5J2QA

Hiv-1 reverse transcriptase in complex with dna that has incorporated a mismatched efda-mp at the n-(pre-translocation) site
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
547
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords HIV-1 reverse transcriptase p66 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 154
structure length 547
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2qA05
2OPQB 5EWFA 3MECB 4CEOA 4YP3A 4J9SA 3K5MA 2FC0A 1C0TA 4OPKA 4EBDA 2BQUA 3QZ7A 4E7HA 4MFBB 4M42A 5CYQA 5HBMA 5C24A 4J9RA 4R5PA 3HJFA 1TKXB 3NHGA 4IRDA 2ETJA 4OL8A 2HHTA 3DLKB 5KFEA 1RDRA 5KG7A 2R8IA 2HVHA 3KKRA 2KTQA 4IFYA 1NJXA 4DSKA 4ED2A 2AWZA 1JLQA 2IAJB 3KLIB 4CF2A 4M3WA 4IG3B 4CJFA 3BR9A 1BI4B 1NKCA 3CDUA 3SQ0A 4ECQA 4FLXA 3H5UA 3VQ5A 3TABA 1VSJA 2EC0A 2IGIA 3PZPA 3NF7A 1CXUA 1JLFA 5HLFB 2Q3SA 4ECSA 3OS0A 1KHVA 3BSNA 5KRSA 1XR6A 1BIUA 1C0UB 1S1TA 2ZQBA 3MXJA 1WSFA 1J5OB 4N47A 1U4BA 1JLBB 1JLAA 2UUTA 4RUCA 1RDCA 3T5KA 1KLMA 2X78A 3KJVA 2BANB 3KLHB 3MR2A 3ZSOA 4Q0BA 5EU7A 2X6NA 4CJ5A 5KT6A 4OPJA 3SNNA 2PYJA 1ZBHA 4EP4A 3CQ8A 1RT7B 1NOYA 3IN5A 4IKFA 5KFHA 1HPZA 1ASWA 1ZETA 3TAMA 1WSHA 4NRUA 1BL3A 3VQ8A 3C6UB 3DRPA 3I0SA 3ZT4A 2C28A 4RNFA 3HK2A 3TANA 4M3UA 2FLNA 1TL3B 4QCLA 1IH7A 1EETA 3TR8A 2JEIA 3HPGA 4ID5B 3E01B 1L3TA 3BGRA 3RMBA 4Q5VA 4O0JA 3QZ8A 4QWBA 4B9SA 4OJRA 3KLFA 3ZSXA 4CEQA 4FK0A 3P5JA 4PUOA 4ZVHA 1HMVA 1NJWA 4BE0A 3HP9A 1RTDB 5DMRA 4JV2A 4B8CA 1T05B 2F8EX 2IA6A 3AA5X 3MEGA 4L8RB 3V6DB 1LWFA 4BE1A 2ASJA 1RT4B 3RTVA 1JXEA 4ED1A 2JC1A 1QTMA 3LAKA 4M3RA 4JRQA 3ASMA 4U6PA 4C8NA 1BISA 3IS9B 4O3OA 4N76A 2UVVA 2F8SA 4DQIA 5HRRA 2GC8A 4CIGA 3T5JA 1TVRB 1JXBA 1L3SA 4K4VA 4ZVFA 2IOCA 1QS4A 2W7OA 1C1BB 2OPSB 1ZBFA 3CJ4A 3FSIA 3Q8SB 4KFBA 3FQLA 2BQRA 2J6UA 1D1UA 3WNHA 2FBTA 4OGCA 1TQLA 1X9SA 2FJXA 3DLRA 3M8PB 4IG0A 5KFDA 3UPFA 3HPHA 2VG5B 2JGUA 1HQUA 2D3UA 1RYSA 5E41A 3S3MA 1VRUA 4LSLB 3SPZA 1NJZA 2G8KA 1B9FA 3KMSA 3CO9A 4DTNA 4O4GA 3DOLA 4F3OA 4CGDA 1JX4A 2XWYA 1KHWA 1DTQB 3DRSB 5KG1A 5KGWA 3KHGA 3N6LA 4Q43A 3CJ5A 1WAFA 5DG8A 5KG5A 4W5NA 4F4KA 1SH3A 2W9BB 2E9RX 1RTJA 3KK1B 2XGPA 3CJ3A 3AO2A 4FK4A 4KPYA 1FK9A 1T3NA 3K5OA 3GV8B 1U09A 4NLXA 2OPRA 3GIIA 4CHNA 3HT3A 4RZRA 4FZXC 1IKXB 1U04A 3THVA 1QSYA 3O4NA 2FVSA 3TAPA 4Z4EA 2GIRA 1EX4A 3VQ9A 1RTHA 3IAYA 3DLGA 3VA0A 3H4DA 3CM5A 2AGOA 2KQ2A 4RW6B 1RT6A 1TAQA 4E3SA 2HHWA 2OZMA 1EP4A 4YR3A 4CIEA 2PYLA 4YQWA 3DM2A 1D5AA 1EXQA 4IOBA 2P5OA 1RT5A 1ZBLA 5CYMB 4LY7A 4CJEA 3NGIA 4KB7A 2UVRA 4I2PA 1RTIA 5HROA 1QSSA 4O44A 5KGXA 2QV6A 3FFIB 3WNGA 4J2AA 1JKHB 1JLAB 3SQ2A 4Y2CA 5KRTA 4C8KA 1GOBA 3KD5E 5JUMA 4CEDA 1REVB 3ICLA 4J2BA 2WB4A 4HUFA 4RG8A 3QIPB 4R8UB 1HYZA 4FJ7A 2BRKA 3S9HA 4ZVEA 3V1QA 3OL7A 2YKNA 4K8XA 1TK8A 3BSCA 4NLUA 3KLGA 4CERA 5D3GA 1VSIA 2AX0A 3CDWA 2OPQA 3C95A 1NKEA 4DEZA 1BCMA 3ISND 2J6SA 3MECA 3I0RB 2PZSA 1ZTTA 3KK3B 2YKMB 2I5JB 1NK4A 4MFBA 4CJKA 2R2SA 1FXXA 1TKXA 3B6OA 2QXFA 3LP2B 4HTUA 2YHAA 3DLKA 3ALYA 3VQCA 3ZT1A 3VQAA 2Z1GA 4WZMA 3AVLA 4W5RA 1NHVA 3BQ1A 3OYLA 4I9QA 4U7CA 2BGGA 1RDDA 3AVBA 3OYIA 1JLEB 1VRTA 2IAJA 2P1JA 3KLIA 4CFBA 3TAGA 4IG3A 4H4MB 3PW4A 1BI4A 2B5JB 3TQ1A 1TK0A 1S0OA 3AVIA 3RBEA 5L1JA 3VQBA 1ZBUA 4PWDB 3NH2A 5HLFA 4GVMA 5KFIA 2G8UA 3HM9A 1N6QB 3IGVA 2BRLA 2IMWP 2B6AB 4ECYA 5KTQA 4KHNA 