5J1PA

Lassa virus l protein cap-snatching endonuclease. bound to two manganese ions
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
171
structure length
169
Chain Sequence
GMEEDIACVKDLVSKYLADNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEIDSCNANGCEHNSEDKSVERILHDHGILTLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKTVNISLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
source organism Lassa mammarenavirus
molecule tags Transferase
total genus 61
structure length 169
sequence length 171
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17296 ArenaCapSnatch Arenavirus cap snatching domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1pA02
3JSBA 4MIWA 5IZHA 5J1NA 5J1PA 4I1TA
chains in the Genus database with same CATH superfamily
3UD5A 4DV7F 1YZ7A 5KOXA 3AA9A 1IR2A 4O3SA 2G2OA 3PRDA 3NGRA 1CJTA 2L9WA 5KFPA 2M7SA 5BYSA 2DRDA 2XS2A 2ZITA 2DH7A 1UWAA 1N5SA 1VQMS 4ZLNA 5IT9U 2PDAA 5IT9Y 5C25B 3IO1A 3OVBA 1DTQB 1YRTA 4LFCF 3DRSA 2B7CB 2AJ2A 1HBNB 5EDWA 1HBUB 3POTB 4P2XA 1YBAA 4W92B 3ULHA 2DNMA 3KLEA 3X1LB 4LF8J 2XS7A 2BRKA 1Q81T 3EGVA 2FLPA 4ITSA 3KYLA 3W9IA 4K2XA 3M8SA 2ILZA 5M2UA 4DPOA 4DR6J 2JC0A 3LTOA 2DCUB 3MGJA 4HDGA 3G8TA 1FWKA 4N77A 4LVOP 2K3IA 4OZ2A 1LFWA 2UVRA 5D0EA 1TK0A 2ZM6F 4U6PA 4RW8B 5DDRC 1HQEA 2IAJA 2NYHA 1YJUA 3M32B 5LT5A 1SC6A 3NL0A 1O5JA 1JJCB 4K59A 1HMVB 4QIFA 4ZPDA 3HM9A 3K8VA 1DZ5A 3KLHA 2G1DA 2DNYA 1UJ6A 2UUTA 1SQGA 4B3OB 3RG6A 3H7HB 2RIJA 1VIXA 5KFXA 3PTWA 1FWPA 1QAIA 1JQGA 2HURA 4HEA9 4OZJA 3H4BA 1Y10A 2B8QA 2GW8A 3TA0A 1KQGB 3LAKA 2XNQA 1FVSA 1SBRA 3AOCA 2CDRB 2V50A 3NGSA 1IJEB 2BXJA 1U02A 4ZVEA 1SL1A 3AQPA 3FC9A 4ZPTR 4K0KJ 2JL9A 5KG7A 4F4KA 1G6BA 4TQSA 2R9LA 4LREA 1OY9A 1NPKA 3U1LA 1WELA 3TRGA 1RE1B 2HBRB 1T9VA 3ITHA 3WQPA 2CQ1A 1JLBA 3GJSB 2BV3A 2CJXB 3T6JA 1UMJA 1T03A 2NPIA 2WVEA 5B0EA 4LVNP 3P5BP 4ZPBA 1SJQA 1SH2A 2CQPA 2HZVA 4WU3A 2I8EA 3A4TA 4R8UB 1FKOB 4YQWA 4DSLA 1ZZNA 5E41A 3GSIA 4DX5A 3M2VB 1O6XA 3QT8A 1ROFA 4BS2A 2X1FA 1C4CA 3H2LA 2CQ4A 2O3DA 2W2QP 3I0SB 1QUPA 5F9NA 2Q66A 2O5DA 1TKTA 4USVA 3MURP 1X4GA 2CG8A 3M30A 2WBRA 3Q22A 1YVFA 1JXVA 1K73T 4F26A 2VG5A 4QYZK 2V4RA 4DL3A 3T5HA 5DDPC 1JLFB 3MWBA 1RWXB 3SXLA 1HWKA 1EP4B 2IFXA 4B17A 4AL6A 3CIMA 1VK8A 2E1MC 1HBOA 1DLOB 3SQOP 4NASA 3EGNA 1QY7A 5F41A 4ELTA 2R7RA 3T1YJ 3IWLA 1VRUA 2V8GA 5DM7Q 1TL4A 1RT5A 4BLGA 2UUBF 3Q8UA 4UOCA 3ZZZA 1WF2A 2LFVA 2RAQA 3IXQA 4ZCLA 1G3OA 1IR1A 4ES1A 4W4MA 1M5KC 3T1HJ 3PR5B 3GFYA 2DNPA 1R6YA 5AJ3F 1WC1A 3D66A 4USHA 4TY8A 2OJ3A 4K50A 3FEYB 4NLSA 2N7YA 3T41A 5HL7Q 3GILA 2VH7A 1WG4A 3BM7A 3KG4A 2XC9A 2EFVA 2U2FA 4YFUA 4WZMA 5J1EA 4MKBA 3P45B 4OI6A 3J7Z5 3KK3B 3HP6A 4AXIA 2DTJA 5M2PA 2KXNB 2XSJA 1EAYC 1R7IA 5DQIA 1L3SA 1OSCA 2DKOB 4QIEA 1QJHA 1REVB 1EX8A 2M2BA 5JVHQ 2ZZMA 4EBEA 4PQUB 3BKUA 3TR5A 3W8GA 5B0CA 5HVGA 4N47A 3EM1A 2WRMA 5IT4A 4ZCIA 2HNDA 3RB6A 3ZTQA 2D69A 4ILLA 3PACA 4JV0A 4OZ3A 5JJBA 5J2MA 4DCOB 2R2RA 4KV8A 1Y0HA 2HHHJ 2PMWA 3SCKE 4DLGA 2IIHA 3IC1A 2DEJA 3NCPA 1KC8T 3HSZA 2P8IA 4ANCA 2OP5A 3HFVA 2GHVC 2KM8C 3VAIA 1BLUA 1SH3A 2B6AA 3FEXB 1BWEA 3PVXA 3BGUA 1VGYA 3SQGA 1A7GE 2RNEA 4HH0A 5AE3A 8ATCB 2V94A 2W7AA 4A8YA 2RJZA 2VFRA 3CJRA 3DHXA 4RW7B 1WOOA 3BQ1A 4ZS6A 1EQMA 1SPBP 2J0WA 2EFGA 2L48A 1R89A 2R7XA 5T7LB 4DR7F 1RTIB 2VQFF 4ZIVA 4B9NA 1LKZA 2P9CA 4KPCA 2B9EA 2MQNA 3NGUA 3LALA 5AXMA 2MEWA 3MM7B 2I6WA 2FD2A 3FEZA 4PRFA 3BJYA 5ETMA 1FKPA 2FHJA 3MPVA 2AGOA 2EPIA 3M9NB 3W2WA 4RNFA 1RHMB 1AYEA 1PYSB 3P4UB 4N56A 1RWVB 1WTFA 2M70A 3QSYB 4HHUA 1AZSB 2KI2A 3TWZA 1QUVA 2QL7B 1N0UA 1IUJA 3HHLD 4H4MB 4N8OA 1VI7A 2B4VA 3D3CJ 5GAEU 2KZZA 4C8LA 1Q95G 2LU1A 1NK8A 4P52A 3IR6B 1F9EB 2CJ9A 3F41A 3IS9B 2PI5A 1RTHB 3HD2A 3V81A 2CPIA 4YOEA 2WOMB 4NLGA 3BSCA 3ENVA 1NHKL 2G13A 4ECXA 1MWZA 5KFDA 2DGVA 3OSPA 3VTIA 1Q78A 2LECA 5ETQA 1UVJA 1B7YB 1Q82T 3OT9A 1JKHB 3MAAA 4URQU 2BW2A 3D4JA 2R2SA 2KT5A 4F04B 1KFDA 2NYIA 1B99A 3AA8A 2HNYA 3PXGa 3PFEA 5DQHA 2AJFE 5E5NA 3HI9A 2OELA 3NMAA 2ZHBA 1KNZA 2IPOB 3QBCA 4U7CA 4ILMA 5KFOA 1BQXA 1HNVB 2EW9A 3W3SA 3UNGC 1K1QA 1HNWF 1S6QA 1D9FA 4N7TA 4DFKA 3FJ2A 4I0WA 4LBPA 3N5BA 5L9XA 3EUNA 1H2VZ 1UA0A 2MKSA 4DU8A 1KSPA 1TQLA 3MEGA 1NJYA 2DISA 2MQQA 4X4UA 1WOPA 2FHOB 1APSA 1OO0B 2C2ZB 1FJCA 2F4VJ 4WYWA 2W9CA 2CQGA 2KM8B 4C3MA 5KG2A 5K20B 2XMJA 3WBZA 2MZ1A 2XMKA 2QEXS 2AHOB 1I51B 2A2CA 3DLBA 1NJZA 3BGRA 2YBVA 1K8AT 3TI0A 2JLEA 4B9UA 4LSLB 2YNGA 4A8WA 1IKWA 1LFPA 1JLGA 4RU9A 1Y5NB 2MQOA 1MN9A 2B9YA 2FHMA 3LP1A 2VU5A 1J5OA 4C11A 2RRAA 1H7WA 4L73A 3R5GA 4WK3A 3V2UC 2ZH6A 4PUOA 3HFZB 1NDPA 1VOMA 4EMDA 1XNQJ 3D1QA 4ZKAA 4NEZA 1E6VB 5D4PA 1YX2A 4IFYA 3IGVA 5FJ4A 3WC2A 4QWEA 1RT1A 2I5JB 4KKOA 2DK2A 1XR6A 4DF4A 1V3SA 1TV6B 1FK9A 3PCOB 4ICLA 2W7OA 3TAMA 1WKJA 5KFJA 2Q79A 4P2MA 2ZH5A 4EZ6A 2B7BB 2Y0SD 1TZ0A 1FRKA 3UDEA 2R7TA 1T9WA 2BJEA 2DGWA 2B51A 2QV6A 3I5AA 5EHHA 3GJTB 3CCJS 5CD4H 3K7RA 1YLXA 4ZLJA 5C42A 2MSTA 4A48A 4DR5J 1NB7A 4K4SA 2ZH3A 3FKBA 1DQ8A 1X4AA 1JXEA 2WCXA 5EWGA 1D9DA 2JEGA 4K4TA 4J9UE 1N5VA 3UN3A 1ZH5A 2Z2MA 4WKRA 3GR0A 1TAUA 1V9OA 3AH6A 2VODA 2MZTA 2HNZB 2BA9A 3ET6A 3VQTA 1NO8A 2RUSA 2GS8A 2J9CA 