4ZVUB 5B0BA 2GVDB 3VALA 2IPOB 4X4SA 1HNIA 3G87A 3EWGA 3OLBA 1E6YA 1N0VC 1JLBB 3G96A 3MM6B 3KUGA 1NB2A 2BE2B 2B7BB 5DJBA 2JOQA 3I87A 4TQSA 3DOMB 3DRXA 1SJFA 4Y00A 4P2XA 3KJNB 4DV3J 5CQGA 1EKRA 1ZPWX 5I4MA 2CADA 2N7CA 5I3UB 4I2PB 4W92B 4LRBA 3IG1B 1XMQJ 4ZVTB 4DR2F 3I4PA 1T9VA 1VQ4S 3RRKA 4FYDA 1DQAA 4CCHA 3DXSX 3UVJB 3OL6A 4Q43A 2YQ1A 4A47A 4CT8A 4UOGA 3AD7C 2Q6CA 1IWAA 4J9RA 1VOMA 4A8XA 3BH7B 2LEPA 3FBCA 4Y3CA 2N82B 2M52A 2OTJS 4FXDA 2AP6A 3KMSA 2BOPA 4F2SA 4C8OA 3FRZA 2OSRA 3LUYA 2JEFA 3CE8A 4WFXA 1EETA 3CCZA 5KFOA 1CG2A 4RW4A 2JFDA 3ZXWA 4YR0A 3G2XA 1TL1A 4PCQA 2DGOA 3KK3A 3AT1B 1QAXA 2RAQA 5CD4H 2BJDA 3CMQA 5LMUF 1IBKF 1VQMS 5KFHA 3QO9B 3KJFB 2RUSA 2RRAA 1N5SA 3SDEB 2ZD1A 4RWWA 3AQPA 3QZ8A 2DR7A 4MFBA 1H7WA 4YB7A 1GTEA 2FZKB 3NGUA 4EBDA 5D8HB 1RT6A 4HT7A 1MW7A 4CIOA 2HBYB 1DURA 2RQKA 4JI8J 3M2RB 2CQBA 3ZZPA 2P2CB 5BXIA 1JKHA 3R27A 1S0NA 4PG5A 3DXBA 1UVLA 3ZC4A 2M8DB 4HVZA 1NBEB 3W60A 2QMXA 4NI2A 5DETA 4LT6A 3OJSA 5J2QA 1FDNA 3TUZC 2HZVA 3RBDA 3K59A 2HK3A 4TNOA 4M8LA 1S1VA 5HMWA 1UL3A 1LK7A 3SSQA 4J9MA 2HPUA 3SQOP 2L08A 1Z4UA 3M32A 2DO4A 1PIEA 3QATA 3MFHA 5CCMA 1F0XA 2CYYA 5L1JA 2D69A 2Y0BB 4HACB 4GKKF 4U7CA 4IR9A 4CZCA 4NXMF 2BKOA 4NZ0A 3O2IA 1N5YB 4H4OA 1WORA 4BDPA 1FJ7A 1FD2A 3R6LB 1SL0A 4C0HA 4B02A 4EI2A 3IWNC 3ULHA 3M6VA 2HG4A 3KLVA 1YLXA 1JXLA 3PYDA 2IY5B 1VRQC 5E3PA 1VBYA 2B3TB 4ZMMA 5B0AA 3L7UA 4WP8A 2RD5C 4TVAB 2BABA 2XZWA 2PMWA 2GC8A 2YWHA 2ZDPA 4I7FB 3ISND 2CZ4A 1U45A 3KLGA 3PYGA 5A8WB 3ZFVA 1RQ0A 4CT9A 5J1EB 3GSIA 1T94A 3DRPA 3EVOA 2V9KA 3N28A 2OPQA 5C2GA 2QFIA 4USVA 1SV5A 1HHQA 1SJ3P 4QOTA 2PGCA 3CWJA 3T5HA 4UUWA 1RA6A 4P10A 1RDRA 3GJQB 1BUXA 5ETTA 4DR2J 4B9MA 5JXSA 3EX7B 3N9UC 1PSDA 2ZM6J 3PW4A 1HWIA 2I5JA 3NS5A 2R7VA 2YNHA 1GX6A 5JVGQ 2XGPA 4PAAA 2KKHA 2V4QA 3HZEA 2BW7A 2C3OA 4UZBA 1CJUB 4OHVA 2HNZA 2M7SA 1Y00A 3QWPA 4J37A 2E1AA 1N48A 1R6VA 2YKMB 1B0PA 2CPYA 3PIOQ 2KT3A 3BV8A 5KT6A 3CCUS 4E8UA 4FVCA 2WVCA 3UI3A 2UV8A 3G9CA 3OPKA 4PR6A 1MWZA 3QGGA 1VRUB 2BE9B 2DH8A 1RT5B 3A1YG 3TZYA 3WDOA 2D74B 1Y5LB 2W4PA 1U7LA 4X84A 2HURA 1KC8T 5A8RB 2HFOA 3OSNA 3HPOA 1GAOA 2H5JB 4E98A 5C42A 2OHDA 5KFUA 1V5IB 2UVWA 1TFWA 4NLQA 1F6TA 1S7IA 4NWBA 3TUPA 3LQVA 2E1CA 3L09A 2WRMA 4RNMA 1Q1KA 2ZE2B 3G8SA 1JLFB 1RWNB 1FJGF 1HBMA 3PRBA 2ZJQQ 1L3TA 2QV6A 4HL9A 4HDHA 2HFNA 4R0EA 3KK1A 2LP4A 3V5RA 3ZZ0A 2YNFA 4ICLA 3CJ4A 1S57A 1FRIA 1YJRA 4ZVRB 5AXNA 3AD9C 3Q0AA 1RAOA 4LSZB 3J7YI 5HP1B 1NDPA 4DPTA 5EX0A 2DD8S 1RT2B 1BQMA 2HGMA 1RHJB 3GP9A 5E3AA 4X4UA 1FFSB 4CLKA 4LF9J 1IBMF 2QLJB 1H3DA 4PWDA 2BEFA 3R7SB 1OY9A 1H73A 2L9NA 2MKSA 4C3MA 2AQ4A 4NYZA 3JTPA 1N34F 4WE1B 1GXUA 2ZOFA 1LW0B 5KT5A 3VGUA 2CQ0A 1FDDA 3VAMA 3AOBA 2CPJA 4L73A 3DOLA 3MM5B 3VGTA 1PJ6A 1SKUB 1Z2LA 2ROPA 1OJ4A 4JUZA 4F3OA 2W9AA 2CPFA 3GFHA 5KFRA 5KFQA 1TVRB 2FJDB 3MM7A 3O1LA 1KWMA 2ABYA 2AX0A 3NWGA 2CQGA 1P27B 1M90T 4UY85 1X4FA 4DCOB 3SFGA 2CNLB 5CYMA 3N6NA 2NZCA 2VL1A 4XIUA 3K8WA 1X9WA 3I9ZA 2YXLA 3LPEA 4A8QA 3TJAA 2EFOA 4RUCA 3GJRB 2BKNA 1KHWA 4P71A 4EU0A 3RB4A 5KOXA 2ROGA 1QUPA 4NMXA 2DXEA 4ZDNA 2HGLA 2OD6A 1H2UX 2XMUA 3CUNA 3IS9A 2POKA 3WQPA 1FFWB 4YB6A 3W7BA 2G9OA 3RUBL 2CDQA 2HVDA 2P6SA 1HW9A 1QSYA 1S6PB 2MZTA 3K5NA 1Y4ZB 2GMHA 1YHQS 4N8NA 2F40A 2A6OA 3G82B 3HM9A 2DGVA 2XQCA 3P8BB 1EARA 3W66A 2DGWA 4C4WA 3M8RA 4WFZA 4WFNQ 4I56A 2VDIA 1NH7A 2NCKL 4OJ3A 3PTWA 4JV2A 1JLGB 5LL6d 1RWVB 1CS4A 4PG6A 4OX7A 5J1PA 4ZLJA 1F60B 2VBWA 3UD5A 3BO4A 2KZMA 4CI0B 2QLWA 4C8YA 4CRJA 3BSCA 3DGPB 