4CJPA 1C0UA 1NK5A 1J5OA 3VQQA 1JLBA 1SH0A 3MR3A 4NYNA 4F4ZA 3V9SA 1ZBIA 4KKOB 4R0EA 3K5NA 2AQ4A 3C6TB 3AA3A 1ITGA 3MR6A 2AU0A 3SI6A 2BANA 3KLHA 4Y1CA 3V6JA 1FKOB 5KFQA 3PR4A 1HYVA 1LV5A 4AHRA 2IM3A 1LAWA 4DSJA 1U49A 4NCBA 1RT7A 3DYAB 2LSNA 3U6FA 1QSLA 4DU4A 4DG1B 3OY9A 5J2MB 4EEYA 4W5QA 3KIOA 3GILA 4B9VA 3QLHB 5KFFA 1TP7A 3L8BA 1S1WB 3RAQA 1UOCA 1LW0B 1TL3A 3H5YA 5F8JA 3MXMA 2UUWA 3V9WA 4RUAA 5L1LA 3OLAA 5L1KA 3AVFA 2WONB 4ID5A 3E01A 1HQUB 1IM4A 4BWMA 3BDPA 4NCAA 1S1XB 3A2FA 4K4YA 4CESA 1RTDA 2VG6B 1BHLA 4Z4GA 4Q44A 1T05A 2XY5A 2Z1JA 4M3ZA 2R2UA 4B3OB 2PY5A 3V6DA 1WLJA 4MK9A 3ZT3A 3RMCA 4TY9A 1RT4A 2GBZA 3N6MA 4QW8A 5KFNA 3V9UA 1OS5A 3K59A 4KHYA 2R8GA 2OPPB 1KVBA 3RWUA 4FJNA 4JUZA 2BQ3A 4KREA 1KCFA 3EZUA 3LWLA 4WFYA 3E51A 1TVRA 4KTWA 2KFZA 3KHRA 1Y97A 1S0NA 1GX6A 3OS1A 3JSMB 5L9XA 2YNHB 4IDKB 1C1BA 2OPSA 4DL4A 1SKSA 4OLBA 1C6VA 2ZKUA 3NKYA 3L2VA 1DTTB 1LWCB 3EPIA 1S6QB 1A5VA 2AGQA 4CEFA 1U48A 4F8RA 4FXDA 4IFVB 5F8HA 2UVUA 4CEBA 5HRSA 1GOAA 2FLPA 1LWEB 1NKBA 1RAJA 3NL0A 3PY8A 5DLFA 3M8PA 4FJKA 4KE5A 1W9HA 2HB5A 4WZQA 4URQU 3AV9A 4ECXA 2XCPA 4IH6A 1C0MA 2VG5A 2F8TA 3AVKA 4FLVA 4FM1A 4QOZB 4CFCA 4MKBA 2HHUA 2KW4A 4CGFA 2YKNB 1SKWA 3OYJA 3P83D 4XPCA 5F8IA 1N5YB 4G1QB 4WE1B 2R2TA 4FLUA 4Q45A 4NLOA 3AVMA 1DTQA 3DRSA 1HNIB 1Z26A 4DSIA 2RDIA 3AA2A 4ECTA 2X6SA 3T5LA 2QE5A 1C1AA 3BQ0A 4DFKA 4DU3A 4GC6A 3NCIA 3VN5A 2IBKA 1RILA 3EZ5A 2W9BA 3KK1A 3QEVA 4KHWA 1LAVA 4EBEA 4FVMA 4DF8A 1Q9XA 4E1MA 2EX3A 3LWMA 5C42B 1NK9A 3AVNA 3SI8A 1IKXA 1VRTB 1T94A 3D5MA 3L3UA 4AHTA 4LQ3A 4LQ9A 4KBIA 4NLVA 3OL9A 4K50A 4DTOA 2ITGA 4RW6A 1TV6B 5KFVA 5KFKA 3MTKA 1BCOA 3S3NA 4CECA 5DQHA 3DLBA 3O3GA 5EDWA 5CYMA 4ELUA 4RU9A 2RDJA 3QERA 2ASLA 2C2RA 2C22A 3KK2B 3FFIA 4WYWA 1JKHA 4C8LA 4EZ6A 1WSEA 1TKTB 4HUGA 2D7SA 3OYFA 4DTMA 3OSNA 3F9KA 2V4QA 3OYCA 1IKYB 3KLVA 4ZPCA 3SUNA 1REVA 4Y2AA 1SV5B 4RW7B 3QIPA 4Z0UA 2ZE2B 4R8UA 4EYHB 2IDOA 3OJSA 3H40A 3C94A 4F4WA 2JEFA 4CF1A 4H8KA 1KFSA 2RN2A 2YNIB 4J9KA 3O3HA 2JLEA 2E4LA 3K5LA 3SPYA 1S9EB 4O5BA 1UA1A 4KI4A 3I0RA 5DQIA 2BR0A 1SL0A 3KK3A 4AHSA 1JLCB 2YKMA 2I5JA 2C2DA 1HNVB 4TQSA 4DF4A 3RMDA 3AO1A 2Z1IA 4ED0A 4CGIA 4BDZA 1YVUA 1RBSA 4ECUA 3LAMA 2OH2A 3LP2A 3BSAA 1WN7A 1S4FA 3BREA 4TLRA 1CLQA 1N56A 3OYMA 5KG2A 1WAJA 1VSFA 3M8RA 3NGZA 1JLEA 4H4MA 1IKVB 4FLTA 2B5JA 4YR0A 4EP5A 4WFZA 1NK0A 3AVHA 2XY6A 3OVNA 3UR0A 3VQSA 4PWDA 4B9NA 2YNFB 2W8KA 1VSKA 1SL1A 1N6QA 3ZSYA 4MH8A 2B6AA 5J2NB 1HRHA 4B8AB 4F4YA 3G86A 5C5JA 1TL1B 3I5CA 2G8IA 4Y3CA 2XGQA 3P1GA 1K1SA 3RR7A 3QNOA 4KKOA 3C6TA 4YMEA 4LD0A 1XR7A 3LPUA 4I9LA 1FKOA 4DL6A 3H4BA 3ZCMA 4QPXA 1VK0A 4CJ4A 1S97A 4PA1A 5KG3A 1RT2B 3DYAA 1JLGB 2OZSA 3PUFA 4DSLA 5KFMA 3ZSZA 4FJHA 4DG1A 4NLYA 3AVCA 3B6PA 3L2RA 5J2MA 4FJGA 3ISNC 3QLHA 3CG7A 1HYSB 3VQ6A 1S1WA 2XCAA 4FJ5A 4ID1A 1LW0A 3M8QA 5KT3A 2IC3B 3LALA 1WSGA 4KTZA 2FLLA 2WONA 3QGIA 4Y34A 2V9WA 1S1XA 2W42A 2G8VA 3NGYA 4DTRA 4MIAA 5KFAA 4ECZA 1XI1A 3OYHA 3I5AA 1RT1B 4TSXA 1NNDA 3EYZA 3NF9A 1S1VA 2VG6A 3DI6B 5KFRA 4ZHRB 5SZTA 3OYKA 1RA7A 4B3OA 4JV1A 3CJ0A 4DTUA 3HO1A 4CJTA 2CJQA 4RNOA 3MR5A 3G6XA 2W8LA 4KV8B 3RRGA 3L2UA 2V0NA 1XC9A 3OHBA 3I5BA 2VA3A 4F2SA 3L2QA 3MEEB 4URSA 4RW8B 1KTQA 2OPPA 1S9GB 4QWCA 3SUQA 4KHQA 1VSDA 4OVLA 3JYTB 3RMAA 3MEDB 1DLOA 3TAFA 1TK5A 1X1PA 2IS3A 2HHQA 4J2DA 