3B4MA 4ZIWA 5K8PA 3BSOA 2R8GA 4J9VA 2DR7A 3HJVA 3DC2A 4AQYF 3AOAA 1U26A 3LP2A 3I9ZA 4X4RA 1X4BA 5EN1A 1RAAB 3MM8A 2ZBIA 1U1PA 5ETKA 4Y00A 1AUSL 1S0MA 2J6TA 1FESA 1KQKA 1RT3B 2ATCB 5F0UA 1QAXA 2DPIA 1KLNA 1XIQA 3BDPA 4M5GA 3V6DB 1F2GA 2GC8A 5KFEA 2BOPA 1S0OA 1KFSA 4EI2A 4AUKA 4DFPA 1SUQB 4OJ1A 4LSZB 1N54B 3PFOA 1WD6A 4Y65A 2MTLA 4ZMMA 4U96A 3L7PA 1S9EB 4ZP9A 3GG1A 2XTJP 5BYRA 2GNKA 4KTQA 3CJKA 2OPRA 3PM9A 1F0XA 4C2MA 5K8OA 4P9SA 4CM2A 2QYCA 1YITS 2AEFA 1NPRA 1DTTB 3CO9A 3I56S 2GIQA 1VQSA 3J81U 3J81Y 5F3ZA 3FCWA 4HLBA 5HI7A 2KB2A 4JI4J 3A8EA 3Q8SB 1OWXA 4LRAA 3T5LA 2YXLA 1LOUA 3H5SA 1ZM3A 4Q8EA 5CZVA 4U9RA 3R5JB 1PJ6A 5L39A 2YKNA 3CDWA 1SIWB 4IRKA 4EO6A 3AAWB 5FLXU 5FLXY 3CMES 1CJUA 4HI2A 1C1CB 3ZNUA 2ZH1A 5GMDA 4LBIA 1Q5VA 3GSDA 2O01C 4DG1B 1HBMB 3EMTA 4YHHF 1LWCB 3QGHA 3OXFA 5KG3A 1W26A 2YWFA 4ZVHA 2EK6A 4XIUA 2OPPA 1NH7A 2M9KA 3HDSA 5H1SV 3HVTA 2L9NA 2IBOA 1QAJA 1X5PA 3F56A 1U1LA 2BJ9A 5KFHA 5KG1A 1VFJA 4ED2A 2W25A 4AFFA 1PG5B 2WVFA 5EX0A 3G82A 2YWEA 4CO4A 2PFDA 4OMFG 1B3TA 3TO8A 4L72B 2IM0A 1KHWA 1VQ7S 1BGXT 4FP9A 3KHHA 4MFBB 4GKJJ 4XPEA 4RW6A 4NXMF 3DLKA 1I6JA 2VQEJ 2W1BA 3RR8A 1N56A 2YWWA 5IOLA 1NHVA 4DU7A 4LIWA 2RKIA 3CCES 2HMIA 3C6UB 4F0KA 4IG3A 2QLFB 4NLXA 2OPQA 2B4UA 4A8MP 1T3OA 4LFCJ 2R7QA 1H38A 1B0PA 4URGA 1NRKA 3OR1B 1S1WA 1PC5A 1HIYA 2IM2A 4B3TF 1XQIA 2VB6A 7FDRA 2DNKA 1M0SA 4ZPCA 4K4XA 2CQHA 3M2UA 2WONB 1R8AA 1Y7PA 3EGWB 3TUZC 3RB4A 3H5YA 3WC0A 2CZ4A 4YR3A 4PG7A 3GB0A 5ETOA 4DV1J 5A8KB 4IUFA 3GYGA 2KXFA 2QA4G 2OEJA 4DFMA 4OZ1A 2E5JA 2ZC4A 2F7VA 4KC5A 2AX0A 3NG8A 3QT6A 2ZVSA 2FGCA 4W90B 1T95A 2ZUGA 2XB2D 4ZOSA 1S6PA 1NMEB 1BWVA 2BJ1A 3LANA 1QM9A 3MM6B 4AT1B 2YQ3A 4X84A 1REGX 3H25A 2JVOA 2J9DA 4IR1A 1R8CA 1TELA 3HX9A 1RHKB 3N6LA 2YKQA 3KDOA 2Z2ZA 1N8RT 1RK8A 1YWXA 1U45A 1HWIA 2FC8A 4DV5F 4B3RF 1VDHA 2CJAA 5AE1A 3SZ2A 1RB0A 3GG0A 1BHNA 1HFEL 2W4DA 4ECTA 3CCUS 2X3GA 1S7IA 3PHTA 2C2DA 4Q43A 4F50A 3ZTOA 4UW2A 4OJGA 3NCRA 3DU6A 3MHYA 2ZBQA 4ID8A 2UUCF 4OX7A 2IY5B 2Y1LB 1F9FA 1U09A 2DGQA 2ZDOA 1C1BB 2KKHA 4O4RA 3V5RA 2RDIA 3SBMA 1WUUA 3VGVA 2ZWOA 3KJVA 3S8SA 4WFXA 4FBUA 4PWDB 2GIRA 4OYOA 2HQ3A 2WW8A 1HARA 1T05A 3ISNC 4X4SA 1TL1A 3CDEA 5KFVA 3TUPA 3KK1B 4USIA 5KFMA 2FZCB 1TU0B 2BJDA 3GFZA 1O51A 4OQJA 1LK5A 3O2IA 2RHSB 1ZM4A 3MUVP 1SJFA 4CO2A 2Z57B 3FBEA 3G2XA 1XMQJ 4XK8C 1PJ5A 3IR7B 5L9NA 3LUYA 3TA1A 4MK8A 4F36A 4ZP8A 3HLUA 2KXHA 5JMNA 3P6YC 4Y28C 1M1GA 4MYTA 3NS7B 4I67A 3AXKA 2CPXA 3IN5A 1BMQB 2J6UA 3KG1A 2ZH2A 4D3HA 4RNOA 2RUGA 4XDDA 2KTQA 2AZ1A 1X4EA 1RHRB 1XERA 5A8WB 1Q4RA 2D3UA 2LMIA 4P10A 1KWMA 2RU9A 2HAFA 1VQKS 3P8BB 3BSNA 5A8RB 5LMNJ 3HFKA 2W4CA 3NS5A 3FRZA 5CHCB 4QZVB 1G7CB 4A46A 1YBTA 3MR2A 3BBCA 2XY5A 4KGZB 1HNIA 4QYRA 5B0GA 4ER8A 5ETRA 1MN7A 3SSSA 2HHVA 2XMVA 3L09A 5J2PB 3CCWA 3E3XA 4H4KA 5EGYA 5T14A 3NWRA 4LF6J 3B54A 2UXCF 4KY3A 1H7XA 3WX4A 1WNEA 2DJWA 5IM0A 1ZETA 1CC7A 4KHPF 2UVUA 4CNYA 5CQGA 2Z2LA 4CYUA 2CFXA 3DLGA 2W9AA 3ENAA 1MU2B 4KE5A 2Y8WA 3SCJE 2D3ZA 5CAAA 4MH8A 4B3SJ 5KFYA 2VFSA 3M9MB 4FXWA 4RPFA 4TLQA 3BPDA 3FRYA 1N4LA 2R8JA 3GJRB 1V3ZA 4PWUA 1DQ9A 2IJFA 1PBAA 3F73A 3HVRA 4B9MA 3VVTA 3OBIA 2GQQA 3TNVA 2C1EB 1P1TA 2M5YA 4KO0A 3UCGA 3NCQA 2HWHA 4LF8F 1WC4A 3KHGA 2GVZB 4MIBA 5KAKA 3GFXA 5F8MA 1LWFB 1Z1ZA 1T3NA 2M3DA 3ADAC 5B0AA 1JX4A 4M5DA 3IBFB 1RXOB 4DR7J 5LXRA 4TXSA 3NAHA 4DR6F 4ED0A 3KKFA 3MPYA 5IV4A 2L3MA 2DHHA 3OUYB 5KT3A 3CULA 2PIIA 3JSMB 3OTDA 4J9MA 2DO0A 5HK4A 4C97A 3VF0B 3AHPA 2HFNA 1MMLA 1Y9OA 1WEXA 1ULRA 4PR6A 3M8PA 3LWMA 2GIFA 5GAGI 2FJBB 3RRGA 3GYXB 1RTDB 3ONQA 3RAQA 4IDKA 3K5OA 2C3PA 2DNLA 2HIQA 4MIAA 3DRYA 2JHEA 2H48B 3UW1A 1S1VA 4DUTA 1JLAB 2CQBA 3N28A 1R0AB 1HPZB 4OHVA 2KL8A 1RAGB 4A4JA 3I82A 2FY8A 1CS4B 2Q6BA 3H8YA 5I42A 4OHWA 2J8SA 3CE8A 3QMQA 4B9SA 1N6QB 4K0KF 4FF4A 3UDCA 2QL5B 4CH1A 1QE1B 2DIVA 3UVJB 4QU6A 2GHPA 5IQQA 4DZ6A 4L6V3 3RB0A 5B0FA 2F65A 3CCQS 2FYXA 3NOCA 2FTRA 3KLGB 4IFVB 1S1UB 1L3VA 3NAIA 1HQ2A 2R4FA 2V4JA 3G6YA 2MGZB 3QIPA 4JV5F 2VDIA 1MWQA 1LNQA 5LMUF 1D9AA 5CD4A 5EWEA 4KQZA 2C2EA 3MCMA 2DRBA 4BC7A 4CLYA 2MZJA 2YKAA 3DDKA 1Y3KA 4WZQA 4P7VA 4JI6J 4ZK7M 2E66A 3D2WA 3MEDB 3BBFA 4LFBJ 4P2FA 4DCJB 2UVWA 5GADU 3JQMA 5DQGA 2XYPB 1GMUA 1YSJA 3EZOA 2W2MP 4GVBA 2Q3PA 5DETA 3U1NA 1VQ9S 3O8WA 1U6BA 2VV5A 1NSPA 3C15A 4XPCA 3FGVA 2BE7D 4CTAA 3HXMA 3F44A 2H4WB 2PGCA 5G0RA 3HK2A 4G1QA 4EU0A 3HT0A 3FNNA 2VICA 2VBXA 2BE2B 1AXQA 1TMMA 1UFKA 4RW4B 3MAQA 4DSEA 2E7VA 4NLOA 2JFKA 2R8IA 1X4DA 3KOAA 4HVZA 1EETA 1N5TA 2YKPA 2EWHA 3SSRA 3EX7B 4BDPA 5CYMB 1BQMB 5IC4B 2YWKA 4CRJA 5L1LA 3S7RA 2IVYA 1TP7A 2UUWA 1TVRB 3S1TA 4RUBA 3BO2A 2AGQA 4KGXB 5K14A 2FVPA 2FY1A 5HP1B 3JB9k 4QJVA 3DLEA 4WYLA 4GO5X 1TAQA 2F9JA 2EBEA 1M1HA 1FD2A 4NCAA 2H9ZA 4LJMA 4H4OB 4RO0A 2LXUA 4ZHRA 3CJQA 3NKYA 1LW2B 2KJWA 3M2RA 5I4MA 3K5LA 1N0VC 2YQ1A 2CG4A 4TVAB 3QJLA 4UQGA 1U1QA 2ZE2B 4IG0B 2RQCA 2BKNA 3H5XA 2MKJA 2BYCA 3J7YU 2FIUA 3MR7A 1UPPA 1U1KA 3EYZA 2MKHA 3PRBA 2CPDA 1IR0A 2NXEA 2HVIA 2IVMA 5A6WA 2PC6A 3HCXA 4RJVA 1GH8A 1BY9A 1CQNA 1GMWA 4USJC 1ZOTA 2QC3A 1YJTA 1FRXA 3BYRA 2L41A 1RQ0A 4WWSA 5CA5A 3D3BJ 1FNMA 1YHQS 4DCPB 4V1Ak 2ZJRQ 2RQKA 4EO8A 