5J1PA

Lassa virus l protein cap-snatching endonuclease. bound to two manganese ions
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
169
Chain Sequence
GMEEDIACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILTLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKTVNISLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
source organism Lassa mammarenavirus
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase L
total genus 61
structure length 169
sequence length 171
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1pA02
5IZHA 4I1TA 5J1PA 4MIWA 5J1NA 3JSBA
chains in the Genus database with same CATH superfamily
4DV0F 1U0HA 4C11A 2FTRA 2ROGA 4I6WA 4MH8A 4ZP8A 1JLEA 1HNIA 4MIWA 1LV5A 1YITS 1NKBA 3MUMP 2ZH1A 2PI5A 4G1QA 4PAAA 1LW2A 2Z56B 1RLDA 2KT5A 2DJWA 2IM3A 3BREA 2EFVA 3W60A 4DUTA 4FYXB 3QFHA 1RAGB 3U1LA 1Q5VA 4BS2A 2QC3A 2MQ8A 3I0SB 1RDRA 2U2FA 4DG1A 3SI8A 2GNKA 4OI1A 2NLWA 2W8LA 3CCVS 1ZM2A 1LFWA 1RCOB 4AYBD 4N76A 2GQQA 4ECVA 2HQIA 5AJ3F 3K7RA 2V0NA 1YRUA 2VDHA 5JVHQ 3OTCA 4XTTA 2HIQA 4ZLJA 4G1QB 2W9BB 4B3OA 1S1UB 1HD0A 1VRTB 4Q7AA 1HNZJ 4L3KA 1SH2A 1I1GA 2IY5B 1ZBTA 1ZA1B 3AXKA 3QRPA 2KFNA 3J7ZT 2M5YA 4LF4F 1UWBA 1RAFB 5F9NA 5C25A 2KXNB 4LJMA 4I67A 1EQMA 4YB1P 3MI7X 3CC2S 2EK1A 1NH8A 2H5JB 3IWLA 4USKA 2D41A 4B3MF 4W98A 5IZHA 4J9OA 1RWXB 1SC6A 1UVMA 3BN4A 2F63A 3CJ5A 4ALZA 3CNQP 2ZD1B 1RHQB 2E7VA 4X66F 5LL6d 1ZZNA 1B0TA 1LW0B 1S5ZA 2DNLA 2R4FA 3BV8A 3M2UB 1KTVA 3N4WA 5IT4A 3VAGA 2P9GA 3W9HA 2AMCB 2K7JA 1HA1A 1T3OA 1FRLA 2CFXA 2FGCA 2LEPA 2QJ3A 3NGKA 3QLHB 4OZ3A 4EYHB 5D0HA 1MN7A 2ZKTA 1C0UB 2AIRB 3GFHA 3OTEA 3K5LA 3HT0A 4K4WA 4LRDA 3GSDA 4USJC 3PFEA 1G3OA 1EX8A 1ITPA 2QX0A 1IBLF 2EK6A 3EX7B 1ZYQA 4C8NA 4ED1A 1GAOA 3OR1A 2DT9A 4K5RA 2WSFC 2PFDA 2I1RA 5BXIA 1C4AA 1IJFB 2CPZA 2PC6A 2ZNZA 5HK4A 5B0AA 2ZJPQ 4XPEA 4RW4A 3IM9A 2XLJA 4QR0A 1K1SA 4WP8A 3K5NA 2C3YA 4ZP6A 4R8UA 3ZNJ1 2YWFA 2XMWA 3WHIA 3Q2TC 1WOOA 2I38A 3W5ZA 4PG6A 3DHWC 4R5PB 4RW7B 2HNDB 3D1QA 3TP2A 3KK3B 3R1HA 1DFDA 4XDDA 4YB5A 4ENOA 2MHNA 2OLWA 2X3DA 4UOHA 2LXUA 2AV5A 1CC7A 4NYZA 1AB8A 2DB1A 1H2VZ 2NSBA 2V4JA 4IG3A 4O44A 3I5BA 1HIYA 4PPDA 5CHCB 4C3MA 3MM9A 4ZMMA 4QPXA 3NAIA 2GO8A 3P3DA 2ASJA 2K3KA 2QMXA 3KFWX 4FF1A 1J5EJ 5D0RA 1B64A 3TNVA 1S0OA 2BBEA 2DCUB 3MMBB 3NGTA 2PMHA 5L9XA 1NPKA 2R2RA 2FUG9 1U6BA 1O6XA 1U02A 4PR6A 2HNYA 3OT9A 2BVZA 4M5IA 1RWMB 2Z58B 1RT3A 4QR2A 3JTOA 4QBUA 1IBLJ 4DV3J 4B9SA 2VHGA 5KT6A 3U1MA 2L41A 1RE1B 1FNMA 3D2WA 2VODA 4WKRA 3AAWB 1KD1T 1RXOB 1KBRA 3K59A 1C1CA 3S1TA 2OEMA 3DLJA 1TMJA 4AD6A 4EUVA 2MKSA 4PABA 5JVGQ 4LBPA 1IKXB 3M2VB 4DR2F 3R1LA 1ZTTA 1ZAVA 1AZSA 2R3VA 3BGOP 5HATA 3J81U 2JLGA 3NMAA 4CLTA 3HVTA 3TVKA 2XHWA 1AT1B 1X5OA 2XMJA 1RAOA 2WVEA 3CJKA 4ZPCA 1RTHB 2J0WA 4OYMA 5T7LA 5GMEA 4WXWA 4EZ9A 3UDCA 3BO4A 5J1PA 2QLXA 3PHTA 2RS2A 4JI8J 2P2CB 3P96A 2F5GA 2MY8A 4X4SA 2HAIA 2VA2A 4ZJQA 2C2RA 1NLKL 5AE1A 3DOLA 4B3MJ 3RRGA 3KNAA 1S1TB 2OAUA 5E5NA 3HJFA 2KN4A 3D1HA 3OFGA 4LSNB 3UO0A 1PCAA 1D9AA 2LKZA 4CO2A 2Q6CA 5T14A 4K4VA 1FVQA 4Z7CA 1LWFB 1T9WA 2JWNA 2WONA 4LFBF 4OFZA 1NPPA 2F1FA 4PG5A 2R7TA 1VHIA 4CO4A 2ZFHA 3CTRA 2I9SA 1FKOA 1SJ3P 2K3IA 4JI0F 1N54B 3M8SA 5E3AA 4JI1J 2XZTB 3N5FA 4DL0C 1TKTB 2OD4A 1G2EA 4ZPDA 3KJNB 4C98A 4DSJA 1BQNB 3IGNA 1ZH5A 1GXTA 1HWJA 2VL1A 2AD9A 3MXHP 2DNKA 2Z30B 2AF6A 3B4MA 1F5AA 2VJVA 2RMLA 4J9KA 1WI8A 3WIVA 5E41A 2P6SA 4RPFA 3OLBA 1N5TA 2GIFA 2IRXA 2VJUA 4ANDA 3EVWA 4CTAA 1IM6A 1S9EB 1NJIT 1SXLA 1X4BA 1JLCA 4K2JA 4KSEB 3W2VA 2B4UA 4CLKA 1BQNA 2HWTA 3FSYA 3PFOA 4DV1J 5CYQA 2F8MA 2AYMA 5ETVA 1NH7A 4AT1B 5DG9A 4B3RF 1IVZA 4ECXA 2ALYB 3CJ4A 3DRPA 3Q8UA 4PKDB 2JC1A 5DQIA 3GWCA 2BQUA 4C0OC 4A8OA 2MYFA 3OBIA 4ZJLA 4C0HA 4NRTA 4WFAQ 1KS2A 1S12A 2E1RA 4NLUA 3QT7A 3TZXA 2KYXA 2PE8A 4JI5F 3E8OA 5A0YA 3GV7B 2I8EA 1FNOA 2DNMA 2RDDA 1JNRB 2CJQA 2YNHA 3H5UA 5HI7A 3PX6A 4YUDA 1XMOF 3BH6B 4U9RA 2HS0A 2C2EA 2ZH5A 2GMHA 1VRQC 1RA6A 4X66J 4RLEA 2KRBA 1S1UA 1VRTA 2F8EX 3HKWA 3MM9B 3CCLS 1FA0A 5DGAA 4B9NA 3R2CJ 1H73A 4J9UE 1FO1A 3BGUA 3Q8RB 4MK7A 2MKJA 2Y0BB 5GAEU 3PO5A 2E1AA 3BQ0A 2FHJA 3UVJA 2IVMA 4XAKA 2LQBA 3SSRA 3WDOA 2RD5C 3X3UA 2N7CA 5EX3A 4AL6A 2HYIB 4OHVA 4IG0A 3GJSB 3FQKA 3FGVA 3PYDA 2ZD1A 4F04B 2R8KA 1YJNS 3BPDA 4NOHA 4A4JA 4X4QA 3H5YA 1NKEA 3HI9A 5J2MB 4DSIA 2AU0A 2OPPA 1S72S 3CD6S 3MPUB 4DEZA 1UEUA 4LRBA 3H90A 4Y65A 3ZNUA 4PG8A 1FK9A 3JSMA 4DWIA 2MHEA 3VTIA 5FLXU 2YKMA 3Q89A 5LSRA 3B82A 2B4VA 4K4ZA 3IRXA 3M8RA 3GMGA 4KGKA 2UVWA 4C7QA 4J9NA 3K2YA 4C6AA 3F73A 3GU0A 4J37A 3AFGA 2PIIA 3G6ES 4RO0A 2UV8A 1FJ7A 5D3GB 1RT2B 1LW0A 1LWEA 3M2UA 4P7VA 3VQTA 1VQLS 1MMDA 3MZIA 4HHUA 2E5LJ 1UVKA 1Y5LB 1FX4A 1Q0NA 5AXNA 2RUSA 2VFVA 2DNGA 4N5SA 4DR6F 1WOSA 2HNZB 5CYMB 1RT1A 2J7KA 4Z37A 3TEGA 4BLGA 2CZVC 4RW7A 3TJ8A 4DV2J 4DR3J 4NXMJ 5G0RA 4DCPB 1NEEA 2B5JA 3BKUA 3IN5A 4UUWA 3MM6B 1N52B 3UCUP 2HHHF 2E9TA 4JBCA 3AQPA 2V4JB 1UZDA 4O44B 3R5JB 3A3NB 1KONA 3UFCX 1OPIA 4O0IA 4H4OB 5KG1A 3EPIA 4FBUA 3CJQA 2DCLA 2DITA 1SL0A 1T02A 2YH0A 4JI8F 1FJCA 4NASA 4R5PA 1U1MA 2FD2A 3NWRA 1N0VC 2OP5A 4KB7A 2AW0A 2LU2A 2NXJA 1SIWB 4CLLA 1NB7A 