3RBDA 3JSMA 2WTFA 2YNHA 4IDKA 1C2PA 4FM2A 1DTTA 4ELVA 4IH7A 1LWCA 3G10A 4MQ3A 4FLZA 5J2PB 3KHLA 1S6QA 4OKKA 1GX5A 4ED3A 3MXIA 4IFVA 2W9AA 4E7JA 1LWEA 3CFRA 4C8MA 4AHUA 1CZBA 1EKEA 4I2QB 4ECWA 2R8JA 4FS2A 4ZVGA 5DQGA 4CJ3A 3OJUA 1KVCA 1WSIA 3SUPA 1YTAA 3KOAA 2EHGA 1N5YA 4G1QA 4WE1A 4QWDA 3NDKA 2XHBA 1QE1B 4CJLA 1HNIA 4O3QA 3LP1B 4GMJB 4KAZA 2ILZA 1SL2A 2D0BA 5DK5A 1RT3B 4YFUA 3V4IB 2Z1HA 1S1UB 2A1SA 4WXOA 1IKWB 3TWHA 4AH9A 5C42A 4DSFA 4TY8B 3OYBA 3SZ2A 2FVCA 3V9ZA 3QETA 3ZT2A 4CEZA 5C25B 3GIMA 5FRMA 2DPIA 4FBTA 1QHTA 4KHUA 1Z25A 4FBUA 4J9OA 3KNAA 1QQCA 4TN2A 2ATLA 2XO7A 1HARA 4F50A 3VQPA 1TV6A 4G3IA 2HAIA 4J9LA 2FVRA 1VSMA 1UWBB 4KHSA 3DMJB 2IJNA 2W9CB 5KT2A 1S6PB 1Q9YA 4MKAA 3KK2A 3M9NB 2G8FA 4RNMA 1GOCA 1TKTA 3PX6A 2FVPA 3LPTA 3ITHB 3SJJA 4DL7A 3V1RA 1IKYA 3OL8A 3IRXB 3L2WA 1C1CB 1N4LA 1SV5A 4RW7A 1N48A 2ZE2A 1I39A 3Q8PB 3N6NA 1RCHA 1QUVA 5KFOA 1J9AA 4FLWA 5F8NA 5F8LA 2YNIA 4CGGA 5I3UA 1B9DA 3RAXA 1SKRA 2P51A 4ED6A 1S9EA 1YT3A 3ZSRA 1BGXT 3NBPB 4NLGA 3K58A 3QESA 4LH4A 1JLCA 1HNVA 2G8HA 2IJFA 4ZPBA 3M8QB 2JEJA 1QAJA 2RPIA 4JV0A 4DQSA 2FBYA 4F4XA 3AVJA 2DFHA 2DFFA 1KSPA 4C8OA 1RBRA 2VWJA 3QEIA 3PJWA 4DTJA 1IKVA 4ZP6A 4OGEA 2Y1IA 3LANA 5KFSA 4M41A 2VWKA 3RRHA 5FDLB 4PY5A 3WNFA 3M9MB 2HWIA 3M9OB 3OYDA 3K57A 3FRZA 2YNFA 1S1VB 5I42B 1RNHA 2KFNA 5F9LA 4K4ZA 3BQ2A 3LDSA 4ZTJA 5KFZA 1X9MA 3PR5B 1SUQB 5J2NA 2E9TA 3OHAA 3NH0A 4WYLA 1VSEA 4FW2A 3QO9B 1TL1A 3PJXA 2VG7B 4K4TA 4ELTA 3QYYA 1YTUA 2E6MA 3RB4A 3HVWA 5T14A 3ULDA 3HKWA 3EPGA 4DTPA 3MF5A 4AILC 4Z4FA 4KHMA 4K8ZA 4ICLB 2V4RA 1D8YA 3HVAA 1JL2A 1DLOB 5KFGA 4CK3A 1TAUA 1TKDA 4Y1DA 4M3TA 4KHRA 1RT2A 3OSPA 1JLGA 3QIDA 1O1WA 3SV4A 1KVAA 4QAGA 1KFDA 2XC9A 3QGGA 2GIQA 5F9NA 1HYSA 4RW4B 5T7BA 5KFLA 3AVAA 5SWMA 4PQUB 1SH2A 5EWEA 3HP6A 4J9QA 3CWJA 2IC3A 4X2BA 3CJ2A 2HNYB 4EO8A 3HSTB 4ED7A 2BE2B 3LZIA 4MK8A 1FKPB 4RW9B 4ZP7A 3T3FA 4NLDA 3TAEA 3FQKA 5DGAA 1RT1A 2NUBA 1TKZB 4FM0A 5EWGA 5CZ1A 3DI6A 3PX4A 4ZTFA 1NJYA 3H59A 4HVJA 4ZHRA 2JC0A 2FJVA 4M3YA 2B43A 2DFEA 3DRRB 3KLEB 3V6HA 4CHZA 1I3AA 4EYIB 4KV8A 4I7FB 2HMIB 4GW6A 1MU2B 5J2QB 3MEEA 2ASDA 3RB3A 4RW8A 5HRPA 4J9NA 1S9GA 1S48A 2R8KA 3H08A 5KT4A 4CHQA 4K4XA 4HHTA 3JYTA 3PV8A 3NH1A 3MEDA 3VA3A 2HVIA 3UDLA 1CSJA 1K1QA 1WNSA 3AA4A 2P5GA 5KT7A 3ZSVA 2IM1A 3H98A 2X74A 3LP3A 4FJLA 4LSNB 4J9MA 3G6YA 3EY1A 4DLEA 2ATQA 4NLSA 5J2PA 1BQMB 4CJSA 3HYFA 3O4QA 2A1RA 4ECRA 1L3UA 2DTUA 2YV0X 4JS5A 3PO4A 3RB0A 3NFAA 3DLEB 2RF2B 5HP1B 4IH5A 2GV9A 2D0CA 3VQDA 2HNZB 4I2QA 1S5JA 4KRFA 2ILYA 3WNEA 1D9DA 4WFXA 3DOKB 4JLHA 3OLBA 4BACA 4DFJA 5L1IA 3MFIA 3GIKA 4BDPA 2AX1A 1JL1A 4NLQA 4DQPA 4HUEA 5KFCA 1J53A 3VQ4A 5I3UB 2YNGA 4IRKA 4ZP8A 3U3GA 1ZTWA 1XWLA 4YR2A 4DTSA 2C2EA 4DS5A 2FVQA 4N5SA 1QE1A 4DSEA 4CFAA 3LP1A 3GV7B 3L3VA 4QW9A 5KFJA 4F3TA 3HHKA 5HRNA 1RT3A 3QEPA 1NOZA 1K6YA 4EO6A 3V4IA 3H5XA 5KG4A 1S1UA 1W0HA 1BQNB 1IKWA 4CGJA 3QEWA 4CK2A 5KFTA 4TY8A 2O5DA 3AO3A 4UQGA 3HVTB 5C25A 4HCCA 4FJ9A 5J1EB 4TYAA 2O4IA 4O3SA 2XRIA 4N41A 3V6KA 4ZMMA 3QGHA 2FBVA 4MK7A 5KFWA 4CGHA 4DTXA 2D3ZA 1RA6A 3K2PA 4FYDA 4IR9A 1UWBA 3IGNA 4H4OB 3D28A 3DMJA 4W5OA 2ZD1B 3HPOA 1A5XA 1CXQA 1LW2B 2W9CA 3SUOA 2CKWA 4Q8EA 1S6PA 4CE9A 3V81B 4DQQA 1ASVA 2WK4A 1XHXA 4Z4IA 1R0AB 3ITHA 3LZJA 4HKQA 3DDKA 3IRXA 3IG1B 4IRCA 1C1CA 3NAHA 2WOMB 2OA8A 