5J1TC

Torsinadeltae-lull1 complex, h. sapiens, bound to vhh-bs2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
VQLVETGGGLVQAGGSLRLSCAASGNIFSFNVMGWYRQAPGKQRELVAAITSGDTTTYADSVQGRFTISRDNAKNAVYLQMNSLTPEDTAVYFCNARRNPINGPYYTTAYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Torsin-1A
publication title Structures of TorsinA and its disease-mutant complexed with an activator reveal the molecular basis for primary dystonia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2016-03-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j1tC00
3MOBL 4O5LL 2F53D 1MHHA 1NGPL 3TN0C 3IXAB 4F2MA 1WT5A 1YEIH 1INEL 5D1XC 3P11H 4IOIB 4W68A 3PNWB 4YQXL 3IRZA 5EZIH 3F12B 4XAKD 2HA1A 3O3UN 4J3WA 1G6RB 4U1NB 1KJ2A 5LXGH 4P4KB 4DAGL 2E7HA 3OKEA 5F71A 1P53A 3TV3L 1CFSB 2Q20A 1O0VA 4NPYA 4JFFD 1WLHA 4MQXD 5T3ZD 4MJIB 1N8ZA 1JHTB 1LO2H 1MQ8A 3ARED 3QRGH 4O02H 1OY3B 4GRWB 4EDWH 1RJYB 5DJXB 1DQLH 3WUWB 3CXDH 4IMKA 4XI5C 4AEFA 4Z76A 3W5NA 3MGTB 4UDUA 5D7JC 5DJ2A 4K2UL 3HR5A 5BRZB 4LHUA 1YECH 9CGTA 1N2RB 5I76B 5CCKL 5HTSA 1A1NA 1IE5A 4OQ1A 5FM5O 4UB0H 1Y0LA 2P5WE 3K8KA 5E6IA 3VXUD 2CDGB 5CJOH 5DEFB 2HT2C 2N4IA 4I18A 2X05A 3RVVD 4Y1AD 3EJZD 3GRWH 4HWEH 2G5BB 1P7QD 2PO6C 3FRPG 4RDQF 1XGYH 3Q6GL 5A40E 3C60C 2HRPH 5I73C 2VXQL 3L3IA 1ZV5A 2OTWA 4DUVA 2DTSA 3O9WC 3Q2CA 1M6OB 1G1YA 4GRMB 4U1SB 3PF2A 4YDIL 3BRGC 4D9LL 1CFBA 5JOEA 4A2LA 1R3HB 4CU8A 5ESQA 4Y5VA 5SWSE 4FTVB 3GK8H 4P5KB 3TT1H 3MRDA 5I1KH 4XNUL 1SBSL 2FX8L 1PD6A 5KVDH 3Q48A 1FFPB 3ULVL 3BIAX 4ZNEA 1CDYA 2QSTA 1VFMA 1KPUA 5L0QC 1H5BC 4PPTA 1PYWB 3BSZL 3LRGA 4LU5H 5INCA 5ERWB 3BVNB 3JXAA 1UWGH 1ZT1B 1CICA 5LGHL 3UPCA 4NJAL 1UCBL 4MA1B 4QYOB 2CIKB 3KDMB 1ZHBA 3T3ME 4OD3L 3QFDB 4HH9A 5A3IC 4KV5E 4KFZC 4P23A 5J1AA 1CLOH 2CRIA 1A9BA 1EEYA 1LO0L 3QXVA 2P5EE 1E27B 3RP1A 4H1LB 4XCCH 3EOBB 1W72H 35C8H 4NT6A 5EFIB 4QCIA 3ME0A 5FV1L 1NC2A 3DARA 4ZXBD 5EIIA 2C9AA 4M9PA 4R4BB 1QLEL 2I60H 2NCMA 4PJCA 3Q6FA 3B3IA 1J18A 1I85C 2YPVH 4HEME 2XTJB 3QIWD 4X8JB 2ITDB 3HCVB 4NM4H 3QUXB 4LSTL 1ROWA 3C09C 5DJZA 2DQGL 1S8DB 25C8L 2WIIB 1K4CB 2QQLL 4P46D 5DJ6B 4S0SD 2DB8A 3VFTB 4TUKH 3ZE1F 3BT2L 2X6MA 3RKDD 2HH0L 4XWOD 3KYKL 1KXVC 1Z9LA 1P6AB 2AEPL 3P77B 5ELIA 5C2UB 3MOBH 3KWWA 2IJ0C 3SDAB 5IW3A 1EMTL 2Y5TA 4PRHD 2BJML 1WEJL 3MRHA 5DJ8B 2CRMA 1FL5B 1J1XL 3S5LG 1G9MH 3QP3A 1INEH 5I1LB 3EIFA 1Z3GL 4BFIB 1AGFB 3SGKA 2DQUH 4YQXH 5EC2B 3LH2L 3QNYB 3HG1A 1BZQK 1U8IA 3N50A 5IFAH 4DAGH 3H9ZA 4XXCA 3AS1A 4J3VA 3RUGF 5GIRA 5BS0A 4P2RE 5MENB 1QPXA 5EUOB 1T66D 3RVWC 2HJFB 2O5YH 3U46A 2NY5H 3LKOB 3BUTA 4F58H 2AK1L 5DC9B 2E8YA 4FQHA 1JZ8A 3BD4A 3MYJA 1I1RA 4U0RB 3NPZB 5C09E 2BCKB 5JHDD 3D69B 4R90H 4JRYB 4GS7B 5DRWB 3CFEB 2ZKHH 3UPRB 2NW2B 5CINH 1NBYB 5CCKH 1KT2A 3PJSB 4NRZA 5CJQL 1CLYL 2HT3D 3REVB 3O3EB 4NQCD 4JN1L 2XWBA 3KPSD 1NL0H 1CIDA 5MEQA 1U8JA 3IDMA 3DX8B 2JLLA 5GGSB 1NFDE 1P4BL 3MLRL 3RNKA 4HZLA 4PGDA 4WFFD 3MV9D 4ODXB 1QSED 4L3CB 1HXYA 2N1KA 2Q8AH 4GQ9L 4CU7A 1MCIA 3ZT7A 3G6JA 1EZVX 2VXQH 3LN4A 1NGQL 5GGVL 1DLHB 4YDIH 1FZOB 3CC5B 4HSQA 4XWGL 4MHHI 4ALAH 4DVBB 3V4VH 5CILL 5IT2L 1P84J 4YHNA 1JWUB 4ZUUA 4N0YH 1NAML 2X4OB 1WAAA 3BXNB 5JNYA 4MNGB 2Z93B 3MV7B 3MCLL 4K71C 4RBPK 4AZ8A 2A73B 1KJ3L 3F65A 4WFGD 4AMKL 2FWOB 4XNZB 2ORBH 5LKNA 1IC1A 4UILH 5B8CC 1BOGA 2X4PA 3OHXA 1KIRA 2LAGB 2VQTA 2CKBL 3C6SB 3IU4L 1UJ3C 4WFED 5HHOA 4MXVE 4LCUA 3DYOA 4HPYL 5GSVB 1WFTA 4ZUSB 2H9GA 5TDPB 3MRRA 1TCMA 4AEIL 3OWEA 4X4MA 4Z7WA 3KLAB 4OCSL 1G9NH 3CLFH 4ONFL 2HMIC 4QRUB 4OD3H 5CZXC 3F8UB 5JA8B 4YPJA 3LKQB 5B4MD 4UV4H 1RUKL 5I66B 1LO0H 3T0EA 4F7PB 1RSFA 5K9JL 4YPGA 4XCFL 3PWUB 2FB4H 5IG7B 3HC3L 1GL4B 3IDNA 3ZHLA 4C56E 3T1FB 4GKZB 3UZVB 3S36H 3PWPB 1P5UA 1P9MA 3GSOA 4PJGA 1BD2A 3HAEA 3LMJL 2E27L 3QH3B 3QQ4B 3BIKB 4I8DA 4IS6A 5HGBB 1N7ML 2NTSP 1DJSA 1AY1H 4NGHH 1MWAB 2F53A 2EDFA 3PQYB 3W39A 2YD9A 2QQLH 3D39E 4F3FB 4LCWE 1B3JA 3SKNB 4A6YA 3CH1B 1I8IB 3IFNH 3W9DB 4OCNC 1FG9C 3GMLB 1KG0B 2E7CA 4KJPD 3BD5A 4MXWH 1FYHB 4Z0XA 2V5RA 4EDXA 1RZ8B 3HPJA 3TBVA 4MA8H 5DD3H 4KTEL 3RA7H 4MYWB 2BJMH 1CZ8L 5DQJA 3P9WB 1A1MB 4QGTA 3S8WA 4NUGL 3CH8A 1J1XH 4K8RD 4MS8C 4JFFA 2C4FU 1ZLVH 3OJMB 3QR2A 3DNKA 2VN4A 1IGFL 4HKBB 1F00I 5FHAH 3AREA 3VGHA 4HLZH 4F33B 4BZ1H 2AEIT 1Z9MA 5ESVB 2GT9A 3OKMB 4QO1A 3P0VL 3PHOA 4Y8AA 4YZFF 5C0DA 4HIEB 3ZKQD 4UNTA 3FO2A 3WIIH 4F15C 4R7NA 4N90E 3UBXB 1YZZA 1NDGA 3G5ZA 4MD0A 2X4RB 1XZ0B 5M95B 2Q7YB 4JFDB 3V4PL 1Q9KB 5JOFB 4UIMB 4OI9A 2AK1H 2OYPA 3VXUA 1U8MB 3OGCA 4JY5L 1U42A 1UXWB 3VI4F 1P7QA 2M8XA 2YBRA 1CGXA 1LEGA 4TTDC 5C6TL 4JQXC 1XCTB 3VG9C 4JRXB 3L3GB 4OAWB 4YEEA 5KS9A 5L2KD 2VC2L 4JEGB 3DUUB 2A9NL 1EX0A 3C9NB 2HJKA 4ZAKC 2E6QA 2FIRT 1CLYH 2F5AH 3MJ8A 3O8XC 3OB0H 2V9QA 4JN1H 4UU9A 1SJEB 4HK0A 1Q1JL 3QQ9D 4RDQG 4F37F 1A7RL 3IS0X 3P9MB 1B6DA 3DJ9A 3PABB 2HJLB 3OQ3B 4RAVA 3X17A 1FNLA 2P46B 4OT1H 1AHWA 3CXHJ 1NGQH 5GGVH 2JF1A 1XIWC 5EA0H 3MZGB 4OF8A 4RIRA 4OLVH 1UGNA 2EEAA 4XWGH 3TT3H 1JGLL 4E5XA 3K2UL 5F88A 3MFFA 5CILH 3ZT5A 2Q6WB 3PHQA 5C71A 1XGTB 4K9EH 5GZNC 4HWBL 4DZBB 4N5EC 1I8LC 3ZYIA 3MCLH 1GIGL 1II4E 2OI9C 1EERB 2AXFA 4FQXB 4PRIE 5EOCL 