1IBKJ 3CCZA 2FGOA 1R43A 3DLHA 1CS4B 5EDWA 1U24A 1CJKA 5DDPC 4IO1A 2ILYA 1R8PA 2QO3A 4WYWA 1B3TA 4ECWA 3DGVA 2EWHA 4RUCA 4RZRA 4OYZA 4UZCA 4LFBJ 2LECA 1YHQS 3E2EA 1EAYC 2MLZA 4OZ2A 2XYHB 4B3OB 4DL3A 1HWKA 2HVDA 3A8KA 3R5DA 4UQGA 2XEXA 5J2PA 4DJBA 3M8WA 4QR1A 1TFYA 3PR4A 1JLFA 2R7QA 3G9CA 1B0PA 4P73A 3C16B 3UNYA 4IRKA 1LXNA 4OX8A 2VICA 2ZBPA 1WC3A 1S4FA 4FYVB 2ZITA 3QYYA 3RW7A 2DIUA 3WC0A 4ZCIA 1YJ7A 1HLWA 4ILMA 2GHWA 3FEXB 3CEDA 2RB7A 4KGXB 4LFCJ 4U6PA 5DLFA 1FDDA 3NBPB 3VCDA 4OI3A 4ZHRB 4DQIA 1NK7A 1WEXA 4LRFA 4YDXA 1UTAA 4TY8B 2GC8A 4QOTA 5F8HA 5F8NA 3DRYA 3AJ1A 3NG8A 4CT8A 3UWTA 2W9BA 3BSCA 2DHGA 2E5IA 2V94A 2H4WB 3CSKA 3TANA 1MU2A 2ZEJA 1BQMB 1NHUA 2MZQA 3MDFA 2XWYA 2HAFA 4YB7A 4C97A 4ZJOA 4ER8A 2J6TA 2GJ2A 2QTWA 3G8TA 4GKKJ 4ERDA 1Q7LB 1REVB 2MKHA 4NLVA 2ZM6J 4K7QA 4YMEA 4LF6F 2X1FA 2ATCB 4ZOSA 2XYGB 1N48A 2J9EA 2M3DA 3AJDA 3EGNA 3QO9B 4K4YA 4BWJA 2PI4A 2CDRB 5E7OB 1TK5A 3QGIA 4EYIB 1WC1A 1HBMA 2C3MA 3DXBA 4YR3A 5B09A 1NDPA 3PRDA 2CXEA 3BPSP 3FBBA 4RNNA 2XNRA 4I6AA 1S1XA 2VG7A 2C2KB 2YKPA 3CJ8A 3U02A 7FD1A 5A2QU 2HHUA 2PFFB 3BBBA 2JLEA 1IKWB 3RBXA 1Q5YA 1TL4A 1RYRA 4JYAF 3W7BA 3QSIA 4B08A 1WF1A 5A8RA 5DS7A 3UD3P 2E7XA 3KLVA 3DOKA 3VF0B 5CCLA 3CW2C 4RW6B 4DR7F 5LXYA 3ZZYA 2ZH6A 5IQ6A 3BJYA 3I6PA 1HR0F 1U8SA 4QIEA 5KFOA 2AEJA 1CBKA 1M5KC 4EGLA 4JI4F 3M9OB 2L08A 2ZDOA 3D66A 2CAJA 2XS5A 4PQUB 5ETPA 3NS5A 4F0KA 4NCBA 4NE9C 4ATNA 2MTLA 4Q8FA 3TI0A 2QE5A 3SIPB 5C24B 5HP1B 1VFJA 4ZA1A 1N56A 2VH7A 1H74A 2OSRA 4H4KC 4H4MB 1YBAA 3D6HB 4MIBA 3NGDA 3SV3A 3A3OB 4QWEA 1VK8A 2W2MP 3OPKA 2O01C 1D9DA 2HS3A 2RHSB 1HQEA 1RA7A 1GNKA 2Y1LB 2X1AA 1M90T 2UXDJ 4BHQA 3O6QA 3TAMA 2W7PA 4Q0BB 2DHSA 1TR0A 1U25A 4DV7J 2UXCJ 2QN6B 1GK8A 4DU7A 3DMJA 3BM7A 4USIA 4ZVHA 3MEGA 2G13A 1NBEB 1U8WA 3AD7C 4FXWA 4NPOA 4EI2A 4M5DA 1CJTB 1YX2A 2CYYA 3MR6A 2RQCA 1CJUB 4K8RA 5I3PA 2YNFA 3OFEA 3M32B 2XWXA 4WP9A 5L39A 1Q82T 4DR1J 1D8ZA 2M9KA 5DETA 3NMRA 1FKPB 3V81A 2LU1A 1RAAB 1HYSA 4FDFA 8RUCA 1LEOA 2CQ0A 1RTHA 3LW5C 4FF4A 4J9RA 4U8VA 3KUEA 1QTNB 2DXFA 5KFXA 2R2UA 2DH7A 5F8GA 5J2MA 1Q8BA 5G4DA 2W4DA 1VJQA 3BBCA 3EICA 3IBCB 2AYGA 2KFZA 1UW9A 5CYJA 3SDEB 5L38A 3W5YA 3CT9A 5J2PB 1W25A 2H1YA 3HDSA 4YN3B 3DNCA 3NCQA 4UY85 4YHHF 1OPZA 4M5GA 3DRXA 4C8OA 5IXUA 2LP4A 2ZBIA 2O66A 4QW8A 4P74A 4R0JA 1VC5A 4DFPA 1NU4A 4G6VB 3OR2B 3H2LA 4OJ1A 3QZ8A 4CLPA 2LQ5A 4IOAQ 1RU1A 4NCGA 3EUNA 1QE1B 4Y2MA 4O3OA 2HLTA 3I87A 5IM0B 3GJRB 4B3SJ 2VDIA 3BYRA 2LYVA 4KY3A 3MURP 1U1LA 2MMYA 2VPWB 5AXKA 1GH8A 2IBOA 3I9ZA 1N6QB 5HO4A 4CDIA 2DD8S 3RBEA 3EGZA 1NUEA 2B4PA 2LQ8A 1HQUA 2CKWA 4IH6A 5J2QA 2RNEA 2MJUA 1S77D 3H20A 3OVAA 2YKQA 3CJ3A 1FXDA 4B9MA 2G9OA 4DUZJ 2KI2A 2DHXA 1HWLA 4CP5A 2C3UA 4E2FB 5H1SV 3HM9A 2N4DA 3MPVA 3EPGA 1NK9A 1FX2A 1Q4RA 3KHHA 4ITSA 1UMJA 2LXFA 2COLA 2CQGA 1W2BR 5KFPA 1L3VA 2UUCJ 2GHPA 3FZ2A 2YPZA 4NL5A 4QIGA 3W9JA 4KAIA 1P9QC 1RU2A 2CQPA 2G0IA 2QSWA 4IDKB 4V1Ak 4NXNF 1V6HA 1BE4A 2RT3A 2HNZA 5CYMA 1AROP 1R31A 1VISA 2A2CA 2B4OA 3CMQA 3W2VB 2QLJB 5DLGA 2IDLA 2IJNA 2AGPA 4QJVA 4NZ0A 4A8MP 2R2SA 2O67A 3LUYA 1WOPA 4Q5VA 3PVXA 1SL2A 3PYGA 4OLOA 3N6NA 2E1CA 3PNIA 5JUMA 3OQ2A 1U2FA 3THPA 2B3TB 3SBMA 2IA6A 1UVIA 2WVBA 1O0PA 1VCTA 3LP1A 5K9FA 3PV8A 4WK3A 1FRXA 1WORA 2CQ4A 2GIRA 1U09A 2KYZA 3IGVA 2IHR1 4CLWA 3A12A 1NHKL 1RWUA 2YH1A 4O3QA 3AODA 2V2QA 4LBHA 5IT9Y 1QDUB 1KTQA 3C15B 1JIHA 5LT5A 4B3RJ 4FYYB 4F0HA 2GVDA 1OY9A 4BDPA 1R0CB 2RUGA 2F4VF 3DI6A 3THTA 4K59A 4URSA 3RTVA 3H0PA 1F9EB 1VQSA 2C2OB 1NDCA 3RR7A 2XSFA 4LF5J 2Z57B 2XLIA 1TL3B 2XM3A 2V5HG 3TZYA 3V6KA 1J5OA 3SZ2A 1RYSA 1KQKA 1TTHB 1T94A 3PEHA 4CM2A 3C46A 1W26A 4UOFA 1T9XA 1UAWA 2PA8D 3I4PA 5J1NA 2J8SA 1REGX 5L8RC 4C48A 3IFEA 2CQ3A 2JL9A 3H2UB 1ZOTA 4PXEA 1PKUA 1UWAA 3PXGa 1EZZB 3M30A 3SCIE 5KFZA 4ECUA 2CPIA 2M0GB 5KG6A 4K4XA 4J9QA 1FK9B 1OJ4A 3W8GA 4ECSA 4IKAA 1J2VA 1ZAXA 4NMLA 3R7SB 2RH3A 5B0GA 3PO4A 1SKWA 2LCWA 1X4DA 3N79A 5CZXA 2JVOA 9RUBA 4M5HA 4F4AA 5CD4A 4B3TF 1CEZA 3A8EA 3H98A 1K44A 1FRMA 2FYXA 2HVZA 2C42A 2XTJP 3BB5A 4G65A 1RT6A 2UV8G 4WE1A 4UY8T 4LMZA 3QT6A 3RB6A 2RVJA 1R8BA 2F8HA 2DGXA 2IRYA 2VFUA 3BGFA 4DXLA 3HT3A 1YJ9S 5U47A 2BQRA 1JKHB 3NNCA 5KT2A 3ADAC 4P75A 2QV6A 3PEJA 3AB2B 2RKIA 3QRQA 2BJEA 2HZAA 2P9EA 4NLXA 2M70A 4F3MA 3BO2A 1TUGB 1PC5A 2CG8A 3ZC4A 4ED8A 3P49B 3Q23A 4PRFA 5EHHA 3OD2A 3CJSA 2KG1A 9ATCB 2D9OA 2DXEA 4UT4A 1VLYA 3HHEA 1XIQA 2DGQA 3EGWB 4UUXA 3TO8A 3OJUA 4UOGA 1F3VA 4U95A 1RP5A 4JI7F 1F5CA 2WBRA 3ILJA 4KBIA 4LBIA 3W2WB 3ZZTA 4KGZB 4W92B 4KHRA 4V19X 2R7VA 2R7XA 1R89A 3MCSA 4OX6A 4OQJA 3TARA 3VALA 1RCXB 5HL7Q 2R2TA 3TX8A 2HHVA 1JX4A 1DTTB 1PIEA 1JLCB 2PDAA 1CC8A 4AE5A 5T41A 2RF2A 1KHVA 1S9GB 3CO0P 4Q43A 1Q53A 2DNYA 2MZSA 5BYSA 3WX8A 5D6GA 4K50A 2FJDB 2KO1A 5AE2A 1FFSB 1XR7A 1OSDA 1QAYA 4MK9A 1KLMA 1ZPWX 3RRHA 4N41A 4ICLA 3UDLA 2O3DA 2MY7A 1UA1A 4Y28C 2V2ZA 2XI2A 2J9DE 4FVMA 4WIQA 5F8MA 2VQEF 4H4MA 5C42B 3HP6A 4Q8EA 2NYHA 5IFMA 3O2IA 3HHLD 4A47A 1MMLA 2UXBJ 4Q44A 4DOZA 1IQZA 4X4RA 2FQQB 2DY9A 1DY3A 3HD1A 2K1RB 3O8WA 1DQAA 1JLBA 1JB0C 4LSNA 5DJBA 4NLDA 2BJ8A 2OGUA 4FP9A 1FRKA 4F7VA 3T1HJ 3RR8A 3TOQA 3UD5A 1YKWA 2DEJA 