2R2RA 2R7YA 3PHEA 4CJUA 4NRTA 2O4GA 4KI6A 4NCGB 4OLAA 5K14B 4M3XA 1T8EA 4CFDA 3NBPA 3QNNA 4KO0B 1Z4UA 1IO2A 5F8GA 1RBVA 4FJXA 4FJJA 3Q8QB 4J9PA 4E7KA 4E0DA 4Z4HA 3H2LA 5KG0A 4FCYA 2VA2A 4B9LA 3AO4A 1G15A 1NHUA 3M8SA 3SCXA 4AHCA 5KFPA 3QINA 4M45A 4QWAA 1XHZA 3NGDA 2DPJA 2RKIB 4H54A 3KHHA 4DLGA 4BDYA 3OL6A 1HQEB 3U3YA 5FDLA 5FRNA 3LP0B 3AVGA 4B9MA 2HNDB 2XI2A 3PW0A 4O3RA 2GUIA 4Q8FA 5I42A 5EUHA 3V9XA 3TI0A 4DS4A 4DFMA 3PW2A 1T03B 3HXMA 1SUQA 2XY7A 4CJVA 3D45A 1RBTA 4DL2A 3DLHA 1X9WA 1C0TB 3QO9A 4FJIA 1TGOA 4DU1A 5CYQB 3T5HA 5C24B 5HBMB 3CIZA 2VG7A 4R5PB 3QIOA 4K4SA 4FW1A 4CK1A 5F8MA 4GC7A 2WHOA 4K4WA 1D9FA 2D5RA 4TYBA 4IFYB 1RDAA 1F21A 4ICLA 3CFPA 2HHXA 1JLQB 3F73A 4KAIA 3CM6A 4ZPAA 1IG9A 1VSLA 2G8WA 3GV5B 3SFGA 2OYQA 4NLWA 4CJRA 3QEXA 3NF8A 3D0PA 4BE2A 4ED8A 4DQRA 5DGBA 4CHPA 2IM2A 3BJYA 4CEEA 1JLFB 4FJ8A 4CF0A 1U47A 4RW4A 2HW3A 4PQUA 5DLGA 3SQ4A 4EBCA 4XO0A 1S1TB 1W25A 2QK9A 2HHSA 5FROA 2HNYA 3CVKA 2BE2A 5KI6A 1KLMB 2YNGB 1NK8A 2W7PA 4DL3A 1FKPA 3KJVB 4RW9A 3NAEA 4TXSA 4Q0BB 5JXSA 4CHYA 3GIJA 4KTQA 4DFPA 3OS2A 5KG6A 1ASUA 4KSEB 3PW7A 4CCHA 3G6VA 1TKZA 4HYKA 2D0AA 3VQEA 2HHVA 3FDSA 1NK7A 1HPZB 5JS2A 4FLYA 3GQCA 3RB6A 1S0MA 4FZZA 4FZYA 3PO5A 3TAMB 2KZMA 4FS1A 4DL5A 1XR5A 3MFHA 3DRRA 3KLEA 3I0SB 3DRPB 4F2RA 3ZSQA 1VSHA 2WCXA 3PW5A 3SQ1A 4N56A 4I7FA 3CFOA 1EETB 2YHBA 2HMIA 4JS4A 1MU2A 1T7PA 5J2QA 2E9ZA 1WNEA 3CDEA 4O3PA 1S10A 4YNQA 4CHOA 3KMQA 2AJQA 2XY8A 3BGRB 3G0ZA 3NAIA 1Q8IA 4E7LA 2QKBA 3KLFB 1QAIA 4NYZA 3NMAA 2FJWA 2IM0A 3HVRA 4PUOB 4FK2A 3TARA 1U45A 3OYNA 1HMVB 4LSNA 1NK6A 1BQMA 3BSOA 3MEGB 3VQ7A 2J6TA 2WRMA 3UIQA 1LWFB 3DLEA 2RF2A 5HP1A 3T1AA 2HNZA 4ZPDA 4NYFA 1L3VA 4Z4CA 3DOKA 3S3OA 3RR8A 4URGA 3UQSA 3CYMA 4ZP9A 2AGPA 4W5TA 1L5UA 3KKSA 2I1RA 4NLPA 2F96A 3OYAA 4K4UA 1S49A 4XPEA 3MAQA 4O0IA 3OYEA 4BWJA 3ZT0A 4IQXA 2XI3A 5JS1A 4KFBB 4IBNA 1UAXA 2BDPA 4CJQA 4O3NA 1RDBA 2HWHA 3HL8A 5KFXA 4B9UA 1KRPA 1BQNA 2QKKA 4WXWA 3C6UA 4E1NA 1BIZA 4EZ9A 4B08A 3HVTA 3Q8RB 2UVWA 4CF9A 4IG0B 5J1EA 4LH5A 3V1OA 4CEAA 1UA0A 3PX0A 1B92A 5KT5A 4M95A 4M94A 4FJMA 4XIUA 4E19A 4O4RA 1VRUB 1HJRA 4CIFA 3NF6A 1RBUA 4H4OA 4O4GB 3DOLB 3TVKA 1RYRA 2ZD1A 4QWEA 3GYNA 1LW2A 4DWIA 3KTQA 3V81A 1JXLA 3SYZA 2DY4A 4NZ0A 1RTJB 3AO5A 1R0AA 4NLRA 5CY4A 4OKJA 1WSJA 5CZ2A 3IG1A 3OYGA 1ZYQA 4B9TA 4IKAA 1FK9B 2WOMA 4DMNA 2OPRB 3H5SA 3TAQA 2FBXA 3NE6A 4RNHA 3ZSWA 4OKEA 2ALZA 5DG9A 1RTHB 4CJWA 3DLGB 5DG7A 3IS9A 4NCGA 3T19A 5K14A 4NLTA 5KFBA 2D41A 4ECVA 2Y1JA 4E7IA 4JRPA 2E6LA 1RT6B 4TQRA 1EP4B 5KFUA 4KO0A 3SFUA 3PVXA 3DM2B 1I6JA 1RT5B 4I2PB 1RTIB 5HROB 4E89A 1CZ9A 4O44B 4KB0A 2B4JA 4IR1A 4HCBA 1S9FA 4AHVA 2RKIA 2KZZA 4KB1A 4O55A 1D0EA 3I8DA 4J2EA 1HQEA 3KD1E 3LP0A 2HNDA 1MMLA 1YVFA 2R8HA 1A5WA 4CF8A 5KFYA 1J54A 4LSLA 1JIHA 2JEGA 4MIBA 3O3FA 3SV3A 1T03A 3KLGB 4RNNA 1KLNA 5D3GB
chains in the Genus database with same CATH superfamily