4AENA 2QQQA 1E4XL 3TVMC 1BVKB 3SKOB 3ZE1E 5GRVL 4D9RE 1IT9L 1RFDL 2V5TA 2O5ZL 4EIGB 5F7HA 2Z0BA 5F7WC 2CKBH 2DLGA 2OL3B 5E8OA 1T5WB 3UTSD 5EUOF 4GAYA 5EU4B 4HPYH 5J89A 2VDQL 4NNPH 4AEIH 1CFNB 2DQIL 3E1F1 1JZ2A 4OCSH 5DHVB 4ONFH 4OLWL 4NKQB 3HS0B 1J86A 1JNJA 5C0GB 3WL9A 5CP3H 1YEGH 2VXTH 4ZNEE 3CK0L 2IH3A 1S7XA 4MCYB 4WU7B 3RFZC 1PGRB 2BFVH 3FONB 3RIFF 1YJDC 2YUVA 3QIWA 4IJ3B 5T3XD 5I8EB 2B1AL 3HC3H 4Z7NE 3DVFA 4P46A 1NCCL 2IH1A 1L9MA 4OD2B 3G6AA 4MA7L 4F57H 5IMLA 2X70B 5TE4L 4Y8DC 4Y4KB 4XVSL 4FG6C 3LMJH 4EUPH 3OL2A 2J6EH 2QJDA 1NUDA 5EU5A 1N7MH 4OB5H 4Q97A 4UI2A 2LFGA 2FNBA 5CBAB 3CCHA 3STZA 2AGJL 2YEZA 4LHJB 5HDBF 4PRHA 2DBJA 3O4OC 1MF2H 3EJJX 2AXGA 4K3JL 1R5VB 3VFWB 1ED3A 2PF6A 3MV01 3ZDXE 2IQAA 4RGNE 3HE6D 2R4SL 5DK2A 1JYWA 1BFOB 1LDPH 4FMKA 4OZFB 4URTB 1OP5H 3BZ4A 1LWRA 4S1DC 3LDBC 4O2CB 1DVFD 2WP3O 3NCJL 4AT6A 1AQKH 4L4VB 3L7EB 5KSUB 2HG5B 3KJ4C 2M26A 5B8CB 2YK1H 3H0TA 5FKPB 3FB6A 1HSAB 3LZFL 4FOMA 3HUJB 4ODTL 1CG9B 1UJ3B 1YMMB 5CZKA 3BKCL 4NQDB 1RZIA 2DQTL 3P0VH 4ERSL 4YHZH 5D71L 3BO8A 3DX7B 3LD8B 3BWAB 3I6LE 1HINL 2BHYA 5D7LD 5I8OL 1HEZA 1WFUA 5FOBA 5JHDA 3GSNB 4NN5C 1T7VA 5EC1A 2BK8A 4AQOA 4POUB 5HI3D 1Q9OA 5EU7E 1KCUH 2HRLA 4H26B 3VGDA 2H32H 4NQCA 4B0MM 3BPCA 2ZUVA 3KPSA 4FQCL 1H8SA 4MJIE 3T08A 5D7IB 4J3TA 4GRWE 5HBBA 4PLJD 3V5DB 3RY5A 3MV9A 1QSEA 2F19L 3BH8A 1EEZB 1FQ9C 3PDOA 5IB5B 1CGWA 3H3KA 1CT8A 1BM3L 1U3YA 1MJ7L 5BRZE 1PG7X 3VMNA 1A64A 3O4LB 3NH7L 4PRNB 1HDMB 1CU4L 3QA3A 5GGUB 1EAPB 4NKDA 3GSRA 1IJ9A 1YQ2A 3UC0L 4KJWD 1OTTD 1SEQL 4RWYH 5FO9A 4BFEA 3I84A 1NDMA 3NCEB 4NQED 2IAMB 3KPNA 4G7YL 4NO2A 1KTDA 4LRIA 5T5NF 5AD0B 1F4YL 5FYJH 4UT6L 2FJGA 4EXPX 2P8LB 1M7XA 5F1SA 1WT5C 4RNRB 2BVUA 4J3OC 5JDSB 4PJ7E 3BH9A 5EZOL 4PLKD 5A2LH 3OAYK 1C7TA 1CGSL 3BPNB 1F97A 5TGBA 2IANB 5EBWB 3VXNA 4D3CH 4P59L 4HULB 3QCTH 3O2WL 1NCUA 3QWOA 1EGJL 4UNUA 4WI5A 2H41A 3R8QA 4GRLB 1E4XH 2D03L 2GI7A 5H35A 4LSVH 3F5WA 2DBLH 3G6JE 5C0IB 4F7CA 3WNMA 2PW2A 4M6OH 1MVUB 1T4KB 1EZVY 1I8KB 4JM4L 1HOCA 2W38A 3THML 3EHBC 4L8BB 5DD0H 4DVRL 1N0LA 4F15B 5B39A 4XNMA 4IMKC 2BP3A 3GMMB 4WW2C 5TE6L 1T5XB 3PIQA 1HHJA 3KGRA 3EFFB 5AYUL 4RMRA 3U6RA 4PGEB 1KJVB 5F9OL 1I3GL 4HV8A 4S10A 3P4LA 2F58L 2GIYA 2DN7A 4PRAA 2IFFH 1AQDB 1CVRA 4JHAH 2D3VA 4OZIB 15C8L 3KNBB 5E6IC 1X4YA 3PGDB 4ODSH 1ITBB 4I18C 3SGDH 1BBJA 4G5ZH 5I19L 1KOAA 3BE1H 4HBCL 3X11A 1BFVH 1NCCH 2EC9T 2FRGP 2ENSA 1FZJB 5I75B 3QZWA 1C5CH 1FP5A 4MA7H 4LARH 1VEMA 4XVSH 5FYLE 2HLFC 1H3PH 1IGJB 2ADJB 3RWHA 3TNNB 2YUXA 4X4ZA 1U58A 4J8RB 1QO3B 3PL6B 1FNSH 1ZHLA 1F02I 2AGJH 2R0WL 2WNGA 4UTBL 2KZWA 3GJFH 3DYMA 2Q3ZA 2XTJE 2EKJA 5F89B 4Y5VC 4M00A 1K5NB 5D72L 2CXGA 1HXMA 1NGWB 2AQ1A 5DJYA 2VXUL 5DS8B 1VPOL 4Q74A 4YDJB 2AQ3A 1L6ZA 3T2OA 2ADIA 2RR3A 3K74B 3MLZL 2R4SH 3CFKB 4GMSL 5I1EL 1IGTA 4LCYA 4LVNB 5I16A 3F7RA 2BSRA 2HN7B 4K23L 5EBLA 1X5AA 3UX9B 4GKSA 3QCVH 3TP4A 3ECBB 1CICC 4IDJH 5J57B 1R3JA 4L9DA 5DQ9A 3LZFH 3VE0A 2CLZA 4ODTH 4APQD 4P23C 4WO4A 2QV2A 3QFJD 4ZUTB 2DQTH 3TJEH 4G43B 4IM8A 2MHAB 2VLRB 3O6KH 3FQRA 4YX2H 3CSYA 1T83A 2ZZUT 4JM2D 3K0WA 4IDLA 4RSVA 5I8OH 3A67H 3QDMD 4KKAD 4TQEL 1T0NB 5L2KA 3WIFB 3MREB 3TC9A 4B5EA 5E6YA 5MENE 4NZRL 1WBZA 1DDHB 5BVPL 3VFUA 1CXKA 3BMWA 4CDGC 4NQUA 3CUPA 2A0LC 2FATH 1JVKA 3ARBC 2GJJA 5TH2B 1ZWIB 5JDJA 1JZ3A 2HVKA 4PJFA 2F19H 43CAB 3RX7A 1EFXB 3DO7B 2OTPA 4LLMB 1BM3H 3GZKA 4PV9B 1FFOB 2CLRA 3MLYL 1EVUA 4JRYE 4FFVC 1BLNB 1F2QA 4PBXA 5E2VH 2LU7A 4QGYA 1S7SA 1GGBL 4RQQB 1ZLWK 2HKFL 3WFBH 4P9HL 3H9HA 1ZKAA 5ICXA 3QT2A 1AGBB 4Q7DA 1MCRA 4L8CA 2WV3A 5BOPA 1KXQE 2V17L 5GRWA 4HUUA 5JHLL 1RD6A 3SGKC 3LDBB 3UTSA 3IDIA 5HDBE 32C2B 4F7MB 5MERA 1JWMB 3L3HA 3HUJF 4WU5B 4NCDA 4PB9H 4XXCC 3MJGX 2E9JA 1BPVA 4YE4H 2C3XA 5ACZA 1IARB 3LKNA 5IQ9B 2D03H 4KAQL 4ZTOL 3JTSB 1NGZB 1IEAA 1TMCB 4MNGE 3MV7E 2YPLD 1P2CB 4XPTL 2R0ZL 1FIGH 3O2VL 4OI8A 1MFNA 4YFLI 1AD9A 2Z92A 4DKEH 1YA5A 4ODUA 4DVRH 4HJ0D 3QQ3B 4CNIA 5AAWA 4GG6A 4FXGA 1HHHB 3IXTB 4YDVA 4KMTH 1RK0A 4TTGA 4X6EB 1MFEH 4OV5A 1EH9A 5D7IF 1XCQA 1I3VA 4PTTB 5I30L 3UROR 4IIQA 2DI7A 4ZFGH 3ULVD 3WYRA 2LV4A 5CSZA 5DJDB 15C8H 4LVOB 4HF5L 4OCYH 4X6BB 3UYRL 5I19H 3KS0J 1VKXA 5DD6A 3NCBB 4HBCH 5EO1B 4GQPH 3ZKMC 4DN4L 3DV6A 4YHPA 1QZ1A 4FZEH 3FQUA 5DZLA 5HI4C 1U8OB 2EIDA 3RDTB 3F7PC 5IBLD 5FK9A 5I74C 4UTBH 5KANI 1UWXK 5GRJH 3C5SB 4Y88A 4F2MB 1WC7B 1OAYH 3N1PC 4ZFFA 3KYMB 4GW1A 1PG7W 3LQAL 3PQYE 3KPQA 3D0LA 2VXUH 2R39A 2C1PA 3R06A 4DEPB 1P7KB 4JZNB 3MLZH 3SDXB 3RWCB 3QYCA 4GMSH 5I1EH 1U93B 3C5JA 4K23H 4MNHA 5D6CA 1AGEA 4BZYA 1A6AB 5D7LA 3S4SA 4X98A 4ZNCD 4PY7A 4ELKB 5JW3L 3T0DA 4JHWH 3RTQD 4RA3A 4H8WC 5E2UL 3D85A 2R4RH 2K7PA 5ALCH 1M7IB 1D7FA 3DXAB 1YDPA 4G6AC 1JP5A 4XCYB 4X7TA 1BZ7B 4WW2B 4MX7B 5FO8B 4JFZL 1ZS8B 2EDLA 3I75B 3DRTB 5EO0A 3WEXB 3T0EC 5CEXB 1HQ4B 2G60H 5ID0A 3HMWL 4KDVA 4YBQD 1T21A 4TQEH 4DFHA 1HH6A 3BP7A 4OLZH 5I9QB 5IM7A 1SYVB 1ZT4A 5JXEC 4OZIF 3A6CL 2OK0H 3QIBB 2V5YA 2PCPB 2XA3A 5BVPH 1P9MC 4NWUL 1HYRC 1ZLSH 3ARVA 2UWEA 1ONQB 1T1ZB 5IJVA 5HHMB 3JBG7 4NQEA 2KDGA 4H25B 1ZT7B 1TJIH 1S7WB 1P5VA 5DMJB 5E5MB 1S9WB 2GUOB 1EEQA 4JRXE 2ZG1A 3PWJB 