5FLXY 4F36A 1G7CB 2VG5B 1YJNS 3PX0A 4CM0A 2ZH8A 4F8RA 2FY1A 1T9UA 1QVFR 1D9DA 3C3LA 4L72B 4URSA 2F63A 5GMKa 3W3SA 1H2TZ 2ZKUA 2WB4A 3L4BC 1FJGJ 1FJEB 3W9HA 1BGXT 2B51A 1FVSA 1WOPA 2IAJA 2HMIB 1HNZJ 4IOAQ 4P73A 3UQSA 3UCUP 4PG8A 2EI5A 1F9HA 4PG4A 2F1FA 5KG1A 1HQUB 1FT8A 3VR1A 2FGOA 2HRUA 4UOCA 2ILZA 2QG9B 4Z7CA 3M8WA 2R7SA 4KO0B 4ID8A 3BSOA 1KBRA 3OR1B 2MQMA 2YWWA 4ED0A 4KTQA 1DRZA 1H98A 4RW9A 3UR3C 1R8HA 3CD5A 4CO4A 2HAIA 2XMVA 4QIGA 3TA2A 2QYCA 3PJWA 2BACA 3MEEB 2MEWA 2QL5B 3ETOA 5C5JA 4DQIA 4CNZA 2MQ8A 3DLJA 3WC0A 1UWAA 1R8AA 3QAEA 2Z57B 4NYOA 4U8YA 3T5KA 1QTMA 4DV0F 4JV5J 4WZQA 4NLWA 1SIWB 1CJVA 1B70B 3TAMA 3TUIC 3ZZYA 2HLTA 3T5LA 4HHHA 3T3FA 2I38A 2E7WA 2V2QA 2EBEA 1NLKL 1KTVA 4Y2AA 2YNIB 4U95A 4IRDA 3OFEA 1BE4A 1U1NA 2MJNA 4YR3A 4AUKA 4DSKA 2E7VA 1RABB 1YJ7A 5T7LA 2YX4A 2HIYA 1MNEA 1YBAA 3PHEA 2J0QD 1S77D 3MZIA 5HMZA 1VBXA 3ILLA 1NM2A 2VKRA 3PNIA 4NX9A 1DTTB 4CLYA 1IM6A 1FKPB 1VYAA 2W9BA 5I3QA 3KHLA 2D9OA 3L95X 1T3NA 3SYZA 1RJJA 1XEZA 5IFMA 2H9ZA 2QTWA 5ADZA 4DL2A 4EGLA 1UCNA 1FK9B 3FEXB 4UF4A 2UUBF 5FLXU 4B3OB 3G6YA 2FJXA 2GGPA 1HHSA 2KG0A 4ECSA 4YMEA 1RAIB 3CIMA 3DRYA 1VIOA 4NA3A 1Q7YT 3J80Y 1T9TA 4QIVA 3T1HF 4GC6A 5HROA 1ZZFA 1SJQA 4WYLA 3CGIA 3QJPA 4FXWA 1S1UB 4H4MB 1JNRB 2FY8A 3M30B 3OTDA 3POTA 4J9QA 4ZN1A 4DCPB 1S9EB 2VQFF 3FCVA 4URGA 3FMWA 3JQJA 3E2EA 3DLHA 3M4XA 4PWWA 2B4UA 3M9MB 4MTPA 1OQ3A 4DSFA 4QW9A 5HVHA 2H65B 5JJBA 4ZK7M 2VFSA 4OYWA 1ZM2A 2XG8A 2ZITA 3MPVA 4NXNF 2CRLA 1BLUA 2A6MA 1IR1A 1ZM3A 3MR2A 3KLIB 2IC3B 2Y0SD 2ZH9A 2FD2A 3A8KA 4OX9F 3J7AN 2WSCC 2KTQA 2QLBB 4DFPA 1ZM9A 2DR6A 3DLEA 3EDRB 1NK9A 4IDKA 1C4CA 4PG7A 3LP0B 1B7FA 2CJXB 2XO7A 1T03A 2FVSA 1NPRA 3W64A 1P1LA 4GMKA 1OPZA 2RB7A 5DDOC 2B7CB 2KXFA 2DPIA 4P2SA 4PQUB 2LECA 3DDNA 3W62A 4QPXA 2BJ1A 6FDRA 5J2MA 1MROB 1ZAWA 3PYEA 2BV3A 5LJ5Y 1S9FA 1SC4B 4K59A 1HNWF 2XZDB 3JSMB 2XLKA 1TAQA 3R5BA 5CD4A 4JV1A 1PGZA 4P6QA 2CQDA 1I51B 2IA0A 4DR6J 3QPIA 2J76E 4R8UB 4LRDA 4ZCLA 1S1TA 4OJ1A 3J7A1 3M05A 4RUAA 3DYAB 4X64J 4IFYB 5T14A 4YY3J 2DEJA 2Y8YA 2LQJA 3BO2A 1S10A 4KV8B 2DNQA 5ETRA 3OLAA 2AJQA 4DPYA 1TL3A 2F4FA 4FZVA 2W25A 3ZO7A 2DT9A 1FHTA 3PKYA 1Q81T 4G1IA 3T1YF 3P4UB 2PEBA 1S1XA 1EZZB 1D3WA 3W8PA 1VRTA 3ENAA 4MYUA 4ZLPA 4FKXA 3RYLA 4OI6A 4PXCA 3DLBA 3KXDA 4CLPA 2XLJA 4ELTA 3MOZA 1V6HA 1RADB 1LK5A 4ZIVA 3CMES 2GFFA 2DH9A 3CW2C 2P9EA 4TQRA 2MY8A 2FJVA 4YR2A 1HQEA 1U4BA 1JX4A 4MJKA 5EUHA 1RAGB 1N36F 3P49B 2UVRA 2Q43A 1NJZA 4ILMA 1RBAA 1FCAA 2NSCA 4UQTA 3CDEA 4S0MA 2UUWA 3ZTRA 2JVRA 3AJ2A 2EG1A 3DI6B 5LSRA 1J5OB 3HVTA 1YJWS 2DXDA 2KFYA 1G4CA 3T1HJ 4KH1B 1ACMB 4DUYJ 1SJRA 3OR2B 4LR8A 2W9CA 2MLYA 3OVBA 1N5VA 1HBNB 2MZJA 3MEGA 2XCAA 3LP2A 1L3SA 1N6QA 6AT1B 2GJFA 3B8HA 1WHWA 2JNJA 3MDFA 3KLEB 2CJBA 4ECQA 3D0HE 3KG0A 4EEYA 2YH1A 4C11A 3MMAA 2E44A 2IJNA 2WCXA 1AFJA 5D15A 2NS1B 3GFZA 3VWSA 1NSPA 5A76A 3CC4S 2V5HG 2X7IA 4L74A 3BBBA 5KFCA 3UPFA 3OHAA 2J9DE 1REVB 4CLUA 2CWXA 4DU8A 1X7VA 1TR0A 4F3MA 3AHPA 2V50A 3PRDA 3MTKA 3NGKA 2MSSA 5M2RA 3RU0A 3GE9A 4DSLA 2GIFA 4OX9J 2GJIA 4RNNA 4OYXA 3GSDA 3GV7B 3MGJA 4M1KA 1NHKL 2C28A 1HI8A 1QTNB 1LXNA 1O8BA 4EFAC 3GCXP 1AZSA 3TVYA 1U1PA 1PG5B 4B9LA 4RBTA 3W2VB 1GMVA 4W90B 1R6YA 1AXQA 2QSWA 4O3PA 4WIIA 2XCPA 2V8VA 5KFGA 1RAFB 3MWBA 3R97A 1TMMA 3BM7A 3NRBA 2IDEA 4Y0FA 1W2IA 5IOLA 5D77A 1IR0A 1FKOA 1OQ6A 2IRYA 1UWBB 4Y2CA 2N3OA 4B3RJ 3C6TA 3V4MA 1S1WB 3UN2A 1S7HA 1RE1B 1JMTA 5D3GB 3CD7A 3GJSB 4LFBF 1XNQF 4B9SA 3EZ5A 2AYEA 3KFWX 2OEMA 3NGRA 4DQSA 