1RWMB 5SUHA 3QMLA 3RUBL 4CEOA 5E33A 3E9OA 1C0TA 3I55S 3CCJS 4EBDA 4OPKA 1VJWA 1WD6A 4ZCKA 2DXDA 2DGWA 3L3CA 4IRDA 4OHVA 1RLCL 3DLKB 3ISZA 2XSJB 1NLKL 4YORA 4BRLA 2NRZA 4DSKA 3NNAA 2CJYB 5G0RB 3WIVA 5HMXA 1LKZA 4NB4A 4CF2A 4M3WA 4IG3B 1NKCA 3HZGA 3B4DA 1H73A 4FLXA 2W2OP 3PIOL 4EK2A 3VALA 4CIOA 3TABA 1VSJA 2IGIA 3PZPA 3D4JA 5LL6d 5KRSA 4JI2F 1A9NB 2XNRA 3THWB 4R25A 4OX9K 1TUYA 1JLAA 2WSFC 3GFHA 1RDCA 4QR0A 3VESA 2DR7A 2QWOA 3PIOQ 4NZ6A 1WG5A 4CLYA 2F8MA 3MMAA 2YH1A 3SNNA 2X6NA 4OPJA 5KT6A 3X1LB 2V5HG 4PR6A 5T7LB 5GMDA 1RT7B 1NOYA 4MYTA 3FR0A 4AXIA 2IFXA 1ZETA 1FJCA 2IVPA 2UUAK 1WSHA 3WC2A 2CNOB 1BL3A 2FPHX 3LTOA 2C28A 4UOHA 2MQNA 2VGMA 3CUNA 3VEWA 3PIPL 2HFOA 4ID5B 3E01B 4L3NA 2E2PA 1L3TA 2R7OA 3CIMA 3M5RA 4DR5K 4B3TJ 4O0JA 4LBHA 3QZ8A 4QWBA 4KYZA 3KLFA 5AJ3F 5DETA 1JCGA 3P5JA 4OLPA 6FDRA 2MDAA 2DGXA 4WIQA 2K8GA 2ZWPA 3HSJA 2LP4A 1HMVA 1N8RO 4BRFA 4BE0A 2R7XA 1VC6A 4B8CA 1T05B 3AGKA 3C6HA 1FFSB 2F7TA 3ULEB 2CPIA 4CH0S 3PIPQ 4DR7F 2ASJA 3R1HA 2F9JA 5MAOA 4BR7A 1QTMA 3MTJA 4U6PA 4O3OA 4N76A 2RHQB 2PA8D 4DQIA 5HRRA 1HWIA 3T5JA 1RCXB 3DLJA 4ZVFA 4C23A 4C1NK 3G8SA 5FIIA 2UYTA 3CJ4A 3FSIA 2VL1A 4FYYB 4KH5A 3FQLA 2BQRA 1P8GA 1RTZA 3M6VA 1MG7A 2QW9A 3MURP 3K8WA 2CADA 4F3QA 2IRYA 2RHSB 2FBTA 4OGCA 1P9QC 2GHPA 3U27A 2ZH2A 3DLRA 3OVSA 3G2XA 3TTFA 5AZJB 1FX4A 3UPFA 1R89A 2ZF5O 3ATUA 5E41A 2ABYA 3O08A 1B9FA 2X1AA 4O4GA 3DOLA 1KHWA 3H3NO 4Q43A 4MIWA 3O1LA 5F0WA 2AT1B 1WTBA 4W5NA 4F4KA 2O8DB 2E9RX 2DXEA 3AO2A 2ZM6F 3CCES 5B0DA 1NRKA 2FZKB 3K5OA 1NBEB 1SZ2A 5JLFA 3CJ7A 4BRMA 4RZRA 4ILGB 1IKXB 1U04A 3VAKA 4JI0F 4G1IA 4B3RJ 3O4NA 2O8EB 2GIRA 3VQ9A 5DO2A 2HFNA 3DLGA 1I94F 4C7QA 3VA0A 4ZKAA 4JKAA 4CDIA 1RT6A 1TAQA 2MTLA 3C7NA 2OZMA 4YR3A 4CIEA 3ZZ0A 4DR3K 4YQWA 3DM2A 4G1PA 2UUCF 1Y10A 1YRUA 1CC7A 1ZBLA 1MW7A 4ZPVR 5AXMA 2HAFA 3FFIB 4PPDA 1TFYA 3F9MA 4ZIVA 3QT7A 4LF4K 4CP5A 4WBFA 2H5EA 4CEDA 1REVB 1S22A 4JD2B 3ICLA 4HDHA 2YXLA 3GG0A 2QEXN 3EXCX 4OI3A 3OBWA 3CSKA 3GFZA 1WKKA 3HSCA 1WUUA 4AYBD 2AD9A 2BRKA 3M2VA 1SQEA 2E5GA 4JI5F 1JWWA 2HZCA 3CDWA 2OPQA 1BCMA 2J6SA 3MECA 2KT3A 3RSEA 3ENWA 1VQMN 2NXEA 5BJRA 2GGPA 4OX9J 1CJUA 1VQ6S 5HMWA 2PD1A 2AP1A 4UT4A 1F2HA 3VQCA 3Q86A 2GFFA 2F4VF 4H03B 4I9QA 4U7CA 2BGGA 1RDDA 2BMBA 4YOTA 4NXMF 3AVBA 1M5VC 3OYIA 1VRTA 2IRUA 4USHA 2P1JA 4CFBA 3TAGA 4CD1A 2B5JB 1QQOA 3QNWB 5FD1A 5L1JA 3CJBA 1F6TA 2UUAJ 3NH2A 1YI2N 4L75A 5JVGL 4GVMA 4P9SA 3HM9A 1Z6RA 3IGVA 2IMWP 1AFJA 4CJPA 4XDDA 2E7WA 3IR6B 2EI5A 1GFWB 5F2RA 4H5VA 2ZUGA 3V9SA 4DR5J 1Q7YT 3MR6A 4RWWA 2P6TA 2AU0A 2BANA 1FKOB 5KFQA 1HYVA 4P72A 1U49A 2DR9A 2DPNA 4NCBA 3V4MA 3J7Z5 3O5BA 2LSNA 3TSQA 5E3CA 4NXNF 1QSLA 1WC4A 1A0OB 4WU2A 4DG1B 4DU4A 2DNYA 3ZXWA 4WK3A 3KVGA 4CZCA 4W5QA 2I38A 3OTOK 2QL5B 1TP7A 2CQPA 4A8FA 1ZH5A 4OZ0A 3VTHA 2W41A 5L1LA 1E6VA 6FD1A 4BRNA 1FDAA 3SEOA 2K7JA 3AVFA 4QS8A 1S1XB 1H3DA 3OVAA 1P1TA 1VC0A 3IWNC 2WAQD 1NGIA 2ZHBA 4Z4GA 4Q44A 2PDAA 1TZ0A 1GMVA 2IVYA 2R2UA 5GAHP 4MK9A 4FF2A 1NNEA 4TY9A 2C2KB 5A2QO 2G0JA 4DV1F 2GBZA 2CZ9A 5KFNA 2GVZA 3JS9A 1AA1B 1OS5A 3K59A 2ZVIA 4KHYA 5C0YA 1NJIO 3R6GB 2RS2A 3KJNB 3LWLA 5DM6L 4AT1B 1GLBG 1P90A 5AQRA 3BM7A 3KHRA 2RT3A 1GX6A 1ZM2A 3SCLE 1SKSA 4IDKB 2OPSA 2ZDOA 2OMLA 3TUPA 2KM8B 4OLBA 2P9LB 2K1RB 2MQMA 2VONA 3EPIA 2AGQA 5FLXO 5F8HA 2UVUA 4B3SF 4CEBA 3UD4P 1RHUB 3NL0A 1VOMA 2GJFA 2ZUAA 1CJKB 3OXLA 4LRFA 4URQU 3OV7A 5DM6Q 1N32K 4CLWA 4FXWA 4IH6A 1C0MA 2VG5A 1UJ6A 4P10A 3SQGA 3AVKA 2VGNA 4DDFA 2B0GA 4FSVA 3NG8A 2KW4A 2YKNB 1SKWA 1P1LA 5LSOA 4PHTX 4OYPA 2BYCA 4G1QB 2XS2A 4DR3J 5IFMA 2R2TA 4FLUA 1X4BA 4CBUA 4DSIA 1Z26A 2Q1NA 4CZHA 3SXLA 1SJ4P 2H5JB 2Q66A 4DU3A 2IBKA 3HRGA 1B64A 3H7HB 3KK1A 3QEVA 1LAVA 4LF4J 4FVMA 4DF8A 4H0VB 1NPPA 2EX3A 2HGLA 