4HI2A 4C8YA 2NXEA 3Q2SC 4H54A 4BCAA 4F4WA 4P52A 2V34A 1SKRA 2BOPA 2DRAA 1JLQB 4F36A 3V81B 2JEFA 4MIAA 5KG5A 2KM8B 3ITHB 2V2VA 2XMTA 3LGNA 1DQ9A 3BYPA 3HX9A 1RHRB 1FF2A 4A8KA 4LF4J 2ZOGA 1WC6A 5DO2A 3TWZA 2UVVA 2AX0A 4FYDA 3POTB 4G1IA 5BYRA 2G1HA 3RAQA 1IKVB 2HURA 1EB0A 3GG1A 4MKVA 5KFUA 4KPYA 2JRSA 1R7IA 2MSTA 1NSAA 2KZZA 4ETZA 3FDSA 2QL7B 1RGVA 3U1NA 3CJRA 3Q0AA 1IXKA 2H48B 3KK2B 3ONQA 4DFKA 2Y1RI 2YNIA 1FTCA 1UL3A 1RACB 4ID5A 1FCAA 1PYTA 1FESA 1FXRA 3E51A 4JOUA 4B3SF 3NNAA 2OMOA 2YKNA 4OYAA 4ZVEA 1OYDA 2Q6BA 4BWMA 1N32F 1NK8A 1IJEB 1VGYA 2MKYA 2G0JA 3AHPA 2PEBA 3AOAA 3D54A 2AJ0A 4KFBB 2B9YA 3G8QA 4EFAC 2DGUA 4F2RA 3J7AN 5F8JA 4CH0S 1AXQA 3FMWA 2XMUA 1XNRJ 1HNVA 2DY1A 3CCWA 4DPOA 4C4WA 1RI7A 1DURA 3BGRB 4I2PB 2NQPA 2HFVA 2Y8WA 2UVUA 2W2OP 5J1EA 4F3OA 1SJFA 3I31A 2F9DA 3HFKA 2YWWA 3MM8B 2FC8A 3UI3A 2GO9A 4ELUA 1P9YA 5KFRA 2BE9B 1S6OA 4QU7A 3OJSA 1M5HA 1SJRA 2B9XA 4IO9Q 3UD4P 5HAOA 3RYLA 2ADCA 2X51A 1KVJA 3CD5A 2KT2A 5ETQA 3T1YJ 2ASDA 4PCQA 4WTYA 3EZ5A 1S1WA 2XYPB 3D6TB 2GIQA 3GIJA 2W24A 2N4CA 3HVWA 3LP2B 5LMUF 2UXBF 3JTPA 1CQNA 1D0EA 1VS3A 1TL7B 1UW4A 3CGIA 1LWFA 4GO7X 5EWGA 2FLLA 3N5BA 2C22A 4ZVQB 2HSEB 4R8UB 2XY6A 1QLNA 4DR5F 3G4SS 1CS4A 2HGMA 1RHKB 4NYPA 1QJHA 1SIZA 4P9SA 3MCNA 5E3RA 2MZRA 1VQ4S 1N33J 2HKEA 1U4BA 3D4JA 3RW6A 2WBMA 2GFFA 2A18A 2DGWA 4P7TA 3J81Y 3X1LB 1H6KX 2MLYA 1OS5A 3L7UA 4I64A 3S01A 2OEJA 2FJXA 4AFFA 4YR2A 5KFGA 3AD9C 2HMIB 2F4VJ 3EVOA 1XQIA 1WELA 2KVQE 1GXLA 3A8IA 3Q24A 3K5PA 3FSIA 3C2PA 2EPIA 4EO8A 4M94A 2JZ5A 1KDNA 2HWIA 3C6TB 3M9MB 2C3OA 3UDEA 2ERRA 1IBMF 1F3FA 3E3XA 2DR7A 4O0NA 3TA2A 3H2VE 3QIPA 1HR0J 4IYQA 5E2QA 3KDOA 1S7IA 4ZVPB 3IG1A 3MPYA 3CWJA 1NXIA 2ASYA 5H9FJ 3JSMB 4OZ5A 3MGJA 2LQJA 1RT6B 1S76D 4K4UA 4O4RA 3H8YA 4F2SA 1FFWB 5BYQA 4PUOB 2DHHA 2FHOB 5IV3A 1M5OC 3DCAA 2PMZD 2OEKA 5HMXA 3GYXB 3ZTQA 3DRSB 3EMTA 3MEDA 2RE1A 5GVQA 3VHQA 5KFHA 3GYNA 5C25B 4CLUA 3TAPA 4DR3F 2MJNA 4YDDB 2K7KA 4K4SA 4D3GA 5I4MA 2YKNB 1X4CA 4RU2A 1HWIA 3MMCB 3ILLA 1RBAA 1WG1A 3P5TL 2UUCF 3H7HB 5HQ8A 4QW9A 3MFIA 2ZKUA 2MKCA 2DRDA 4RJVA 4ILLA 4LR7A 5CH7B 4B02A 5SUHA 3KLIA 2QEXS 5FIIA 1U1RA 4FF3A 2RKIB 1MLAA 2JX2A 2KL8A 2F65A 3ZTRA 1L5UA 1M5PC 1W7WA 3GG0A 4HACA 5I42A 2YNIB 3OXFA 1IBKF 4HVZA 2BABA 3L3CA 2RQ4A 2YNGA 3C19A 1D9FA 1TVRA 4O3SA 2O1PA 1HHTP 4I69A 1VBKA 1NMEB 1Z4UA 3L09A 5J2NB 2G0CA 3DLEA 3VAMA 2VFTA 4LSZB 4USUA 2FPHX 3T3FA 1V5VA 5EGYA 2HVIA 1IWAA 1TP7A 4MFBB 3F41A 3FEYB 5GMKa 4MAKA 2IJFA 4TU8A 3FCHA 3L9ZA 4OI2A 4LFAJ 1JJ4A 2AZ3A 4FS1A 1S9FA 4Q2LA 1UVLA 2VB6A 1CG2A 5THWA 2QIFA 2UUWA 4DDFA 3TUJC 1KLMB 3CB4A 3H25A 4F26A 3P6YC 2Z2MA 2EXUA 1UPMB 2JLFA 5HMYA 3OTOF 1FRJA 3BZQA 3M8ZA 4MT1A 4OZJA 5A0YB 1KFSA 4LF5F 4M5JA 4N8NA 2Z4PA 2RF2B 4TNOA 3KLEA 1R6YA 2CQCA 2ASLA 2JEJA 5EWEA 5HLFB 2BDPA 3BKFA 3OFHA 2UU9J 2HBQB 4J7CA 4WK1A 4O3NA 2K8GA 2IVFB 1RSCA 5ITHA 3ZZ0A 4DZDA 1NPRA 3GV5B 3FSXA 2MZTA 5CYQB 4U7CA 4DV6J 2C2DA 1VC6A 4J9VA 1N5SA 3FJ2A 3UR3C 1WI6A 4I56A 3ULHA 2OPQB 1JXVA 1RWKB 3A3PB 5IT0A 2ZZTA 2VQFJ 1S0VA 3AH6A 3QAUA 3ENQA 1JWWA 1RAIB 3MM6A 3ZZOA 4YY3J 3US5A 1S0MA 3PKMA 4PWDB 2AP6A 5B7WA 2ADBA 3ICLA 2WW8A 4OI0A 1DZ5A 2XZDB 5DZ6A 2JOQA 3LH2S 1FWLA 2C28A 1E6YB 4Y2CA 1RABB 1G7CB 2MKIA 1XR5A 1U1NA 4DI6A 1X5PA 1Q79A 2QG9B 1WJ9A 2DNHA 1QVGR 1X9WA 5D4NA 1T9YA 3CCES 1ZAWA 1VLOA 1DTQB 3NGRA 1NJXA 1L3TA 3SDEA 2OI2A 4A8QA 4CRJA 4U8YA 4ED6A 2Z2ZA 3VAFA 1XWLA 2A3JA 4KR0B 1QM9A 1WF0A 4IRDA 1XNRF 1Q8LA 1U6ZA 1WSRA 3IR6B 4DPYA 3MR7A 3KJQB 2NR0A 1IR0A 4DR1F 3TW0A 3SYZA 1HWUA 4KIAA 2VFRA 4J90A 5LM7E 3CCQS 4ECTA 1ZETA 2QYCA 2GJIA 3LP0A 1PO6A 3TQEA 2WRMA 1TKZA 4YR0A 3ZZPA 5DDOC 2DR9A 5HN0A 1RWWB 2B9EA 3H5SA 2LDIA 1VIOA 1XNQJ 3MM7B 2OPPB 3H42A 2KHCA 1VJWA 3I82A 1N4LA 1HARA 4RBTA 3M2RB 1R8AA 3T19A 5F3ZA 4X62J 3GJQB 4YP3A 5ETNA 1JK9B 3QBCA 2HQCA 3T41A 4B9LA 5KFEA 5DG8A 4JV5F 4UW2A 2OPSB 3D6FB 3SMZA 3WX4A 3OL6A 4Y0FA 5I3UA 3UNGC 2AGQA 4DL7A 1X5TA 3ZZUA 3B78A 4DSFA 2NUUG 1U47A 1SVDA 2IC3B 3K8WA 3P8BB 3AY0A 4QYZK 3WQPA 3NXZA 3CDUA 4HH1A 3M6UA 4LQ9A 1KKHA 4DF4A 2MEWA 2CJKA 7AT1B 2H4YB 1GFWB 1S99A 2HWHA 2ZVIA 4ZVFA 3HMJG 3Q8QB 1O5JA 2LVWA 1U1PA 2RHQB 3DLLQ 1WACA 2Y1JA 2VC1A 2W01A 2FVRA 1CSJA 5B0FA 3C6UA 2HRTA 4NLQA 4WZQA 2RQKA 1SH0A 2GCFA 2NXUA 2J9DA 3PACA 1IUJA 2CQBA 4JV2A 1RWVB 4WFZA 1PJ6A 2EW9A 1EETA 1Q8KA 2DHAA 1EJ7L 3R6GB 5LMNJ 4JI1F 1S7HA 4LRCA 1T0TV 1X8DA 2QRRA 5D77A 5DGBA 2I2YA 3ISZA 3JQMA 3IC1A 1T3NA 5KFFA 3G96A 1R27B 3JAMY 4LF7F 8ATCB 1ZZFA 2YWKA 1S9GA 3TZWA 3WBZA 4UQTA 5KG0A 4RW6A 3J80Y 3KYLA 3QSYB 4K0KJ 3V4IB 3W65A 2HK2A 1WC5A 2BJDA 4DCOB 2J0QD 3W5XA 2AGOA 3HVTB 4X65F 4CO3A 3S8SA 1JLAA 4R0EA 2J0XA 3MAQA 3D28A 2FLOA 4LVOP 2IFXA 3PRVA 4J9SA 1HNWJ 1S1VB 4RNOA 5IOLA 4OV6A 2B56A 1P8GA 2V2KA 3HSZA 4DLGA 1WSVA 3EM1A 1TL1B 4M63A 3KTQA 1TV6A 2BOAA 4I7FB 2HIYA 3PY8A 3OVBA 1CPZA 1XK8A 2XS7A 2BE2B 1FDNA 2BJ1A 4OYWA 4RW8B 3TUIC 3BGRA 2KG0A 2C2NA 5KFVA 2FVPA 1FKAF 3EZUA 2GQ2A 1KQFB 1T9UA 3I32A 5I3UB 4OHZA 2ZHBA 1R0AA 3MOJB 2XB2D 2WONB 4ED7A 1GX5A 3LP0B 4CIOA 4FZVA 2IC3A 3IRWP 2KRRA 3MR3A 3CJ2A 1F6TA 2AQ4A 4DV2F 1RK8A 2LXIA 4ZHRA 3CJ0A 3KLGA 3AXMA 2J9CA 1SPBP 