5FYKH 5JLZB 1LO5A 5HGHA 1S5IL 1C5BH 2ICWI 5BQ7A 2HKFH 3AMLA 4WTXA 3GRWA 3D48R 3SKMA 4M7JL 5K9OA 4NHUB 4D0CB 3FZUD 1UH4A 1NJ9A 3IKKA 2VXSH 3HI6L 2V17H 4P9MH 4CUCA 1QYGH 4MQXC 4OTXL 1A7QL 3AREC 3MXVL 2NR6D 2NPLX 2XIDA 4PJDA 5GGRA 5E5UB 3I02A 3AAZB 2MCG1 2R1XA 1IM9D 1MCLA 3HRZA 1PX4A 2OSLA 3I50L 3KPRB 3QNXA 3UBXG 2BNRB 3OAZK 2C4FT 4XPTH 5FGSA 3O2VH 1KNOA 2C7UA 5C08D 3OZ9L 4HUVB 4UQ3B 5TDOA 5FIEA 3MYZA 4XHQA 3V6OA 3RVVC 4U1HB 3FJTA 2B5IC 1L0QA 5F1IB 1F90L 2YRZA 3KS0H 4U1KA 2VDRH 4B41A 4GXUN 4QXWA 1CLZL 4OFIA 2FLRT 4QOKB 2KZ1B 4L1DA 5IKCB 2VDKH 1OP3H 3S3JA 4NN7C 3ARBB 4HXBL 5ESAA 1U8KB 2MQCA 3ZMRA 4TUOB 4BUHA 3T77A 1DE4A 1IKFH 3BP6A 2XY1A 1KGCE 4XVUD 1KENL 3U30C 2VZSA 1CGUA 1D3CA 3UYRH 2NY4D 1K4DA 3EZJB 5GGQL 1B90A 5JQ6L 1HHGB 1W72A 5JOPD 5T5FL 4LSPL 3OAUL 5D5MB 3IJSB 3G9AB 5F93C 3SGJA 5LG1A 1N6VA 4J6RH 2QKIA 3WXWL 2WBJD 1AHWC 1QSVA 4K55A 4M62H 5ICYB 5EB9A 3QJFB 4FQ2L 4Q9RL 3TBWB 4NC1E 3Q5YA 1Z0MA 4NQVB 3FTGB 3KWWB 3V52L 3U0TA 5IVOA 4H20H 4U1LA 1IEHA 1QFWM 2XT1B 1KF9B 4KMQA 3MRMA 1UZ8B 2BOCB 3M1BB 2JTDA 3CX5K 4BH8A 3J7HA 1LE9B 2YD5A 3QFJA 5T1LD 1R3KA 3EYVA 3ZO0A 2HVJB 4TN9A 4U6VL 4JE4B 4Z7UB 5D2LA 1ES0A 3GNML 4JM2A 4MLIA 3O41A 1A1OA 3MLPA 2OQJA 5JW3H 3QDMA 1V8HA 5CBEB 3SO5A 2ARJQ 2R2BA 5TF1L 3U0WH 1FV1A 3LRSA 4Z5RB 1TVBB 5EBMA 4HD9A 2VIRB 4G6JH 1MLBB 4S1RH 3H3PH 4FZ8H 3AS0A 1V3LA 3IS1X 4D2NA 1YMME 3WO4C 2Z31D 1H8NA 5F8RC 2DYPB 1W8NA 1FLRL 3IGAA 3QIWC 2V2WB 3HMWH 1NMCC 2BSTB 1A9EB 4HH8A 5HXMA 1FAIH 3A6CH 3LSOA 4P46C 4WTWA 3W81A 3BYTA 4JJ5A 5JZ7D 2ZPKL 3WE6B 1JPST 4IEFB 3RBSA 3MLXH 5F7YC 3FHAA 3RKDC 3EYUH 4XWOC 1U92A 3TPUB 1VADA 5I1GH 3UJTL 4LCIH 4G6FD 1Q9WB 2RIKA 1OGAD 3AU1B 1V3JA 3QPXH 4NC0B 5D7IE 5DGRA 5IVNA 1F6LL 3G5VA 4NO5A 3NOIA 4OUUB 2P7TB 3VXOA 4WGWB 3STLB 4JFED 4JN2A 3NZHL 1S5IH 3WIHH 1BQHA 3FMGH 3G6DH 4PREB 4OZFG 3O4LE 1Q0YH 1D9KB 3BMVA 2MCPL 3ULUH 1UXSA 1MHCB 1WCQA 3SCMB 3SDXF 3VWJB 3ABZA 2YC1B 5HYSA 1T66C 3HI6H 2YPLA 3FO9A 5E8PA 1RK1B 4OTXH 1RIUL 1IM3A 4Y19D 4LCUB 5KSBB 4POZD 1NEZA 3QHFH 1BX2B 4S1SL 3VFMA 3OKKB 4HIJA 2R2CA 4JY6A 4WW2F 3A6BL 3I50H 3T1WA 2EKSB 1MFCH 5FYJD 2IGFH 1JZ5A 1ZSDA 5H2BA 5M94B 4YHKH 2EO1A 3ARGD 2HT3C 2XN9D 3QQNA 3P4MA 2E3VA 5K59F 4PRPD 1H15A 1S5HB 1IAKB 3GMNA 4C4KT 1T20B 3RWFB 2PTTB 2W9LA 3QUMB 3TESA 4IRSA 4Z77A 2ZNXA 1XGRB 1Y18A 1CLZH 2VZUA 2D4FA 4WWKB 1R3LA 1B4JH 4X9IA 4DGYL 2JB6B 4X7SH 3KHQA 4HXBH 1XR8A 1B0RA 1VA9A 2OJZH 4PJXA 4AK1A 4MCZB 2FJFA 3U7YH 3OXRA 4GG6E 4XC3H 4OZIE 1N64H 1PQZA 3GBML 2H26A 5JQ6H 4LSPH 4NOFA 4LRIC 1E4KA 1A7OH 5CHNA 2DTML 4D8PA 3IF1A 4Y5YB 3GMOB 2XV6B 3SOBL 4G8IA 5F3BA 2P8MA 5E08L 1U36A 1XR9B 2ZUQC 4YDLC 1BIIB 4HKJA 3N1FC 2F8OA 3MRBB 5B38B 3IFOA 1K2DB 2R1YA 1MFAL 3RTQA 1FNHA 2XKNB 4R26L 1DUZA 2UY6A 2CGRL 4DW2L 4WY7L 5BVJA 5B4MC 3MTRA 1OGTA 4W6XB 1MI5D 4U6VH 2NX5B 4ODWA 1K6QH 3GNMH 4M7KH 4PG9B 3DVNB 5A1AA 3QUZD 3RL2B 1NDGB 5SWQB 4Z7OE 1YEKH 4YO0A 2CH8A 2CPCA 1ZTXH 5D2NB 1MHEB 5HVFB 5I15L 1OQOA 2DQJL 2G2RB 1IRAY 2X1WL 5DUMH 1G7IA 2P45B 1NAKL 5CWSA 3MCKA 4AG4H 2Q87A 4NC1C 2R2EB 1RJZA 4Y1AB 3ROOB 3SY0B 2BY0A 5ISZD 2J4WL 4OZ4B 2FEEL 4O2FB 4NSKA 2X4NA 5J11C 3FOLB 5ITFA 5M7QA 1IAMA 3N9GL 1IGIL 1U91A 3VXMB 4Q2ZB 1BHGA 3SO3C 5CGMA 4XPAL 3FFDB 4CADA 5D5MF 2Y25A 3TFKD 4KJPC 4J3SA 2YPKB 5DMKB 4TULH 3UJTH 2YRLA 3OR6B 4AIXA 1QKZH 1VFBA 3RZCB 2VE6B 2VQUA 1A7BA 4K8RC 2AEQL 3P3YA 3KPLA 5I1DA 2WBKA 1A47A 2IALB 1OLZA 4BH7A 5IHZB 3VRIA 2FEEI 2VDLL 1KIQA 3BN9D 4JGUA 3LN5A 1QRNB 3OKLA 1U3ZA 5KZCD 1MCQA 5K9QG 5C1MB 4U7MA 2MCPH 2IG2L 5GPRA 4X6DB 4Z7UF 2VH5L 4ZUWB 4JR9L 5HYEA 2Z91B 4EBQL 2OX5A 5C08A 4GAYB 3MXWL 4WO4C 5CP7A 3MRGA 3DX9B 3HLAA 4N0UA 4S1SH 3S4SG 5E95B 2C4XA 1T83C 5J3HD 4XNYH 3ZKXC 4BQCA 4JKPH 4ZXBB 4BQ8A 3VJ6A 2DWEB 3DROA 2OP4H 3WFHA 4Y2DD 4WCYL 5EU6D 1KTKE 4U1JA 4ZD3L 1A6WL 1HILA 2R69H 3QEQD 4ACPA 4XMLL 3RBGA 2R2HA 5AYQA 5FA3A 2OZ4L 2DS4A 1SJHB 2CKBA 4F80A 4JHBA 4KUCF 1ZANL 3QQ9C 5I17A 1EO8L 3ES6A 1MNUL 1HKLH 3INUL 2JB5L 2ATKB 3JSSA 2OBGA 4AL8L 3WKMH 3T0WA 1A21A 5E4EB 3ULSB 4XPGL 5EU5B 1JGVL 5CP3A 1FIEA 1LE5B 4OZHA 3GKWL 4LGRB 4FABL 3N1GC 1NMBH 4KHXL 5DD5H 5GS3A 1S9VB 1FDLL 2DTMH 1GZPB 3DVGA 3K2MC 1MEXL 4CVWA 4GUPA 3QG7H 5KJRH 2IEPA 3KAAA 3P4OA 4PRDB 3VGAC 3V0VB 3LHPL 5T1LA 4EUPA 1B0WA 4HJGA 2J6EA 5EWIH 5JO5B 3OJ2C 2BC4A 2E9WA 5SWZD 5DK0A 1CFQB 2MKLC 4WEMB 2BY2A 3FB6B 5KSBF 4L4TD 2Y4SA 3E3QC 2NNAA 2L4OA 1U8NA 4KJQD 4NRXA 4MAYB 5DRNB 3S35L 4XP1H 4RISL 1XF3A 3NIGF 2K3TA 3TBTB 2Z31A 2QR0B 1MHPH 1PFCA 3RWGB 3OG6B 2XZAL 5JHDB 1ZEAL 1P69B 4HCRH 1TXKA 3FAWA 2EECA 1R3IL 2GITA 1JPFB 4Y16D 3ARFB 3EJYD 1F6AA 1FL3A 2CK2A 1IILE 4WI7A 2GTWB 2KH2B 1LEIA 5DGQA 5C6WH 3OF6D 4WDIA 4IIQC 4KHTL 4UZGA 1WVZA 1LK2B 3DXAE 2J4WH 3QUKB 3QHTC 5GGSY 1OGAA 1U8PB 3QDME 2FR4B 3JWOH 4XBGB 1GRWA 5CEZL 1A6PA 3UDWA 1TNNA 4QY8A 5TQ0L 5K59E 4LPWA 4R4FL 4JFEA 3BYYA 4R4ND 4R2GD 4RFEB 1I9JL 2H32A 1BGXH 1QUNA 5GZOD 2I9TA 3DUSA 4PIRF 5E8NA 5DJCB 3M45A 2GCYA 3NIDE 3BKMH 4YAQA 4GXVL 1DVFC 5AZ2L 2YWYA 3UZQA 4QHNB 3KXFD 4JFOA 3QHZL 4UQ2A 5D1QB 1A6UL 2K1MA 4NQXA 4XP9H 4EEEA 3D3VA 1C08A 1HIML 4CMMB 1KCVL 2Q86B 1KC5H 1YEHL 3C8KA 2VDLH 