4IJAA 2X7IA 2Z2MA 2LA6A 4BG8A 2EG1A 4NE9C 3C6AA 3GWCA 1U1NA 4C8ZA 1BXNA 4AHTA 4A4JA 2FSKA 4LQ9A 1FRJA 2A2CA 4NLVA 3OL9A 2F3JA 1NB7A 4DTOA 2IMOA 1ZM4A 1OH8A 1BCOA 1HL6A 2GX8A 5CYMA 2J0SD 4KGXB 4P52A 2PMZD 1FNXH 3QERA 4JI8K 1HNWF 4C8LA 2A41A 4ENOA 1ESVA 5HL7L 1QVFR 3R6MA 1QAXA 1LK5A 5A8WB 4RW7B 3SJHA 4R8UA 3AA8A 3NS6A 1X3MA 4ZDNA 3C94A 4F4WA 4KHPF 4KH4A 1FRKA 1QVFM 2EWSA 3TZYA 1UA1A 4KI4A 4JI2K 3KK3A 4AHSA 1JLCB 2YKMA 3SAHA 5HL7Q 2FJDB 3Q23A 5D78A 2HS0A 1YVUA 1RBSA 4JI1F 4YOYA 2HBZB 3LP2A 2IYGA 4OI2A 3AD8C 4I0WA 4ZITA 3OYMA 5KG2A 1WAJA 3TU5A 1FWPA 2GNKA 3M8RA 3FMWA 1WF1A 3OTCA 4FLTA 4YR0A 4WFZA 3F0NA 3DXBA 3DXSX 1BD6A 4BQLA 4XH4A 3AVHA 4PWDA 1EQYA 5D15A 1SB6A 2W8KA 3W63A 2LA4A 3OTOJ 4OLOA 3W3DA 1FW6A 3TTCA 3ZSYA 4MH8A 5A76A 4F4YA 5IT0A 1N0VC 5AT1B 5C5JA 1TL1B 3L95X 2LU1A 2G8IA 1TL4A 1K1SA 2V34A 7FDRA 4LF8F 3PKYA 4KKOA 5KQDA 1R43A 2RMLA 3LPUA 3ZCMA 1WEYA 5KPRA 5CHCB 1UVMA 1U2RA 1S97A 4PA1A 1OKJA 1U1PA 2DBBA 2IY5B 1N34K 2L9DA 5KFMA 5RUBA 4F36A 3AVCA 5J2MA 4P6QA 5LSLA 4L74A 3ENHA 2R42A 4UUWA 4LT6A 3VQ6A 2LEAA 2YQ0A 1FA0A 2DB1A 1G2EA 2IC3B 3Q7CA 1SIZA 4KTZA 3MGJA 2EG2A 2W42A 2KJWA 3TA2A 2DRAA 1T9TA 2BE9B 3CMES 1K0VA 1RWOB 1RT1B 1CVJA 1NNDA 5ADZA 2VZ9A 5AQWA 3IBWA 4CZMA 5FPDA 3PACA 4JI3J 2R3VA 4ZHRB 5IT4A 3W9HA 1WKJA 4B3OA 4BC3A 1D09B 5IZHA 5ETQA 1FT8A 4RO0A 1U2VA 3ULHA 2QLJB 4RNOA 1SVDA 4KV8B 1ZM3A 2VICA 1XC9A 5I3PA 3OHBA 4E8UA 2VA3A 3L2QA 4URSA 4RW8B 1C4CA 1KR4A 2OPPA 1MROA 1FTRA 4I67A 2RILA 3JYTB 4UOGA 2ZZTA 3MEDB 1M5OC 3TAFA 3FGUA 4UQTA 2DNRA 2IS3A 3JSMA 2YNHA 3D6MB 4FNHA 4JB8B 3ZZRA 1C2PA 1GTHA 2XYHB 1DTTA 4ELVA 3T1HF 5J2PB 3CD0A 5CABA 2XULA 1YJUA 4CVNE 2B9YA 4IFVA 1VBXA 4ZLJA 4E7JA 1LWEA 4C8MA 4JI0K 2CAJA 3J81U 3U8XA 1N5VA 3DXKB 5KPZA 3ENAA 3OJUA 1KVCA 1I94K 2PN6A 1WSIA 4ZIWA 3SUPA 3UR3C 2W2NP 4QPTA 3QJLA 3BEXA 2JLFA 1PG5B 2UUCK 2M88A 5GMEA 2KXHA 1QE1B 2H9ZA 4CJLA 4JI8J 3LP1B 1WSRA 4KAZA 4F04B 2BJ9A 4CM0A 2QFJA 4K25A 1RCOB 1RT3B 5B08A 2FDNA 5BYSA 4YFUA 3V4IB 5D0EA 2CNLB 2A1SA 1N36F 3UFCX 4OX7A 4TY8B 3ZT2A 2YQ1A 3W62A 1Q18A 3GIMA 3R9PA 4OJGA 5FRMA 2DPIA 2KU7A 4KHUA 1VIOA 2VPZB 1T3OA 3OBIA 4TN2A 2ATLA 2YVSA 1R0CB 1TV6A 4B1ZA 1FNMA 3KKFA 3UDEA 2HAIA 3UN3A 3VGUA 4JI2J 3EUNA 3R27A 2J9CA 3BN7A 2CPDA 4Y65A 5AE1A 4NA1A 1U0HA 2P9PA 2YWHA 3U9ZA 5KT2A 2PIIA 3C14A 3F5TA 1TKTA 3MWTA 3LPTA 1FRMA 2F4VK 3V1RA 4IEEA 4NXMK 2EFGA 3AJDA 5JICA 2ZC4A 4MO5A 1SV5A 2MHNA 3N6NA 2EK6A 2VD3A 4WF9L 5C15A 1R59O 2BACA 5BYQA 2NYIA 4CZGA 3W60A 3RAXA 2H48B 3D7EO 1FTCA 3K58A 1GT8A 1BE4A 1HNVA 3M8QB 2LU2A 3JAMO 2PSZA 1M5SA 1DKGD 4C48A 4WF9Q 4W90B 1KSPA 3FC9A 2NRVA 1YGYA 1NU0A 1DAXA 5B0GA 3MMCA 3W9JA 3GB0A 5KFSA 3CT9A 1Q5VA 3M30A 5FDLB 1N34J 4YB7A 3R7NB 3M9MB 2HWIA 1S1VB 5I42B 3OT9A 2I7NA 5F9LA 2HURA 1H1VA 4CTAB 2BUNA 5DM7L 3LDSA 5KFZA 1OPIA 3B78A 1SUQB 1GEHA 3OHAA 3OR2A 1VSEA 2F9DA 4C11B 3SDEB 2VPYB 4ILRA 3QYYA 4C97A 4CBXA 1OPZA 4A62A 1BOTO 3ILOA 1M1GA 3AH6A 1ZA2B 5T14A 1X4GA 5IWAF 3MF5A 3CCMN 2WVDA 4ICLB 2CXEA 4KHRA 5DM7Q 1RT2A 2HHHF 1FE0A 1JLGA 2VBWA 3CJ9A 3SV4A 1RHMB 3UVJA 2HF4A 5B0EA 4FPBA 1KFDA 2PO4A 1FFWB 2GIQA 1HYSA 5SWMA 3J81Y 1BLUA 4DV1K 3ET6A 1K73T 2NXJA 4X2BA 3MR7A 2HNYB 2M8HA 4ED7A 2R7WA 3W7BA 1FESA 3ID6A 3HOSA 4ZP7A 2VDIA 3VAJA 3TAEA 1AUSL 1RHKB 1UZHA 1R31A 1GXLA 4AL7A 5ETLA 4FM0A 5CZ1A 4TU7A 