1T05A 5C24A 3AXKA 1VJWA 2N4DA 5AXKA 3M6XA 4K4VA 3HVAA 2ZH5A 3T41A 1FWLA 3ILOA 2D9PA 5BR8F 2Y1JA 2C3YA 3GCWP 3C8YA 1F3FA 3R7NB 2DO0A 3BGRB 1Q5VA 4NZ6A 4DSJA 5E3QA 4AYBD 1YIJS 4P52A 4CLSA 1QD1A 3SQGA 4IUFA 3MR7A 3EJMA 2R8GA 1B4SA 2X1GA 2CJQA 3SMZA 1PBAA 1U2RA 2BW2A 4WWSA 2VPZB 2VASA 5CXTA 1UEKA 1ZH5A 4USKA 1SUQA 2ZOMA 3W9JA 1GQEA 1FNMA 1FRMA 3PO4A 4K7QA 3MPDA 4KH0B 4D3GA 1WI8A 4WTOB 3BEGB 4TKTA 3IP0A 4BCAA 1QLNA 2FHJA 1IN0A 2Y1IA 2BYCA 3QO9A 2KRRA 3EZOA 2I9SA 4ZLNA 4W98A 2FQQB 4RUBA 1EHWA 1EAYC 1YBUA 2PMHA 4RU9A 4DSIA 2UXBF 4J9PA 3J81Y 3KDOA 4OLOA 4AXIA 4OYAA 5K5MA 4A8WA 3R9LA 4K2XA 2YY3A 2Q79A 3BO3A 4BHQA 3QGIA 3ET6A 3QIPA 3LPYA 4G6VB 2OH2A 1H7XA 3PW0A 2BRLA 2OGUA 4PZVA 3KJQB 2K7JA 1S0MA 4WTYA 5F3ZA 2GVZA 3IMQJ 4N56A 1TKZA 3C14A 2BANB 4X4RA 4I64A 4KAIA 4EYHB 1IVZA 2VQEF 2E9TA 1FXLA 2OMOA 1RHUB 2M4MA 4ZLLA 1VLOA 2ZH4A 3CCWA 3RBZA 2FHJD 4Q8FA 5KT4A 2P9CA 4DV1J 1RAHB 1S6OA 3KLHB 1TKXA 1HNVB 3ELHA 1RKIA 3GIRA 3CCES 2AHOB 2Z30B 4ATNA 3LH2S 4DL7A 1YJ9S 2MZRA 2XB2D 2RQCA 4DX8H 1CULA 2C2NA 1K1QA 3L9ZA 2ALZA 4C7QA 3DHXA 4X4VA 2OFGX 1F2HA 4V19J 1KONA 4U96A 5AE1A 4FBUA 2ZH3A 4RW7B 5T41A 2HHPA 5A0YA 1TKTA 4FYWB 4TU7A 4YB1P 4Q45A 3VV2B 3EICA 4M5MA 5L1LA 1X5OA 2WK4A 4GKJJ 5L1IA 3TAPA 1X60A 3KLFA 2OIHA 1LWFB 4KHPJ 4JI7F 3V6DB 2BQ3A 3TNVA 2GIRA 1RYRA 1P1TA 4KGKA 4OX8A 4LFCF 4HH1A 4GC7A 3HMJG 4RO0A 3JB9k 1WWHA 1KFDA 4WFAQ 2G2OA 1QVGR 1C0TA 2LCWA 2DGTA 3PZPA 2HQIA 1X4AA 3PHTA 3I96A 3NP5A 4MMOA 2GMLA 3M1VB 2YKNA 4A4JA 3HXMA 3TYTA 2HQGA 5BR8J 3TQ1A 3F73A 5SZTA 1BWVA 2VH7A 1Q95G 1X0FA 5CYQA 2ZH6A 3N5FA 1FE0A 2MMYA 3Q8RB 2PE8A 4IFVB 2HHHF 2V9WA 4TY8B 2ZJPQ 3JTNA 4I2QA 2XMMA 4LF8F 2XGQA 4MKBA 1S6QA 4K4TA 3QT6A 2V4JA 4CYUA 3GFXA 1RBOB 2MKCA 5E41A 2JLGA 2FZCB 2CFXA 4EMDA 1CPZA 4C97A 3W5YA 2IYIA 2YKAA 3KDNA 5A8RA 2MZQA 1UW9A 2DR9A 1XK8A 1FKAF 3BJYA 2RRNA 5IWAJ 4CNYA 3ILIA 5A2QY 3BB5A 2J9CA 1VQLS 4F4ZA 2Y1RI 4HDGA 3BPDA 4WPAA 4OQJA 3AA8A 4CO0A 4F2RA 2NXNA 4TU9A 3GR0A 1MMNA 2AEMA 4K5RA 3BQ2A 2B9YA 3WC2A 4J90A 2HHVA 1FESA 5L8RC 4TY9A 3I5AA 2PDAA 3TZZA 4JI3F 3GG0A 4O44B 4F7VA 4KYZA 1TUGB 4X2BA 4NLSA 3DFEA 3HK2A 1FD8A 1HHTP 4LF2A 2YQ0A 3OW2R 2ADBA 4UY8T 3CC7S 5HLFA 2VQEJ 1NSAA 3SZ2A 1F9EB 4WFYA 2VFUA 3V2UC 4JI5J 4IOCQ 1C2PA 2F4VF 5A8KB 2JVOA 3NBPB 2FPHX 4X4OA 1JNZB 3CCQS 3QQCD 1U6FA 1ZM4A 1NJIT 3T9ZA 5F8HA 5C25B 3MURP 2BBEA 5U47A 1DZ5A 4FPIA 2B5JA 1SQFA 1TZ0A 3SCLE 3U7JA 1D8YA 3P6YC 2FJAB 2AYMA 3MM5A 1WHVA 1Q53A 1KTQA 5F8MA 1WG1A 2KXHA 1HWUA 5F3TA 3L7PA 2YX7A 3FNNA 1WD6A 4EWTA 2ERRA 4USMA 1R8CA 2DCLA 5IXUA 2B9EA 4E0DA 1NSQA 5G4DA 2G1HA 1SPBP 1UPPA 3IXQA 3I4HX 3GFYA 3SV3A 5EN1A 2J8SA 4NLDA 3LP1A 2KB2A 1FF2A 1AFIA 2RJZA 2HHUA 3TJ9A 4Q5VA 4JI7J 4ANCA 4QWEA 1F5CA 5DQHA 4YP3A 2FC9A 3I82A 3EVWA 3K17A 4LF7F 4G1PA 5A2QU 3BR8A 3BH6B 1EP4B 4QBUA 5KFYA 2V8DA 3SXLA 3NEKA 3ZTQA 3QFHA 1KLNA 1K0VA 3FEZA 3K8VA 4DR7F 4NCGA 1U8SA 1R31A 2KVQE 3QMQA 3OTOF 3IWXA 5EWEA 2FGCA 5F41A 2J0XA 1SB6A 1E6VB 4OX6A 4QIEA 2V6AA 4G65A 4DV6J 2RHQB 4AQYJ 1UVJA 1XMOF 2RQMA 3ITHA 4NLUA 3UN3A 3M9OB 1RA7A 1B7YB 1SL1A 2LA6A 5KG2A 3ILJA 4AL6A 5KAKA 4N77A 1PJ5A 3OFFA 3H20A 4RW8B 3UR0A 1AUSL 5D0GA 3CCMS 5IT9U 3Q8PB 4Q44A 2UUAF 1K73T 1AROP 4C48A 2YX1A 2H5IB 2FTRA 4OJGA 1ICEB 2RVJA 4H4KC 3KJVB 1N32J 5LMNJ 2BUNA 1QDUB 3CNQP 3DOKA 2MHEA 3DRSA 5EDWA 4OYOA 4USUA 4Z2XA 1HKAA 1IKWA 1LV5A 5GAGI 3DGVA 3VQTA 5IZHA 4DL0C 2MKIA 4O4GA 2MXYA 1KD1T 3X3UA 5AT1B 4ECTA 2G0IA 4RR5A 3I0RB 2HHTA 4KO0A 3M6UA 3A3PB 2YKQA 2HHSA 3FZ2A 2HNYA 