3VZHA 3OLBA 4KIAA 2KHCA 2C2RA 2MQ8A 2HHUA 2QMUB 3HT3A 4RW9B 1IBKJ 2MMYA 2OAUA 5DJBA 2ASYA 2HGNA 3KLFA 4V19X 2GZOA 1U7LA 1UA1A 4OI3A 3MTKA 2LCWA 3DOLB 3PX0A 2VASA 4ED6A 5KFFA 3JQKA 1LXJA 3JYTB 2WB4A 3C16B 3QFHA 4EYHB 4OZNA 4OI2A 1ACMB 4ZDNA 4RX6A 1MROA 2IHR1 1KOOA 3KUEA 2VG6B 1RJJA 2KFNA 2NUUG 2PO4A 2MXYA 2J5AA 3L4BC 3MEEB 4P75A 3BV8A 1HLWA 2IRUA 3OUYA 1IKVA 3VCDA 5BR8F 4NLYA 2HPUA 4MTPA 3JTPA 1CJVB 3MCSA 2XMMA 5FIIA 3IA0A 3CCZA 2VFVA 4J9RA 2JEFA 3TJAA 1V5VA 5GAHU 2MHNA 2CVIA 2AQ4A 3U02A 2RD5C 4NEYA 3KNGA 2MZRA 2ZH8A 1TR0A 2QA1A 5KFSA 1RDRA 4OYPA 5HAOA 3KK2B 2A3JA 3NRBA 3CC4S 4NYZA 3DRRA 4C98A 3MMCB 4ZP7A 1IKXB 3QAUA 1E6YA 5HLFB 4HI1A 3RTVA 1M5OC 4TY9A 4B08A 2GJ2A 2X7IA 3A3NB 1JIHA 4HT5A 3CW2C 2OEKA 2C3OA 2A18A 4R25A 3D67A 2ROPA 2V8PA 3DMJA 1N32J 3BQ0A 2G2ZA 3KJQB 4DR3J 1RYRA 5C24A 4OYIA 3MECA 1SL2A 1IBCB 2QN6B 4UY8T 2W8KA 4LF7J 3CNQP 1NAQA 4J9LA 1OIAA 1X7VA 5THWA 4DX6A 3R9LA 1S9GA 2AX1A 2KJVA 3BBBA 1DURA 1HQUB 2ZH9A 2OTLS 3VGSA 4GMKA 1CJTB 1X4FA 5E0OA 1WORA 1RT6A 1S4FA 4I69A 3MD1A 3DOMA 5B0BA 1HA1A 3D1HA 1I94F 3BH7B 4DF8A 1Z2ZA 2ZD1A 1DY3A 2MSSA 1FDDA 1S4EA 2ABYA 3OVAA 4NXMJ 5BYQA 3D9BA 3UN5A 3R27A 2HVDA 4CLFA 2F4VF 4C8YA 1A6LA 3DRSB 1LW0A 3JTNA 2BQUA 2AU0A 3KLEB 4M5LA 1GFWB 4RKUC 2OI2A 1X9WA 4IQXA 1WC3A 2GFFA 1Q16B 4ZP6A 1Z4UA 5GVQA 1GX6A 2XS5A 4NCGA 4DV3J 3G86A 4WBFA 5L8RC 5D77A 2G0IA 2FHKA 4LRDA 3K5NA 1CVJA 4I2PA 2YNIA 1HQEB 4OV6A 2IAJB 3AFGA 3QQCD 3F0NA 1RT7A 4ZPVR 3W9JA 1NB2A 1SJ3P 5KFWA 3J7AN 3ETOA 3CD7A 3KLHB 3GIMA 2Y9HA 2VPWB 1OY6A 4LF4F 2XGQA 1KLMA 4GC6A 3HULA 3VAKA 3TUJC 1VC6A 1C0UA 3HHEA 1U1OA 3Q8YA 2DNNA 3PJ9A 3A3OB 4Q7AA 2CXEA 2KN4A 3GCWP 2A6MA 4YR2A 3SV3A 3VR1A 1WHWA 2G4BA 2HBQB 3VAFA 1FX4A 3OR2A 1W2IA 1CULA 2QLWA 4IH5A 4TKTA 1RBOB 5D4LA 1CQMA 4ED5A 1M5VC 1R3NA 2QMWA 5D0GA 3AB4B 2EFQA 3UDLA 1TL7A 4WP9A 2E44A 5LOQA 1X0PA 2DH9A 3A8JA 3ITHB 1KVJA 1JLBB 2OSQA 3GLJA 1T03B 2DNRA 4DV2J 4DV5J 1XTZA 2QLBB 2Z56B 3G6XA 2XZWA 3D5MA 3T6BA 3EZUA 3IM8A 5H9EJ 2AP6A 5SZTA 1X0FA 2D7SA 2BVZA 2C3MA 2E7XA 3PIPQ 2DPJA 3Q24A 4E2FB 1F5BA 3H20A 3TAPA 1EKRA 2AYBA 2JLFA 4DQRA 3MZIA 5GMEA 4QW8A 4USUA 1S1TA 2GGPA 1TKTB 2BEFA 2MKYA 2UXDJ 3M30B 1FNOA 3PYFA 2VG5B 1VIOA 1P6TA 1RABB 1IM6A 2OEMA 3V4IB 1GQEA 2Q1LA 1PGZA 3X3UA 1R0BG 3ELHA 2E9ZA 2M0GB 4YR0A 2ZKUA 3BKFA 1HBOB 3I4HX 1KRPA 1DRZA 4UOGA 1FFSB 3OL9A 2AD9A 1DFDA 1YJ7A 1VRUB 2XMWA 3CT9A 2OH2A 5K9FA 2JJ4D 5AXNA 1B70B 2X1BA 4GKKJ 1RT5B 2E5GA 3W1YC 4CM0A 3BO3A 5KG4A 4FKXA 2NSBA 3T19A 1YJRA 9ATCB 2AEMA 2I0XA 1HHQA 4I56A 2YVSA 3DDNA 3IFEA 3R5AA 2VFTA 3O3LA 4KHMA 2FVQA 4OJ3A 2QT7A 1W25A 2ZOFA 4WE1A 2XQCA 1EJ7L 1YBUA 4ZVQB 1JWWA 1NJWA 1BUXA 2FC9A 1H98A 2PSZA 4TY8B 1ZTTA 4JI3J 3TJ9A 4LSNA 5IWAJ 4JBCA 3MM9A 2PD1A 3E01A 4C0OC 1S99A 2MJNA 3P5TL 1YK9A 4CDIA 1Y5LB 4LF1A 4EBCA 1S72S 5J1EB 1U6ZA 3LOUA 3SDEA 1YQHA 3ZZOA 1AW0A 4KFBA 3FSXA 3HSDA 2J7KA 2JVRA 5D3GA 4C8KA 4OX8A 4NZ6A 1YRXA 2VG7A 2XSJB 3VHQA 3GIIA 1RLCL 3MMAA 1S79A 1S57A 2ROGA 3CEDA 1U47A 4J9KA 3RU0A 1Q7YT 5EUHA 4MYUA 2L9DA 1ZBTA 2HQCA 4LF9F 4P7TA 1UZDA 1FFWB 4QWAA 1RHJB 4NA2A 2E7WA 1RHUB 2JEJA 4MKAA 2F40A 2KYZA 3GWCA 2HK3A 2HNDB 1IQTA 3UR0A 3MOZA 2UXCJ 2K2PA 2YNFA 1OS5A 5J2MB 4KV8B 2K1RA 3DGPA 4ZVFA 4P71A 3DI6A 4RUCA 4KHPJ 3NMRA 1VBKA 1NJIT 1UETA 2HHXA 2DR9A 3RAXA 4NLUA 3RUBL 4GKJF 2B6AB 4FXDA 1JB0C 2DXEA 4RUAA 4DUYJ 1QAYA 2FLOA 2VQEF 3SQGB 4F4XA 1OSDA 3BEGB 5U47A 1UEVA 3HF5A 3ZTPA 2A2DA 3US5A 5KFUA 2Y3YA 3MMBA 2MY7A 4DV6J 3MEKA 1KP6A 4Z7CA 3QLHA 2KHDA 2MQPA 4I7FA 1XNRJ 2IDEA 4WTYA 3DLLQ 5DG8A 2WB1D 4BWMA 2XMAA 1JNRB 2OSRA 3B8HA 3R6GB 2CQ0A 4X2BA 4DPYA 1FKPB 4OIXA 2COLA 2NREA 3W2WB 4ZVPB 3I5CA 4WF9Q 1IXKA 3QFWA 4MKVA 4I6AA 4N8NA 4O3NA 4DJBA 1T02A 4DV1F 1SQEA 2BUNA 4F7VA 4N41A 3N79A 4NLPA 2V2KA 1RCOB 5KFNA 3C8YA 2ACMA 4FPRA 2VF3A 4PXCA 2QL9B 1HWJA 4FNIA 4ED3A 3V81B 1K0TA 1OJ4A 4HHHA 1FE4A 4C8ZA 1TKXA 3AD7C 3ILLA 3BGOP 2ADCA 2F4FA 2XY7A 3QO9A 2HQFA 4JUZA 1FHTA 5T41A 4I4BA 1SIZA 2MB0B 2W9BA 2ZBPA 4EBDA 3MAAB 2OD4A 1IBLJ 3TJ8A 2VD3A 3I0RA 2HNYB 4C8NA 1RU1A 2BJ8A 2XY6A 3OL8A 5J2NA 4BBYA 4CWBA 1U1MA 1D0EA 5A0YA 2KG1A 2Z8QA 3QSIA 3TEGA 1TKZA 3AY0A 1C0TA 3I32A 3R8YA 4F2SA 2AJ4A 1S6QB 2KVIA 2AYGA 2ACYA 2ZFHA 2HQGA 1SKWA 4DSJA 4HACA 3TVZA 3MCNA 4JV5J 2BBEA 2DNZA 4YB7A 3MEGB 5LMUJ 4UZBA 4MIWA 1FA0A 1U8WA 3IAM9 1P1LA 2QJ3A 3PEHA 3KHRA 4PYAA 2WBMA 3VVUA 1WG1A 2WK4A 1DAXA 3AD8C 1GK8A 2VHGA 2NSCA 2W9CB 6FD1A 2J0XA 4C8OA 1R31A 3EVOA 4NMLA 3DM2A 3BGRB 3V4IA 4I6YA 3UN2A 4HH1A 3PW2A 2ASLA 5D4OA 3R5DA 2YNGB 1JK9B 1IKWB 2FJXA 2R2UA 1JLGB 2DITA 1MLAA 1UFWA 5HMZA 1MSWD 3ZZTA 4M94A 3LP1B 4CIOA 1XMQF 1J5OB 4C11B 2ZWPA 2JOQA 4X4PA 2FLLA 2HLTA 2UXBJ 5HMYA 1OPIA 2B9XA 4PUOB 2CADA 3G8QA 1RP5A 4IOCQ 4DV4J 1H74A 1S5ZA 1R8HA 4WXOA 4UUXA 4RNHA 4IFYB 4WFNQ 3N01A 2NR0A 1RT1B 1F5AA 3CB4A 1QVGR 4KKOB 1UFLA 4NLDA 4YDXA 3MM5A 1FK9B 4ICLB 4K8RA 2CNKB 4ETXA 3TAMB 3W9HA 4LF2A 3H98A 5LMNF 2Y1RI 3K89A 1HNZJ 1IM4A 3LGHA 2QA2A 4YB1P 4DQIA 3TYTA 4EZ9A 2M8DB 3QRPA 2HFOA 4DUZJ 2VPXB 1VRTA 4ZJQA 4J9SA 3ZXWA 1M90T 5C42B 3HKZD 2ZC3A 3FCVA 1PBUA 5KG6A 5G4DA 4LFAF 3V6JA 2ZBRA 3C2PA 3HMJG 3Q86A 1A0OB 3C6TA 4KT0C 1BQNA 