3MM7A 4NLPA 2AJ1A 3RBZA 4WCEQ 4KPCA 1T9TA 1X4GA 4OYIA 1JJ2R 4AL5A 2HHQA 1MSWD 3R27A 4HACB 4WJBA 2HGNA 3M2RA 3G8SA 3OHBA 4IQXA 2VOOA 1NJWA 4OJHA 2L9DA 3H59A 3N6LA 1UFWA 4NZ6A 1S97A 5KT5A 3LOUA 3MEKA 4WFNQ 1VQNS 4RNMA 3CMAS 1SJ4P 2YQ0A 4RR5A 3NOCA 3DC2A 3D0IE 3J80U 1S6PA 5KFSA 3S7RA 2C1EB 3NNHA 3AA9A 1X4AA 3IR7B 1NSQA 2M88A 1BC6A 1A9NB 2HK3A 2POKA 1F9FA 1D3WA 3HHLB 2OFGX 1BWVA 3LGHA 2BM1A 3LP2A 3ET6A 3CO9A 4RKUC 1S10A 1RTDA 2YY3A 2JNJA 1GTEA 4TY9A 3I0RA 5E3QA 2QLWA 1I5OB 1QSSA 2ROPA 1HBUB 2BR0A 2HFNA 5RUBA 3DXSX 1RBOB 1EETB 3Q8SB 3K89A 4NX9A 3VZHA 1TQLA 5L1LA 1KC8T 3HVRA 2D3UA 2B8PA 2DGVA 1JLEB 1HNIB 1P1LA 2QGFB 3O1LA 1SL1A 3A8JA 1H2UX 3O5TB 4TVAB 5B08A 2RU3A 4X64F 2E5LF 2OTLS 1ULRA 1VQ6S 3AD8C 2H65B 1BGXT 2YWEA 4YFUA 1C1BB 2HQDA 4MMOA 2KFYA 3KNGA 1RTZA 1BLUA 1O51A 3JXOA 4AXIA 1VHFA 2J7WA 3PYEA 3UPFA 1RHJB 2E29A 4KYZA 2LQ9A 2DO4A 3TAMB 5DZ7A 2MB0B 2GJFA 2CWXA 3HCXA 2ZZNA 1NNDA 2EC2A 1X31C 2PO4A 5A76A 2YVSA 4JV1A 1IKYB 1SV5A 2BYCA 3GIRA 4O4GA 3T9NA 1WG4A 3OFFA 2VU5A 1MROB 1MU2B 2V8DA 1UVJA 1UWBB 1NKCA 1XN9A 1VK3A 1X4EA 2BJ3A 2QSFA 1VI7A 2A10A 3EVMA 4OX7A 5FDLA 3NL0A 3C16A 5DDRC 4EBDA 3VAKA 3QJJA 3DRRA 1MWZA 2BKNA 2WAQD 2HBZB 2IAJA 3R6LB 4ZVOB 2HW3A 1Q1KA 3C14B 1NDKA 1TKZB 2YPYA 5HJXA 4CNYA 4DR5J 2X1BA 4CH1A 1OSCA 3DKDA 2ZVSA 3G87A 1YLXA 3GCWP 4DQSA 2M8DB 2E9ZA 1X0PA 3VAHA 2ZH8A 4U96A 4F4XA 4JV5J 2BRLA 5GADI 1YZ6A 2NSCA 3D7SB 1JLGA 1NCLA 3JTNA 2UUAF 3K0JA 4TU7A 1IBCB 1KFDA 5K8OA 3KK1A 4WFXA 1QSLA 3CCJS 5GAGI 3DYAB 4I6YA 2VA3A 4FXVA 2GA7A 2VONA 1NRKA 2OIHA 3CIZA 3PM9A 4Y6IA 5KFQA 4XDCA 5B0CA 2MZ1A 2EKYA 4ZIVA 3QAEA 4LSLB 1V3ZA 1WHYA 2HBRB 3IAS9 1B4SA 1UETA 1RJJA 2L3MA 1UPPA 1I94J 2FY8A 3ISND 3W3SA 2ZE2B 2E9RX 2HHXA 1L3UA 2AJQA 5L1KA 4RNHA 1S79A 1K9MT 2FHMA 2OO4A 2YNFB 3CIMA 4P72A 1GEHA 4S0MA 1RWPB 4CLSA 3DOMA 3RGIA 2N3OA 1UEKA 5H9EK 1RADB 4ILRA 2HG4A 4M5NA 4JI2J 1GX6A 4JI4J 2HQGA 2V4RA 1KWMA 3BQ1A 4IUFA 5AJ3J 1N32J 1J27A 3W63A 2C2ZB 3VAJA 3I9V9 2GVZA 2DNQA 4CLZA 3T1HF 2FJWA 2B5JB 3BBFA 1TU0B 4YY3F 3RBDA 2VUGA 1PAUB 1CQMA 4PG7A 4J9LA 4DV5J 1QAJA 1X4HA 3FBEA 1G4CA 2VG5A 4E0DA 1M1GA 3B8HA 3R5BA 4RW9A 4MKYA 6FDRA 1U48A 1N5YA 3KKFA 4HTIA 1GQEA 3PDNA 1YVFA 3SQOP 4DHVA 4LR9A 2ALZA 1RTDB 2CDQA 2BZ2A 3KG1A 3MCMA 3B54A 3FRZA 4GMKA 1JLBB 4PQAA 3MCOA 3GIIA 3JYTA 5SZTA 2QMWA 3T5JA 3W62A 2ZC4A 2XY5A 1NZ8A 1KOOA 3R3TA 1RBLA 3IAM9 2RDIA 3MM5A 3HHNB 4NLTA 5GAEI 3TEHB 4AQYF 4QU6A 1TL1A 5DDQC 1IKYA 1SV5B 2B51A 2CPXA 2WVFA 5HVFA 3MR2A 2BKOA 5HVGA 2GZOA 3OTDA 2VBYA 1MN9A 3DGPA 2GQCA 4USTA 3UVJB 3H4DA 3WZ0A 2ZUGA 5AE3A 1AUSL 1O8BA 4USMA 1FJGF 2PSZA 3DOKB 1Y00A 4JI7J 4LF9F 4GKJJ 3CDWA 3MD1A 3PHEA 1KNZA 4CWBA 2VOPA 2RRBA 1FE4A 2BE7D 5JJBA 4TXSA 3FZBA 3MEEB 2HHTA 4OYPA 3QO9A 1TUWA 1UFLA 4P2MA 2E7WA 1CJVB 2E44A 2WCXA 3A13A 5KOWA 4IQMA 4WBFA 3O44A 4YOEA 2YWHA 4JI0J 1RLCL 2OUGA 4Y2KA 4BC9A 1AW0A 4FKXA 3VGTA 2CNLB 2N7YA 4KFBA 4DX6A 2XBPA 5KFKA 1VBYA 2ZBRA 3OHAA 3DYAA 1YTYA 4RWXA 2BM0A 1R8HA 3CDBA 4DL4A 3D0HE 1SCJB 3TVZA 1YJWS 4ZK7M 5D15A 3B4DA 5H9FK 4OYOA 4ED0A 2EEYA 6FD1A 3ZZRA 4WTOB 3KLGB 1J5EF 3W9IA 4GVBB 1IN0A 4LF7J 3AA8A 1YJVA 2DR6A 3CXCR 3LAKA 4IR9A 2ABYA 3QJPA 2EFOA 4J91A 4PXDA 3CJTA 3HKZD 1YRTA 2IMOA 1EARA 1NSKL 2JFDA 1U49A 1YG0A 2BXJA 2VV5A 2Y0SD 1H7XA 4NI2A 3P5BP 4DR2J 3OTBA 4XIUA 1N36F 2WK4A 3NEKA 5CQGA 1PYSB 3LF0A 4ZPVR 4JI3J 1IKVA 1K73T 1DTTA 3TAQA 4OHYA 2A2DA 3KK3A 3HFVA 2RILA 5HROB 3SV4A 4ECQA 1XC9A 3UDVA 4A8SA 4O3RA 2AZ1A 3NOGA 3LPYA 5AXMA 4NXNJ 4LVNP 3UR0A 4JP8A 3HLUA 1WKKA 2LLZA 4ZP9A 2Z2LA 3M30B 3I4HX 3SCLE 5LSOA 4OJ3A 2WB1D 1T7PA 4EWTA 5CCMA 1BD6A 4TLRA 3SCKE 2IYIA 3SCJE 2FY1A 3TA1A 4HYKA 1HNZF 3FC9A 5IQQA 2H5EA 4Q0BA 2X3GA 1DLOB 2QA4G 3OSPA 1TZ0A 2OFHX 1KRPA 5HLFA 2XC9A 1L3KA 3SQGA 1NZAA 2DXDA 3Q8PB 3R5AA 5GMDA 3GFZA 1RT5A 2E1MC 3FMBA 1Y3KA 3MOZA 2MGZB 2IM0A 4OIXA 3MMAB 2VKZG 4CYUA 2W25A 2LEBA 1ZS6A 2RQMA 1FJGJ 2CPHA 2XI3A 1RT5B 1VMBA 3MAAA 2RS8A 4YEAA 2MGZA 3QJLA 2VG5B 3EWGA 3I96A 1Q7YT 5JXSA 3PIPQ 1HL6A 5GAHI 4IG0B 3MAAB 3T9ZA 1DLOA 2I5JA 5KG7A 4NA1A 3EJMA 4MJKA 3UN3A 4CO1A 4DSKA 1AZSB 3IWXA 3KXDA 1VQ8S 4ZN1A 4A48A 5DQGA 1P27B 4K2XA 3LP1B 2CIMA 2DRBA 3FK4A 1SJQA 3MHYA 2YX1A 2YBVA 2KJWA 1SKUB 3DOLB 2RSQA 3KJVA 2KTQA 2ZJRQ 1APSA 2ACYA 2W9CA 3M1VA 3UN5A 3IRXB 3V5RA 2I5JB 3NY0A 5E3CA 2UP1A 1R0BG 3A4TA 4ED4A 4TKTA 3THVA 4ECZA 1QUPA 4ES1A 2K2PA 4KKOB 4UTGA 2GMLA 1VR6A 4LIRA 4USVA 5B0DA 5BR8F 2IBKA 1X9SA 4W4MA 4FBTA 1HPZA 5AT1B 4XK8C 3GQCA 5MAOA 1Y7PA 5IWAF 3POTA 2Y1IA 4DF8A 2EBGA 3R5CA 1FFGB 5IV4A 4DFMA 3D68A 3GTYX 2JH3A 2BACA 3J7YU 2KDOA 3W8PA 2DEIA 3E01B 3CCTA 3M6VA 3L4BC 3H5XA 4RUBA 3DLGA 2ZH2A 1ZM4A 3J81j 3QLHA 4DQRA 1G6BA 3V6JA 4QWAA 5LJ3Y 5J2NA 3MMCA 3K57A 3HVAA 1MW7A 3KK1B 2WB4A 4OZ0A 1R3NA 5EUHA 1WG5A 1LWXA 2V8VA 3T5HA 1HBNA 1UJ5A 1VRUA 2U1AA 2XMKA 3NS6A 4G1PA 3N28A 5A6PA 3DDIA 1URNA 5HQLA 2QL9B 3QZ7A 3LWLA 3QNWB 5E0OA 4IR1A 4PUOA 5M2UA 5L46A 3EGVA 1UJ4A 4PWUA 4F8RA 3LO3A 4AL7A 2ILZA 4ZVSB 5EX0A 2Y8YA 4I1TA 3Q86A 4O23A 1CJTA 3QGGA 2LMIA 3KG0A 5KG2A 4HT7A 2VQFF 1P6TA 1TMMA 1T03B 3RG6A 3ITHA 2UUAJ 3GIKA 3DRPB 2HNDA 4JI6J 2OD6A 3R8YA 2BRKA 3AT1B 