2YNGB 1VK3A 3S7RA 4USWA 3RW7A 3DNCA 1KLMB 4LMZA 4OI1A 1U1LA 4NLVA 3R5DA 1PCAA 2ASLA 2KT5A 3M8QB 4KGMA 5LM7E 4LFAJ 3VZHA 1URNA 2R2UA 1Q8IA 2BE7D 2WB1D 4FBTA 2ASDA 2EWHA 4CH0S 5DZ6A 4LSNB 3IRXB 2X1FA 2OPPB 2B4OA 2JFKA 2K1RA 1T8EA 4U8VA 3RGIA 4ZOSA 3G6ES 1TK5A 4FF2A 4F4AA 2VG6B 4LBIA 3VVUA 4R5PB 2L3MA 4IRCA 2LEAA 4OZJA 1BWEA 4I1TA 2DEIA 1ROFA 3OUYB 1U48A 2BR0A 2ACYA 4QR1A 1WDDA 2EKNA 1X4GA 2HFUA 2RF2B 1K44A 2XS7A 4OZLA 1WG5A 5E3CA 1FRKA 1M5SA 5KT7A 1UFWA 3VQSA 1RT7A 1S6UA 3JS9A 2IMWP 2JHEA 4DV4J 4ZJLA 3FBBA 2OEKA 2Q66A 1FRXA 1MWYA 1TFYA 2DGQA 5FDLA 1VCTA 3O5TB 5I42A 3QRQA 4FS2A 1X4HA 1JJ2R 3NCQA 3EPGA 4AE5A 4RJVA 2H1YA 2DR5A 4AFFA 3KG1A 3H25A 3Q2SC 4DOZA 4K4ZA 3NGDA 2EFGA 1T3OA 4DR3J 2COLA 2W2QP 4H4KA 4OZNA 3M2VB 2UXCJ 2FHOB 2PA8D 2XI3A 4B3MF 1NK4A 1I6JA 2A2DA 1S12A 2DK2A 2Z2ZA 4P2FA 2XS2A 1HMVB 2U1AA 4EYIB 4M5GA 1RHKB 2XMWA 3R3TA 2V4RA 5GAHI 3MEKA 2LU2A 2LYVA 3RW6A 4C8NA 4R25A 4ZVPB 2HFVA 4RUHA 3ISZA 4L6V3 3SI8A 3LA0A 5E7OB 4WKYA 3GIIA 1U6ZA 1DQ9A 5KFIA 2QE5A 1UVKA 1JJ4A 1HNIB 1IXKA 3NG8A 2MQOA 3DU6A 2VFTA 2FVQA 3K7RA 1E6YB 4FNHA 4K50A 4ES1A 2BM1A 4KKOA 1FNOA 1YJUA 2EG2A 1B64A 2HS4A 4IQMA 5CA5A 1Y3JA 3LW5C 2B8PA 1QM9A 2AYGA 1SC6A 2C3UA 2B9XA 2XY6A 1R7IA 3GWCA 3PX6A 2B9WA 1MLAA 3IC1A 1M5HA 3OHBA 2WOMA 2AMCB 3BN7A 1RB0A 4UQGA 2RKIA 3PXGa 3NCRA 1VISA 4OZ2A 1IKVA 3H2VE 1WG4A 2KVIA 3VAGA 2W1BA 3DKDA 4L75A 2M88A 4K5SA 3EXYA 1LWEA 2QMUB 2NYIA 5KT2A 5EGYA 3AJ1A 1QSLA 3Q8YA 2EK6A 1FE4A 4O3QA 3IGNA 1Y9OA 1R8PA 4ZPDA 3EXCX 1Z2ZA 2G4BA 1C1CA 1NK0A 3P96A 1VQ6S 3Q86A 1HNXF 2DNRA 2V68A 2IM1A 1EETB 5K8MA 2Z2LA 4GO5X 4RW4B 1TL1B 3KK3B 2HQCA 4HR2A 2AJ2A 4OHZA 1YI2S 1WUUA 1RUSA 1R3NA 4TYBA 3SCIE 5E33A 1TV6A 2UXDJ 2CPEA 3CJQA 1FJCA 3D1QA 3S01A 2YWGA 5B0EA 2MKHA 2RS2A 5KFTA 2ZD1B 2HQFA 3SFUA 1I1GA 4KV8A 1RZMA 4MFBB 5J2NB 4ED1A 4U67Q 4CDIA 4JI1J 3C6UA 4NCBA 4CH1A 4LUBA 2JJ4D 3UDCA 1APSA 1ZA1B 1RT6B 2LQBA 4PXEA 4M5DA 1UW4A 2CNKB 2OSQA 2CZVC 1JLQA 1VQ5S 1DTQA 4ZPWR 2W2OP 2E5JA 1IKXA 4PXDA 1MG7A 2EW9A 2B56A 2V2VA 3NMAA 2IFXA 1JKHB 1UTAA 2V63A 1IBLJ 3CF5Q 3RAMA 2F3JA 3CJKA 3NNAA 1RSCA 4ECXA 1WC0A 4TLQA 2O5DA 4Y2IA 3C2PA 4NI2B 1CJTA 1NDCA 5J2QB 3LGHA 3RZAA 2DIVA 3VAHA 3PACA 3QLHA 9RUBA 2DH7A 4FNIA 1JLEA 2MY7A 3KK2A 3MAAA 1S1VB 3KNAA 3KG4A 5AXMA 2LLZA 1RTIA 4YEAA 3H5UA 1LW2A 2C2EA 5DDRC 1RTHA 3M32B 1LFPA 3WIVA 4ED7A 4FVMA 3C16A 2KL8A 1ZYQA 3MMBA 3HF5A 3OXLA 4CO5A 3MHYA 5J2PA 2HVIA 1RT1A 3G4SS 2CPZA 2NXUA 1RACB 2ZDOA 4DJBA 1KKHA 5GAEU 4H4OB 5BYQA 2C2MB 2WONA 2HAFA 4BBYA 5IM0A 1RT4A 1XWLA 1I94J 3HHLA 3W8GA 3MPWA 4RW6A 3CDAA 4DXLA 2DRAA 3T5JA 2BJ9A 5DO2A 3DLKA 1AYEA 4I68A 2E5IA 1RWMB 1W2BR 2V8PA 5G0RA 2ZHAA 2ZKTA 3TOQA 2J6TA 2VBYA 1XNRJ 4USJC 5ETKA 4UTGA 3KLGB 4OLPA 1JLCA 1SKWA 2GNKA 4YDDB 3U1LA 4GRSA 4B9TA 2AYBA 3DRPB 3HHNB 4LF4F 5KG4A 1XR5A 4OYIA 2OPQB 3NLCA 4V19X 4X62F 2F9JA 1SV5B 2Z2MA 2PMZD 3PYFA 4MIWA 2KXNB 2EKYA 2IDLA 3V81A 2OKQA 3NNCA 4DV2J 3HHLD 4YHHJ 4F4WA 2W7PA 1KQFB 1NB7A 2GO8A 1CJKA 2I5JB 3IBWA 3SCKE 1QUVA 1ZPVA 2ZVSA 4ED4A 2YNHB 3CCTA 1YJTA 3NXZA 1GT8A 3CIZA 1UVMA 1DLOA 3FCHA 2HNZB 3CULA 4ZPCA 2DNKA 2RILA 4FYXB 1PAUB 4G1QA 4CLZA 1HI1A 3KKFA 2OEJA 1SBRA 4CLTA 2RDDA 4Q7AA 3Q24A 2R7XA 4JI2J 1FEHA 2IJRA 9ATCB 4IH7A 5JMNA 3KWMA 1AW0A 4CLFA 1AB8A 3CJTA 4GVLA 3N4WA 4QU7A 1HD1A 4ECWA 5FD1A 3S1TA 1ITPA 3MM8B 2DVIA 3R2DJ 2BKPA 2QT7A 2HKEA 4OV1A 4U6PA 3A12A 3K5MA 4JOUA 4I4BA 3LOUA 3GYXB 5C42B 4KGZB 5KFEA 4LF5J 3CMAS 1HR0F 5E5NA 4UOHA 2MQLA 4ZVHA 3ZZTA 4YB5A 2K7KA 