4NYPA 3TA2A 3LA0A 4LF6F 2VA2A 2UZAA 2XYHB 2BE9B 4CO0A 1MG7A 3ET6B 2AJ1A 3KWMA 2JZ5A 1NDLA 5DLGA 3L9ZA 1RA6A 3KUGA 2CVEA 4DR1J 3LP2B 2WVBA 1UEUA 3QRRA 2R2TA 4B3SF 3MM8B 2GQCA 4UOFA 2RH3A 4B3MJ 4M63A 3H4DA 4ZLLA 1BC6A 3VQSA 2ZOMA 3W5XA 1SC1B 2HHWA 3ISND 3OHAA 3Q2SC 2DY9A 3R2DJ 3E2EA 5E3CA 2LYVA 3WDOA 3PHEA 3MR6A 5HANA 2RE1A 1VQ4S 5IFMA 3IG1A 5E2QA 1GXLA 1NHUA 1X5OA 1VQLS 2LXFA 2HVZA 1TMJA 2XNRA 4NL5A 1K47A 4N5SA 1ZAXA 4ZVRB 4P73A 2Y1IA 4Q0BB 4FZVA 2XWYA 3CJKB 2OPRB 2J6SA 3B4DA 5ITHA 3OL7A 4HTJA 4DR2F 3PO4A 2JNJA 1VBXA 3BSAA 3O6QA 3THPA 2J0SD 2Y1JA 1WOSA 3AQOA 4ZVUB 3D6TB 4DSIA 3K58A 4F8RA 3DOKA 1IKYA 1B4SA 1P27B 2Z0GA 2FQQB 5BR8J 1WF1A 3THVA 5AE2A 1EARA 4PCQA 4USKA 1XJWB 2LKZA 4O3OA 4PABA 1JLEA 2GMLA 2E1AA 4YB6A 1X5TA 2OPSA 2AF6A 2CYYA 2YKNB 3G87A 3KXDA 3GV8B 4OYWA 3MFHA 4JI5F 3HHLA 2XYGB 4LBHA 2HGLA 4M5NA 3WIVA 1CJUB 1H0HB 4HT7A 3OTBA 2RVJA 3EWGA 3QGPA 1FCAA 1WHVA 1AUDA 4X64J 4NLRA 1V6HA 1KQFB 2O66A 5KT7A 3UD3P 2OPPB 3RYLA 2QFJA 4IKAA 4DQQA 4OYZA 3WHIA 2LU2A 3HVTB 3C3LA 1YKWA 1ZM2A 2KH9A 3GQCA 4TNOA 4M5IA 2BM0A 4U7UK 1IVZA 2DB1A 2OMOA 1N88A 2PMHA 3BZQA 4QQBA 1RADB 3G82B 4ECWA 2C3YA 3UCZP 4ZCMA 2VPYB 4RBVA 5KT4A 3IRXA 2LP4A 4O0IA 1VLYA 4I68A 2HVEA 3OTCA 3TANA 4K4WA 4OL8A 2RMLA 1B0TA 4L3KA 4JI6F 4RW6B 5D0HA 2B5JA 2GA7A 3G8SA 1NSAA 3W63A 3DLKB 4A8FA 4LFBF 4L74A 6FDRA 1RU2A 2VKZG 2OMLA 4CLKA 4X4TA 4HR2A 2EKYA 4GO7X 2BMBA 3M8ZA 1I94J 1AB8A 2RKIB 3T1AA 2HMIB 1VK3A 2VBYA 4IG3B 4QWCA 4PG8A 2OPQB 1SJRA 1QLNA 3N9UC 4DDFA 4ZCKA 4WPAA 4Y2CA 4QPTA 2BDPA 2O67A 4P2SA 3EPGA 5J2QA 4ZJLA 4LRFA 2R7SA 1VYAA 2H54B 2QRRA 3LO3A 3M1VA 3QT7A 3TX0A 1TL5A 1S1WB 4ID5A 1VMBA 2H5JB 2KT2A 3U7JA 2E9RX 1UWBA 1V5IB 2N4CA 1NK4A 3QWUA 3JXOA 3M2UB 5A76A 3PDNA 3NEKA 2UUAJ 5KFQA 2BKPA 2V2QA 3Q8VA 2NXNA 4FF3A 2DHGA 3FBFA 4ZVSB 1PO6A 2BKOA 1RSCA 2VL1A 1C2PA 4KGMA 1NEEA 4ANEA 4PG4A 3EICA 2L08A 2CQ3A 2MY8A 2C2NA 1KONA 4OFZA 2FVCA 2OFGX 2GX8A 2I1RA 4QBUA 4LF4J 4H4KC 4KHRA 2WVDA 3LP0B 2FZKB 1JLQA 2ATLA 1S6PB 1FD8A 5ETNA 1RTJA 4ZVGA 4X62J 1FDAA 3UR3C 4F2RA 3QJPA 3KG0A 2YY3A 4QR2A 3IGNA 4KAIA 2FJVA 5C5JA 2J0QD 2V67A 4A8SA 1F5CA 1SV5A 2DO4A 3BH6B 1FT8A 1G2EA 4USMA 3W2VA 3G6ES 1FJEB 2BANA 3RZAA 4ANDA 2XCPA 4IRDA 4XO0A 2GVDA 3BPSP 2C2MB 1S7HA 3GP9A 4O4GA 2FVRA 2YKMA 2WSCC 4NLTA 1VQOS 4DOZA 2MYFA 1UKUA 1T94A 3QJJA 2HSEB 1FNXH 2J8AA 2IA6A 1K1SA 2ROEA 3ZTSA 1VBYA 4OZ5A 2LQ8A 2VA3A 2RHQB 5CYQA 5F9LA 3KLIA 1UJ5A 3K57A 3N5FA 5HQ8A 1PC4A 3KJVB 1X4HA 3H42A 2W8LA 1T05B 1IBKF 1J5EF 1B7FA 4L75A 1U1RA 1TL1B 1NDCA 4O3RA 3IMQJ 3M8QA 1RAJA 4WJBA 1HYSA 4NRTA 5AT1B 4G1PA 3L95X 2WW4A 4TYAA 5LSRA 5IXUA 2D3OR 2PFFB 5H9FJ 3RW7A 4Y34A 5C7PA 3TAQA 1VC0A 4FF1A 3BDEA 3A12A 5GAEI 3L7UA 3FK4A 4XAKA 4Q0BA 1UVLA 1N5YA 4K5SA 2LEAA 3U27A 4IO1A 1LWEA 3SFUA 2B4PA 5HBMA 4M5KA 3PNIA 3CCLS 3V6KA 3MPDA 4JV1A 4NLWA 1YTYA 2FDNA 3PJXA 5IS2A 4F4WA 2V0NA 4DSKA 2WHOA 3NWGA 1HWUA 4F4YA 5JXSA 2OLWA 1FRHA 4CZCA 5FDLA 2XBPA 1RISA 3KHLA 1RT2A 2DGTA 3OXGA 1S0NA 4YMEA 4U67Q 4DPUA 4DN0A 2UU9F 2OD6A 4Z7YA 1T11A 1HNIB 2ZEJA 4PWWA 1VC5A 1GXUA 4XDCA 3K5MA 4FYDA 3ISZA 3PJWA 2YQ0A 2GV1A 1U8SA 4PXDA 2LXIA 4DX7A 1SKSA 3RBZA 5HATA 2WSEC 2XSFA 3D0GE 1N32F 1HWLA 4LF9J 4DR3F 3DYAA 3G96A 5IM0B 1TUWA 3BR9A 2FJAB 2Z4PA 1NCLA 4I2QA 4LF7F 2MHEA 1AROP 1KN6A 5MLCV 1H72C 2KRRA 2DRAA 3THTA 4CYUB 1JXLA 3DLGB 5LJ3Y 1OY8A 2B0GA 1FJGJ 2HVHA 2CPEA 4JI1J 2KO1A 1RWPB 3QZ8A 4DWIA 3OTOF 2YNHA 1IWGA 4ZVOB 3AT1B 4DPWA 4PPZA 4NXNJ 3PRVA 4LQ9A 2LDIA 3AJDA 4C0BA 1CJKA 4EK2A 3NLCA 2OO4A 2EG1A 3IWNC 3EVMA 2AV5A 3KMQA 1VLOA 2QFIA 5HQMA 2DNOA 4I1TA 3RBXA 4KO0B 4OYBA 3FSIA 1P8GA 5IC6B 1Q0NA 3LWLA 1S77D 1Q1KA 3NY0A 4O44B 1AFJA 4DX8H 1MNEA 4NOHA 1HR0J 1SB6A 4M5DB 1FRMA 1ZYQA 3A8KA 1PJ7A 4R5PA 4DV3F 4X4VA 1UVIA 3RAMA 2NQPA 2OUGA 2WAQD 5B0DA 5B7WA 3MR5A 5ADZA 1EKSA 3J7ZT 1HD0A 4Y2AA 3W60A 4JI8J 1S6OA 4O3PA 5LM7E 4J90A 1F3VA 1U6FA 3KDNA 3M8PB 1Y5IB 2HWTA 2NXCA 4DS5A 1IBMJ 3LGMA 1OYDA 2CWKA 1S9FA 4OYXA 4IDKB 1CC8A 4NI2A 2RF2A 3IRWP 4DL7A 3C14A 4DR4F 2C22A 2H1YA 5I3UA 2VDHA 3CO0P 3MMJA 3LW5C 1RWMB 1S1VB 3DRXA 3CC7S 3ENQA 1GTEA 4CO3A 2XM3A 3FBBA 5D15A 3GCXP 4F0HA 3AXMA 3LP0A 1QD1A 5I42B 4RNMA 6AT1B 4DQSA 5DG7A 4AD6A 4URSA 3HPOA 4F4ZA 4FDFA 2D41A 2JX2A 2EFPA 2P9EA 2OHDA 4TN2A 5C2GA 2EVZA 1TTHB 1NM2A 2EK1A 3BB5A 1B0VA 2OGUA 4CO5A 2CIMA 1FX2A 3RRKA 1T7PA 5D0RA 2IJNA 1LXNA 2V4JB 5KT6A 4DV2F 4YUDA 2ASDA 3QIPB 2CQCA 2K06A 2ALYB 1VQYA 2IC3A 5MAOA 4RLEA 4LQ3A 3A3PB 2E5IA 1YJ9S 4YDDB 2GJIA 4LMZA 3D68A 2DGSA 5IZHA 1PAEX 4OX9J 1NU4A 3JTOA 1MMNA 2MLXA 2UXDF 2FJDB 2RILA 1U2RA 4MK9A 4GVBB 5HVHA 2JDJA 1IQZA 2W7PA 1M5HA 5HJYA 4FF2A 2EC2A 4YB5A 3PKMA 4CLLA 3FFIA 4HHJA 3C15B 1WDTA 4CTAB 1HL6A 5G0RB 2AMCB 2PA3A 3WIUA 2GJFA 3D0HE 3FVYA 1X4CA 1FERA 4G1QB 2XMTA 2MKIA 1XR7A 2CPFA 3W7BA 3ILJA 2R8KA 2W2OP 3IBCB 2W2PP 1JLCA 4GKKF 1T9UA 1EETB 2QTWA 2C42A 2RB7A 4LR8A 2E5LF 1VQNS 1U0HA 3CIZA 4ALZA 5KFLA 1FF2A 4DL4A 2BJ7A 1RT4A 4QW9A 1GEHA 2XWXA 4FXVA 4UF4A 5HROA 2DHXA 3SMZA 1RA7A 2G0JA 4JI3F 5IWAF 2CZVC 2EG2A 3DRPA 5K14B 1VBZA 2HHTA 3CCSS 3LF0A 3DLEB 1WDDA 2XLIA 1TL3A 1S1XA 5KFZA 1XBWA 2CQ2A 2XI2A 2CJKA 3UDVA 4PKDB 4CT9A 4A8QA 