2J5AA 1EO1A 4B3SK 4ZVTB 4M3YA 2B43A 4JI0J 3MCSA 3DRRB 2XZTB 2AIRB 4IYQA 3V6HA 2Y0BB 3M32A 4A47A 5IT9U 3A8KA 1Y5LB 1I94J 4HR2A 2HMIB 2ASDA 3RB3A 4WTYA 1AXQA 2ZGYA 4CHQA 1XEZA 3TO8A 4HHTA 1UKUA 2UUCJ 2HRYA 3PV8A 3VEOA 3NH1A 3UDLA 1CSJA 1PILA 3DDNA 4A59A 4LFAK 2F8HA 3AA4A 3SIPB 2P5GA 1HKGA 3CD5A 2H51B 2X74A 1VQPS 4ERDA 2ASOA 1WC3A 1NAQA 4J9MA 2QL9B 2VKRA 3O4QA 4ECRA 1L3UA 5D4LA 3VWSA 2OO4A 2MZTA 1HHQA 5CA5A 1GLJO 4EI2A 2V8HA 3RB0A 3NFAA 5HP1B 2RF2B 4RBVA 4IH5A 2D0CA 4KRFA 2ROPA 2VQEK 3CCJN 3P6YC 2ACYA 4WFXA 3NMUA 4JLHA 3M6XA 2UXDK 3FE1A 3MMJA 4IRKA 4IQMA 2D9OA 2WW4A 4YR2A 2C2EA 2FVQA 1ATSA 1LOUA 4DSEA 2E29A 3GV7B 2QA4S 4DJBA 3BYRA 3AJ1A 5L38A 1M90T 5A8RA 3JTNA 4FWKA 5HRNA 4CI6A 4NXMJ 1S1UA 2DH9A 4O23A 4CGJA 4CK2A 4DX7A 2GEMA 5KFTA 3OW2R 5ETVA 2O5DA 4HACB 1Y7PA 4H5RA 3IBFB 3OXGA 4KHPK 2O4IA 3V6KA 3WZ0A 4BREA 3P5BP 2DR5A 3QGHA 3DGPA 1N33F 2FBVA 3LDQA 2RRBA 1NH8A 5BRFA 4MLEA 4BGAA 4CGHA 2D3ZA 1MWZA 1WKLA 4X84A 1N0UA 2JSXA 1YBTA 3ILIA 1YIJS 2QM1A 3SCIE 1APSA 3V81B 4Q7AA 4DQQA 4JI1K 1ASVA 4UZBA 2ZHOA 4PYAA 3BPDA 2WZ1A 2HSTA 4K0KK 3ITHA 4KIAA 3CULA 2E5LK 3LZJA 2Q6CA 3DDKA 3B8AX 2AV5A 2BJDA 3MUTP 3NRBA 2OA8A 4M7XA 3FZBA 4GVBA 3MCMA 4NRTA 4J9VA 5TKWA 3FZMA 2A18A 2BOAA 3IFRA 3Q8YA 3FZHA 1VHXA 3QNNA 3TZXA 1IO2A 2ADBA 3C0BA 4FJXA 4IUFA 4J9PA 3O1WA 1G15A 5H1SV 3CCUN 3IWLA 3SCXA 3QINA 2HBRB 4M45A 3GMGA 2Y3YA 1GLEG 3OL6A 5THWA 1HQEB 1P8ZA 2XYGB 4B9MA 2YX7A 1FEHA 1Z1ZA 1F1BB 1GLAG 4O3RA 1SPBP 2GUIA 3V9XA 4DFMA 4JOUA 3PW2A 3HXMA 4CJVA 4DV1J 3D45A 1RBTA 1X9WA 4FF3A 1DHMA 2J0QD 3QO9A 4WKRA 1OY8A 5CYQB 3T5HA 5C24B 3VGMA 4O8UA 4ILHA 1ZZFA 4C2MA 2L3MA 3VETA 2KKHA 4N77A 2WHOA 2V4JB 4K4WA 1D9FA 3CFPA 3EM1A 4ZPAA 5HAOA 1U1LA 2ZDPA 1IG9A 4NLCA 2G8WA 1OY9A 4K5SA 2OYQA 4NLWA 4G6VB 4BE2A 2CWKA 4X64F 1I1GA 3N5FA 4CQ1A 3GP9A 4AQYF 1FD8A 3W5YA 2JFKA 1VBKA 2CA9A 1AUDA 2ZBQA 4RW4A 3EDRB 3SQ4A 2QI2A 2MKJA 4MAKA 1NZ8A 5AZIA 2HHSA 2M5YA 5AQPA 2UUBF 3T7ZA 2J7UA 1KLMB 3MM9B 1FKPA 4LFAJ 3KJVB 4CJ7A 3AGRA 4TXSA 2XMKA 2MJUA 1IWGA 5JXSA 3CC2N 2DK2A 3GIJA 4DFPA 1RAEB 5KG6A 3LA0A 4KSEB 1NSAA 1N52B 4CCHA 2JJ4D 4HYKA 4OJ1A 2QGFB 3CEDA 3GQCA 4FZZA 3VGTA 5CCLA 4GKJF 3CERA 4FS1A 2CPEA 4XK8C 3D2FB 2VQEJ 3MUMP 5GADU 4WQ4C 4JP8A 4YS2A 4CLKA 3SQ1A 4N56A 3FZ2A 1MU2A 3DFEA 3SSQA 2KO1A 2UXDJ 1KXPA 3SBTA 1PIEA 2E9ZA 1FO1A 1WNEA 4OYOA 3ZFVA 3KNGA 4O3PA 4YNQA 3IM9A 2A6AA 3NP5A 3BGRB 2PC6A 3GBTA 2NXNA 2QKBA 1NUEA 2IM0A 4LR8A 4WJBA 3AQOA 3A5OC 4PUOB 4FK2A 4FWNA 3OYNA 2IVFB 3VENA 3ZTPA 2V50A 2H65B 3VQ7A 2J6TA 1GLFO 2OD4A 1LWFB 4DV6F 5A6PA 4KHPJ 3ZTRA 2LDYA 5MLCV 4ZPDA 1ROFA 4URGA 1VQ6N 3IM8A 3SQOP 5C2CA 2AGPA 2CQDA 3OVBA 1L5UA 5L8RC 4LFBF 4DR2F 1FRIA 2W4DA 3HHDA 2F96A 4EUVA 4Q2LA 1S49A 4FKYA 3CQXA 1QY7A 2G1DA 4XPEA 2BKPA 1RQ0A 2JRSA 5LMNF 4B3MF 1IM6A 1KBRA 4JI1J 1XN9A 4IQXA 2ZJPL 2KI2A 4KFBB 4DPWA 4K0KJ 4CJQA 4O3NA 2E5LJ 2AJ2A 1OSDA 5KFXA 1BQNA 2W1BA 3ILJA 3C6UA 1U2CA 2DGQA 1BIZA 2GCFA 4JN4A 1O51A 1X4HA 4CEAA 3SLCA 2JFDA 2PBDA 5KT5A 1HBNB 3CQYA 7AT1B 4O4RA 1VQOS 2GMLA 2GJIA 3KHYA 3KJFB 4CIFA 2ZJPQ 3MCPA 2DNKA 5E5NA 2C2OB 1OIAA 4H4OA 1S7HA 3OR1A 1X5OA 4QWEA 1FEEA 2CRLA 4DWIA 2WBNA 2XB2D 1Y64A 3UE5A 4LBPA 4G65A 3J81j 2HS3A 1DARA 1JXLA 4NZ0A 2O01C 1RTJB 3ATVA 4NLRA 3N4QA 1KAZA 1WSJA 5CZ2A 1ZYQA 1SQFA 4WK1A 2OPRB 4DB3A 3H5SA 3TAQA 1TUWA 