4DN0A 2CUYA 5BYRA 4RLEA 1BQNB 1WC6A 1MU2A 2DNMA 2HHWA 1RT3A 1SH0A 1REGX 2IM2A 1KRPA 2A3JA 3DDIA 4BC9A 2PI5A 1HBMB 3HJFA 1NK5A 1UETA 2QRRA 2R42A 3KK1B 2YNFB 1VC6A 4ICLB 1NO8A 3M8ZA 4C3KA 2UU9J 4WCEQ 5MAOA 5EWFA 3PRVA 2C2ZB 3FFIB 1CLFA 3DCAA 2E1RA 3MPYA 1HW8A 4ZHRA 4HT5A 1BQMB 1Q8BA 5C7PA 2B4PA 2H3EB 4LSLA 2NUUG 1CQMA 2ALYB 4JP8A 3AXMA 2U2FA 2FVCA 3GIJA 3LWMA 4HI1A 2C3PA 2BA9A 3S8SA 4JI6J 2FUG9 2ASJA 3OT9A 1LNQA 2PA3A 3H4DA 4PWDB 3HULA 1NXIA 3D6MB 1ZS6A 5D4OA 5ETVA 3THPA 3W61A 3M8PA 1XR7A 3DOLB 2GHWA 1NU4A 1NK8A 3I0SA 1RWPB 2DHAA 1I3OB 2VG7A 1D0EA 1D8ZA 5B0FA 1UKUA 4DL4A 2Z56B 1XTZA 3MM7B 2DHGA 5HBMA 4K0KF 2VB6A 2PFFB 3QGHA 4FXVA 3BQ0A 1RI7A 1PYSB 1O0PA 2G0JA 4C2MA 4NEYA 4DUZJ 3GILA 1R89A 4OZ1A 4CQ1A 1WTFA 5KFZA 4ZVGA 2GQCA 5CAAA 5CYMB 3CDWA 3HHKA 1P9QC 1FX4A 2EFNA 3KLHA 2KT2A 3GG1A 5CCLA 2LEBA 3PIPQ 4L76A 1OO0B 2AJ4A 3G86A 3GB0A 2E7XA 2B43A 1HL6A 2ZH7A 1A7GE 3EPIA 4DZDA 5RUBA 3LF0A 3G6VA 4WF9Q 2CG8A 3IS9B 5DG8A 1JXEA 2BMBA 3NOCA 4ZJQA 1X4DA 1K0TA 1U26A 2LMIA 1Y5IB 5AE2A 2ZUAA 4LIRA 5IV4A 4MIBA 2GZOA 3MAQA 2AJFE 4A8FA 3H0PA 3W2WA 1YGYA 2F8EX 4X65F 1S49A 4K4UA 2E66A 1HA1A 1NJWA 2PSZA 3Q83A 5LJ3Y 1S9GA 4QR0A 1CS4B 5DQIA 1L5UA 2HWHA 3CDBA 2XMAA 4EO6A 3AOAA 2XHWA 4E2FB 3CD6S 1M1GA 2Q1LA 4UT4A 2AF6A 5F0UA 1FRLA 2YKPA 1U25A 3SEOA 5GMEA 3SSSA 1Q8KA 1VGYA 5B0GA 1C1BA 4DI6A 1I5OB 5L39A 3UDLA 1FA0A 1S4EA 4ZN3A 4K4SA 2HS0A 3M2UA 1V9OA 1KQGB 1F5AA 5LMUJ 1IBKJ 3BS9A 5GVQA 1YWXA 1T9XA 2C1EB 4J7CA 2IAJB 2XWYA 3HX9A 5KOWA 1NJYA 1PO6A 2QJ3A 3FEYB 2ZZTA 4IG0A 3PW5A 1KNZA 3FSIA 1UA1A 1U2CA 1DFDA 3HHEA 3O8WA 2CA9A 1TK0A 4OV6A 3PG9A 4B3SF 4P7TA 1GK8A 2P5VA 3FSXA 1JQGA 3O3LA 3CJSA 4PQAA 4ZCIA 3R8YA 2XY7A 2O01C 3IR7B 4RW9B 2RU3A 2PD1A 2N7YA 4ILLA 1A0OB 1RGVA 2P6TA 3FBFA 3V6KA 3H5XA 2VJVA 5HVGA 4BWMA 2AGQA 3E8OA 4ERDA 4U7UD 4IR1A 2EFPA 5HL7Q 1S97A 3D0IE 3MEDA 1CJVB 3T9NA 4GKKJ 4NXMJ 3TAMB 2CPXA 3TA0A 5IC6B 4FDFA 5I3PA 5DDQC 4B17A 2D3OR 2QYGA 5IS2A 4C6AA 4WU3A 3NAHA 1EKSA 1MMLA 4FYVB 4DV5F 4B3TF 3LO3A 1U2FA 1WOSA 4DR5F 3A4TA 2BJ8A 3ZTPA 4NLXA 2QEXS 3OFGA 5T7LB 1NK7A 4IRKA 1LKZA 5MLCV 2ZH1A 3CVKA 3FQKA 1PJ7A 2EVZA 2BXJA 2AZ1A 2CQ3A 4DU7A 3G6XA 2HVEA 1RTJA 4QW8A 4JI4F 4WXOA 5L38A 1X9MA 1HPZA 2ZUGA 1U1OA 5AJ3F 1SH2A 2XBPA 1XC9A 2VPXB 5HQLA 4JYAF 2GGPB 4PUOA 2I0XA 5ETNA 2Z58B 1FXDA 2OPSA 4DSEA 4P2MA 2KN4A 1GNKA 3HFKA 2MPUA 3UWTA 2ZZMA 5HROB 2BDPA 5ETSA 2PC6A 1R0CB 2V0NA 5A6PA 3POTB 3JYTA 2H48B 4I0WA 4TXSA 4YFUA 3PR4A 3HSDA 8AT1B 2DIUA 3MD1A 2VF3A 2JL9A 4IG3A 2VD3A 4DPWA 2CQPA 4B9NA 4GVBA 2E29A 4F02A 3EVMA 5KFJA 4F25A 3CO0P 1KOHA 1NNDA 2KU7A 1IUJA 3VCDA 4Y6IA 1U1QA 3C19A 4MAKA 2G1DA 2VA3A 3PEJA 4I6WA 3QSIA 2HQ3A 1U0HA 2RU9A 3ENVA 4DF8A 3RAQA 1P8GA 3EGNA 5E0OA 3HHDA 3DLEB 2D3O1 4IDKB 1VLYA 3I9V9 3OXGA 2OPRA 3UNYA 2LXFA 2EFQA 3EGVA 3HFZB 2GAGC 1T03B 4I6AA 3DM2A 2B6AA 2BJEA 3HD1A 4B08A 3O6QA 2BJ3A 2Y3YA 2BJ7A 4GO7X 2ZJRQ 3C15A 1QE1A 4B9VA 1M5PC 1ZAVA 4OL8A 3O44A 1VQ8S 5CH7B 3MCOA 2LDIA 4J9KA 3DLGA 5J2MB 1FWPA 3MECA 4NA1A 5GADU 3MM9A 2YVSA 3P5BP 2DHXA 3NGTA 4ID5A 1R0AA 2J9EA 5J1NA 2ZBIA 4V1Ak 5HJXA 1H72C 2PIIA 4PWUA 1TP7A 2CPDA 1LWCA 2H4WB 5DM6Q 3TP2A 4DV7F 4DV3F 4QIFA 3BBCA 1S1TB 2GO9A 3GTYX 3K0JA 1IBMJ 1XMQF 1WC5A 1QAJA 3D1OA 1S79A 3DC2A 1BC6A 1TL4A 5CZVA 1NRKA 3FGVA 4DLGA 2VODA 4WK1A 3I55S 1Y10A 2Z8QA 1NUEA 1N34J 4LBPA 1TL3B 2HWTA 2BRKA 2UUTA 5GAEI 3RJMB 3D66A 3MR6A 4DV5J 2GA7A 1HQ2A 4Q0BB 4DR5J 4KPCA 4O4RA 2W7AA 3GZ7A 4FF3A 4LR7A 1VRTB 2P8IA 1HYSA 3LAKA 1SC3B 3US5A 