3H40A 4OHYA 1ZAVA 4YY3J 3NBPA 4ZHRB 1HI8A 1MWYA 3M2RB 3UQSA 4YN3B 2RRNA 2QO3A 4BHQA 2VFUA 4GVLA 4O23A 4J37A 2IMWP 3N6NA 5CYJA 1FRIA 4EYIB 3TZWA 2DGUA 1U1NA 2NXJA 3CJ8A 5L38A 4LFAJ 3LGNA 3K0JA 2OIHA 1S59A 3KLVA 2R42A 4DPXA 2HS3A 2HG4A 3KNAA 1Y3JA 1SC4B 2X1GA 4JB8B 3AJ1A 1TK5A 3RBDA 2W24A 1FFGB 1SKRA 1Q7LB 1NK6A 1YI2S 4UOHA 4WFZA 5CCLA 2CQDA 3TUIC 2LA4A 3RW6A 1VQPS 1D3WA 5C25A 1DTQA 1RAEB 2OTJS 3EDRB 2FZGB 1HBNA 4DUYF 1HBUA 3POTA 3I55S 3MI7X 4JI0J 2BZ2A 1SVDA 4C8MA 2FPHX 1RWOB 1FO1A 3L7OA 4RZRA 2FHJD 4CI0B 2RQMA 3HKWA 4DEZA 3GFHA 3OFEA 4Z37A 2U1AA 3IP0A 4ECZA 3GMGA 3MDFA 4DV6F 3KLFB 3M05A 1RZMA 1WWHA 3QGIA 3LPYA 1XNRF 3PYGA 2IRXA 1AA1B 4TU9A 4RW8A 2X3DA 4I6WA 3GV7B 1T0TV 4O44A 3WZ0A 2YWGA 9RUBA 3M32A 3CMQA 1S49A 3FCHA 1MROB 3ZZPA 2F9DA 2QIFA 4IH6A 5B09A 1HMVA 1HHSA 2LQJA 2X51A 3DDIA 3MAHA 5H9EK 3P49B 2LEPA 3ZZ0A 4CT8A 1GXTA 3FMWA 4Q2LA 2XO7A 3TVKA 1N36F 4DR2J 2HKEA 3QNWB 1IKVB 1F1BB 4B3OA 3ETMA 2HHPA 2QE5A 1RWUA 3ZC4A 2A1BA 4QIVA 2MLYA 4AL5A 4OYAA 2HFZA 2MQLA 4QR1A 1RLDA 2M8HA 1T9TA 2C2KB 4K4YA 4HDHA 4DBQA 4DFJA 4ED1A 1N33J 3D0IE 3QYYA 4Y6IA 1Q8IA 2I38A 5BXIA 2SXLA 1ZPVA 3OJUA 3HVAA 4JI7F 3DRRB 2NPFA 1K0VA 2Q43A 1E6YB 4JI5J 2KU7A 3EJMA 2Y0BB 1ELOA 1TUGB 4E8UA 5LJ5Y 3AOBA 2CPYA 2CDQA 4U8VA 2LQ5A 1IBLF 2V68A 4WIIA 3QATA 4ECSA 4ZN3A 1NUEA 1S6UA 4ZITA 4CQ1A 3CJ0A 2HEKA 2G1HA 1FKOA 4R8UA 4RU2A 2QLXA 3DMJB 1WI8A 3R7BB 4DV0J 1PAUB 5C24B 3M2VA 4C48A 1XMBA 4A8XA 1RI7A 2QGFB 1UVMA 3MECB 1RAOA 2WZ1A 3GPAA 1HW8A 4DL0C 3I0SA 3KJNB 3PW5A 3H0PA 4G3IA 1S9GB 2HRTA 3OTEA 1V3RA 2HFVA 4FVMA 2MLZA 2V8VA 5C2CA 1M5SA 1CG2A 2A10A 2CPHA 3O44A 2ZZTA 2WTFA 4B9VA 1JLFA 1RT6B 5DZ7A 2LLZA 3V6HA 1EP4A 3DOMB 4UUWA 1NBEB 4QIGA 4CH7A 2ZD1B 4DQPA 4YEAA 3J80U 1VHIA 3J80Y 4U95A 4KH0B 1U2FA 1JJ4A 1F2HA 1DLOA 1KVIA 2VJVA 4CCHA 4X65F 3J7A1 3MPUB 1LW0B 2KVQE 2ZHAA 1NLKL 3UNYA 1SQFA 1U24A 2XHWA 1N52B 2UVVA 2ZUAA 4QOTA 1XEZA 3IAS9 3ZO7A 3CJ4A 4M95A 5ETSA 4O0NA 1K44A 1YIJS 2HAIA 4WFYA 4ZVTB 3NXZA 3W61A 4EFAC 1J2VA 4DS4A 4QR0A 4NCGB 2C2OB 3G4SS 4UTGA 2UXBF 3PG9A 5ETLA 2VKRA 4WFBQ 2YPYA 4I2PB 1UW4A 4DN9A 4DV4F 2YNIB 3K59A 2QZ8A 3TEHB 2MDAA 2HRYA 2VPZB 1FTRA 1RT7B 1KKHA 4Q45A 2I2YA 3CCMS 1HI0P 2LQ9A 2DNQA 4OJHA 1Q5YA 2MZSA 1PILA 3KK3A 3EDQB 5KFRA 3CVKA 1KLMB 1NH8A 2APOA 1DHMA 4FVCA 1N34J 3VV2B 1C0UB 1HNZF 5BJRA 1VS3A 4FYYB 2F1FA 2ZH7A 1REVA 2DEIA 5HSPA 3TZYA 1HNXJ 4OLOA 4WK1A 4DUZF 3BGFA 4FNHA 4FPIA 4PQUA 2EC0A 3HZEA 4WCEQ 4NWBA 1OPZA 3TOQA 3OR2B 3CJ5A 2IMOA 1CULB 5DGAA 1RWKB 2DR5A 1PSDA 2J9EA 3BS9A 1VRQC 2ALZA 2R7OA 1TUVA 3T3FA 2ASJA 2PMZD 1M5PC 1SI9A 3D6HB 1TL7B 4MKYA 4NCBA 5IV3A 2CJQA 3MUMP 4OLPA 1F9HA 3H5UA 4M5MA 1WEYA 1NZAA 2AW0A 2ZNZA 1GNKA 2V8DA 2N7CA 4N76A 1VQ8S 3UO0A 2VUGA 1GTHA 1PIEA 3MUTP 4L76A 3CTRA 1D09B 4DR1F 2YX4A 3K17A 4B02A 3UI3A 4MAKA 3OFGA 1FJ7A 2MZQA 4B3MF 4RW7A 3BGLA 1QSLA 1S1TB 2GGPB 4WP8A 3FBCA 4EGLA 2WSFC 1HW9A 5T7LA 2G0CA 1YZ6A 4ENOA 1RTIA 4C4WA 1RAFB 4OX6A 5LXYA 3HHDA 5A2QU 1R43A 3B82A 1ZA2B 5A2QY 4QWDA 4RL1A 3MM7A 4K4UA 2DD8S 4HKQA 2V5HG 1OQ6A 1J5EJ 5DO2A 2YH0A 1SJ1A 4DPTA 3N6MA 2QG9B 1WSVA 2RS8A 4FYWB 4PYDA 2GAHC 2GCFA 2M52A 1YJWS 1AZSA 1NK7A 3GIRA 3KMSA 1X5SA 4X66J 3UD4P 1S0VA 1Q8KA 2XCAA 1WJ9A 3W66A 4EEYA 2OKQA 5HMWA 5DDOC 4H4MA 2GHWA 2CRLA 3CJSA 1YJVA 3CXCR 2D9PA 4WE1B 4Y3CA 5F8NA 4O3QA 4F3MA 2H65B 3IS9A 4LSNB 4X4NA 4LF5J 1FXDA 1RTHA 3MM9B 4UZCA 4MT1A 2KFYA 4JV2A 2WOMA 3E01B 4OHZA 2DYAA 3S6EA 1NXIA 2CAJA 2F8HA 4CLZA 4QYZJ 3OJSA 3L3CA 3SDEB 2CWXA 2UV8A 1JKHA 3R7NB 4KFBB 3TZXA 4WKYA 2HHQA 4NZ0A 5D3GB 4NA3A 1UVKA 2A0FB 3OXLA 2N3LA 4D3GA 2GMJA 3I4PA 1EB0A 1TFWA 2VG7B 4FYVB 4X64F 2ZJQQ 2VZ9A 2UU9J 3MMAB 3SIPB 1XN9A 3EXYA 4JI2J 3R6LB 2FJWA 3PO5A 1HNVA 3BN4A 4IOAQ 1XR5A 2BQRA 2HFSA 2E1CA 3WX8A 4Z2XA 1WC5A 1KS2A 3Q23A 3B78A 2VIHA 4DV7J 3DLHA 2HQDA 3C66A 5GADI 3ICLA 1CLFA 4Y0FA 2YNFB 4DMZA 3KTQA 5D6GA 2XULA 2DCLA 2K1RB 2K3KA 3DGPB 3G71S 3GIJA 3DI6B 4XTTA 4C3LA 4IH7A 3ZZUA 4M5HA 3W8PA 1RCXB 2AZ3A 3VAJA 3TVYA 3EE3A 4ILRA 4ERDA 3SFGA 2UP1A 4NA1A 3EZ5A 3NS6A 3VGUA 2RS2A 5JUMA 2BOAA 2B43A 2KDOA 1EHWA 3OTOJ 5L1JA 1I3OB 1OYEA 3VAMA 2YWHA 1Q86T 1QSYA 2XEXA 2BQ3A 4ES3A 1KR4A 4X4OA 4LSLA 1JMTA 3I5BA 5CH7B 1VQ6S 3MMBB 2XHCA 3I96A 2NLWA 3D7SB 3BF4A 1WEZA 5F8IA 4NLVA 3VWSA 3QLHB 2KFZA 4I7FB 3BO4A 1M1KT 2DR8A 2ZM6J 3M7VA 3ZZRA 2HZCA 1ITPA 4C0HA 1E6VA 2JC1A 3W65A 4PZVA 2IYIA 4KJIA 5L46A 2CJYB 2I5JA 2QLJB 2UUAF 2JWNA 2NXUA 1TV6A 1URNA 2DVIA 2V6AA 2PN6A 4WTOB 1WHYA 2HS0A 4RWWA 3G6VA 4IO9Q 2POKA 3HSJA 1QSSA 3QZ7A 1XMOF 3LQVA 2AJ0A 3CSKA 2YKOA 1F3FA 5GAGU 1AFIA 2H5IB 5DRKA 1R8BA 3J7YI 1CPZA 3BN7A 1FTCA 5F8LA 5A6PA 2VBZA 4DR4J 1Z2LA 2BACA 4DI6A 1S76D 1NK5A 7AT1B 2EFOA 1RKIA 4X62F 5LSOA 2D9OA 1TKXB 1S48A 3GV5B 3NGDA 2BABA 4TLRA 3MXHP 3SCIE 2HNZA 3QO9B 3AB2B 1UEKA 3D54A 5F8GA 4QWBA 2W9BB 2D74B 4OHXA 3CD5A 4BC9A 1VHFA 5CZXA 1QVFR 3I0RB 4CLWA 1URRA 3E51A 4GC7A 5E3QA 3OPKA 3CGIA 5J2NB 2IRYA 3AODA 4ECQA 1UTAA 4PXBA 5A0YB 2YH1A 4IQMA 4E98A 2ZNYA 5F8JA 3SV4A 2DHSA 5KFBA 1TKZB 4X4QA 2RRBA 2XO6A 1C0TB 4G65A 4JYAF 2G2YA 1RT3A 1WF0A 4FYXB 1DJ0A 8AT1B 2CQIA 3DFEA 4HACB 2RDJA 3CPWR 1JJHA 5HN0A 2V4QA 4MK7A 4DLEA 