2MSSA 1YJUA 4JI6F 4DL5A 1MWYA 1MWQA 2GGPB 4IFYA 2R8HA 2IPOB 1HI8A 3KMSA 1LXJA 1RTJA 4C0BA 2D69A 2UU9F 3BH7B 1TL3A 1KR4A 2BW7A 1FHTA 2AJ4A 3I5AA 1HFEL 3RAMA 4F3QA 1VQOS 3FFIA 3UCGA 1WDTA 1TL7A 2DH9A 1X5SA 4M5DB 5F3TA 3JYTB 3L95X 2VZ9A 2YX4A 3RB0A 1S57A 2D1CA 4DQPA 4QYRA 3CJKB 1XTZA 1BWEA 1FRIA 1HHSA 2RIJA 1YRXA 1TELA 3NS7B 3O3LA 2XSJB 4C11B 4G3IA 3AOCA 2P9CA 5CABA 3D1OA 4ZIWA 1VQPS 1RTIB 5DM6Q 2FJVA 3OR2A 1ACMB 4TYAA 4QZVB 1X0FA 1U1QA 4RU9A 4DR4J 1URRA 5ETOA 3OL8A 2AWZA 1HNVB 5DQHA 1LK7A 2CPYA 2EVZA 4ZVRB 5GAHU 2CPDA 1C1CB 4X2BA 2R7WA 2NXNA 1Y11A 2HVEA 4OLPA 1RAEB 1XMQF 2GS8A 5JMNA 2OPRA 3EDQB 3NGSA 2K06A 1DJ0A 3LPEA 4X84A 4C8MA 5C2CA 2BMBA 3PTWA 3OLAA 3W66A 2MKKA 2YWGA 1YI2S 5HVHA 5C7PA 2J0SD 1TVRB 1ZM3A 1X9MA 3NBPA 1HBMB 1YWXA 4X4NA 3GB0A 4AUKA 3BQ2A 1HNWF 4WE1B 1S6UA 3LAMA 2PA3A 2JC0A 1XMBA 4P71A 3KHRA 3UQSA 1VOMA 1XBWA 3WIUA 1AUDA 1M0SA 2XZWA 3KLIB 3OTOJ 4L72B 3VVUA 3HPOA 1S1TA 3ZFVA 3HK2A 2CRLA 3C14A 5FJ4A 4LSLA 1N88A 2IYGA 2QYGA 3ILOA 2J8AA 4NA2A 5HMWA 1UCNA 3MEDB 4HEA9 1OQ3A 4ZITA 1N34J 1FERA 2JDJA 3CCMS 2Q66A 1KP6A 4LFAF 2HQ3A 4B9TA 4KV8A 1NM2A 3UE2A 1B99A 3DOMB 3KLHB 4DPUA 1YQHA 3PYFA 3GV8B 1I3OB 1YJRA 2W8KA 1XR6A 2HQFA 4B3TJ 2YQ1A 3KJFB 4H4KA 3SSQA 4DU8A 2VC0A 1NK0A 2BJ7A 4P10A 1S4EA 1T95A 2B43A 2EFGA 2V6AA 4F02A 4P6QA 2NZ4A 3IR5B 1TK8A 1N0UA 1PJ5A 3CCSS 5KFTA 1KSPA 5F8LA 5L1IA 4EU0A 4KV8B 3KLHA 3G2XA 4X4UA 2P8IA 2NREA 4GRSA 4URQU 1S1VA 1FD8A 4WWSA 3UN2A 1EHWA 2G2ZA 4X65J 2J76E 3ZTPA 4DV4F 3G6YA 4F50A 4ECYA 4DV4J 1S59A 1EP4B 4CLYA 5LOQA 4DR6J 4OZNA 2V69A 3D3BJ 4XPCA 4DUYF 4CNZA 4GKKF 3IBFB 4LF1A 1YDLA 3RRKA 1SB6A 3NP5A 4DPWA 4ICLB 2YXLA 3V2UC 2G4BA 2MQPA 4BBYA 3TA0A 1KQSR 4MKBA 1CJUA 1HQ2A 3IS9A 5LMNF 1OWXA 1HQEB 4QYZJ 2W2QP 1KVKA 1X4FA 3GR0A 4KH0B 4ZCMA 1FRHA 1K47A 3OXLA 1NB2A 5IS2A 3I5CA 2KZMA 1TK0A 5BJRA 3M8YA 4M95A 3OL7A 2GGPA 4IFYB 2HGLA 3JS9A 5HBMA 2CJAA 5ETMA 3R9LA 3CUNA 3HO1A 3P45B 2GHVC 4OMFG 2LEAA 1C0TB 4LREA 1WF2A 3BSNA 3VGSA 3CD7A 1RT7A 4QWCA 1JJCB 1FDAA 1S1WB 3CC7S 3S6EA 1UVNA 1Q78A 2K1RA 3EXYA 3IS9B 4B17A 3BSAA 2EFQA 3FQLA 1BQMA 3V6HA 3TJ9A 2QFJA 1H7WA 1C0UA 1T05A 5K14B 1SI9A 1DQ8A 5HQMA 4JI2F 5MLCV 2CQ2A 4WYLA 2DGOA 2XY7A 3VVTA 1F0XA 5A8KB 1KN6A 2ROEA 4ID5B 5KFBA 2QLBB 4WP3A 2W4PA 4L3NA 5IC6B 4DBQA 3ENAA 1RTIA 2NUHA 1HI1A 4URGA 3BF4A 2LA4A 3PW5A 2HHWA 3F56A 4FPRA 1SQFA 2DYAA 1VQ7S 4C8KA 4NCAA 3JAMU 2FLPA 3K5OA 3HJVA 3HSDA 4YB6A 2QL5B 3BKTA 5K5MA 1XMQJ 1WC4A 3DLGB 1JKHA 4QWBA 1WHVA 3I56S 3M7VA 5IWAJ 4GVLA 1Q86T 3CE8A 5HSPA 1SJ1A 5M2PA 3VV2B 1X60A 3ZXWA 3NRBA 4DV6F 3CD0A 3KUHA 1YSJA 2ZH4A 1FVSA 2XNQA 2HHHJ 2IRUA 1IM4A 4EMDA 1HPZB 2XGQA 4GC7A 4FF2A 1D8YA 3QT8A 2DTJA 4I7FA 1Q95G 2KXHA 3DDKA 4P2SA 5J1EB 1YK9A 4K5SA 1LK5A 2ZE2A 4ANEA 1UKUA 1V3RA 2B7CB 3HULA 4PYAA 4WU3A 4ZLNA 1F2HA 1H3DA 1UEVA 5HMZA 5L1JA 2EG1A 3MMJA 1HBNB 3DU6A 4UOCA 3HSJA 2DIVA 2FVCA 2ZOFA 4N77A 3V6DA 1S0NA 1I6JA 1QVFR 3CCUS 3G86A 2GMJA 4F4ZA 4PXBA 3J7Z5 4A46A 3U27A 1ZPVA 4E98A 3DU5A 2ATLA 1M1HA 2YNHB 3W61A 2FZCB 4OJGA 3GFYA 3CCRS 4ZS6A 3VGVA 1TV6B 2HZVA 3HHLC 2XCPA 1OY6A 2W2NP 1XNQF 4QIFA 1XEZA 4DMZA 2BANB 2PN6A 2CNOB 3OSNA 1U2CA 4L76A 1XMOJ 1FEEA 2V50A 2L9WA 3AB4B 3C15A 4RW8A 5K8PA 1I94F 2UXDF 2W7AA 1PJ7A 5K14A 4N56A 3M1VB 3Q22A 1OY8A 4HTJA 3MAHA 1NHVA 2JEIA 2LFVA 1CVJA 2VPXB 3R97A 1CJKB 4DL6A 4QWDA 1VIXA 3T6BA 3DFEA 3TR5A 4ECRA 4X64J 3VWSA 1T03A 4NEZA 5D4OA 1S6QB 2YKOA 1GT8A 2RJZA 3N01A 4M5KA 3NGUA 4LIWA 2FJEB 1PILA 4A8YA 3MTKA 2ZWPA 3KUGA 4ZCLA 2I0XA 2VPYB 4B9UA 3ZZZA 2EG2A 3F44A 5M2RA 4KQZA 4AXJA 4DX5A 5ETSA 4L73A 3KHGA 1GTHA 3QFWA 4DPXA 5KFCA 2W9CB 2KU7A 1TKXB 3D5MA 4LF2A 4WPAA 3CF5Q 2A1BA 4RX6A 2CPFA 4L75A 4WU2A 3TJAA 3MR5A 4ED3A 2DPJA 4LF8F 1GMWD 1XJWB 4IH5A 4JI5J 2V8GA 3PR5B 1QE1A 5IM0A 2DNZA 1C0TA 1JXEA 4Y3CA 4MFBA 4CO0A 2B0GA 3FCVA 2VG6A 4R25A 1JJHA 1RT2A 1NDLA 3SFGA 2OMLA 3M2VA 3FEZA 2Q1LA 2EFPA 2LA6A 1KEKA 2F3JA 1U1OA 1YJTA 2JHEA 3HHKA 3ZTSA 3FUYA 1C4CA 1VQ5S 2OPSA 1H2TZ 2UUBJ 4KGVB 5EN1A 1U45A 3KWMA 1YGYA 1AYEA 3NCRA 4A8XA 3LA0A 1NK5A 4A8FA 2V9KA 3HZEA 4USHA 4CT9A 2W9AA 1N8RT 2V68A 4XO0A 2B9WA 3ZO7A 2HFSA 2ZHOA 5LJ5Y 1HHQA 1M5VC 2DKOB 4JI3F 3MWBA 1ZM9A 3SXLA 2A6OA 1F5BA 1D1UA 5H9EJ 3BDPA 1A6LA 1RHUB 3LALA 3GP9A 2ZH9A 4X4VA 2VPZB 3CDEA 4NYOA 1Y3JA 3FVYA 4P2FA 4CI0B 1TAQA 2XG8A 3MUTP 3GSIA 1QAXA 4NEYA 1NJZA 2A6MA 5EWFA 4LFCF 2AT1B 4E8UA 4CTAB 2KM8C 2V8HA 5DM7Q 2N82B 1VQYA 3DM2B 2HFUA 3OUYA 2AEFA 2O5DA 3DMJB 3CC4S 2QA4S 1VRUB 5DG7A 4DPTA 2FJAB 3M9NB 1EIYB 2OHDA 2KHDA 2XMMA 1PBAA 3JSBA 3NWGA 2PGCA 4ES3A 2GVDB 2C3PA 2RDJA 1U26A 1KLNA 5F0WA 3T6JA 2SXLA 4GO5X 4N8OA 4OX9J 1Y9OA 4LT6A 3C6TA 4F25A 4X4OA 4DLEA 1QAIA 3V6DB 1JLFB 4KHPF 4DS5A 3N9UC 1N33F 3PW4A 2V4QA 3DI6B 4U67Q 3Q8YA 1M5SA 1IR2A 3A1YG 3SQGB 3HHDA 2CADA 4CZCA 3KLEB 2JVRA 1P1TA 1NK4A 3UW1A 2KT3A 5ETTA 1N5YB 3R2DJ 4Z7YA 2A0FB 1DAXA 3ETOA 1WHWA 2WOMA 2B7BB 3DRSA 2DBBA 4NLYA 5LXRA 1ZTWA 4ZN3A 1WEZA 2XULA 1HW9A 4NLOA 4GC6A 4NXMF 2GVZB 1W2IA 4CQ1A 3MEEA 3TZZA 4M1KA 3KLFA 3QGHA 3H4BA 3AJ2A 1WEYA 1PG5B 1WKLA 1E6VA 1FKOB 3LQVA 4I0WA 1S6QA 3TRGA 4CM0A 1SC1B 2MQMA 1RHMB 1ROFA 4MTPA 2UUBF 3CULA 