3HZYA 4M8QB 1QD0A 1MRDH 1I7UA 1KB5H 1IC7H 3BW9A 1S7RB 4BSJA 1AR1D 3V4UL 1JTPA 1KPRA 1EDQA 2W9DH 1B6UA 1YYLL 4U3HA 1OD9A 1GAFL 4LEXH 3VFPB 1VHPA 1T1WB 5HI3C 1FNGB 4OJFH 1ZLWH 3WN5A 4S2SB 2XNAA 3MXWH 4DGIL 1B88A 3ARGA 2XN9A 5B39B 5DT1L 1T80A 5FYKD 4P2OD 5IW1B 2RQ8A 4HFUL 4PRPA 5HHXH 1HHJB 1OAQL 2R8SH 5D93B 5A2KH 4X9HA 3G5YA 4PLJC 1CR9H 2EIZA 4RFNB 3RJDA 3RPIB 2W60B 3EYSH 4PGCB 3HKFA 4PY8J 4M43L 1NANI 3LVEA 3KPRE 4ZD3H 5KS9F 2BNRE 4XMLH 8FABB 3TGXA 1EVTC 3SJVB 4UDTB 1VACA 2EICA 1U3HD 1WBYA 2DWDB 1EO8H 5KVEL 2PTVA 1MNUH 2Y7QA 2CD0A 4NYLB 1GGCL 4KJWC 1OTTC 3OPZL 2NY3D 3GHEL 5GS1B 4NZDA 1EV2E 1KLUB 5L8LB 4PJEB 4QOKE 3KPOB 4LCCB 3IAGC 5IP4A 1JGVH 3DRQA 4PLKC 3EYOB 4YC2C 5FYJU 3K80A 2BVPB 4PJIB 1MLCA 4NJ9L 43C9A 5BV7H 3BRFA 3PGCB 4FABH 4CW1A 4PJAA 4HXAH 5IR1A 1S3KH 4R7DA 3QAZC 4XZUB 1N4XH 4HDIA 3MROB 1XH3A 1FDLH 4K94H 2R56H 2GJZB 5TPWH 1J05B 2BVOA 4Y4HD 5D5ME 2BSED 3MLTB 1A4KB 1OP9A 2CUMA 1FO0H 1BQHG 4X6DF 1FCGA 1MI5A 3ILPA 4PJXE 3RVXC 4G7VH 4JFYB 4PV8A 3QUZA 4WI9A 1NC4D 3FB7B 1AI1L 3GJFA 4LLQA 3SDCD 3NCCB 3QPQD 3DX6A 4PJ9B 5HYSG 1KEGL 4OCLC 4EI5B 4EQ2A 3NFSH 3MOAH 1UWXH 1UQSB 4LF3B 4RISH 2XQYG 3RPKA 5LVEA 2XZAH 3H42L 3L5XH 4LQFL 3V6OC 4NQSB 4DKFL 5L2KB 1MJ8H 4Z7UE 3W82A 2P1YA 2IMMA 1X6NA 4MXQD 4PJ5D 1OB1B 3BGFC 5GRZA 3HI1A 3WLBA 3CZJA 4LLYB 3VRLF 5D9SA 4ZSOB 4N0RA 3T4AB 4JFXA 3VFUB 3VXRB 1K85A 1RIVL 2Y07L 4KRNA 4Y0GA 4TSCL 5ACMA 1J8HB 1NQBA 3QNZB 4ZOAA 4K7PX 4FQQA 4MD4A 3DUHA 4KK5D 5E8EA 4OIIH 3BQUB 4KTYA 2ZUTA 1YNTA 5CD3A 2Z35A 1NCNA 5F7NC 4GW5B 3SGJC 4X6FB 5K93A 4S11A 5L2JA 2X4QB 1DEEA 5TQ0H 1NLBL 1PG7H 1CGYA 1I9JH 2PW1A 1WCBA 1XGQB 2UV3A 2PYFA 1NCDL 3F7VA 1TQBB 3KLDA 4EOWL 4NKMB 1DANU 1B2WH 2FHCA 2EDRA 4C55A 2B4CH 5ICXB 4Q0XH 2IPTH 3LKRA 3AY4A 3QHZH 4XT1C 2DQDL 1FPTL 1RUPH 3VGAB 2VISA 4Z78A 1D5XB 1L0YA 3BUYA 4LEOA 1YEHH 4APQC 1DSFH 2WINA 3I6GB 2NLJA 1VGKB 4MJ4A 2Q76A 3KR3L 2D7PA 3TN0D 1OAKL 3FT3B 1BJ1J 4JM2C 3EOTL 1QHPA 4KKAC 4LMQE 3GMQA 4ZOEA 3BP4A 4PGBB 1S7UB 4CVXB 1GAFH 1FGNL 1AE6H 4Y2DA 4MJ5B 5EU6A 1QBLL 2BMKA 1G9MC 1H3GA 3QEQA 3FT2A 5DMGD 1PJ9A 5IHUH 2ZUUA 3VFNA 2V2TA 1OAQH 1J88A 5KSBE 2BRRL 3BOVA 1OCWH 4M3KB 1TQCC 1KEMH 4M7ZB 5ANMB 4LP4A 4I9WD 4L3ED 3B9KD 3LAFA 4MWFA 4PRBA 4M43H 4RGOL 4G8GD 1AP2B 2MQ0A 2R1WA 5ABDE 2E9BA 3HZMB 3CFJA 1IKNA 1KELL 3RGHA 2CSPA 4G9FD 1ZGLB 1J1PH 1UG9A 3MPCA 1G6RL 2NY5C 5DD6B 5DVMA 3OAZH 3P4NA 3LCYA 4JQVA 4N0UE 3BDBA 3QEUA 2X4SA 3TEUA 3OPZH 4DFIA 1A5FL 2AV1A 3GHEH 3M8OL 5ETUB 4AEHL 1AC0A 4NZTL 3UTTD 3DV6B 5FHBH 1F8TH 3MRFA 4HUXA 3HE6B 3A6OA 2RJMA 2W9EL 4QRRB 4I3RH 1I9IL 5F6IB 3AB0C 3G5XB 4Y4FB 1KN2L 1JGUH 5C0CB 1B0GB 2IBGA 2JJTA 4NKOA 1F5WA 4HIXL 1O7SA 4OLEA 1UWEH 1DVFB 4ENEC 4ISVB 5SWZA 3V95A 2IADB 2MFNA 1GGIH 3MV11 2ZSWA 4L4TA 3R06B 4X6CB 2L0DA 1TVHB 1CCZA 4DQOL 1KBGL 3UZEA 3DIFB 3VG0H 3MBXL 2B0SH 4U1GC 5E7BA 2QTEA 5JPNA 4KQ3H 4RAUA 1W0VB 3EAKA 4PY7B 4CVUA 4OZHE 3K81A 1LK3H 3MJ7B 3Q3GA 1MCWM 3JWDH 1AI1H 4I5BB 4PUBL 2D31B 1F4XL 4Y16A 5L8KB 3A0OA 1JNNL 3TA3A 1Q94A 2IF7A 4KZEL 4AM0A 2GK0B 5KN5B 3OX8B 3OKDA 4NUJB 3D25B 3WLWC 3OF6A 4P57A 3RGVD 2JK5A 4WFHD 2ED7A 4U1IB 5ICZB 3ULVC 2J88L 5HJ3A 4LDOB 1FN4A 1QA9B 4LQFH 3V7AE 3L6FA 2NX5E 1E28B 3IDYC 4JVUA 3MACL 5FF6A 1CF8H 4IRSC 5JA9A 3BGMA 2VLMD 1JGDA 1GC1L 3OR7A 5FGBA 2BNUB 2PYED 5HDQL 5C7XL 1RIVH 2HLAB 5J7CC 4J1UA 3MRNB 5HPOA 3B6SB 1P7HL 3DHJA 1AKJD 3EO1B 1XAUA 4PJEF 3LQZB 3OKOB 4P4RA 5F96H 1OSPL 3KXFA 1RZKH 1VSCA 5F1NA 4JPWH 1ORSB 5DYOA 5I8CB 2YS4A 1A2YB 2ZSVB 2XPGB 1E4KC 4PP2B 5LBSL 3UJIL 1I7RB 3X14A 2BY3A 1JL8A 4ZYKA 3VXME 1UYWL 1G7LB 1DN0A 3B2VL 4L8SB 4OFKA 4KK9D 1NCDH 1A6ZB 1BQLH 4JDTL 5K9KB 5E9DB 4XH2A 1BJ1H 1JHKL 2AJSL 5D8JH 3U4EA 1OGAE 3B2UD 5B38G 4UNVA 2A83A 2H6PA 4YNYB 4PJ8D 5HGAB 3W11D 5FYLL 3RTQC 5MEOA 3SN6N 1X9QA 4JO3L 2Z4QB 5DUBB 5GRYA 4U33A 4XHJD 5JORA 3GSWA 4EUPG 1EA9C 1U6AL 4QHLB 2WQ8A 2R23A 3KR3H 4P2OA 5KVFH 3DMMB 3V7AG 4UINL 3RX5A 2W07A 1XT5A 1M7DA 2BNQD 1KLGA 1REIA 1QRNE 2R0KL 2ZP0T 2CDEA 2DQEH 4YBQC 2WUBL 2DKUA 4PB0L 3SQOH 3UCRA 3U1SH 5C0BD 3TLRA 3MJ6A 1PEZA 1YPZB 4RWHA 4W70A 4NCC2 4XBEL 3PP3K 3D3VE 1MIEL 1OAZH 1TIUA 3O3BA 1PEWA 2EE6A 1G7QA 2BRRH 3BKJL 5IWLC 3EUUA 4BELD 2LTQB 4U1MB 4QWWC 3RVWD 4X0KB 4A6YL 3RNQA 4LSRL 3V0WL 1BVLB 1EUUA 2NTFA 4XCNA 3FQTA 1HHKA 1TZHA 4HG4K 5C0FA 1KELH 5FXCH 4G6MH 3UTPD 4ZFOB 1G6RH 3UTQB 3QO0B 4R0LB 4ZS7L 3I6KA 3IFPA 4PRPE 4L9LA 4NZTH 3T0AA 3VRLE 4BQ9A 4JG1L 1QLFA 5FYKU 4D0DB 2M2DA 3FZUC 5H94A 2OLDA 1SJVA 3HMXL 4Y4HA 3O6ML 2V7NA 1KN2H 4F8TA 2WW8A 1YEJH 2QQNL 4KTDL 4G80B 5BOZG 4KXZH 2KKQA 2NR6C 3TYFA 2EXWC 1NGXB 4HIXH 5IB4A 5LGJB 2DQHL 4FNLH 3FN9A 1NC4A 2CIIB 1UKQA 4H5SB 3SDCA 4E42B 2R9HC 1FLTX 4GOSA 2PR4L 2VL5B 3HI5L 4APQB 3TH2T 3AC0A 3GJEB 4DQOH 5DZOA 1S7TA 2XWTB 5AEAA 1WTLA 4UUJA 3PWNA 4CBPA 1INQB 1NCWL 2VAAB 5IB1A 3P9LB 3BWUC 4PGJA 3LV3B 1A1OB 1XGUA 4GSDL 1CD1A 3U7AA 2ZCHL 2Z9TA 5HPMA 2H8PA 4K9EC 4PJ5A 3MRJB 1F4XH 4XNXL 1NKOA 4KZEH 7FABL 1I4FA 4HS8L 4P3DB 2VSDA 2F8XC 4TNVK 4RMTA 2DJSA 2J88H 1DEDA 4DK3A 1G0XA 2Q1EA 4D9QE 1JPSL 4XVUC 5J12B 3T8XA 2G9HB 1IZKA 2CK0H 4HIHB 4DZ8B 2A6KB 2NY4C 1T1XB 2AJUL 4JAMB 