3V6DA 5IT0A 4UY85 2B3TB 2C3UA 5ETVA 3CDBA 3CD6S 1X31C 3NGTA 1SUQA 2N4DA 2QA4S 4IRCA 4AYBD 2AGPA 3VGTA 2QX0A 2BW7A 3R2CJ 4NE9C 1MW7A 1SH0A 3H59A 2AJQA 2XLJA 1NSQA 1S9EA 2BX6A 2G9OA 2P6SA 3R3TA 5DLFA 1U48A 2J7UA 4NRUA 4CO1A 3DM2B 4UT4A 1UVNA 4CLUA 3IR5B 2UUBJ 4RWXA 2O1PA 2XI3A 1VR6A 3Q83A 1HKAA 1DTTA 3R1LA 3PEJA 3T9NA 2X1AA 4Y2IA 3D6MB 1QTMA 5GAHI 2DXDA 5AJ3J 1ZZFA 4C7QA 3I9V9 1U25A 4Y2MA 3UE2A 4NYOA 3ZFVA 1U4BA 3HVWA 4B9LA 4DL2A 3H2UB 2E5LJ 2ZJPQ 2EFNA 2Z30B 4UQTA 1VJWA 3HHLC 3BREA 4PXEA 5J1PA 3FUYA 4CLSA 4WIQA 1UL3A 4HL9A 4A8KA 3OFHA 2ZBCA 4OZ0A 1C1CA 5CXTA 2VJUA 5CABA 3AJ2A 3MM5B 4KRWA 4DG1A 7FD1A 1L3KA 1GT8A 4L3NA 1HBMA 1H3DA 1LWCA 4V19J 1OMSA 2VBWA 3I31A 3ILOA 3DGVA 3W5ZA 4FN5A 2V2VA 2V9WA 4LR9A 1VRTB 3HHNB 1O8BA 2P2CB 1KHVA 3ENWA 3UCUP 2NZCA 3I87A 4ELVA 2M88A 3C6TB 1BQNB 1DQAA 4NX9A 1WG5A 5E3RA 3PW7A 1CBKA 3PX6A 3PZPA 3CJ3A 3OD2A 3R5BA 1R27B 4M8LA 4LUBA 2CUYA 5M2RA 4MFBA 5F3TA 2ZKTA 4J91A 3H90A 3GTYX 2EEYA 3Q2TC 1YGYA 5J1NA 1TFYA 2IYGA 1FDBA 3BQ2A 3P3DA 1FJGF 2M4MA 2XZDB 1UJ4A 4NMXA 4JI1F 2E9TA 1QTNB 2AEJA 2CPZA 3JSBA 4Q5VA 2HBZB 3C6UA 2ZZNA 3UPFA 2LQBA 4NXNF 1EQ0A 4WP3A 1LV5A 3EXCX 4M1KA 1YG0A 5D4NA 1F6TA 2W2NP 1W2BR 4U7UD 2B8PA 1CSJA 2VQFJ 3RGIA 4F0MA 2H5EA 2MQMA 2CZ9A 4MJKA 1L3TA 4EWTA 5DZ6A 3OR1A 2FVSA 1L3UA 1ZS6A 2ZHOA 1TK8A 4ZPAA 5LL6d 3IG1B 4ELUA 3VZIA 3BKTA 1HD1A 4QPXA 1I5OB 2MPUA 5JVGQ 2WONA 1KTVA 4K4VA 3C46A 3GZ7A 4PPDA 3TARA 1HR0F 1Q8BA 2PEBA 1X8DA 4G1IA 2KZMA 2JFDA 3CDAA 4A47A 4F3QA 1QDUB 3ZNJ1 4GRSA 4RUHA 4ZA1A 2H4YB 5A8KA 2Y8YA 5K5MA 2V8HA 2R7WA 2EKNA 2W01A 5CCMA 5KFGA 4Q8FA 1TKDA 4IOBA 5SUHA 4JI8F 2XLKA 1SCJB 3V4MA 3DXSX 2H3EB 5EWFA 2YPZA 2AYEA 3EVWA 2FB0A 4EUVA 2HFUA 3DOKB 1IKYB 3KJFB 1N36J 1G4CA 1IBMF 4M5JA 4TQRA 3GYNA 1JLEB 2VOOA 3PY8A 3MM6A 3OL6A 3LH2S 2OPSB 4RNNA 4HTIA 3ZZYA 1D1UA 3SSQA 3HHLB 2IJRA 1PKUA 1RBAA 2YX1A 3FQLA 4QU7A 1NKEA 2FLNA 4ED4A 1H2TZ 4LIRA 4W98A 5F8HA 2VOPA 4F02A 4JI7J 5KFCA 3Q8RB 2AYMA 1WSRA 4AXJA 2QSFA 2HIYA 3DLJA 5H9FK 1X9MA 2JRSA 3D28A 2RU3A 2AWZA 1IWAA 3K5PA 2V9KA 1HNWJ 3U1MA 4ED8A 4FS2A 3SYZA 1FEHA 1YDLA 1RWWB 3FZBA 3RJMB 2HLUA 5EX3A 1I1GA 3CF5Q 1C1BA 1FI4A 1Q53A 3IRXB 2V63A 5DGBA 3PKYA 1AT1B 4NZ7A 4OZLA 2QSWA 3QIDA 4PWDA 2JEIA 2B5JB 2DXFA 5DDQC 1RUSA 3W64A 3M6VA 4OX9F 2E1RA 1WKLA 5K8MA 2Z2YB 4K7QA 4K2JA 4CH0S 3KFWX 3T1YF 4G6VB 3KK1A 2NCKL 3Q8PB 1VISA 2HGMA 3OLAA 3M8YA 3TZZA 1R8PA 1H2UX 4YP3A 3NNCA 2E29A 4DHVA 1C4AA 5B08A 1JNZB 2F8MA 1N5QA 4X65J 1EIYB 3EGZA 4P74A 5J2QB 2Z58B 1LQ9A 3T1HF 2PEHA 1SJ4P 3M1VB 2RSQA 2HQIA 2IA0A 4P72A 4ID5B 3FSYA 4PG5A 4AL7A 4F3OA 3HZGA 1KVKA 4RR5A 1UWBB 2GQ2A 3HHKA 4USWA 3NP5A 5A8WA 2DNHA 4PEOA 4ZLPA 2B4OA 4KPYA 4CNZA 1IJFB 3TQ1A 1Y00A 3IWXA 5A8RA 1NSKL 1PYOB 1NDKA 2P5VA 1ZM9A 4DL5A 1WTBA 2R7UA 3NGKA 2KG0A 4WU2A 3T5KA 3MD3A 3RB3A 2R7VA 5E3AA 3CCVS 1U49A 1FVQA 1Q8LA 3CMAS 3D6FB 1ZA1B 3VALA 3QGGA 3PIOQ 2K7KA 4J9NA 1ZAWA 5KT2A 4KSEB 3G9CA 2NS1B 4DL6A 5J2PA 2HS4A 4B9TA 1JLQB 3DKDA 1PYTA 2CNOB 1RTJB 3MTJA 4TU7A 4YY3F 2DH8A 3SI8A 1MMDA 2GMHA 1U0SA 4USTA 3HD1A 1GMWD 1KDNA 4I64A 3O5TB 3NNAA 1RYSA 2J7WA 1WHXA 2HHHF 1FXRA 2JSXA 5L1IA 3ILIA 5DS7A 4F25A 3A13A 1SV5B 2RT3A 4AQYJ 4NPOA 3I6PA 3W2VB 2ZVIA 1WACA 1MU2A 2BANB 4QCLA 2DNGA 3BR8A 5FD1A 2GVDB 3DNCA 4CLPA 1RACB 4KR0B 4O4GB 4ECVA 2EI5A 3FZ2A 2UV8G 5RUBA 4KH1B 2YKMB 2VONA 1IN0A 1GMVA 3UWTA 2PT0A 5E33A 4QIWD 1RWNB 1NPPA 2ADBA 3PYDA 4J7CA 1RGVA 2K7JA 3MR3A 3GR1A 3Q89A 2AKWB 1UAWA 4JI0F 3JS9A 2E1PA 4PQAA 2K8GA 5CYQB 3OQ2A 2OFHX 3KLIB 3CD0A 3IM9A 2GVZA 1CEZA 1Y4ZB 1SC3B 3C19A 1LWFA 4YS2A 3CJTA 3OHBA 3R97A 1KEKA 3NNHA 8RUCA 3KUHA 1A9NB 4HYKA 2MKKA 3OW2R 2DIUA 1UZHA 3CCTA 2BJ3A 3N0VA 3Q0AA 3M8QB 3Q8QB 1H6KX 4LT6A 2V69A 2HZAA 1HYSB 5AXLA 1UW9A 3JSMA 5KFAA 2CJBA 1WC0A 4OI0A 4ECYA 1RBLA 2EXUA 3LAMA 4MMOA 3BYPA 5IQ6A 1KTQA 4RBTA 4Q2MA 4CP5A 2V2ZA 1T9XA 1D8ZA 3JAMU 3JAMY 1FXLA 3PX4A 1RTDA 1N5YB 1LWEB 3FQKA 5HBMB 4FS1A 5F0WA 3A8IA 3OVSA 2BRLA 5E3PA 1JLAA 3GIKA 1D8YA 1R0AA 1HPZA 4S0MA 5KG0A 3W62A 2C28A 3W5YA 3CWJA 1RHQB 1CS4A 5FDLB 4DSFA 4F67A 4NLQA 1S12A 1EZZB 4ZN1A 2FUG9 4YHHJ 3R7SB 2GAGC 5ETPA 2LEBA 2AIRB 1NK9A 1N33F 1RT2B 4ES2A 5HVFA 1N6QA 3GU0A 3PV8A 4R0JA 1PCAA 3TQEA 3ZTRA 1QE1A 1WKKA 4TU8A 4FKYA 3UVJA 1ZPWX 3DHWC 2IDLA 1BE4A 4ETZA 4J5OA 2EBGA 2XZTB 3QAEA 4OI1A 4J9PA 2HHSA 3KLGA 4IFVA 1S1UA 2DBBA 3H2VE 3AD9C 1B64A 2HK2A 1P9YA 3O1LA 2KYXA 2CPJA 1LEOA 2MGZA 4KYZA 4OV1A 1VJQA 3M8RA 2F5GA 4DV0F 3DYAB 5I3QA 1SXLA 1KD1T 3CC2S 4I2QB 2PI4A 3PW0A 5K8NA 2ZDPA 3MPWA 3QWPA 2A6OA 1LWXA 3MEDA 5DG9A 4IR9A 1FDNA 5LSLA 5KOWA 3K8WA 5GMKa 3P96A 2JH3A 4ZJOA 5KFKA 2YNHB 1RTZA 3J81j 2XMUA 4KGKA 3OFFA 2N3OA 2NUHA 2H51B 4RBUA 5KTQA 1CJKB 3GE9A 3MFIA 3HSGA 3QPIA 1BXNA 2HYIB 2BE2A 1FE0A 3TX8A 4RW4A 4B3TJ 2GO9A 2IBKA 1WI6A 3N4WA 1U2CA 2V34A 5D78A 1XNQF 2QMXA 4C9DA 2J76E 2VC1A 5CYMA 2WVCA 1BQMA 3SCLE 4IYQA 4ECUA 1S97A 1XWLA 4ED7A 2R3VA 4R5PB 4WXWA 3TW0A 5DM6Q 3MCOA 3GONA 3A1YG 1TVRA 2F3JA 2DR6A 1H73A 1P9QC 5AXKA 3JQJA 1NZ8A 5L1KA 4C3KA 5HP1A 1NKBA 5KT5A 2I9SA 1NNDA 1SKUB 3FDSA 3LPEA 4WFAQ 2IVFB 4AE5A 1LK7A 4H54A 2QYGA 3PW4A 4DR5F 4H4OA 3OSNA 2ZOGA 4NI2B 2RF2B 5I3PA 3C14B 