3QT5A 2R7RA 2G1DA 3LANA 4MKAA 2ZOMA 2CA9A 3P4UB 5CA5A 3KHLA 3PX4A 3OR1B 3DGPB 4DX7A 1HQUB 5J2QB 3MTJA 1VDHA 2DNNA 2YKMB 4TQSA 4TU9A 4RW4B 2R8IA 2HHSA 1HBOB 1GXUA 4N7TA 2I6WA 1FD2A 1PBUA 5A8RB 4EO6A 3VQSA 3MM5B 4LF9J 4GKJF 1FEHA 2CG4A 1NAQA 1QD1A 4I2PA 4I2QA 4RNFA 2FHJD 4TY8A 3QWUA 3KOAA 2AX1A 3PZPA 2E5JA 2HRYA 3MUVP 1Y5NB 1JNZB 2VQEJ 5LMUJ 5CAAA 4W90B 2E66A 2OELA 1OO0B 1HNXJ 1IKXA 1GMWA 1WTFA 5E3PA 2KB2A 1RQ0A 2AJFE 2H51B 5F8IA 2XS2A 4MYUA 2YNGB 3DHXA 3IO1A 3C66A 3JB9k 1DHMA 1V9OA 4DS4A 2VBWA 4WXOA 2XCAA 4OHXA 2HLUA 3ENVA 4WF9Q 3U7JA 1Q16B 3VR1A 4BC7A 3BO3A 4ELVA 2DPIA 2VBXA 2MQNA 1QTMA 3OV7A 1NSPA 1S1XB 2VG7B 4Z2XA 4A8WA 4NWBA 5D0EA 4X62F 4DUZF 3QRRA 7FDRA 2P5VA 3FBCA 2F9JA 4FN5A 1VQKS 1OQ6A 1MROA 3K5MA 2KXFA 5CZVA 2C2MB 3LTOA 4WKYA 4RWWA 5L9NA 5IT9U 1FKPA 1SC4B 3PW7A 1QUVA 3K8VA 1JMTA 1R8CA 2FVQA 3I0SA 4ZP7A 4I4BA 1B7FA 1OIAA 2YTCA 3ELHA 1U6FA 3M32A 4ETXA 3N0VA 2MQOA 3EDRB 3MMBA 1UP1A 4L74A 4F4KA 5ETRA 1R0AB 2X7IA 2FC9A 5C42A 4DV7F 1VBXA 3DDNA 2UXCF 4KJIA 1RT3B 4YHHJ 3KMQA 1CJVA 3GE9A 3GZ7A 4PYDA 3NAHA 5KFWA 5KT7A 1FTRA 1IR1A 1SH3A 1U7LA 4EZ6A 2DH8A 2JJ4D 4OHWA 2HVHA 2VASA 3LWMA 4RW9B 3VAIA 2IM1A 3BR8A 5KFAA 2OPQA 4NZ7A 3PIOQ 5D4PA 3V4MA 5KT4A 3DRRB 1K0TA 1PGZA 1VYAA 3QATA 4QQBA 2ZUAA 4D3HA 2CQHA 2VIHA 1YBUA 2CUYA 4ID8A 3UCZP 1HBUA 1V3SA 2IMWP 1PSDA 2OH2A 2JSXA 3IG1B 2FJBB 4ZVGA 5KFJA 4HH0A 3JSRA 2H5IB 1UFKA 2MDAA 5D3GA 2QA1A 4PQUA 1DRZA 2JEGA 3D6MB 1YBTA 3BN7A 5KG4A 2CWKA 2KH9A 1IKWA 2LDYA 2AJ2A 1VQMS 3FKBA 2KJVA 2YX7A 4OYXA 2ZWOA 3JQJA 4UF4A 2HBYB 4DX8H 1REVA 3RU0A 4J9MA 2J6UA 1LKZA 1WKJA 2N3LA 2ZBQA 1CULB 4KE5A 5CD4H 3MM8A 4QIVA 1TUVA 1K8AT 4C9DA 4WZMA 2E1PA 3PJXA 1ZA2B 5HROA 3LGMA 3M4XA 2DGSA 4WFYA 3SSSA 4YQWA 4ZCKA 3EZOA 3D9BA 1N6QA 2J5AA 4ZDNA 3T5LA 1B70B 3DLBA 1RKIA 3W1YC 1LNQA 1U0SA 1SUQA 1Y4ZB 3ISNC 4QPTA 5D78A 3SFUA 2RAQA 1JLGB 2DNPA 3ETMA 5I42B 2EFNA 5A8WB 4RUAA 4CLFA 2NZCA 4L6V3 3GIMA 2XO7A 2NYIA 1Z2ZA 2YKAA 2HS4A 4KH1B 1S6PB 4OV1A 3G82A 5AXLA 5A8WA 2R9LA 4DL2A 4KRWA 2OTJS 2MPUA 1HKAA 3CMES 2CZ9A 2VFSA 3BEGB 3NCPA 1Y5IB 2NS1B 1U2RA 2WSCC 1F1BB 4KO0B 4ELTA 1G1XA 2D3ZA 3BS9A 1LWEB 3RUBL 1KVIA 2CJ9A 4ZPWR 1EKSA 4Y34A 3ENWA 4ZLPA 2QMUB 2RRAA 4KHPJ 2AKWB 3ET6B 1FXLA 2IM2A 2HEKA 2D74B 4OI6A 3L7PA 1Y0HA 4NMXA 1N34F 1C2PA 4TQRA 1RWNB 1IQTA 4ZLLA 2BV3A 1WC0A 2DNOA 2QFIA 3AOBA 3GJTB 1EQ0A 5ADZA 2YQ3A 1JLAB 3TX0A 2PEHA 4KHMA 3DN9A 4JV0A 3OVSA 2D7SA 1Z1ZA 2DO0A 3ILIA 1FWPA 3M6WA 3MD3A 3BSOA 2G2OA 1MNEA 4FVCA 3QIPB 4J5OA 5KFMA 3R7BB 1H0HB 3PKYA 2ZM6F 2OJ3A 1Q8IA 2DNRA 1CLFA 1PC4A 2FHKA 1S9EA 2IVYA 2V63A 3MECB 1BMQB 1OYEA 2AEMA 5HJYA 2P6TA 2XSJA 4QIWD 1WHXA 2HMIA 4DFJA 2HZCA 3CDAA 4CO5A 4X4TA 1WWHA 4PXCA 4PPZA 3SEOA 4JUZA 4HLBA 2ACMA 4MYTA 4B9VA 4ZPTR 1ELOA 2R7SA 2W1BA 3JQKA 1E6VB 1SKSA 1JXLA 3OXGA 4RL1A 2MLXA 2DGTA 3QQCD 3MPWA 4DR4F 1NO8A 3EXCX 2NXCA 4O4GB 1RWOB 2XGPA 2ZC3A 3RAXA 2QLFB 1TFWA 4ES2A 2QT7A 2FIUA 3GR1A 2L9NA 1ICEB 5A2QY 2EI5A 2BE2A 2WOMB 1JLQA 4HL9A 4NLWA 4Q2MA 4TYBA 3C3LA 4LQ3A 2GAHC 1OMSA 3N6MA 4M5MA 5B0EA 4DQQA 1K0VA 4NLGA 3HF5A 5F9LA 1MG7A 2R7OA 4QCLA 1TAUA 3IM8A 2AHOB 4EEYA 4FS2A 3K58A 1RTJB 2DISA 4CH7A 1BHNA 3W64A 4I2QB 3EYZA 2XMAA 3W2WA 1EKRA 3G71S 2D3OR 2AYBA 3KJVB 4PWDA 2KVIA 3HXMA 4IRCA 5KFIA 5B0BA 1HBOA 1SC3B 4H4OA 2M4MA 3TVYA 2UZAA 1X7VA 1HMVB 2W4CA 4IFVA 1WUUA 4LF8J 4OZ1A 2HFOA 2VG6B 3QGPA 2PD1A 3T1YF 1FNXH 2WSEC 1IBMJ 2M2BA 3MF5A 2CQIA 4ZVUB 5KT3A 1T9VA 2MQLA 4PEOA 5C5JA 5CXTA 1KOHA 3NLCA 1RT1B 4ZPAA 4Y00A 1M1KT 2GX8A 2DR8A 2GW8A 2MXYA 2Z2YB 3K17A 1LQ9A 1DARA 2GAGC 3GFXA 4C8LA 4K0KF 4C2MA 1GMUA 5KFYA 4IH7A 3M05A 5K20B 3FRYA 3T5KA 4ED5A 4V19J 4CCHA 3OUYB 4FNIA 1HNXF 2RRNA 3J7A1 4KT0C 1U1KA 3RJMB 4U7UD 4OI4A 3HHLA 1T11A 2GV1A 3DLKA 5F41A 2H3EB 4DN0A 3ZTOA 3H40A 3RB4A 2R8JA 1LW2B 4ZPBA 1QY7A 4NI2B 2XO6A 2CNKB 1NJYA 2E5GA 4Y2AA 1FI4A 1RAHB 3PW2A 1K1QA 2DVIA 1HYSB 2RU9A 4KC5A 5D0GA 4UZBA 1S48A 1U0HB 1Z2LA 3C8YA 1SBRA 2B6AB 3M8QB 1V5IB 5ETLA 3D3CJ 4OYBA 1YZ7A 2BX6A 1LFPA 4TN2A 3TYTA 2CZ4A 4NLRA 1UZHA 5KOXA 2Z8QA 5F0UA 3V4IA 5BR8J 3DLKB 3DM2A 2H9ZA 1WNEA 2BJ9A 4FKYA 1RAJA 2CPJA 3IMQJ 3IXQA 3PJ9A 4RBVA 4ZVTB 4Q45A 1Q81T 3PX0A 2ZJQQ 3IWNC 4HI1A 4IG3B 3RB3A 2B6AA 3M8QA 3NKYA 2ZHAA 2WTFA 4DV0J 1E6YA 1J5OB 2R7UA 4K4TA 1HD1A 3MPDA 1S49A 5D8HB 2IA0A 2D9PA 2W7OA 1VQ9S 4PG4A 2FZGB 1BQXA 4EK2A 4LF6J 4CYUB 4FPIA 3E01A 1XERA 4FNHA 3GCXP 4X4PA 1HW8A 1SQEA 3D0GE 1MMNA 3QIDA 4PWWA 3B6BA 4U7UK 1Y10A 2J6SA 1RUSA 3PG9A 4HDGA 2X1GA 2FLNA 5A8KA 1DTQA 2QA2A 4HR2A 1R6VA 4USWA 3QWPA 5FDLB 4DCJB 4HT5A 1H38A 1TKTA 1QSYA 4DR7J 4DSLA 1RT4B 3GYGA 3M6XA 4ZKAA 1FT8A 1B7YB 8AT1B 1TKDA 1L3SA 4HKQA 3M8PA 5GADU 3PW0A 1T8EA 1F9HA 2Q79A 2NPFA 2IIHA 3IP0A 3PCOB 4NCGB 5KFLA 3KLFB 1NK6A 3MMAA 2ZDPA 4M8LA 4LR8A 4NLSA 5FLXY 3I55S 2CJBA 1H72C 5GAGU 2QZ8A 1RZMA 3F0NA 1HMVA 2M52A 4IFVB 4ANCA 2VF3A 4LUBA 3RZAA 5C2GA 5KTQA 1FE0A 3J7YI 5T7LB 4DUYJ 3HD2A 4DV1F 1RT4A 3GONA 4OX9F 1N5QA 2HPUA 3OW2R 3HFZB 5LSLA 3TUZC 2EKNA 2PMWA 2M8HA 4F0MA 1EP4A 1RISA 2APOA 3HSGA 5D4LA 4NRUA 1TL5A 2FZKB 5I3QA 3Q83A 4GVBA 3Q8VA 1WD6A 3FBFA 3IBWA 1A7GE 2FB0A 3L7OA 4M5LA 2CJXB 4IDKA 