4KKBD 4M1GL 3DHMA 2AJ3B 3ESUF 1GC1H 1S7VB 2DLIA 2J5LC 3ISWA 4N1CA 2OXGA 1I3RB 4ZO6A 2FZ3A 1YUHB 4WI8A 4H0GA 3HZKB 1FFNB 1JWSB 5I71C 1ETZA 2X4UB 5AZEL 3MO1B 3MQIA 4YXKL 5T1MB 3WJLA 4WW1B 3NTCH 5EIQA 1MFDH 5BXFB 1TETH 3EKCA 1QR4A 5FECA 3F7YB 3RY6A 1PZ5A 5IEHB 5EORL 3MLUH 1GVIA 4PJHA 1UYWH 4HAFA 2F54B 4C59B 4X6CF 5DVNA 4NO0D 4KRMB 1AXTH 4H1LH 4LK4A 1F6FB 5HSFA 4K7PY 1FVDB 5FYLH 1RZ7L 2X2YA 3QUYD 2PXYB 4JO3H 1DCLA 2BVQA 1A22B 1K8IA 3EDFA 2W65A 5KBNC 2A6IA 2P5ED 1U6AH 3QWRD 1JNHA 1ADQL 5GGRY 1DQQA 4OGAD 5CJ8A 5D96C 1HCFX 3CMGA 4M03A 4JZOB 3WIHA 3QI9B 2Z31C 1MWAL 4YHML 1PKQA 4ELMB 4WEBL 4X80L 4L8DB 4MS8D 4XNQA 1DFBL 1YNKH 4L3EA 4ONOA 3B9KA 3PV7A 4JDZB 3MGOB 4XBEH 2ITCA 4MSWB 3S96A 5JZ7C 2V7HA 1DBJH 4G9FA 3D87B 5FB8A 3GMNB 1X5LA 4G8FB 3IDYB 1KJMA 3QXAB 4GKNB 3IJYB 5IEKB 5DTFA 2HWZL 4HQQH 2AJYL 4OZGE 5AG9A 4LSRH 5CIPB 3SDYL 3F58H 4LOUD 1CDIA 3FT4A 4PJBA 3MFGB 2ERJC 3UDWC 3U48A 1YYML 5KG9B 2QHLA 3B4NA 3QULA 1HH9B 3JVGA 3LIZL 3IVKB 4ZS7H 2AJVH 2H26B 3SJVE 5EUKA 3VCLB 2HFGL 3H7LA 3W9EB 4DN3L 2YD7A 3IRPX 2H45A 3U79A 2C1OB 3IF1B 1BWMA 2W0PA 2A77L 3E2HB 1DBBH 2EYRA 3HMXH 4IBLT 1DZBA 3HA0A 4KRPB 4FQ1H 3NVQA 3HC0B 3LPFA 3ROLB 2VDML 4PJEE 3MR9B 3QXDA 1ODAA 3HTLX 4OM0H 4POZC 4YFEA 5IQ7L 4V1DB 3PXJA 4FXKB 4P2RD 5EBGA 4PJIE 3GSXB 5BMFH 3TZVD 1FBIH 3HI5H 3DTXB 1ORQB 4DCQB 2XWJA 4MD5B 2XFXA 5BO1L 4OI7A 3RGVA 5L9DL 1QFUL 2VWEC 3WN5C 3ARGC 1YPZF 1UACL 3KYOA 3QJHA 4GSDH 1CE6A 5HGDA 5C09D 1D6EA 4HUWB 3UTZA 3V5HB 1V05A 1AD0B 1T89A 5EPMA 5HYIA 2H3NA 1IGYA 3MC0A 4XRCB 1I1FA 4OM1L 2JCCB 4HS8H 3CZFA 5DC4B 2PYEA 2V2XB 3L5WB 4J4PD 5C0AB 2NY0B 3C5ZD 4LSUH 1U8HB 4PTUB 3HE7D 3WDHA 3DGGB 1AKJA 1U9KA 4I4WA 4LFHG 4YR6A 3RVTD 3UJJH 2VTFA 4M1GH 3BP5B 4TUJA 4XP4L 2DJ4A 4NWTL 4HMEA 4XAWL 2XYCA 3GI9H 3TIDA 5B3NA 1GYAA 1QSFB 3AROA 1AGDB 1MJUH 1D5ZB 4G3YH 3HR6A 2CR6A 1VFBB 2QADB 5AZEH 1J8HE 3VA2C 3WHXA 2HKHH 3TIEA 4PJ8A 4HIIA 4WENB 3Q5OA 5LGKA 3L95A 5EORH 4FG6D 1S7QA 4QHMB 3PE9A 4ZDHB 2ESVB 3OKLB 1SJXA 5JW5B 2WP3T 2WZPD 5DR5H 4OLUH 2R29L 3U0PB 3GMRA 4OF0A 1JRHH 2BNQA 2FO4B 1IM9B 3P73B 3QUZC 3HHRB 4PG2A 1X5YA 4GAJL 1RZ7H 3FN0H 4M48H 4B50A 4UT9H 4MQ7B 3WKNA 4EKXA 4NNXA 4W4NA 1AGCB 3SGEH 1I1AD 4O00A 5IOPA 1YEDB 4EVNA 2W59A 1CFVH 1IEBA 3PWVA 5GJSL 1INDL 1MWAH 1NAMB 4JFPB 4NP4L 4MMXC 4C56D 4X80H 1AR2A 2XZQL 1G7MA 4HFWA 3I2CL 3DROB 1MPAL 3NPSB 3VXTA 5I2IB 1VENA 2AAVA 4YIQA 1CFTA 2FX7L 3E6HB 5GGTH 1FG2A 3FQNA 4QRPA 5FA3B 4JG0H 4JB9L 4N0FA 2NW3B 2G75B 1T22B 5FYKE 1Z0NA 3QDJA 3TFKC 4I1NB 4TRPH 1NKRA 1ZOXA 3GSQB 1NH6A 4GFTB 3D39D 5KTEL 1LEKA 5IB2A 5IV2B 4K8RL 3PWLB 4LCWD 3FRPA 1TZIA 2BHUA 3L3KB 2WBJB 2FX9L 3SDYH 1PY4A 5ANME 1H0DA 3BESR 3SDDD 1IC4H 4OCXL 4Z7VB 4JKMA 1YYMH 4NRYA 5GRUH 1S9XA 4ZUVB 3L3JB 1A6TA 1A6VL 3BN9C 1JK8B 1FGVL 1OAUL 2VXVL 4ZQKA 4DN3H 2EH8H 3I3BA 3L3OA 2A77H 4I0PB 1R5IB 3IDXL 5EZJB 3AY4C 4K7FB 5IF0A 5DEGB 2DMBA 3TCLB 1JV5A 2HFEB 4KROD 3VD7A 4WV1B 3D6GA 3LEXA 3IDGB 3MRCA 4HC1H 4Q6IB 4QRRE 3GSUA 5C0CE 2VLLB 2N56A 1F3RB 4N90D 5J3HC 4M6ML 3NZ8B 3BIBX 4MZ2A 2SEBB 4NRXB 4P5TA 5LWYH 3BZEB 1VFAB 3FFCA 1SYSB 4ELMF 1W0WA 4M93C 2ZUYA 4Y2DC 5IMOB 1JYXA 1HHIB 4X6CE 3QIUB 5AUMB 3FOMB 3K4ZA 1NFIA 2ZJSL 3FO1A 3L9RB 4N9OB 1UACH 2VO5A 1DBAH 1MFBH 4M6NL 3GIVA 4OIAA 2WLZA 1JPGB 3ULVF 4Z8FL 3HNSH 5KSAB 1DQTA 3O11A 2X1XR 3O6FD 4TSAH 1F58H 1G7HA 6FABH 1F3JA 4QNPF 5FA4B 3VMPA 3CSPA 1UCTA 3EHBD 5HGGS 1IKNC 5GISL 2D7QA 4WUUB 2X44D 1BAFH 4P2YA 4JQVC 5J13C 2UZYB 3L1OH 5E2WL 3N1QC 3WDIA 2ARJB 4HCRA 3VFRB 2VDNL 3IETB 1CL7L 4LLVA 3CLEL 4XAWH 5IMKB 2P24B 1YN7B 4MDJB 1U8LA 3GO1H 2OL3H 4GMTH 3MBEA 1RULH 1T3FA 1VFOA 2JJTC 5EOQL 4NO0A 1QBML 2CUIA 2X7LA 4WHTB 3S7GA 4KJYB 4QRTB 3TO4D 4PRID 5HHPB 4EQ3A 5DHVH 1HI6A 4J3UA 4WRLA 1JNLH 3O6LH 4D9RD 3MA7A 3REWA 5DI8A 3NMEA 1FC2D 5IW6A 2AJZB 4Y19B 4KJQC 4HT1H 2GSGB 2WIMA 3CAFA 5F7EL 3QWRA 4KDTA 5A2JH 4JO4H 3S88L 5D1ZB 4ETQA 5TFSH 3AXLA 1M71B 2VSCA 3BKYH 3CVIL 5CKGA 4WGVB 3MLSL 5F9AC 2VABB 1CL7I 3IU3A 3NAAH 1NGYA 3DOSA 4NOBA 4KI5E 5F3HB 4GAJH 5E9DE 3JV6A 3CPLA 3MNWB 4N8VA 3CDYA 4Y16C 3EJYC 1XF4A 1ACZA 3TA3C 5GJTL 2EEBA 5C0EA 5IHLB 1T03L 4ZPTA 2HYMA 2GEEA 5GJSH 1INDH 4NP4H 3CFBA 5C0JB 5EDXA 2XZQH 5DHXB 2C3GA 3VFSB 4RX4D 1LMKA 5ENWA 4ORGB 2E9IA 2CJUH 2DICA 3MRQA 5FGBC 4IRJB 4LDLB 2AK4D 5SX4I 1AJ7L 1WBXB 5FUCC 3L7FA 5H37H 3CFDA 5BZWA 5GS0L 4OZFH 2VDOH 4R2GC 4X5XA 1JYNA 5GZOC 2N7AA 1MH5A 2LE9A 1UVQA 4X4XB 5CEYB 1VGEH 2F74B 1NC2D 4LIQE 3ULUE 3KPPA 1IAOB 4I9WE 4EN3D 4RGND 5DRXA 1ZVSA 2XG4A 4OCXH 5ALBH 1E6OL 3OXSA 2CMRH 3S37X 3GUTB 1C12A 2OZ4A 2A6JA 4LLDA 4CU6A 1EUTA 2GFBB 4MNQE 4XCEA 3VXQA 4NN6C 5I1IL 2X9WA 3P0YH 4Z0BL 3GSNH 1AR1C 2W0KA 3TZVA 1YEIL 1KPVA 2NY2D 3DI2B 4OFVA 2IPKA 1J7VR 2XQBH 4EI6B 1DQJA 1U0QA 3OJVC 4PJBE 5EZIL 3EO0A 3I6LD 3ELAT 1L7TH 5LXGL 2FEDD 4P2OC 4P5MB 5F70A 1KTRL 5C09A 3GIZL 5F9WB 4P4KD 3TNMA 3VD4A 4M6MH 4HG4J 2WM0A 1AO7B 1IL1B 2EDTA 4N9GB 4J4PA 4EXKA 3ET9F 3MJ9L 3QRGL 5EU3B 3C5ZA 4O02L 4MJID 4EDWL 1D5BA 4U6XB 5ISZB 2ZUXA 1DQLL 2FIKB 2ZJSH 3CXDL 3HE7A 5C8JB 2OR7A 4P3CH 1FO0A 1NFDA 4M6NH 2EYSA 4HHAB 3CFCH 5LAXA 2ZG2A 3HRPA 5HYJA 2EXYD 5I1JH 4UAOC 