4KGVB 3RBEA 1LW2A 1N34F 1RAIB 2MJUA 5I3UB 2Q6CA 1UP1A 1XMOJ 4K4ZA 4TYBA 1UPMB 3S01A 1VCTA 3DCAA 1X60A 4DZDA 2LVWA 5KFIA 1NKCA 4OYMA 2ZE2A 4IG0A 1RKJA 1HNXF 2LDYA 1DBDA 2HWIA 3B6BA 3JSYA 3E8OA 5HQLA 4E0DA 2N82B 4J9OA 2BM1A 1GAOA 3IBWA 4K5RA 1JJ2R 3DN9A 1OQ3A 1G1XA 4Q44A 1T8EA 4B3RJ 1K9MT 3DXBA 2D3O1 4DXLA 1FKAF 1WC6A 3SEOA 1BD6A 3CDUA 3T5JA 4F4AA 2KRBA 1VQ5S 3OV7A 2LA6A 2UUCJ 4JOUA 4P6QA 2DY1A 2J9DE 5KG5A 2PE8A 1O0PA 1L5UA 3M4XA 2NZ4A 2MKCA 1R0CB 2IC3B 4FBTA 4R0EA 1ICEB 1Q79A 3VAGA 1FEEA 3HO1A 1FRLA 4JYAJ 2HRUA 3DU5A 1X9SA 4RW9A 1GX5A 3VAHA 2HBYB 3CCRS 1FRJA 1SL0A 2AT1B 4ATNA 2JLGA 4LR7A 2YTCA 2B56A 3CJ2A 3DOLA 1R6VA 1ZTWA 4PAAA 3MF5A 3M8WA 3JYTA 3C16A 5HMXA 3D1OA 1FWLA 3FFIB 2PA8D 4LRCA 2ZH4A 4C6AA 2CKWA 2VG6A 2GO8A 5HO4A 1NK0A 3UFCX 4ECRA 2HW3A 3M6XA 2FJEB 1Y11A 3MEEA 1KBRA 4JI4F 1N48A 3GJQB 4CLTA 1W7WA 1HHTP 3PYEA 3JSRA 1JLCB 4X66F 1T9YA 1CJVA 3TP2A 2DT9A 2RDDA 4Y2KA 1HI1A 1U0HB 1YRUA 2F63A 2P6TA 2YX7A 2D1CA 2R8HA 2P9GA 1RT4B 3M9OB 1XK8A 2FGOA 3CUNA 3R1HA 1KQSR 1F60B 5HROB 2RQ4A 1XC9A 3HJFA 3KK2A 4BCAA 3R5CA 2CNNB 4LF5F 2DHAA 1NJXA 4A8OA 3MOJB 3DRPB 3MMCA 2ILYA 4PG6A 1IKXA 5ETTA 4KBIA 5HLFA 1DARA 4ZPWR 1RAHB 1TL3B 1S1XB 3QRQA 1J27A 2KT3A 3M6WA 2DGXA 2BR0A 5E7OB 2ERRA 4BWJA 2IM1A 1UCNA 2F8EX 2XG8A 3NBPB 3K2YA 4U8YA 3FMBA 5D8HB 1S10A 4OI4A 2IM3A 1YJNS 3EPIA 3T9ZA 3RRHA 1KOHA 3NOGA 4KB7A 3RR7A 2VC0A 4JI2F 2E5HA 4LRBA 2B9WA 2W4PA 2XGPA 5KFTA 3PR4A 4J9QA 2CNLB 3M6UA 4JP8A 2CA9A 2DGOA 1HQUA 3QT5A 5HJXA
chains in the Genus database with same CATH topology
2HWHA 4WKYA 4LF8F 4DV7F 2HHQA 3AQOA 5KOXA 3AA9A 4NZ0A 5D3GB 4O3SA 4NA3A 1UVKA 3KHGA 4DSIA 3OXLA 4MIBA 5KAKA 3K58A 3GFXA 4F8RA 2N3LA 3PRDA 3DOKA 5F8MA 4D3GA 1IKYA 1LWFB 2GMJA 1Z1ZA 1T3NA 2M3DA 3I4PA 1P27B 2L9WA 2Z0GA 5KFPA 1TFWA 2M7SA 5BYSA 2VG7B 5B0AA 1WF1A 4X64F 4M5DA 2ZJQQ 1JX4A 3THVA 2ZITA 2VZ9A 2XS2A 5AE2A 3MMAB 2DH7A 5LXRA 4TXSA 1XN9A 3NAHA 4PCQA 4DR6F 4ED0A 2LKZA 3EXYA 3KKFA 1N5SA 4O3OA 1VQMS 3MPYA 1JLEA 2PDAA 2FJWA 3PO5A 5IT9Y 1HNVA 2L3MA 2GMLA 3BN4A 4IOAQ 1XR5A 3OUYB 2E1AA 4YB6A 2BQRA 5KT3A 2E1CA 1X5TA 2OPSA 2AF6A 5C25B 3CULA 3IO1A 3OVBA 1DTQB 2PIIA 2CYYA 2YKNB 1YRTA 3GV8B 4LFCF 3DRSA 2B7CB 4Z2XA 3JSMB 1HBNB 5EDWA 3MFHA 3OTDA 1KS2A 1HBUB 2DO0A 3POTB 3HHLA 4C97A 4J9MA 4JI5F 1YBAA 2HGLA 3VF0B 3Q23A 4W92B 3AHPA 1H0HB 4HT7A 3OTBA 3B78A 3ULHA 2DNMA 2HFNA 3KLEA 3X1LB 1MMLA 1Y9OA 3DLHA 2XS7A 2BRKA 1Q81T 2RVJA 3C66A 2FLPA 5GADI 3ICLA 4ITSA 1WEXA 1CLFA 3QGPA 4Y0FA 1FCAA 1ULRA 2YNFB 4PR6A 4DMZA 3M8PA 3KTQA 5D6GA 3LWMA 2XULA 5GAGI 1WHVA 2DCLA 3KYLA 2K1RB 2K3KA 1AUDA 4K2XA 3G71S 3M8SA 3GIJA 2FJBB 2ILZA 5M2UA 3RRGA 3DI6B 4C3LA 4NLRA 4DPOA 1V6HA 3GYXB 4IH7A 1KQFB 3ZZUA 1RTDB 3ONQA 2O66A 5KT7A 3UD3P 2JC0A 2OPPB 3RYLA 2QFJA 3VAJA 3RAQA 4IKAA 3TVYA 4IDKA 4DQQA 3K5OA 4ILRA 2C3PA 4ERDA 3SFGA 2DCUB 2LU2A 3MGJA 4HDGA 2DNLA 2UP1A 3HVTB 4NA1A 3G8TA 4N77A 4LVOP 3C3LA 2HIQA 4MIAA 2K3IA 3EZ5A 1LFWA 3DRYA 3NS6A 2UVRA 2JHEA 1TK0A 1ZM2A 3UW1A 2RS2A 2KH9A 3GQCA 1S1VA 2ZM6F 5JUMA 4U6PA 1JLAB 4RW8B 4TNOA 2B43A 2CQBA 2KDOA 3N28A 1R0AB 1HPZB 2BM0A 4U7UK 4OHVA 5L1JA 2DB1A 5DDRC 2OMOA 1N88A 2PMHA 3BZQA 1HQEA 4A4JA 3I82A 4QQBA 2IAJA 3VAMA 2YWHA 1YJUA 3M32B 1Q86T 1QSYA 5LT5A 2XEXA 2Q6BA 3H8YA 4ECWA 2BQ3A 1SC6A 3NL0A 4ES3A 1O5JA 2C3YA 1KR4A 4K59A 5I42A 3UCZP 4X4OA 1HMVB 4QIFA 4OHWA 4ZCMA 4LSLA 3CE8A 3QMQA 1JMTA 2VPYB 3I5BA 4ZPDA 3HM9A 4RBVA 5CH7B 1VQ6S 5KT4A 3K8VA 3IRXA 4B9SA 3MMBB 4O0IA 1N6QB 1VLYA 4K0KF 1DZ5A 3I96A 2NLWA 4FF4A 4I68A 3UDCA 3KLHA 2G1DA 2DNYA 3OTCA 3BF4A 1UJ6A 1WEZA 2UUTA 4B3OB 5F8IA 3TANA 4ILLA 2RIJA 4K4WA 4NLVA 3VWSA 4CH1A 1VIXA 3QLHB 1QE1B 4OL8A 2RMLA 2KFZA 1B0TA 2DIVA 5KFXA 4I7FB 4QU6A 3BO4A 1QAIA 4HEA9 4JI6F 4RW6B 2GHPA 4OZJA 2B5JA 3H4BA 5IQQA 2GA7A 3G8SA 1M1KT 4L6V3 2DR8A 3RB0A 5B0FA 3DLKB 3ZZRA 2HZCA 3CCQS 4A8FA 2GW8A 3TA0A 2FTRA 1KQGB 4C0HA 3LAKA 3KLGB 4LFBF 2XNQA 4IFVB 1FVSA 1S1UB 6FDRA 1L3VA 3NAIA 1E6VA 2JC1A 2VKZG 1SBRA 2OMLA 4X4TA 2R4FA 2V4JA 2EKYA 2IYIA 3G6YA 4KJIA 4GO7X 2RKIB 1IJEB 2MGZB 3T1AA 2BXJA 2I5JA 3QIPA 2UUAF 4JV5F 2HMIB 4ZVEA 1SL1A 3AQPA 1VK3A 2VBYA 2JWNA 4ZPTR 2NXUA 5LMUF 4IG3B 4QWCA 1D9AA 2JL9A 1TV6A 4PG8A 2OPQB 1URNA 1SJRA 2DVIA 5KG7A 1QLNA 3N9UC 4F4KA 5EWEA 4KQZA 2C2EA 1G6BA 4DDFA 4TQSA 2DRBA 4BC7A 4ZCKA 2PN6A 2R9LA 2MZJA 2YKAA 3DDKA 1Y3KA 1WHYA 2HS0A 4WZQA 4Y2CA 4QPTA 2BDPA 2O67A 4P2SA 4P7VA 3EPGA 4RWWA 5J2QA 3G6VA 4ZK7M 4IO9Q 2POKA 2R7SA 3U1LA 2E66A 1WELA 2QRRA 3LO3A 3M1VA 3TRGA 1TL5A 3D2WA 1S1WB 3MEDB 1QSSA 4ID5A 3QZ7A 1VMBA 1XMOF 3ITHA 2UVWA 2CQ1A 2KT2A 3LQVA 5GADU 1JLBA 5DQGA 2AJ0A 2BV3A 1YSJA 3T6JA 3CSKA 3U7JA 2YKOA 2E9RX 1UMJA 1T03A 2NPIA 5GAGU 1AFIA 2Q3PA 1UWBA 5DRKA 5B0EA 2N4CA 1NK4A 1R8BA 3QWUA 4LVNP 3M2UB 1SJQA 4ZPBA 5DETA 1SH2A 3J7YI 3PDNA 1CPZA 3BN7A 2CQPA 3U1NA 4WU3A 2I8EA 1FTCA 4R8UB 1FKOB 5KFQA 4YQWA 1VQ9S 5F8LA 3O8WA 1U6BA 2VV5A 5A6PA 4DSLA 2VBZA 1ZZNA 1Z2LA 5E41A 2BACA 4FF3A 2DHGA 4XPCA 3M2VB 1S76D 1NK5A 3FGVA 4CTAA 3HXMA 3F44A 1ROFA 2PGCA 4BS2A 2EFOA 2X1FA 1RKIA 4X62F 5G0RA 2D9OA 1TKXB 5LSOA 1S48A 1C4CA 3H2LA 3GV5B 1PO6A 3HK2A 3NGDA 2BABA 2VL1A 4G1QA 4EU0A 1C2PA 2CQ4A 2O3DA 