3VF0B 4CTAA 2BVZA 2ZVIA 5KFMA 4NZ7A 1YG0A 4L3KA 4Q2LA 3MCMA 3CT9A 2R8KA 3P3DA 4MIAA 1IR2A 1HQEB 1KHVA 2QLXA 4DQRA 2ZH2A 3N79A 3FCWA 3FVYA 3GYNA 1KQKA 1D9FA 4NLPA 5A6WA 2G2ZA 5DDPC 5AJ3J 4DWIA 1WC3A 5KG3A 2JWNA 1FDBA 3IN5A 3OSPA 4CO2A 2GMJA 3HVTB 1GMUA 3HVWA 4EBCA 3TARA 5IQQA 1YRUA 2YPZA 3E01A 3ZZZA 2JEGA 2W9CB 2FC8A 3VHQA 4JI8F 2MQQA 5KFBA 3MEGB 3D0GE 2ZZNA 3LP2B 4FF1A 4F4KA 2ZEJA 1N6QB 2AGPA 1JLAA 1G1XA 4IO1A 2LXIA 5K9FA 3D68A 1S76D 1P6TA 3RB0A 3MCSA 2YPYA 1SH3A 4U7UK 3QRPA 4P75A 4OHYA 2A0FB 1SJ1A 1Q7LB 3TRGA 1WDTA 1NH8A 3A13A 2MLZA 2MGZA 1C0UA 4KFBA 1IWGA 4RBVA 7FD1A 5LXRA 2MYFA 1OPIA 2D3ZA 5KFFA 8ATCB 3FRYA 2V8GA 4QQBA 2OD4A 4BC7A 3DRRA 3CCSS 1F9FA 1RLDA 1SI9A 4J9SA 1X4EA 1NKBA 2ILYA 1HBOB 2CQCA 3BGOP 3CO9A 4USIA 2IA6A 1URRA 8RUCA 5KG7A 2WZ1A 3HZGA 3IA0A 1GXLA 3AY0A 5HO4A 4QYZJ 1AZSB 4HTJA 2R7WA 2HBQB 1YBTA 3MMJA 2M2BA 4FYYB 3TR5A 2YH0A 4ILRA 3RBXA 3JXOA 2R8JA 4ED3A 1UEVA 3QZ7A 3TX0A 4C8ZA 3RR7A 3CC2S 3HP6A 1FKOB 3BR9A 2R8IA 1R8BA 4M5IA 1JJCB 3C6TB 3ISNC 2CWKA 2JRSA 2MDAA 1FXRA 2FLPA 1TKDA 4KBIA 4YQWA 4KIAA 2C3MA 5K8OA 4DV7J 1VBZA 3UNGC 2UZAA 4DMZA 3Q22A 1XBWA 3PW2A 3BSAA 4USTA 4DDFA 1M1HA 1QAYA 1T05B 5C24B 2HNDA 1FNXH 3CTRA 3ZZUA 4DS4A 3WIUA 4ECVA 3T19A 2ZM6F 2VJUA 5B7WA 7FDRA 2VPWB 3IWLA 5D0HA 1OYDA 4DG1A 3HSZA 5EWGA 4DV0J 2YWFA 3QT5A 1KFSA 5DQGA 3UE2A 2F8HA 3SQGB 2O67A 3K89A 1TL5A 3HSGA 4OZ0A 2GQQA 5KFSA 1OIAA 1HLWA 1GFWB 3M8SA 4O3SA 2W4CA 1SUQB 1Q0NA 4QJVA 2DYAA 1SQEA 3LGMA 3GV8B 2WSFC 2XMTA 4QWDA 3AFGA 4DLEA 2HK2A 4PYAA 4CM2A 2MZ1A 4F04B 3LAMA 5ETQA 5GMDA 2W2MP 5K14A 1N33F 1N0UA 3CPWR 2L9WA 1F5BA 3N6LA 1IKYA 3H59A 4QYRA 4PPZA 5J2NA 3G71S 3M8YA 2F9DA 2UUBJ 2WVDA 5K20B 4N5SA 4KR0B 3H98A 3ET6B
chains in the Genus database with same CATH topology
3VAJA 2EFGA 1T3OA 1JLGB 2COLA 5LL6d 4WK3A 1G3OA 4H4KA 3QIPB 3V4IA 4OZNA 3M2VB 4PG6A 4OX7A 2FHOB 1S99A 3IR5B 5AXLA 2VA2A 5J1PA 2PA8D 1F60B 2XI3A 4B3MF 2DHSA 1NHUA 1NK4A 2VBWA 1I6JA 2A1BA 1WTBA 2A2DA 3BO4A 2KZMA 4WU2A 2DITA 4CI0B 2MQPA 2QLWA 2DK2A 1BD6A 2XS2A 2O3DA 4C8YA 2HVHA 1HMVB 2U1AA 3ICLA 4FP9A 3BSCA 5FLXY 5JVHQ 1G7CB 2VG5B 4EYIB 1YJNS 3PX0A 3QJJA 2CJKA 4WYWA 2JX2A 2XMWA 3OL8A 2ZH8A 4F8RA 3R3TA 3KHGA 2FY1A 5HI7A 1TKZB 4OJHA 1IM4A 2KYXA 1QVFR 4A8KA 4NLTA 2V4RA 4R0JA 1D9DA 3C3LA 1TQLA 5GAHI 3NNHA 4L72B 4URSA 2P9GA 5K8NA 3MEKA 1DHMA 3MMCA 2LU2A 2N3LA 2LYVA 3RW6A 4ZCMA 2YTCA 2APOA 4C8NA 4AL7A 1DAXA 4R25A 1X5PA 2NPIA 3D2WA 4ZS6A 5GMKa 4C8MA 3W3SA 4HYKA 1N32F 1BQXA 1VC0A 4RUHA 5LMNF 3ISZA 4L6V3 1H2TZ 2L41A 2ZKUA 4QWCA 3SI8A 2WB4A 5E7OB 4WKYA 1YRXA 3GIIA 1FJEB 5KG6A 1U6ZA 1BGXT 2B51A 4F4YA 1DQ9A 1FVSA 2IAJA 5KFIA 4LF9F 4J9OA 2HMIB 4IOAQ 2QE5A 1UVKA 3UQSA 3MEDB 3LGNA 4PG8A 3UCUP 1WF2A 1HNIB 1IXKA 3NG8A 4DL3A 2XSJA 2MQOA 3DU6A 5L9XA 1JJ4A 2VFTA 4ZP6A 2FVQA 2EI5A 1TKXB 3IR6B 4P7VA 2KYZA 3K7RA 1E6YB 4EZ9A 4FNHA 5M2UA 2QZ8A 4K50A 3IO1A 1VMBA 2F1FA 4PG4A 2VOPA 2FLNA 5KG1A 1VQSA 4ES1A 1HQUB 2BM1A 4KKOA 1FT8A 4URQU 3VR1A 2FGOA 1J2VA 4XDDA 3PO5A 2HRUA 1FNOA 2RMLA 4UOCA 1YJUA 2ILZA 2Z0GA 2NPFA 2R7SA 2EG2A 1B64A 4KO0B 4ECUA 4ID8A 3IRWP 5IT4A 2HS4A 3BSOA 2XC9A 1NKEA 4IQMA 4QWBA 1Y3JA 5CA5A 3OR1B 2MQMA 2IVFB 3LW5C 1QM9A 5DGAA 3OTCA 2AYGA 2AX1A 2X51A 4ED0A 4KTQA 1SC6A 1DRZA 3FDSA 2C3UA 2B9XA 4J9NA 2XY6A 1R7IA 1H98A 1U1MA 3GWCA 4RW9A 3PX6A 2B9WA 2CVEA 2NSBA 3UR3C 1R8HA 3N5BA 3CD5A 3IC1A 1M5HA 2FJEB 4F26A 3F56A 3OHBA 1WEXA 4CO4A 1F2GA 4HKQA 2HAIA 4IYQA 4DFMA 2WOMA 2XMVA 1O5JA 4QIGA 3TA2A 1U6BA 2L48A 3BN7A 