2KL6A 1YECL 2NY3C 4UT7L 2XI9A 3V6ZB 2HFFA 2DLTA 1HQRA 3ARDB 5BRZD 4JVPA 1SQ2N 2PETA 4IRZH 1WSST 1MUJB 1NSNH 4BKLB 2EDYA 2JELH 1RV6X 5CJOL 1WUNT 4MD4B 3GRWL 4WJ5B 4HWEL 4U2YA 1QG3A 1UB6A 4Z7VF 1U95B 1QEWB 3GGWB 4LKCB 2VZOA 1XGYL 2UYLB 4L9LC 2L7JA 2AV7B 2HRPL 3X3FH 1S78D 4BSVB 1XF2B 1T7XA 1QLRA 1Q72H 5CKAA 4Y4HC 1FYTB 2OJEA 3MUGA 4Q9BA 5EOQH 3VWKB 1QBMH 4HWZA 5INDB 4RAHA 1R0AH 1ZA6A 4CVZB 5IB3A 3GK8L 3TT1L 2F5BL 1JTTA 3L5JA 1QTYT 3SDCC 3QPQC 1G1CA 3GKZA 3JTTB 5KVDL 2OR8A 5DMIH 4YXHH 2RGSA 3U9UA 3EYFB 2DM2A 2GHWB 1I1AA 3DECA 4PD4K 3HZVB 4R3SB 5MI0C 1BBDL 2XKUA 3MLSH 4Z95H 4UOJA 1UWGL 4C56A 1QVOA 2F54E 3M17B 5JPMA 2E6JA 4JZJA 5EU6B 4NCC1 4MXQC 2RFXA 1J8KA 4LDEB 3BEWB 1KIPB 4KKNA 5GJTH 1CLOL 4GG8B 1I7ZA 1I7TB 1RIHL 5E99H 5DURB 4JDVB 1DP0A 3D2UB 1NCBL 1F45A 4G42A 1W72L 2Z8VC 4RZCA 3BX7C 3D39A 3MV8B 4KDWA 4KK5C 4LCWA 1D5MA 4QHUB 2FO1A 2EDBA 4ELME 2X4TB 1BOYA 5FYLD 1SVZA 3W5MA 3SDDA 5J6GA 1H3TA 2F8VA 4Y5XB 2DDQH 1N5YL 4NM4L 2XTJD 4E0RA 4HGWB 4X99B 1XFPA 3PP3H 4NC2B 5C9JA 4KI5C 1YNLH 4UTAH 2UY7A 3AM8A 3WJLC 3ZKND 2NMSA 1NBVL 2GSIB 2YUWA 4M1CD 3F6LA 5EH1A 1OT1A 3PV6A 4TUKL 4I2XB 5E00A 3IKCA 3RY6C 3HPLB 4HKXA 1E6OH 4QRPE 3ZKSD 3UYPA 1JHLH 4YDKL 5DWUH 1P1ZA 5IFHH 1A7PH 3VDBA 3V5KA 3QDJE 5IFJA 5I1IH 5FO7B 1MAML 2IWGA 4Z0BH 3SDAD 5IMMB 4PYHA 3S9DB 1G9ML 3QG6A 4LLWB 3KPMA 2DQUL 1V3MA 3NACH 5MEPA 1YJDH 5IJKA 3H7BA 2Y06L 5J9PB 1KULA 5TDNB 5IFAL 1RZJH 5DMGC 1FL6B 1S9YB 3GIZH 1M05A 3O6FA 1G7JB 2OXHA 3LEVL 1T04B 5HHVH 4V1DE 1I1YB 3GSVA 4HZAA 5MEND 1RPQA 3B9KC 4I48B 2O5YL 3MJ9H 4YGVA 3C08H 1T1YB 2NY5L 3NFPA 4F58L 4A2MA 1FN4B 4HKZB 4TPRH 4ZTPH 2XZZA 4ODVL 1R5WA 5F7UA 3JV5A 4R90L 2EC9U 2VZ1A 4UT7H 3FB8A 2FYYB 3TO2B 5IBUG 2ZKHL 4JRYD 5CINL 3FFCE 4YHYB 4R97B 4ZFZB 1NL0L 2JCCE 2CLVA 1RHHA 5C0AE 3JVGC 3X12B 1RZGB 5F44A 3EOAA 3TO4A 2Y9RT 4PRIA 4TSBL 4K7PH 2Y5EA 2Q8AL 5I6XC 4LBEA 5E1AB 1N59A 2EDEA 3O45B 5I1AA 1YY8A 1QQDA 4XPFL 1OL0A 2ATPA 1HCVA 2A6DA 4ALAL 1AXSA 2YXFA 3V4VL 3TJHD 4QTHB 4N0YL 2ILLA 4C54A 4PBWD 1QSFE 2F5BH 4JLRA 5HYQB 1AXIB 3MV7D 5FCSH 4YXLH 1MJJA 2ORBL 1CIUA 2CUHA 3LKPA 4UILL 3PGFH 3W0WB 5I1CL 1CTNA 2VLJA 2DLHA 1N5AA 1BBDH 4RGMB 1DUYA 3OB8A 3LS5H 4HJJH 4K3DH 3RGVC 1W8OA 3OG4B 1DL7H 1TNMA 2ESVE 4LRNL 4O58H 1AIFB 4IHOA 2CDFA 1UKSA 1G9NL 3CLFL 5IVXB 4RX4A 4BQBA 2VOTA 3DURA 2GKIA 3OJDA 4UV4L 1BP3B 2EDKA 4ZPVA 3GMPA 2PN5A 2AK4A 1RIHH 2YKLH 3QEHA 1P6FA 2DQFA 4U49A 1U3HB 4WHDA 1N6UA 5CZVH 5F7DA 3V6FB 4JPIB 2ICES 1NCBH 1EXUB 2FB4L 5BZDA 4E41B 1JUFB 2YHGA 3DGCR 5HDLA 3S36L 2ZOKB 4OKVA 3BPLC 4Z7QF 4EN3A 3TH4T 1HHKB 1FNFA 3VFOB 1JF1A 2OM5A 3O3DA 4PYGA 1G7PA 5KSVB 3VDAA 3BZFB 5HVHC 3AS2A 1SEBB 5EO9B 3NA9H 4W6WB 1KJ2H 4MA3A 4OCWL 3DSFH 2NY1D 1AY1L 2Y6SC 4NGHL 1N5YH 1N0XH 2I26N 5FDWB 4KK9C 3RWJA 4X5WB 1NFKA 1HSBA 3S3SA 4OIBA 3PQYD 2CRZA 3IXAA 1NBVH 1XEDA 3B2UC 5FKAB 4PJ8C 4KH2A 3W11C 5DFWH 1IGMH 3IFNL 2IQ9H 4GW4B 2XTLA 4XHJC 3PNWA 4MXWL 4F7TB 4YDKH 1PAMA 1GHFH 1HK6A 3F12A 4MA8L 5DD3L 3RA7L 5BCAA 1G6RA 4U1NA 1MAMH 4P4KA 3OTTA 5E94B 3E6FA 4PG2C 1WICA 1CFSA 5CMAB 2VLKB 5GHWL 5FHAL 3S98A 2OCFD 3LS4H 4BZ1L 1F4AA 2Y06H 4MJIA 1JHTA 2JKXA 4RMQA 2XRAH 1RJYA 5DJXA 3C6LB 3WUWA 3SE3A 3D0VB 3WIIL 4XGZB 3MGTA 3LEVH 1T2XA 4N8VG 3JUZA 1RHFA 5BRZA 1ZHNB 2O5XH 4O4YL 4QTIH 4QXTB 2B2XH 3SE8H 5I76A 4JVWA 3OKNB 3KPTA 2CDGA 5DEFA 4NNYB 3GM0A 2DI9A 4ODVH 3ARYA 1K8DB 2G5BA 3NFNB 4JRXD 3MODH 2E5EA 3ZSTA 4PJ7A 2F5AL 4JCMA 3T04D 1M6OA 4GRMA 4U1SA 3PXHA 1F11B 1OAXH 4NFDA 2RBLA 5DUPH 1ZA3B 2WAHA 4TSBH 1P4LB 1R3HA 4JQIH 5HYJE 3MZTA 1UJTA 2ICWB 4WUUE 4OT1L 1KIUA 1MCPH 1KCKA 3GB7B 4P5KA 1MCBA 2DLFL 1JE6A 4O2EB 1TPXC 1RJLB 5EA0L 4U7SA 4XPFH 3TT3L 2QHRH 4OLVL 1FFPA 4NFBA 5J8OA 5DO2D 3TN0B 1YN6B 5DD1H 1A02N 1PYWA 1XGPB 4K9EL 5ERWA 5FM8A 1SM3H 3BVNA 1ZT1A 5D1XB 3H9YA 3QUML 4E9LA 4QYOA 1MSPA 2CIKA 3B5HA 4FQXD 3KDMA 1G84A 5I1CH 3QFDA 4KVNH 3TYGH 4U6YB 3O3AB 1PKQB 1UADC 3CDGB 5DSCB 3FCTB 4NNPL 4LRNH 1E27A 3K8MA 1A4JB 4H1LA 3RL1B 1IZJA 1ND0B 3EOBA 5EFIA 2EH7H 2NXZC 2D4DA 4KKBC 4G8GB 5CSGA 5E7FA 4JANB 1URLA 3ZTNL 5J6HB 4G9FB 1YEGL 2VXTL 4R4BA 4U7KA 1C1EH 1CBVH 1KGCD 5D7JB 3DPBA 2BFVL 1TDQA 3B8YA 3LKSB 4PR5B 1R24B 1NUFA 3UTTB 4X8JA 2ITDA 3HCVA 3VFVB 3QUXA 1DBML 1S8DA 1BECA 2WIIA 1K4CA 4F57L 4HW6A 1FZKB 4KGJA 5DJ6A 3WSQL 4TVPE 1NBZB 3VFTA 3CD4A 1ZMYA 2J6EL 5HHQB 1L4IA 4OCWH 4OB5L 2PO6B 2GJ6B 3MBEC 1XF1A 2X40A 5I6XB 3C60B 3P77A 2ID5A 3MRLB 3WS3B 5I73B 4BSWB 3KG5A 3SDAA 4GLRH 1MF2L 5GSRB 3FRUB 1LNUB 3O9WB 5SV4A 5DJ8A 1FJ1B 2ADGB 1FL5A 1WTGT 3WNOA 1KB9K 4WI4A 3QUYC 5I1LA 1M4KA 1I75A 4Y89A 1LD9B 1AGFA 4BFIA 4P2QB 4HUMB 3U7WH 5EC2A 1LDPL 3NCYP 3L3DB 4DGVL 4OGAC 2BVEA 1AQKL 2FH6A 4HPOH 2YK1L 5DJ0B 1T0MB 4FQLL 5MENA 4QRSB 5EUOA 5GHWH 4HWNA 4YFLF 1H5BB 5L0QB 2HJFA 3HMXA 2VJXA 5IVXF 1YMMD 3KYNB 1LVEA 3LKOA 4YHZL 5IK3B 2COQA 3IDJB 1FCCA 4RMUA 4QXGH 2E7LA 4AH2B 2NY7H 4HX1B 2BCKA 2H2SD 3D69A 4O4YH 4JRYA 5DRWA 1EHNA 1KCUL 3CFEA 4LOUC 3UPRA 4WO4D 2V5MA 1SMAA 2NW2A 2J8UB 1NBYA 1AO7E 3MUY1 3PJSA 3REVA 5ADOL 3O3EA 5K33A 2ZCLH 4YUEL 1BJMA 3DI3B 1OF2B 5C70A 3NGBC 3BPLB 4MQSB 4ONGH 4R6UA 4LNVA 3DX8A 1E6JH 5D7SH 5FM4A 