4TLRA 3I0SB 1QUPA 1NEEA 4KGMA 3FNNA 3MXHP 5F9NA 2Q66A 3SCIE 2HNZA 3QO9B 2O5DA 2VBXA 3AB2B 1TKTA 3D54A 4PG4A 5F8GA 2BE2B 3MURP 1X4GA 1AXQA 2CQ3A 2L08A 4QWBA 2W9BB 3M30A 2WBRA 2MY8A 4RW4B 3MAQA 3Q22A 4DSEA 2D74B 1YVFA 4OHXA 4NLOA 2JFKA 1KONA 1X4DA 2R8IA 1K73T 3CD5A 4F26A 3KOAA 2VG5A 4OFZA 4BC9A 1VHFA 4HVZA 5CZXA 2FVCA 1EETA 1N5TA 2OFGX 2YKPA 2V4RA 1QVFR 4DL3A 3I0RB 2GX8A 3T5HA 2EWHA 2I1RA 1URRA 3E51A 3SSRA 4QBUA 5DDPC 3EX7B 4GC7A 5E3QA 4BDPA 3OPKA 3CGIA 5CYMB 5J2NB 2IRYA 1JLFB 3MWBA 4H4KC 3SXLA 1HWKA 1EP4B 1BQMB 4KHRA 2IFXA 4B17A 4AL6A 4ECQA 3LP0B 3CIMA 1VK8A 4PXBA 1JLQA 5A0YB 2YWKA 2ATLA 1S6PB 2E1MC 2YH1A 4IQMA 1FD8A 1HBOA 4E98A 2ZNYA 1RTJA 4ZVGA 5L1LA 3S7RA 2IVYA 5F8JA 1DLOB 1FDAA 3SV4A 3EGNA 3UR3C 1TP7A 2DHSA 5KFBA 2UUWA 4F2RA 1QY7A 1TVRB 5F41A 4ELTA 1TKZB 4X4QA 2RRBA 3S1TA 3QJPA 1C0TB 3KG0A 2R7RA 4JYAF 3BO2A 2YY3A 4QR2A 3IGNA 3IWLA 1VRUA 4KAIA 2AGQA 2FJVA 1RT3A 5C5JA 2J0QD 3PKMA 1WF0A 2V8GA 1DJ0A 5K14A 5DM7Q 2FVPA 2CQIA 2FY1A 3DFEA 1TL4A 5HP1B 2RDJA 3CPWR 1JJHA 1RT5A 3JB9k 5HN0A 2UUBF 2V4QA 4UOCA 4QJVA 3DLEA 3ZZZA 4MK7A 4DLEA 3V6DA 1WF2A 4WYLA 5IT0A 4A8SA 4GO5X 1F5CA 1SV5A 4UY85 2DO4A 3IXQA 1TAQA 2B3TB 1FT8A 4ZCLA 2C3UA 1G2EA 1G3OA 2F9JA 3W2VA 2EBEA 3CDBA 3G6ES 3CD6S 1FD2A 4ES1A 1FJEB 4NCAA 2BANA 1SUQA 3RZAA 2N4DA 2H9ZA 2QA4S 1M5KC 4IRCA 4LJMA 4H4OB 2XCPA 3PR5B 4IRDA 4AYBD 4XO0A 3GFYA 2AGPA 2DNPA 1R6YA 2LXUA 5AJ3F 4ZHRA 3NKYA 1LW2B 1S7HA 2KJWA 3M2RA 5I4MA 1MW7A 3K5LA 1SH0A 4USHA 4TY8A 1N0VC 3H59A 2OJ3A 2AJQA 4O4GA 2XLJA 4K50A 3FEYB 2CG4A 1S9EA 2G9OA 2P6SA 2FVRA 4NLSA 3QJLA 4UQGA 1U1QA 2YKMA 2WSCC 4NLTA 3R3TA 2ZE2B 4DOZA 5DLFA 4IG0B 1VQOS 1U48A 2N7YA 2J7UA 4NRUA 2RQCA 4CO1A 3DM2B 2MYFA 1UVNA 5HL7Q 2MKJA 2BYCA 3IR5B 2FIUA 3J7YU 3GILA 3H5XA 4RWXA 2O1PA 2VH7A 1U1KA 2XI3A 1UKUA 1WG4A 3BM7A 3KG4A 3EYZA 1T94A 3QJJA 5HBMA 2XC9A 2EFVA 2U2FA 4YFUA 1DTTA 3R1LA 2MKHA 1FNXH 4WZMA 3PRBA 4MKBA 2J8AA 5J1EA 2IA6A 3PEJA 2CPDA 1K1SA 3T9NA 2ROEA 1VBYA 2X1AA 4OZ5A 4Y2IA 2VA3A 4OI6A 3J7Z5 5CYQA 1QTMA 5F9LA 5GAHI 3KK3B 3KLIA 1UJ5A 1IR0A 3HP6A 3K57A 4AXIA 3N5FA 1ZZFA 4C7QA 5HQ8A 2HVIA 1PC4A 3KJVB 2IVMA 5A6WA 2PC6A 2DTJA 3I9V9 1X4HA 5M2PA 1U25A 4Y2MA 2KXNB 3UE2A 2XSJA 4NYOA 2W8LA 1R7IA 3ZFVA 5DQIA 1L3SA 1OSCA 1T05B 1GH8A 1IBKF 1J5EF 4QIEA 1B7FA 1BY9A 1QJHA 1U1RA 3HVWA 1U4BA 1REVB 1CQNA 1TL1B 4O3RA 2M2BA 5JVHQ 4B9LA 4USJC 4DL2A 1ZOTA 3H2UB 2ZZMA 1YJTA 1FRXA 4EBEA 2ZJPQ 2EFNA 2L41A 4UQTA 3M8QA 1RAJA 1RQ0A 4WJBA 1VJWA 4PQUB 3TR5A 3HHLC 3BREA 4PXEA 5CA5A 1HYSA 5J1PA 4NRTA 1FNMA 5B0CA 1UL3A 4G1PA 4HL9A 4A8KA 3L95X 4TYAA 3OFHA 5LSRA 2ZBCA 1YHQS 4OZ0A 4N47A 5IXUA 1C1CA 5CXTA 2WRMA 5IT4A 2D3OR 3AJ2A 4ZCIA 2PFFB 2HNDA 3MM5B 3RB6A 5H9FJ 2ZJRQ 3RW7A 4Y34A 4KRWA 3TAQA 1VC0A 2RQKA 3PACA 4EO8A 4FF1A 3VZHA 4DG1A 4JV0A 1L3KA 1GT8A 4KIAA 2KHCA 1HBMA 4L3NA 7FD1A 3OLBA 2C2RA 3BDEA 5JJBA 1H3DA 1LWCA 5GAEI 5J2MA 2HHUA 4XAKA 2R2RA 4KV8A 4V19J 4Q0BA 1Y0HA 1UVLA 2VBWA 3I31A 3HT3A 4RW9B 2MMYA 1N5YA 3SCKE 2OAUA 4K5SA 4DLGA 5DJBA 2LEAA 3U27A 4IO1A 1LWEA 3IC1A 4FN5A 3SFUA 2V9WA 2B4PA 2ASYA 2HGNA 3NCPA 3KLFA 1KC8T 4V19X 1U7LA 2OP5A 1UA1A 2KM8C 2GHVC 3VAIA 4OI3A 3MTKA 2LCWA 3DOLB 1BLUA 1SH3A 2B6AA 1VRTB 3FEXB 2VASA 3PNIA 3CCLS 3V6KA 1BWEA 4JV1A 4NLWA 1YTYA 2FDNA 3PJXA 4ED6A 5IS2A 3HHNB 5KFFA 1O8BA 4F4WA 3PVXA 1LXJA 1KHVA 2V0NA 4DSKA 2WHOA 3BGUA 1VGYA 1HWUA 3ENWA 3NWGA 2WB4A 3JYTB 4F4YA 3SQGA 3UCUP 4EYHB 5JXSA 1A7GE 2RNEA 4HH0A 2OLWA 4OZNA 5AE3A 4OI2A 3I87A 2V94A 2W7AA 4ELVA 1FRHA 4A8YA 4ZDNA 4RX6A 4CZCA 1MROA 2IHR1 2M88A 1KOOA 5FDLA 2RJZA 3C6TB 2XBPA 1RISA 2VG6B 1BQNB 1RJJA 2VFRA 1DQAA 4NX9A 3KHLA 2KFNA 2NUUG 3DHXA 4RW7B 1WG5A 1RT2A 2PO4A 2MXYA 5E3RA 3PW7A 2DGTA 3BQ1A 3PX6A 2J5AA 3PZPA 3MEEB 3OXGA 1S0NA 3CJ3A 4YMEA 4ZS6A 4U67Q 2IRUA 3OUYA 1IKVA 3VCDA 2J0WA 3R5BA 2EFGA 4DN0A 1R27B 5BR8F 4NLYA 2HPUA 2L48A 4LUBA 1R89A 4M8LA 4MTPA 2R7XA 5M2RA 4MFBA 3JTPA 2UU9F 2OD6A 5T7LB 4DR7F 5F3TA 2ZKTA 1RTIB 2VQFF 1HNIB 1VC5A 1GXUA 3MCSA 2XMMA 5FIIA 3IA0A 3CCZA 4XDCA 2VFVA 4B9NA 3Q2TC 3K5MA 4J9RA 1YGYA 2JEFA 4FYDA 1LKZA 5J1NA 2P9CA 3ISZA 5GAHU 2MHNA 2CVIA 3PJWA 2MQNA 2AQ4A 3U02A 2GV1A 1U8SA 1TFYA 3LALA 4PXDA 2IYGA 2RD5C 1FDBA 2LXIA 3BQ2A 5AXMA 3MM7B 2FD2A 3P3DA 1FJGF 3FEZA 3KNGA 2MZRA 2ZH8A 2M4MA 1SKSA 4PRFA 1UJ4A 4JI1F 3BJYA 2E9TA 1TR0A 2CPZA 3JSBA 4Q5VA 2QA1A 5KFSA 1FKPA 3C6UA 2FHJA 1RDRA 3MPVA 3UPFA 2ZZNA 2LQBA 2WSEC 2AGOA 2XSFA 4NXNF 2EPIA 3D0GE 3KK2B 1N32F 3M9NB 1HWLA 1LV5A 3EXCX 3W2WA 2A3JA 3NRBA 3CC4S 4M1KA 4RNFA 4DR3F 4NYZA 3DYAA 3DRRA 1YG0A 4C98A 5D4NA 5IM0B 4N56A 3G96A 1WTFA 2M70A 3MMCB 4ZP7A 1W2BR 3BR9A 2FJAB 1CSJA 1IKXB 2Z4PA 3QAUA 4I2QA 4LF7F 1E6YA 2H5EA 2KI2A 2MHEA 2MQMA 1AROP 1KN6A 5MLCV 5HLFB 1QUVA 2KRRA 4MJKA 4HI1A 3RTVA 1M5OC 1L3TA 2DRAA 1N0UA 4EWTA 3OR1A 3THTA 2FVSA 1IUJA 1L3UA 4TY9A 4B08A 3HHLD 1JXLA 2ZHOA 4H4MB 2GJ2A 4N8OA 3DLGB 1TK8A 1VI7A 4ZPAA 5LL6d 5LJ3Y 3IG1B 2B4VA 4ELUA 3VZIA 2B0GA 5GAEU 2HVHA 2CPEA 2KZZA 4C8LA 1HD1A 2KO1A 4QPXA 1JIHA 2MPUA 4HT5A 3QZ8A 2LU1A 5JVGQ 1NK8A 4DWIA 3OTOF 2WONA 2YNHA 3IR6B 1KTVA 4K4VA 3C46A 2C3OA 2A18A 4PPZA 4R25A 2CJ9A 3GZ7A 4PPDA 2ROPA 3F41A 3TARA 3IS9B 1HR0F 3DMJA