2UUTA 4WIIA 1PYOB 1N36J 4KTQA 5IC4B 3R7NB 5KG3A 2VKRA 2R8GA 1AA1B 1H98A 2DR5A 3G6VA 3I0RB 4DN9A 4ED2A 5K8NA 4JYAJ 2JFKA 4WFBQ 4DG1B 2Y3YA 2CVEA 1AFIA 2WHOA 2WZ1A 4KO0A 2Y9HA 4HHJA 2M7SA 4O3PA 2E5HA 3G82B 1FDBA 2F40A 4NA3A 3PRBA 1BY9A 1FJEB 3KDNA 2CQ1A 1DBDA 3TUPA 2BANA 2HNYB 1PAEX 4I68A 4DV3F 3IA0A 1WTBA 2BW2A 4F4YA 2BQ3A 2ZZMA 4DZ6A 2J7UA 3T1AA 5K8MA 5KAKA 3KK2A 2XLKA 4LRAA 2D3O1 1VC0A 1LWCA 1F60B 2W2PP 1UJ6A 4Y2IA 1F2GA 2CVIA 1LWCB 1UA0A 4RUHA 1D09B 3BR9A 5HANA 2CJYB 5HP1A 4C8ZA 4TLQA 4KKOA 2BUNA 2V67A 6AT1B 3CPWR 2OKQA 2Q3PA 2ZBCA 1SQGA 4OL8A 2DK2A 3GILA 3R5GA 3FNNA 3GLJA 2HFZA 5FD1A 2MZJA 2MQQA 2HHPA 1IWGA 1A0OB 2F4FA 2IAJB 2R42A 4C3KA 2WW4A 3MEGB 2Z0GA 2BA9A 2CNNB 2FDNA 2Q43A 2PT0A 3QMQA 1RB0A 4RBUA 4YS2A 1GMVA 2AYEA 4IOBA 2KKHA 1N5VA 2IJRA 5E33A 5HBMB 3KG4A 1KQGB 2L48A 3M8PB 2V9WA 1FWKA 4J9PA 1T05B 3BDEA 5DRKA 4C3LA 2ZH3A 1RT7B 2H54B 3GPAA 3EE3A 3JSYA 3FCWA 2NCKL 4JB8B 5ETKA 1HI0P 1TKXA 2BEFA 2VBZA 3FFIB 3G6XA 4N47A 5G0RB 2NPIA 2B8QA 3AQOA 4KGMA 1SUQB 4FYWB 4P2XA 4MK8A 1BXNA 3VGUA 3BGLA 2XQCA 1RKJA 3WC2A 2EC0A 1YIJS 3HZGA 2F7VA 2HRUA 4DV5F 2UVRA 2EBEA 1LOUA 2XMVA 2WVDA 3OL9A 4EBEA 4IOCQ 3PJWA 3MFHA 1BUXA 1CULA 5KFDA 4F67A 4FXDA 2ZNYA 2XHCA 2VD3A 1JQGA 4PZVA 2ZH7A 1KHWA 2WVCA 2OPRB 1WDDA 2CPEA 5A6WA 2OSQA 1I51B 3D67A 5C24A 2FVSA 3MECA 4HDHA 1B0VA 3C6UB 4OZLA 3DLEB 4HHHA 3VZIA 3QPIA 4AQYJ 3CVKA 2BKPA 1VBZA 4EBCA 2CQDA 2IDEA 2G2YA 5KFNA 4DSEA 1C1BA 3TQ1A 1AFJA 2V8PA
chains in the Genus database with same CATH topology
4DV0F 4C11A 2FTRA 2ROGA 4I6WA 4MH8A 4ZP8A 1JLEA 1HNIA 4MIWA 1LV5A 1YITS 1NKBA 3MUMP 2ZH1A 2PI5A 4G1QA 1LW2A 2KT5A 2DJWA 2IM3A 3BREA 2EFVA 3U1LA 4BS2A 4DG1A 3I0SB 1RDRA 2U2FA 3SI8A 2GNKA 4OI1A 2NLWA 2W8LA 3CCVS 1ZM2A 1LFWA 4AYBD 4N76A 2GQQA 4ECVA 2HQIA 5AJ3F 3K7RA 2V0NA 1YRUA 5JVHQ 3OTCA 2W9BB 2HIQA 4B3OA 4G1QB 1S1UB 1HD0A 1VRTB 4Q7AA 1SH2A 1I1GA 1ZBTA 2KFNA 3J7ZT 2M5YA 4LF4F 1UWBA 5F9NA 5C25A 2KXNB 4LJMA 4YB1P 3MI7X 3CC2S 2EK1A 1NH8A 3IWLA 4B3MF 2D41A 5IZHA 4J9OA 1UVMA 1SC6A 3BN4A 3CJ5A 4ALZA 2ZD1B 4X66F 5LL6d 1ZZNA 1B0TA 1LW0B 2DNLA 2R4FA 3M2UB 3N4WA 3VAGA 1KTVA 5IT4A 2P9GA 2K7JA 1HA1A 1T3OA 1FRLA 2CFXA 2FGCA 2LEPA 3NGKA 3QLHB 4EYHB 4I67A 2ZKTA 3GFHA 1C0UB 3OTEA 3K5LA 4K4WA 3GSDA 4USJC 3PFEA 1G3OA 1IBLF 2EK6A 3EX7B 1ZYQA 4C8NA 4ED1A 1GAOA 3OR1A 2DT9A 4K5RA 2WSFC 2I1RA 1C4AA 1IJFB 2CPZA 2PC6A 2ZNZA 2ZJPQ 5B0AA 1GH8A 4XPEA 4RW4A 4QR0A 1K1SA 3K5NA 2C3YA 4ZP6A 4R8UA 2YWFA 2XMWA 3Q2TC 2I38A 4PG6A 3DHWC 4R5PB 4RW7B 2HNDB 3D1QA 3TP2A 3KK3B 3R1HA 1DFDA 4XDDA 4YB5A 2MHNA 2OLWA 2LXUA 2AV5A 1CC7A 4NYZA 2NSBA 2DB1A 1H2VZ 2V4JA 4IG3A 4O44A 4PPDA 3I5BA 5CHCB 4C3MA 4ZMMA 4QPXA 3MM9A 2ASJA 3NAIA 2GO8A 3P3DA 2K3KA 2QMXA 3KFWX 4FF1A 1B64A 3TNVA 1S0OA 2BBEA 2DCUB 3MMBB 2PMHA 5L9XA 2R2RA 2FUG9 1U6BA 4PR6A 2HNYA 2BVZA 4QR2A 4QBUA 1RT3A 3JTOA 4B9SA 5KT6A 3U1MA 2L41A 3D2WA 1FNMA 2VODA 4WKRA 3AAWB 1KD1T 3K59A 1C1CA 3S1TA 4EUVA 3DLJA 4DR2F 2MKSA 5JVGQ 1ZTTA 1IKXB 3M2VB 3R1LA 1ZAVA 2JLGA 3NMAA 3HVTA 3TVKA 2XHWA 1X5OA 2XMJA 3CJKA 4ZPCA 1RTHB 2J0WA 5T7LA 4WXWA 4EZ9A 3UDCA 3BO4A 5J1PA 2QLXA 2RS2A 3P96A 2MY8A 4X4SA 2HAIA 2VA2A 2C2RA 5AE1A 3DOLA 3RRGA 3KNAA 1S1TB 2OAUA 5E5NA 3HJFA 2KN4A 3D1HA 3OFGA 4LSNB 4CO2A 5T14A 1D9AA 2LKZA 4K4VA 2Q6CA 1FVQA 1LWFB 2JWNA 2WONA 4LFBF 4OFZA 2F1FA 4PG5A 2R7TA 4CO4A 2ZFHA 3CTRA 2I9SA 1FKOA 1SJ3P 2K3IA 4JI0F 1N54B 3M8SA 5E3AA 3N5FA 4DL0C 1TKTB 2OD4A 1G2EA 4ZPDA 4C98A 4DSJA 1BQNB 3IGNA 1ZH5A 1GXTA 1HWJA 2VL1A 2AD9A 3MXHP 2DNKA 2AF6A 3B4MA 1F5AA 2RMLA 4J9KA 1WI8A 5E41A 2P6SA 3OLBA 1N5TA 2IRXA 4CTAA 1S9EB 1NJIT 1SXLA 1X4BA 1JLCA 4KSEB 3W2VA 2B4UA 1BQNA 2HWTA 3FSYA 3PFOA 5CYQA 2F8MA 2AYMA 1NH7A 5DG9A 4B3RF 4ECXA 3DRPA 3CJ4A 4PKDB 2JC1A 5DQIA 3GWCA 2BQUA 4C0OC 4A8OA 2MYFA 3OBIA 4C0HA 4WFAQ 4NRTA 1KS2A 2E1RA 4NLUA 4JI5F 2KYXA 2PE8A 3E8OA 5A0YA 3GV7B 2I8EA 1FNOA 2DNMA 1JNRB 2CJQA 2YNHA 3H5UA 5HI7A 3PX6A 4YUDA 1XMOF 4U9RA 2HS0A 2C2EA 2ZH5A 2GMHA 1RA6A 4RLEA 2KRBA 1S1UA 1VRTA 2F8EX 3HKWA 3MM9B 3CCLS 1FA0A 5DGAA 4B9NA 1FO1A 3BGUA 3Q8RB 4MK7A 2MKJA 5GAEU 3PO5A 2E1AA 3BQ0A 2FHJA 2IVMA 4XAKA 2LQBA 3SSRA 3WDOA 2RD5C 3X3UA 2N7CA 5EX3A 4AL6A 2HYIB 4OHVA 4IG0A 3FQKA 3FGVA 2ZD1A 2R8KA 1YJNS 4NOHA 4A4JA 4X4QA 3H5YA 1NKEA 3HI9A 5J2MB 4DSIA 2AU0A 2OPPA 1S72S 3CD6S 4DEZA 1UEUA 3JSMA 4Y65A 4DWIA 4PG8A 1FK9A 2MHEA 3VTIA 2YKMA 5LSRA 3B82A 2B4VA 4K4ZA 3IRXA 3M8RA 3GMGA 4KGKA 2UVWA 4C7QA 4J9NA 3K2YA 3F73A 4J37A 2PIIA 3G6ES 2UV8A 1FJ7A 5D3GB 1RT2B 1LW0A 1LWEA 3M2UA 4P7VA 3VQTA 1VQLS 1MMDA 3MZIA 1UVKA 1Y5LB 5AXNA 2VFVA 2DNGA 4N5SA 4DR6F 4Z37A 2HNZB 5CYMB 1RT1A 2J7KA 2CZVC 4RW7A 5G0RA 3IN5A 1NEEA 2B5JA 4UUWA 3MM6B 1N52B 3UCUP 2HHHF 2E9TA 4JBCA 3AQPA 2V4JB 4O44B 3UFCX 4O0IA 1KONA 1OPIA 4H4OB 5KG1A 3EPIA 4FBUA 2DCLA 2DITA 1SL0A 1T02A 2YH0A 4JI8F 1FJCA 4R5PA 1U1MA 2FD2A 1N0VC 2OP5A 4KB7A 2AW0A 2LU2A 1SIWB 1NB7A 3CCZA 2FGOA 1R43A 3DLHA 5EDWA 1U24A 5DDPC 4IO1A 2ILYA 1R8PA 2QO3A 4WYWA 4ECWA 2EWHA 4RUCA 4RZRA 2LECA 1YHQS 3E2EA 4B3OB 4DL3A 1HWKA 3R5DA 4UQGA 2XEXA 5J2PA 4DJBA 4QR1A 1TFYA 3PR4A 1JLFA 2R7QA 3G9CA 1B0PA 1LXNA 4OX8A 1S4FA 2ZITA 3QYYA 3RW7A 2DIUA 