5GGSA 1HKFA 3RIAF 2C3WA 4ODXA 1L0XA 2AW2A 4L3CA 4XBPB 3U2SB 1C16A 5EOTB 3HNVL 3I9GH 1DLHA 4U6HB 3C09B 3O4LD 1FZOA 3CC5A 3NN8B 4XMPH 4DVBA 3BDYH 4RWYL 4NO3B 1WF5A 3X13B 3MRIB 1JWUA 4H8WH 2X4OA 1MRCH 5DRZA 3H9SB 4LLUB 3BXNA 5D7KD 2IAMD 4MNGA 2Z93A 2C3VB 3MV7A 5FYJL 5CFHA 2DLFH 3TZVC 4KKCD 2A73A 2NY6D 2KUTA 2FWOA 4JHZA 1AFVL 4LKXB 3RZWA 1PX3A 1K9TA 4HS6B 1I9RL 3C6SA 4D3CL 1FYTE 2XOTA 1AC6A 3QCTL 2APVA 5GSVA 3DBXB 5TDPA 4ZUSA 1N3NB 3QUMH 5BV7C 5C0BB 4MAUH 1A14H 4LSVL 2DBLL 4GRLD 4NKIH 1ZXQA 4K94C 4M6OL 1FRGH 4J4PC 4MGXA 4EVNB 3LKQA 3C5ZC 1WIPA 5DD0L 5B3JF 4L29B 3HE7C 4F7PA 4GAGH 5MHSE 3PWUA 4L5FH 3RVTC 3VXTB 2VYRE 4U05A 3FHQA 1Q0XL 3U4AA 4YIQB 5IG7A 4L3AA 1QR1B 1ZE3C 3T1FA 4GKZA 5JUEH 3PWPA 3ZTNH 3MUZ1 2IFFL 4JHAL 2NZ9D 3OSKA 2VLJE 3QH3A 3QQ4A 4M3JA 1E4XI 3RUGE 3BIKA 4ODSL 5I18H 1ADQA 5HGBA 5D4QA 5FUOL 4G5ZL 3BE1L 1TZIB 1MWAA 3VXSB 1BFVL 1DBMH 3PQYA 4PD4J 1C5CL 3VRJB 4LARL 4F3FA 3MUHL 3MV8E 3WSQH 3VH8B 3SKNA 1B9ZA 1T0PB 3UMTA 1H3PL 1I8IA 3CH1A 1GZQB 2AK4E 3W9DA 5GGTA 1H3UA 3TBYB 3E0GA 1KG0A 1FNSL 4DTGH 2X1PA 2B8OT 3FQWB 3PL6D 5AWNH 3VMOA 4YGAB 5T33L 1A0QH 3QO1B 4DK6A 1A1MA 3K1KC 1KCRH 1VERA 1FSKC 3FB5B 3MNZB 3SGDI 1YC8A 4HKBA 4I2XE 3DV4B 2CO6B 3DVIA 4F33A 3MLVH 1I1AC 5DJAB 4K71B 5ESVA 4DGVH 5GS0D 3OKMA 1I8MB 4XXDB 3QCVL 4AIZB 4QF1A 4X83A 4IDJL 4HIEA 4X7CC 3SPVB 1WWAX 3UBXA 4FQLH 2BERA 1BZ9B 1MREH 1OQXA 2B4CC 2MWCA 2X4RA 2P5WB 3EGSB 3FN3A 2Q7YA 4JFDA 4IMLB 1NFIB 3E8UL 3D18B 1OM3H 3TJEL 5JOFA 3O6KL 4UIMA 1QFHA 4YX2L 2HTKD 4HC1A 1U8MA 3U36B 1FVCB 1RZFH 1UXWA 3A67L 4HS3B 1UB5B 5E5RB 4C4KO 1XCTA 4JRXA 3L3GA 1H3VA 4OAWA 3KJ6H 2E7MA 1ZVYA 3D85D 4KC3B 3DUUA 4CN6A 1JPTH 3C9NA 4MDIB 3SDDC 2O61B 3P0GB 5ADOH 4OGYH 4IOSD 1SJEA 5SWSB 4YUEH 2FATL 1J1OH 4OCMC 4H0HB 2XXCB 3P9MA 1H3WM 2EDNA 3MRPB 1LO4H 3PABA 2HJLA 3ZDZF 5FCUL 3RRQA 1JBJA 1WGOA 3AM8C 2W0FB 4KKLD 5ILTL 5EN2B 3HNVH 2FSEB 5E2VL 5C07B 5CJ5A 4KROC 2FL5A 3N85H 5CS7A 4D0BB 4YK4C 4YHIB 3HNTH 3CVHB 2Q6WA 1FFRA 3WFBL 3HFML 1XGTA 1CXEA 3S5LB 4DZBA 2UVEA 1T6VN 3QUYB 3QDGB 5T1KB 4GKOA 3DO3A 4FQXA 4YWGH 1BVKA 2VITB 3SKOA 3P30L 2P5EB 1AFVH 5F9JB 5LQBL 2X1OA 3MMEB 1IBGL 5IJKC 1I9RH 2OL3A 1T5WA 2I24N 5EU4A 4PB9L 5BJTB 4YE4L 1CFNA 3WD5H 1LP9B 5CD5D 3O6FC 4WNQB 1JGEB 5DHVA 2O93L 2GAZB 4FTVE 4G9DB 3VXPB 3HS0A 2FJHB 5C0GA 4ZPTB 1FIGL 5JXAH 3K8LA 4JFQB 5F6HJ 3RVXD 4DKEL 3W0WE 3RWIB 5ITBH 4OFYD 3WUWG 4MCYA 4WU7A 3TBSB 3FONA 4FQJH 4KMTL 2J8UF 1Q0XH 2ARWA 5I8EA 3DYPA 1MFEL 1RUMH 5EZLB 3JWDC 4JY4B 4OD2A 1VFUA 3I3DA 4ZFGL 4YZFE 2ICEB 4Y4KA 5C3LD 1N26A 3LN9A 4OCYL 1OSZB 3VG9B 1A8JH 5FUOH 2QSCH 2VQ1A 1KTLB 3EW3B 5CBAA 4FFYH 3TO4C 3WFCH 4X4YB 4ZAKB 3K1DA 4E41E 4Q9QH 1EBAA 1GPOH 1UKTA 4NM8L 3O8XB 1ZVSB 1R5VA 4FZEL 3VFWA 3BPOC 1FNAA 4ZO7A 5ID1B 3VI4E 3RDTD 4LHQB 2BVTA 4YLQT 1BFOA 5A16B 1WV7T 4OZFA 4P2RB 4KY1H 5GRJL 4QHKJ 1BFTA 2I07B 5IBTL 1CI5A 4CMHC 4NBXB 1OAYL 4O2CA 4Q9CA 2J2ZA 5T33H 1T2QL 1XIWB 3L7EA 5KSUA 2HG5A 4K3HA 3QB7C 2BOBB 5B8CA 1XF5B 3WV0A 5FKPA 4ZOBA 1HSAA 1MCJA 3HUJA 1CG9A 3ARZA 4R96B 2R15A 1YMMA 3MRKB 3ARXA 4NQDA 2OI9B 1J9CT 5FGCB 3TNMB 3TVMB 3DX7A 3OB0K 3BWAA 2C5DC 5L6YH 4NDMB 1Q9LA 1QFPA 5DHYB 4JHWL 4QT5B 1F13A 3GSNA 3RWDB 1NLDH 2R4RL 5ALCL 5F21B 5HY9B 3E8UH 4WI2A 1GXEA 4H26A 3DXAD 1TCRB 4JPVH 5GS2H 2G60L 4H1LG 2YD6A 3RAJH 5D7IA 1ZHKB 4OLZL 3V5DA 2EDJA 1X7QB 5KAQF 1N6QH 2OK0L 3VGEA 1EEZA 5IB5A 5GQBA 4BK5A 3G08B 2PKDA 2ZOLB 4EN3C 4RGNC 5EUOE 1CYGA 5B3JE 3QIBD 1ZLSL 4D94A 2YWZA 3JV0A 3O4LA 1OT2A 4PRNA 1HDMA 4G8EB 1OWWA 5GGUA 1EAPA 4MJ6B 3EYQD 1X6LA 4K3EL 5KOMC 1TJIL 5FCUH 3TM6A 2IAMA 5AD0A 1CE1H 4V2CB 5KANG 2NY2C 2FGWH 5ILTH 2P8LA 3T2QA 4RNRA 2X89D 5FYKL 2YMXL 5JDSA 3V8OA 2AKRB 1JF6A 2GTZB 1C5BL 1FZMB 1TZGH 3O4OB 2WANA 1WJ3A 2VL4A 2IANA 2FEDC 3HFMH 5EBWA 4F7EB 4P4KC 4GRLA 2VXSL 5EU7C 4P9ML 3P30H 4J7RA 1QYGL 3JUYA 5J06A 1I1AB 5C0IA 5LQBH 1CQYA 1IBGH 1MVUA 4ENED 1T4KA 3T65B 1I8KA 3T0BA 3BEVB 2V9TA 1QVOB 3KJ4B 3NCMA 4L8BA 4ONHB 1NEUA 2XG5A 3SE3C 3GMMA 1L7IH 1T5XA 2EXYC 4O51B 2A74A 1Z5LB 3EFFA 1QFOA 4PGEA 3KPRD 1KJVA 3Q1SL 2BNRD 2JIXB 3VW3H 3AVEA 1WZMA 1RU9H 4BYHA 3BHBB 1EHXA 3JV4B 2PTUA 1AQDA 2X41A 5IHBA 4OZIA 4NN5B 3KNBA 4EJ1C 5DDHB 3PGDA 2VDRL 1OP5K 3FQXB 1FZJA 3WLWD 4CN1A 4NZUH 1S78C 2VDKL 4QOKD 1X4ZA 1EPFA 5DVLA 4B53A 1W2KT 5L7XH 1IKFL 1IGJA 2ADJA 3TNNA 2FLBT 2QQKL 1MIMH 2N7BA 4LPVA 4J8RA 2UZIL 1QO3A 3PL6A 4IRSD 3CMOH 4NM8H 5F89A 4J6RL 5E24E 4M62L 1K5NA 4M1DH 4HKXB 3PWPE 3T3MF 1NGWA 4M61B 4LSSH 5DS8A 4YDJA 1GC1C 3D5OF 4KV5F 4YK4B 3MA9H 4WUKL 1MHHB 2E7BA 3CFKA 3ZDZE 1G0DA 4J2XA 5IBTH 2HN7A 4H20L 1PKOA 1A3RL 2GJ6E 3ECBA 1T2QH 4MA1C 1E4WL 1JF5A 1QBAA 3CDCA 1LP9F 1CDUA 1KJ2B 4ZUTA 3OKEB 2WBWB 5TF0A 4P2QE 2MHAA 2VLRA 3ZL4L 2FBJL 5F1KC 3O6FB 1KCSH 1QFWH 5E8DH 4NPYB 3B9EA 1T0NA 3U0WL 1N8ZB 3WIFA 3MREA 3CU1A 3CNKA 3QXTA 2QLVB 1UFUA 4G6JL 3N0PB 4S1RL 3H3PL 4FZ8L 4Z76B 1DDHA 4N5UA 2ADFH 4UDUB 5DJ2B 2MSPA 3HR5B 5JR1L 4O9HH 3RVUD 4XX1E 4LHUB 2XTJC 5TH2A 1TJGH 1BQSA 1ZWIA 1FAIL 3T2NH 3QUXC 4C83A 43CAA 5I0ZA 5JMOC 3ZKNC 1A1NB 3DO7A 4M1CC 1Y0LB 3MLXL 1GH7A 4LLMA 4PV9A 1FFOA 5E6IB 4JFDE 3MJ9A 4I18B 1CDGA 3EYUL 5GRVK 1EHLL 