3IFEA 2UVUA 2PT0A 3TANA 4RU2A 2QYCA 3PJWA 2RKIA 4UQGA 3PXGa 3NCRA 4LFAF 1TK8A 3UD3P 2BQRA 3MI7X 3BREA 2BANA 4XDCA 1NJXA 3J7Z5 2BACA 2AWZA 1IKVA 2Z4PA 3MEEB 5KG5A 1A9NB 5A0YB 1TKTB 4O3NA 3H2VE 5DLGA 3LWLA 3ETOA 2W8KA 1WG4A 4A8OA 5C5JA 4DQIA 2KVIA 4X66F 1RTJB 1Y0HA 4CNZA 3RRHA 3VAGA 3Q8SB 3I6PA 3HI9A 3DLJA 2E1MC 1Z1ZA 3WC0A 3KYLA 2M88A 2PO4A 4N41A 1R8AA 1HPZB 4K5SA 3QAEA 3EXYA 1LWEA 4UUXA 2NYIA 3UD4P 1HI0P 2C2DA 4NYOA 5KT2A 3T5KA 1QTMA 4X4PA 5EGYA 2JDJA 3AJ1A 4DV0F 3UCZP 1QSLA 4IKAA 2JSXA 4WZQA 5F8LA 4NLWA 3KLFB 2EK6A 1SIWB 4YUDA 1FE4A 4O3QA 4PUOB 1HNVA 3TAMA 1JLBA 3TUIC 3ZZYA 2HLTA 3T5LA 3MM6A 1HWLA 2KI2A 3B78A 2VC1A 3IGNA 1Y9OA 3T3FA 1R8PA 2IVYA 2BE2A 2I38A 4ZPDA 2OPSB 3EXCX 1Z2ZA 2E7WA 1YQHA 3RR8A 2G4BA 1HWJA 1RTDB 4C98A 1C1CA 3BGFA 2EBEA 1NK0A 3P96A 1VQPS 1HNXF 1VQ6S 1KTVA 2DNRA 4Y2AA 2YNIB 2AW0A 2IM1A 4IRDA 1R27B 1N54B 3DOMA 3OFEA 1U1NA 1DJ0A 1EETB 2HGNA 5K8MA 2Z2LA 3T6JA 5JUMA 1C0TB 1PILA 2MJNA 4GO5X 2G0CA 4YR3A 3I5BA 4RW4B 4AUKA 1MSWD 3CJ0A 4BWJA 4DSKA 2I1RA 1TL1B 3JYTB 1T02A 3KK3B 1WACA 3QAUA 5T7LA 5D6GA 5I3UA 4OHZA 4I2PA 2YKNB 2YX4A 1YI2S 2EC0A 4KT0C 3MUTP 1R3NA 1MNEA 1XN9A 3IG1A 4TYBA 3CJ2A 3SCIE 4DV4F 1D9AA 3AH6A 1YBAA 1DBDA 3PHEA 5E33A 1TV6A 4N8OA 4RZRA 2J0QD 1S77D 4RW7A 5CYQB 3MXHP 1WEYA 3H5SA 3MZIA 5HMZA 2CPEA 1VBXA 4IG3B 5F9LA 1WNEA 5DS7A 5HMXA 1FJCA 1X5TA 2VKRA 3D1QA 3S01A 3TO8A 2YWGA 3PNIA 4NX9A 3K5PA 5B0EA 1IJEB 1DTTB 2MKHA 2RS2A 5KFTA 1SKSA 4YOEA 1FKPB 2ZD1B 2W9BA 5I3QA 4I2QB 3KHLA 3SFUA 1VQOS 2D9OA 4F3QA 3L95X 4JBCA 4NLGA 1I1GA 4KV8A 1T3NA 3SYZA 1RJJA 4MFBB 5J2NB 1XEZA 1S6QB 2H9ZA 5ADZA 5IFMA 4ED1A 1CC7A 4EGLA 4U67Q 4DL2A 3RTVA 3C6UA 4NCBA 4CH1A 1FK9B 2V4JB 4LVNP 2IM3A 4LUBA 2JJ4D 3UDCA 3EGWB 3R1LA 1APSA 4RNHA 1RT6B 2LQBA 3FEXB 4PXEA 2O66A 2UUBF 2WSEC 2RE1A 1JK9B 4B3OB 2KG1A 3G6YA 4M5DA 1UW4A 1UJ5A 2OSQA 3PVXA 2J0SD 2CZVC 1JLQA 1VQ5S 1DTQA 2VZ9A 4ZPWR 2FJXA 2I2YA 1LWFA 2E5JA 1IKXA 3CD0A 4PXDA 2GGPA 4NLYA 4DR3F 3V4IB 1HHSA 2KG0A 2EW9A 4ECSA 2HFZA 2F8MA 4YMEA 2B56A 3BF4A 3CIMA 3NMAA 3N0VA 3DRYA 1QY7A 3V6DA 2IFXA 1FDAA 1JKHB 1VIOA 2UXCF 4NA3A 3MM8A 1Q7YT 1FERA 3CF5Q 3RAMA 2F3JA 3EUNA 3OQ2A 3J80Y 3EGZA 2FJBB 4RX6A 4QIVA 3CJKA 1A6LA 3NNAA 2W8LA 2RH3A 3T1HF 4A48A 4ECXA 4GC6A 4TLQA 2O5DA 4Y2IA 5HROA 1ZZFA 4OIXA 1SJQA 1YVFA 3C2PA 2CJAA 4WYLA 3CGIA 2M3DA 3QJPA 5KT3A 2OPRB 2LKZA 1S1UB 4FXWA 3E51A 5J2QB 4H4MB 2J6SA 1JNRB 3M30B 2ATLA 3OTDA 3DM2B 3POTA 2DNZA 3RZAA 2DIVA 3VAHA 2DISA 2B6AB 3PACA 2OAUA 5B0DA 4QWAA 3QLHA 4C9DA 4ZCKA 4J9QA 3U27A 2DH7A 4FNIA 3M1VA 1JLEA 1S9EB 4QIWD 2MY7A 3KK2A 1BQNA 2VV5A 4URGA 3EYZA 2VQFF 1G6BA 1S1VB 2WAQD 3FMWA 3KG4A 5BJRA 3KNAA 5AXMA 3H5YA 3E2EA 4I6YA 2LLZA 3TW0A 2YWEA 1RTIA 4YEAA 3H5UA 3DLHA 3M4XA 4RNOA 1LW2A 5LXYA 2PN6A 2C2EA 2B4UA 5DDRC 3M9MB 3FSYA 1QE1B 4MTPA 1OQ3A 3B82A 3CDUA 4DSFA 1RTHA 3M32B 4QW9A 1LFPA 4IFVA 3RBEA 4ED7A 4OI4A 4FVMA 2VC0A 4LIWA 5JJBA 1HNZF 3SDEA 2MKKA 3RAXA 4TY8A 1ZYQA 4ZK7M 3MMBA 3HF5A 3OXLA 4CO5A 2JZ5A 4HH0A 2VFSA 3MHYA 5KFKA 3UW1A 5J2PA 2HVIA 1RT1A 3G4SS 3OTBA 2CPZA 3DLGB 1ZM2A 2NXUA 5HMYA 1NHVA 2XG8A 3MECB 2ZDOA 2ZITA 4DJBA 1DARA 3MPVA 5GAEU 4H4OB 5BYQA 3NKYA 3MM9B 4CO1A 2WONA 2LVWA 3FFIA 4BBYA 5IM0A 1LOUA 4ID5B 4NXNF 1RT4A 3HO1A 1R0AB 2CRLA 3DDKA 1V3RA 1BLUA 3M2RA 3PFOA 1XWLA 4LF6F 3OTEA 1JJHA 2DBBA 2HHQA 3HHLA 1LWCB 1UJ6A 1ZM3A 3MR2A 3KLIB 2WTFA 2IC3B 2Y0SD 3MPWA 2FD2A 3CDAA 2QA2A 4RW6A 4OX9F 2ZH9A 5HLFB 2UUCF 2WSCC 2KTQA 4DFPA 4LJMA 1ZM9A 2DRAA 4AL5A 4FS1A 3DLEA 3T5JA 1VQYA 