3WC0A 4ZCIA 4ILMA 2GHWA 3FEXB 3CEDA 2RB7A 4U6PA 5DLFA 1FDDA 3NBPB 3VCDA 4OI3A 4ZHRB 4DQIA 1NK7A 1WEXA 4YDXA 4TY8B 2GC8A 4QOTA 5F8HA 5F8NA 3DRYA 3AJ1A 3NG8A 4CT8A 3UWTA 2W9BA 3BSCA 2DHGA 2E5IA 2V94A 3CSKA 3TANA 1MU2A 4C97A 1BQMB 1NHUA 2MZQA 3MDFA 2XWYA 4YB7A 1YJ9S 2J6TA 3WC2A 2GJ2A 3G8TA 4ERDA 1Q7LB 1REVB 2MKHA 4NLVA 4LF6F 4YMEA 2X1FA 4ZOSA 1N48A 2J9EA 2M3DA 3QO9B 3EGNA 4K4YA 2PI4A 4BWJA 5E7OB 1TK5A 3QGIA 4EYIB 1HBMA 2C3MA 3DXBA 4YR3A 5B09A 3PRDA 4RNNA 2XNRA 4I6AA 1S1XA 2VG7A 3U02A 2YKPA 7FD1A 2PFFB 2JLEA 1IKWB 1TL4A 1RYRA 4JYAF 3W7BA 4B08A 3UD3P 1WF1A 5A8RA 5DS7A 2E7XA 3DOKA 3VF0B 5CCLA 4RW6B 4DR7F 5LXYA 3ZZYA 2ZH6A 5IQ6A 3BJYA 3I6PA 1HR0F 1U8SA 4QIEA 5KFOA 1M5KC 4EGLA 4JI4F 3M9OB 2L08A 2ZDOA 2XS5A 4PQUB 3NS5A 4NCBA 4ATNA 4Q8FA 3TI0A 2QE5A 5C24B 5HP1B 1VFJA 4ZA1A 1N56A 2VH7A 2OSRA 4H4KC 4H4MB 1YBAA 4MIBA 3NGDA 3SV3A 4QWEA 1VK8A 3OPKA 2O01C 1D9DA 2HS3A 1HQEA 1RA7A 1GNKA 2X1AA 1M90T 4BHQA 3O6QA 3TAMA 2W7PA 4Q0BB 2DHSA 1TR0A 1U25A 3DMJA 3BM7A 4USIA 4ZVHA 3MEGA 2G13A 4FXWA 4NPOA 1VQNS 4M5DA 2CYYA 3MR6A 2RQCA 5I3PA 2YNFA 3OFEA 3M32B 2XWXA 1Q82T 5L39A 1D8ZA 2M9KA 5DETA 3NMRA 1FKPB 3V81A 2LU1A 1HYSA 2CQ0A 1RTHA 3LW5C 4FF4A 4J9RA 5KFXA 2R2UA 2DH7A 5F8GA 5J2MA 1Q8BA 5G4DA 2W4DA 2AYGA 5CYJA 3SDEB 5L38A 5J2PB 3CT9A 1W25A 3HDSA 3DNCA 3NCQA 4UY85 4YHHF 1OPZA 3DRXA 4C8OA 5IXUA 2ZBIA 2O66A 4QW8A 4R0JA 1VC5A 4DFPA 1NU4A 4G6VB 3OR2B 3H2LA 4OJ1A 3QZ8A 2LQ5A 4IOAQ 4NCGA 3EUNA 1QE1B 4Y2MA 4O3OA 2HLTA 3I87A 5IM0B 2LYVA 3MURP 1U1LA 2MMYA 2VPWB 5AXKA 2IBOA 3I9ZA 1N6QB 5HO4A 2KFZA 2DD8S 3RBEA 2B4PA 1HQUA 2CKWA 4IH6A 5J2QA 2RNEA 2MJUA 1S77D 3H20A 3OVAA 2YKQA 3CJ3A 1FXDA 4B9MA 2G9OA 2KI2A 2DHXA 1HWLA 5H1SV 2C3UA 3HM9A 3EPGA 2N4DA 3MPVA 1NK9A 1Q4RA 3KHHA 4ITSA 1UMJA 2LXFA 2COLA 2CQGA 1W2BR 5KFPA 1L3VA 2GHPA 3FZ2A 4NL5A 4QIGA 5KAKA 4KAIA 1P9QC 2CQPA 2QSWA 4IDKB 4NXNF 1V6HA 2RT3A 2HNZA 5CYMA 1AROP 1R31A 2A2CA 2B4OA 3W2VB 4DL2A 1T03A 5DLGA 2IJNA 2AGPA 4QJVA 4NZ0A 4A8MP 2R2SA 2O67A 3LUYA 3PVXA 4Q5VA 1SL2A 2E1CA 4OLOA 3N6NA 3PNIA 5JUMA 3OQ2A 1U2FA 3THPA 2B3TB 2IA6A 1UVIA 1O0PA 3LP1A 5K9FA 3PV8A 4WK3A 1FRXA 2CQ4A 2GIRA 1U09A 2KYZA 3IGVA 2IHR1 1RWUA 2YH1A 4O3QA 5IT9Y 1KTQA 1JIHA 5LT5A 4BDPA 2F4VF 2RUGA 3DI6A 3THTA 4K59A 4URSA 3RTVA 1VQSA 3RR7A 2XSFA 2XLIA 1TL3B 2V5HG 3V6KA 1J5OA 3SZ2A 1RYSA 1KQKA 1T94A 3PEHA 3C46A 1UAWA 2PA8D 3I4PA 5J1NA 5L8RC 3IFEA 2CQ3A 2JL9A 3H2UB 1ZOTA 4PXEA 3SCIE 3PXGa 3M30A 5KFZA 4ECUA 2CPIA 2M0GB 5KG6A 4K4XA 4J9QA 1FK9B 4ECSA 4IKAA 1J2VA 1ZAXA 4NMLA 2RH3A 5B0GA 3PO4A 1SKWA 2LCWA 1X4DA 3N79A 5CZXA 2JVOA 4B3TF 1CEZA 3A8EA 3H98A 1FRMA 2HVZA 4LMZA 2C42A 3BB5A 4WE1A 1RT6A 2UV8G 4UY8T 3RB6A 2RVJA 1R8BA 2F8HA 2DGXA 2IRYA 2VFUA 3BGFA 3HT3A 2BQRA 2UVRA 5U47A 1JKHB 3NNCA 5KT2A 2QV6A 3PEJA 3AB2B 2RKIA 2BJEA 4X4UA 2P9EA 4NLXA 2M70A 4F3MA 3BO2A 4ED8A 1PC5A 3P49B 3ZC4A 3Q23A 4PRFA 5EHHA 2KG1A 2D9OA 1VLYA 3HHEA 3EGWB 2DGQA 4UUXA 3TO8A 3OJUA 1RP5A 4JI7F 1F5CA 2WBRA 4KBIA 3W2WB 3ZZTA 4W92B 4KHRA 4V19X 2R7VA 2R7XA 1R89A 3MCSA 4OX6A 4OQJA 3TARA 3VALA 5HL7Q 2R2TA 3TX8A 2HHVA 1JX4A 1DTTB 1JLCB 2PDAA 1CC8A 4AE5A 5T41A 2RF2A 1KHVA 1S9GB 4Q43A 1Q53A 2DNYA 2MZSA 5BYSA 5D6GA 4K50A 2FJDB 2KO1A 5AE2A 1XR7A 1OSDA 1QAYA 4MK9A 1KLMA 1ZPWX 3RRHA 4N41A 4ICLA 3UDLA 2O3DA 2MY7A 1UA1A 4Y28C 2XI2A 2J9DE 4FVMA 5F8MA 2VQEF 4Q8EA 4H4MA 5C42B 3HP6A 5IFMA 3O2IA 3HHLD 4A47A 1MMLA 4Q44A 4DOZA 1IQZA 4X4RA 2K1RB 3O8WA 1DQAA 1JLBA 1JB0C 4LSNA 5DJBA 4NLDA 4FP9A 1FRKA 3RR8A 3TOQA 4HI2A 4C8YA 3Q2SC 4H54A 4BCAA 4F4WA 2BOPA 1SKRA 2DRAA 1JLQB 3V81B 2JEFA 4MIAA 5KG5A 2KM8B 3ITHB 2XMTA 3LGNA 1DQ9A 3HX9A 1FF2A 4A8KA 2ZOGA 5DO2A 2UVVA 2AX0A 4FYDA 3POTB 4G1IA 5BYRA 4KPYA 3RAQA 1IKVB 3GG1A 5KFUA 2JRSA 1R7IA 2MSTA 2KZZA 4ETZA 3FDSA 1RGVA 3U1NA 3Q0AA 1IXKA 3KK2B 4DFKA 3ONQA 2Y1RI 2YNIA 1FTCA 1UL3A 4ID5A 1FCAA 3NNAA 1FESA 1FXRA 3E51A 4JOUA 4B3SF 2OMOA 2YKNA 4ZVEA 2Q6BA 4BWMA 1N32F 1NK8A 1IJEB 1VGYA 3AHPA 4KFBB 4EFAC 3D54A 2AJ0A 4F2RA 2B9YA 3G8QA 5F8JA 2DGUA 4CH0S 1AXQA 3FMWA 2XMUA 1HNVA 3CCWA 4DPOA 4C4WA 1RI7A 1DURA 3BGRB 4I2PB 2NQPA 2UVUA 5J1EA 4F3OA 1SJFA 3I31A 2F9DA 3HFKA 3MM8B 2FC8A 3UI3A 2GO9A 4ELUA 5KFRA 4QU7A 1S6OA 3OJSA 1M5HA 1SJRA 2B9XA 4IO9Q 3UD4P 3RYLA 2ADCA 2X51A 1KVJA 3CD5A 2KT2A 2ASDA 4PCQA 4WTYA 3EZ5A 1S1WA 3GIJA 2GIQA 5LMUF 2W24A 2N4CA 3HVWA 3LP2B 2UXBF 3JTPA 1CQNA 1D0EA 1VS3A 1UW4A 3CGIA 4GO7X 1LWFA 5EWGA 2FLLA 3N5BA 2C22A 4R8UB 2XY6A 1QLNA 4DR5F 3G4SS 2HGMA 4NYPA 1QJHA 1SIZA 5E3RA 1VQ4S 2MZRA 1U4BA 3RW6A 2WBMA 2GFFA 2A18A 2DGWA 4P7TA 3J81Y 3X1LB 1H6KX 4I64A 1OS5A 3S01A 2FJXA 4AFFA 4YR2A 5KFGA 2HMIB 1WELA 1GXLA 3Q24A 3K5PA 3FSIA 3C2PA 2EPIA 4EO8A 4M94A 2JZ5A 2HWIA 3C6TB 3M9MB 2C3OA 2ERRA 1IBMF 3E3XA 2DR7A 3TA2A 3H2VE 3QIPA 4IYQA 5E2QA 3IG1A 3MPYA 3CWJA 2ASYA 5H9FJ 3JSMB 4OZ5A 3MGJA 2LQJA 1RT6B 1S76D 4K4UA 4O4RA 3H8YA 4F2SA 5BYQA 4PUOB 2FHOB 1M5OC 3DCAA 2PMZD 5HMXA 3GYXB 5KFHA 3DRSB 3MEDA 5GVQA 2RE1A 3TAPA 3GYNA 5C25B 2MJNA 4YDDB 2K7KA 4D3GA 5I4MA 2YKNB 1X4CA 4RU2A 1HWIA 3MMCB 1WG1A 3P5TL 2UUCF 5HQ8A 4QW9A 3MFIA 2ZKUA 2MKCA 4ILLA 5CH7B 4B02A 5SUHA 3KLIA 2QEXS 5FIIA 1U1RA 4FF3A 2RKIB 2JX2A