5I1GL 4LCIL 4QWWD 4RQQA 4K3EH 4M4PA 3QPXL 4HUNB 1C5DA 3SDAC 3FO0L 3L3IB 2OTWB 1GOFA 1DQMH 5I8KH 2MPAH 1AGBA 3MLWH 5DLMH 3ARWA 5JTWA 2YMXH 5T3XH 5ESQB 3WIHL 3FMGL 3G6DL 5T5NG 4Y5VB 1Q0YL 4ODBD 32C2A 4F7MA 4LIQL 3MRDB 2I9LA 3ULUL 1JWMA 1D9KD 4ESKA 4WU5A 3C2SA 2B1HH 5A2IH 2MMXA 4MB3A 3SCMD 1MRFH 3VWJD 2VR5A 5IQ9A 3H9SE 3JTSA 1NGZA 5JW4M 1KPUB 5IGXH 4LAQL 3Q5TA 4XP5L 1J0JA 2EXWD 1P2CA 5INCB 1NCAL 3QHFL 1CICB 2D9QB 4OFYA 4XX1G 3BAEH 3QQ3A 4OUOA 1ZHBB 4FXLA 1HHHA 2R9HD 3IXTA 4HH9B 1MCKA 2E7LC 4P23B 1MFCL 4U0RC 2WMPA 5J1AB 3Q1SH 3WXVH 3GJFK 5KOVC 4XPBH 1A9BB 2IGFL 1EEYB 4GS7C 3BDXA 4FRWA 4PTTA 4YHKL 2ZWLT 4RBPH 1JYVA 2EE2A 4NT6B 5DJDA 4QCIB 1NC2B 4X6BA 5EIIB 4LSDA 5EO1A 2DLEA 4PJCB 3Q6FB 3B3IB 4RFOH 1B4JL 4WWKD 2P42B 4M5YH 4X7SL 1KFAH 1U8OA 3DWTA 5J0BA 1EJOL 4OF7A 2OJZL 4QXUL 3RDTA 1YQVL 3EBAA 3U7YL 2QQKH 5DJZB 1HSBB 2UZIH 4XC3L 3TJHC 1N64L 4MXVF 1G0YR 4J3XA 1W0YT 3C5SA 2NY2B 1WC7A 3KYMA 1A7OL 3VXSE 3HC4H 3G04A 4S1QH 3B5GA 4XNZC 1WZ1L 1P7KA 4JZNA 4WUKH 4HAGA 5FFLA 3SDXA 2Y5TB 3RWCA 1U93A 3MRHB 4WIQA 5LJYH 2B7DT 1RUAH 3E6FB 1A3RH 2WK2A 1A6AA 3W2DL 4ELKA 1E4WH 3GFUA 4KUZH 4PLOB 1YEEH 3HG1B 1UM5L 1U8IB 1M7IA 4TNVF 1MCSA 3DXAA 4L4JA 2ZUSA 4XCYA 1BZ7A 4WW2A 4MX7A 5FO8A 3ZL4H 1K6QL 2FBJH 1ZS8A 1MELA 3DRTA 3I75A 4M7KL 5GIRB 2NX5D 3WEXA 5BS0B 5CEXA 3ARSA 1WFNA 1HQ4A 1YEKL 2Q8BH 3OBAA 2H1PH 1ZTXL 1PSKH 1SYVA 3U46B 4L4VE 2MOVA 5F7FA 5DUML 1V7NH 4M5ZH 2QBWA 3QIBA 4AG4L 2PCPA 3HUJE 4FQHB 5KAQG 3MYJB 2NY1C 1RMFL 4NQDE 5JR1H 4XVTL 1ONQA 1T1ZA 4R8WH 4X7FC 3WNKA 4JJHA 1ERNA 4PJ7B 1LILA 1KT2B 1ZT7A 1X5HA 1S7WA 2V9RA 4H25A 4NRZB 5E5MA 1S9WA 2XWBB 4TOYL 2GUOA 3VXMD 3VH8G 3WFEH 2X89A 5MEQB 1U8JB 4OLYL 3IDMB 3PWJA 1EHLH 1TENA 3TWCL 3WCYA 3RNKB 4TULL 4HZLB 4PGDB 3LB6D 1HXYB 3H3BC 3G6JB 1QKZL 3LN4B 5DXWA 3FO0H 3N06B 4OFPA 4NHUA 3RZCD 4D0CA 3WFDL 2VUYA 3JZ7A 2MQ3A 2HT4D 1IGCH 5I74B 4YHNB 4ZUUB 5H37G 3K46A 1RUQH 2DM4A 5JNYB 5C07E 1J5OH 1QRND 4LIQH 1FORL 4HGMA 3AAZA 5ADPH 5D7KE 1BOGB 2X4PB 3F6IA 3OHXB 1KIRB 3KPRA 2BNRA 1F4HA 3D3VD 1FVEA 4LAQH 3QDGE 4XP5H 3T4YA 5HHOB 5L8JB 1HYSD 4JKWA 5TQ2H 1IAIH 1NCAH 3F7QA 1QBBA 2H9GB 3MRRB 4HUVA 1QACA 4UQ3A 4XC1H 4Z7WB 4FQIH 1SY6H 2XA8H 2IANE 4U1HA 4XNYL 5F1IA 4JKPL 2B39A 2OP4L 1QSZA 5D70H 1LP9E 4QOKA 2R69L 4XTRD 3T0EB 5IKCA 4I77L 4YPGB 3ARBA 1FE8H 1U8KA 5F72S 4TUOA 1DLFH 2IBBA 3IDNB 1HKLL 2D7NA 5LCVH 2Y23A 5C0ND 4ZO8A 1MY7A 5KW9H 1HHGA 5E03A 4OD1H 4UOW0 3GSOB 4PJGB 5D5MA 2AP2A 1BD2B 3IJSA 3WKML 3HAEB 4IS6B 5ICYA 1EJOH 3QJFA 5J4MA 4QXUH 4PBVC 3QCUH 1YQVH 2VR4A 5DO2C 2F53B 3TBWA 4NQVA 3FTGA 3W39B 4O5LH 1NGPH 3ZZ1A 2DI8A 1YEFL 1NMBL 3ALXA 5DD5L 4A6YB 2DMCA 3NIFF 2VB5A 4FQXC 3QG7L 5KJRL 2VZ3A 1JMZA 1CQKA 1UZ8A 2BOCA 1GOHA 3M1BA 4Z0XB 4EDXB 1WZ1H 3HPJB 3TBVB 1NUNB 1LE9A 3H8NA 5EWIL 5DQJB 1P4IL 2HVJA 4NFCA 4Z7UA 3TV3H 3W2DH 4JFFB 5CBEA 3AREB 4Z7NF 1V3KA 2GT9B 1UM5H 3BI9X 3QXUA 2XZCL 3PHOB 4Z5RA 1TVBA 4MAYD 4XP1L 2VIRA 1MLBA 5C0DB 4D9QD 4LLAA 1MHPL 3FO2B 4BZ2L 4R7NB 2UVFA 2VDPL 3G5ZB 4K2UH 2DYPA 4MD0B 4HCRL 1GCFA 4IJ3C 2V2WA 3EZ8A 5FGCE 2BSTA 1A9EA 5DVOA 2JJSA 4UOW1 3ARFD 2V5SA 3IJHA 3VXUB 3WE6A 1RVFL 2EDQA 3OGCB 3ZDXF 2B5IB 4WEUD 1P7QB 4Y4KC 4DOHB 2YBRB 2CXKA 4PJCF 1LEGB 1RMFH 4XVTH 3TPUA 2VLRE 5DQDL 5IIEA 5KS9B 3V2AR 2ZUWA 1ZK9A 1Q9WA 2DD8L 1GJIA 3AU1A 3Q6GH 1MY5A 3JWOL 2HJKB 4NN7B 1C16B 3MJ8B 4UU9B 4TOYH 4HK0B 3VD5A 1NBQA 1SHMA 3U30B 4OUUA 2P7TA 4OLYH 2Z8WC 4U3XA 4D9LH 1BGXL 3TWCH 5JIIA 3STLA 4RAVB 5HD8D 2VAJA 4PREA 5DRZB 1WQVT 3RIAK 3BKML 1D9KA 5GS2D 1AHWB 5EG6C 4X8XA 2R0LL 4XNUH 1F4WL 1MHCA 1T2JA 3SCMA 3WFDH 3VWJA 1SBSH 2FX8H 4XP9L 4RIRB 1BMGA 2YC1A 5D1QD 3ULVH 1UM6L 4E5XB 3FAXA 1KC5L 5F88B 3MFFB 1RK1A 3PHQB 2WWMD 3WDJA 3BSZH 5KSBA 1MRDL 1OP3K 2P43B 1KB5L 5FM5M 5LGHH 1IC7L 4AENB 2AXFB 1BX2A 4NJAH 1UCBH 1FORH 3OKKA 3LD8C 4ZODA 2W9DL 4GRWF 5FUZL 3SKJL 5CIPH 5T1DL 4LEXL 2H2SC 2EKSA 4MZ3A 5E8OB 4OJFL 5CEZE 3UPAA 2CR3A 2R8SL 5HHXL 1Y6NR 5JXEA 1S5HA 1IAKA 2EDDA 1CR9L 1T20A 3RWFA 3WL9B 2PTTA 3OAYH 3EYSL 3QUMA 4C57C 2H2PD 1XGRA 1QLEH 4WWKA 3GBLA 1E4JA 1WFOA 2IH3B 3WO4B 1S7XB 3B9VA 2BSSA 2JB6A 2NY1B 4I77H 3QIWB 1NMCB 4PJ7F 3SJVD 1OD7A 4MCZA 1CDBA 4LFHD 4LSTH 4P46B 2DQGH 2IH1B 25C8H 5DK3A 3G6AB 5HHNA 4BK4A 5IMLB 3WMSA 2IAMC 3DSNA 1C7SA 5FDYA 4KKCC 2NY6C 3BT2H 2HH0H 4TNWF 3G6JF 1WZLA 3GMOA 3KYKH 4Y5YA 1JJUA 3CCHB 3STZB 2AEPH 2YEZB 4PRHB 2KQNA 5BV7L 1XR9A 3UYOD 1EMTH 4WVRA 2AXGB 2WWKT 4HXAL 3BPNC 1BIIA 1ED3B 1WEJH 4OQTL 1S3KL 1YEFH 1N4XL 3MRBA 5B38A 4K94L 1K2DA 1WAAF 2IQAB 3PP4L 2R56L 3QDHA 1Z3GH 5TPWL 4GRLC 5DK2B 2XKNA 3LH2H 3BZ4B 1FO0L 3SHSA 1A3LL 4QF1B 4G7VL 2YD3A 1P4IH 4AT6B 2NX5A 1CXLA 4PG9A 3DVNA 3H0TB 3RL2A 1OHQA 4NBYB 5SWQA 4DKDC 4PS4L 1JN6A 4PJ9D 5D2NA 1MHEA 4Z7WF 1VB9A 5H8DA 1RZIB 3NFSL 2XZCH 2G2RA 3MOAL 4EI5D 5CLTA 3BO8B 2NZ9C 2APBA 2ENYA 4BZ2H 3SDXE 2R2EA 1HEZB 4Y1AA 3ROOA 5FOBB 3SY0A 3L5XL 2VDPH 5EC1B 8CGTA 1MJ8L 4JFHE 4OZ4A 1JZ7A 4O2FA 1Q9OB 1VEPA 3FOLA 3TA3D 4CGTA 4NQCB 3BPCB 3KPSB 5CJQH 5I75C 3VXMA 4Q2ZA 1RVFH 5KVGL 3VXRD 3FFDA 4PJGF 1BJ8A 3MCG1 3MV9B 5DQDH 1QSEB 1J8HD 3BH8B 1P4BH 2YPKA 3MLRH 3PDOB 4OIIL 5DMKA 3WNNA 3PL6C