1NK9A 5DO2A 4IDKA 1C4CA 4PG7A 2GW8A 3DLKA 3LP0B 4I68A 2E5IA 1B7FA 2J6UA 2XO7A 3IAS9 1T03A 2C22A 1W2BR 3CSKA 5G0RA 2ZHAA 4C8LA 2FVSA 2ZKTA 3TOQA 2J6TA 5DG9A 4N47A 2VBYA 1P1LA 2VFRA 4GMKA 3BZQA 4USJC 3KLGB 3I5CA 1FRHA 2KJWA 4OLPA 3TA1A 2KDOA 1OPZA 1JLCA 1SKWA 2GNKA 1KSPA 2DCUB 2RB7A 4YDDB 5DDOC 3U1LA 4M63A 2WBMA 2B7CB 2KXFA 4B9TA 2DPIA 2B5JB 4P2SA 3DRPB 5D4PA 2AYBA 2FJWA 2E5GA 2XS5A 4PQUB 2LECA 3NL0A 3ENQA 3JSRA 2R2RA 1G2EA 3HHNB 4LF4F 5KG4A 3DDNA 5KFPA 1YSJA 1XR5A 2CQ2A 2OPQB 4JV5F 3NLCA 4V19X 4X62F 2F9JA 4KSEB 1SV5B 4QPXA 4FF1A 1D1UA 4IH5A 1FTCA 2MHNA 2Z2MA 2PMZD 4O44A 6FDRA 5J2MA 1MROB 3PV8A 4MIWA 1ZAWA 4N76A 2BV3A 5LJ5Y 2KXNB 4MKAA 2EKYA 3FQLA 3V81A 1S9FA 1HYSB 1N5YA 4A46A 2R7UA 4K59A 1HNWF 2OKQA 4OHWA 3NNCA 4KC5A 4XPCA 4CTAB 2OMLA 1Q82T 3JSMB 2F7VA 3HHLD 4DN9A 1TAQA 5DLFA 4F4WA 2XLKA 2W7PA 3R5BA 3TX8A 4JV1A 1PGZA 1KQFB 1NB7A 2GO8A 4P6QA 2CQDA 2IA0A 3UFCX 4CO3A 4OI0A 2I5JB 3IBWA 3QPIA 3SCKE 1QUVA 5BYSA 2J76E 3D1HA 1ZPVA 2ZVSA 4R8UB 2YNHB 3CCTA 4ZCLA 1Q4RA 2NLWA 1YJTA 1S1TA 3AAWB 3CJ3A 4OJ1A 3J7A1 2VFVA 3M05A 4ECYA 1GT8A 4C0BA 3CIZA 3KNGA 4RUAA 5A8KA 3X1LB 3DYAB 3AB4B 4H54A 1N4LA 1UVMA 4IFYB 3CEDA 2UXDF 3LP1B 3NBPA 5DG7A 5T14A 2CKWA 1L3UA 1DLOA 2WBRA 3FCHA 2HNZB 2NUHA 3DHWC 3CULA 2LQJA 2CQHA 4MK9A 4ZPCA 2W9BB 2DNKA 2KH9A 4J9LA 3BO2A 3PFEA 4I7FA 2D41A 1IJFB 2RILA 4KRWA 4EO8A 2KFNA 2FB0A 3OVAA 1U1KA 4G1QA 1XR6A 1S10A 4KV8B 2NREA 5A8WA 2DNQA 1HI1A 1T95A 5C25A 3OLAA 2AJQA 3KKFA 5J1EA 4O3OA 4OHXA 1TL3A 1SBRA 3CCVS 3Q24A 4FZVA 4Q7AA 5L1KA 2R7XA 4JI1F 2W25A 1FEHA 5GADI 1N88A 3FZBA 4IH7A 2DT9A 3KOAA 3KWMA 4MK8A 1FHTA 3PKYA 1N56A 1X4CA 3MFIA 1Q81T 1AW0A 4G1IA 3T1YF 4DHVA 3E01B 1CQNA 3N4WA 2RUGA 4QU7A 1HD1A 1U49A 4ECWA 5FD1A 1S1XA 3I32A 5H9EJ 1D3WA 5M2PA 3S1TA 3MM8B 4TYAA 4ED2A 2DVIA 2QIFA 1ZTWA 1VRTA 4ZLPA 4MYUA 4TU8A 2R7QA 2QT7A 3OL9A 3F41A 4ETXA 1VC5A 2X1BA 4OV1A 3RYLA 3BSNA 4U6PA 1LXJA 1IBLF 1HFEL 3K5MA 4JOUA 1JLAB 4OI6A 3J7YU 4I4BA 3LOUA 4XAKA 4PXCA 3DMJA 3DLBA 3GYXB 5C42B 5KFEA 2HRYA 2XLJA 4ELTA 3CMAS 1O51A 3MOZA 1HR0F 5E5NA 1V6HA 3MR5A 1LK5A 2DNHA 2DNOA 2FLOA 3L7OA 2VONA 2MQLA 4NCGB 3U1MA 2UVVA 3CMES 2ZBCA 4OZ5A 4ZVHA 2GFFA 1JIHA 2DH9A 3ZZTA 4YB5A 2QMWA 2K7KA 4K4XA 4DN0A 4WXWA 1X0PA 2B0GA 2H5EA 2P9EA 5BYRA 2MY8A 4TQRA 2KZZA 1TAUA 2FJVA 2RDIA 2M8HA 3WZ0A 4I67A 4K4YA 4RLEA 2AV5A 2RDJA 1BQNB 4PKDB 5KFXA 1HQEA 2HS3A 4YR2A 1U4BA 1MU2A 1JX4A 3VTIA 1NZAA 2L9DA 4DBQA 3MOJB 5IT0A 2MGZB 2DNMA 1C0UB 4KFBB 4MJKA 1RT3A 3ONQA 3R1HA 5EUHA 1N36F 1L3KA 4M94A 3P49B 1SH0A 2G13A 2IM2A 1KRPA 2UVRA 1ULRA 3ITHB 3G8TA 2A3JA 4X4QA 4ECRA 2Q43A 4BC9A 4IO9Q 1HBMB 1NJZA 2OJ3A 2PI5A 3HJFA 4ILMA 3M9NB 1NK5A 1UETA 1FCAA 2R7TA 2NSCA 2QRRA 2ZHOA 4UQTA 2XI2A 3KK1B 2N4CA 3CDEA 2YNFB 2UUWA 1VC6A 4ICLB 3DRRB 4Y28C 4HTIA 1J5EF 1NO8A 2JVRA 3AJ2A 1HBUA 1VK8A 2IRXA 2YKMA 2EG1A 4FN5A 4C3KA 3DI6B 5LSRA 1J5OB 3HVTA 4WCEQ 3V6HA 5MAOA 1WHYA 5EWFA 1YJWS 2IMOA 2KFYA 3MD3A 3FFIB 3GV5B 2GJ2A 1CLFA 3DCAA 1SJRA 2E1RA 4ECZA 2GQ2A 1OWXA 3OR2B 3MPYA 3IGVA 1RISA 2W9CA 1HW8A 1CC8A 4HT5A 4ZHRA 1VRUA 1BQMB 1S0OA 3BDEA 3OVBA 4ED6A 1RT5A 1N5VA 1UAWA 4DFJA 1Q8BA 1HBNB 1I94F 1EP4A 2MZJA 1ZETA 2B4PA 5KFLA 3MEGA 1DQ8A 2XCAA 4LSLA 2NUUG 3LP2A 1CQMA 4ZVEA 1L3SA 1N6QA 2U2FA 1U24A 2FVCA 3GIJA 1HD0A 1QJHA 1WHWA 2DGSA 3B8HA 3LWMA 4HI1A 2GHPA 2C3PA 3MDFA 2BA9A 3KLEB 2CJ9A 2CJBA 3S8SA 2ZNZA 2FUG9 2LA4A 3D0HE 4ECQA 2ASJA 3KG0A 3BQ1A 4EEYA 1K8AT 2YH1A 3DOKB 4C11A 3MMAA 4RNFA 2E44A 2IJNA 2WCXA 1AFJA 3DRSB 4NRUA