2V8VA 3ZSWA 2ALZA 2JX2A 4C3LA 5K14A 1OQ6A 2HLTA 4TQRA 1TYQA 3LH2S 3T1YF 4FYXB 3FZLA 3PVXA 3IC1A 1RT5B 1VQNN 2LQ9A 2CGJA 4MKVA 1CZ9A 4O44B 4QOTA 3D1HA 3WC0A 2G2OA 1S9FA 2HQFA 2KZZA 4K8RA 4O55A 2B4VA 4IO9L 3GL1A 1KS2A 3BEGB 3KD1E 3LP0A 2MQ8A 1YVFA 4FNIA 4BGBA 5KFYA 4UY8T 3O3FA 4MIBA 4K5RA 2LEBA 3SV3A 1T03A 3FUYA 5A8KA 3WT0A 4R0JA 2DGUA 1T9VA 2DH8A 3AARA 4BR5A 4F0HA 3QZ7A 4BG9A 1H2TZ 5ETKA 4R5PA 1TKXB 3NHGA 4IO9Q 3V2UC 1LEOA 1HWUA 3KG0A 4OPHA 2KTQA 4WQ5C 4ED2A 1JLQA 1K73O 3DKDA 3EX7B 4ED4A 1SXLA 5C7PA 2B51A 3IRWP 3I33A 4PXEA 5E3RA 2EC0A 3QFPA 2P9CA 1JLFA 1H2VZ 4A61A 3D0IE 4TNOA 1KHVA 5D4NA 3BSNA 1HHSA 1BQXA 2HFZA 1XR6A 3IR5B 3TPQA 1C0UB 1S1TA 2ZQBA 3L7OA 3SAFA 4F02A 1J5OB 1U4BA 4OZ2A 2OTLN 3Q2TC 3ENVA 2YHYA 2DNHA 3P8BB 5HI7A 1B7YB 3I4HX 3KLHB 3HZ6A 4J9UE 4OZ5A 2PYJA 4EP4A 3CQ8A 1J27A 2RHKA 4H0OA 4DV7F 2D3O1 3CHWA 5KFHA 4B1WB 4FDFA 2I9SA 2YI1A 2DCUB 3FJ2A 4FL9A 1HKCA 1RAIB 4JKGA 1FWLA 5B09A 3I0SA 3DRPA 4RNFA 3TANA 1TL3B 1IH7A 4OYBA 2HWTA 3HPGA 1W2IA 3EEQA 1VAZA 4GO7X 1V4TA 1QM9A 1IJFB 2D4WA 4K43A 1MA9B 4CEQA 4ZVHA 4FWPA 2HYIB 4Z37A 2IA6A 2HFUA 3V6DB 2VJVA 4KR0B 1ZAVA 1RT4B 4Y00A 3SCJE 5DJBA 4M7YA 4ED1A 5D0RA 4JRQA 1N33K 4C8NA 2FSNA 1FX2A 2W01A 1BISA 3IS9B 1WTFA 3UKRA 2F8SA 3G87A 4XH1A 1TVRB 1JXBA 4FOIA 5F3ZA 3MM5B 4K4VA 4QYRA 1CG2A 1QS4A 2HGNA 1K47A 2DEJA 2O8CA 1C0GA 3F44A 2RB7A 2PFFB 3Q8SB 2B9WA 4OHZA 1RISA 3AAWB 1D1UA 3FZKA 1TQLA 2QN6B 2IA0A 2XLJA 2FJXA 3W61A 3M8PB 2MZQA 2KT5A 3QSIA 4HH1A 2XS7A 2E7VA 5FPMA 4ISEA 2JGUA 1HQUA 1O5JA 1YLXA 3O3LA 1RYSA 1BMQB 2DHGA 1VRUA 4LSLB 2NRWA 3SPZA 4C98A 1NJZA 1HKBA 3KMSA 2ZH7A 2BOPA 3B4MA 3CCVN 4DTNA 3J80O 4F3OA 1DTQB 3DRSB 3UCGA 3KHGA 2GTDA 2HBLA 1CJTB 4BC9A 3AOAA 1E6YB 4FP9A 2W9BB 2VUGA 1M5KC 1XTZA 2I8EA 2OGUA 3P45B 1FK9A 4WYBA 1CPZA 1U09A 4NLXA 2NZCA 3HT3A 4J8FA 2QEXS 1QSYA 4F0KA 2EBEA 3RVCA 4Z4EA 1EX4A 2KN4A 2J7WA 2E88A 1RTHA 3I32A 4M5KA 2VV5A 1T9YA 9RUBA 4RW6B 3AOBA 2BX6A 1NMNA 2PYLA 1SC1B 3M2UA 1Y9OA 3CMEN 3BGOP 4CWBA 4PG8A 2E5JA 1VQMS 4NPOA 2P5OA 2CQ4A 4ETZA 1E3MA 3GSIA 3OQ2A 3I4PA 1XMOK 3NGIA 2UVRA 4I2PA 5HROA 5KGXA 2QV6A 4J2AA 1JKHB 1JLAB 5KRTA 2BH1A 1VC5A 5CD4A 1RDWX 1YUWA 2WB4A 2VFTA 2UXBF 5LOQA 2DRBA 3VAIA 4X64K 4DN9A 4DV5F 1EB0A 2Q3PA 2FIUA 2ZBPA 2M4MA 2CQ3A 3OUYB 2J4RA 4AQYK 2M0GB 2HVZA 3KLGA 1DFDA 2AX0A 3GPAA 4P75A 4USKA 2KG1A 1NKEA 5DS7A 2VPWB 1G3OA 1H38A 2I5JB 2UUBK 5CD4H 2FGOA 1HR0F 3UE2A 3B6OA 2QXFA 2QLWA 4HTUA 3GR1A 3DLKA 3ALYA 1VQSA 2XSJA 3ZT1A 4USJC 3VQAA 3P49B 4WZMA 3LM9A 3AVLA 1NHVA 3NVKA 3A8YA 2FHKA 3OYLA 5G0RA 3CD6N 1G7CB 4IG3A 1NGJA 1Z05A 4A5AA 2MHEA 3TQ1A 5AQIA 2C3OA 1TK0A 1WI8A 4LF7F 3RBEA 1K8AT 3OTEA 4GKJK 4A8XA 3EGWB 4L3KA 4V1Ak 2KRBA 3PSFA 2J9EA 2B6AB 2NSBA 5KTQA 4ECYA 1T02A 1T3VA 3THWA 5ETNA 1NK5A 2O3DA 4NYNA 4F4ZA 1FJGK 4YB6A 4E2FB 3K5NA 3AA3A 3C6TB 3QRRA 1EJ7L 4B02A 5LM7E 2BV3A 2DYAA 3CE8A 2MZRA 4X66F 2CPHA 5T7LA 2FB0A 1RT7A 2KVQE 1LOTB 3DYAB 2KRRA 2Z8QA 1IBMK 3U6FA 4JKBA 5HQ8A 2GVDB 2PMWA 4J91A 4EEYA 2ZEJA 5KFFA 2CQIA 3L8BA 1UOCA 4PL8A 4PCQA 1EKRA 3FSYA 3MXMA 1N33J 3V9WA 1YBAA 5AQHA 5L1KA 4ID5A 4PEOA 3E01A 1IM4A 1IBCB 2HRTA 2RAQA 4BWMA 4DR2K 2J8AA 4NCAA 3VTIA 1T9WA 4K4YA 2FSJA 4QIEA 4Z94A 1WEXA 5IXUA 3ID8A 3TJ9A 3C8YA 4RBTA 4JI6F 5F0XA 3QFUA 3WXIA 1HBUB 3MN7A 2VG6B 2RQMA 3DWLA 1T05A 2YJFA 4F7VA 2Z1JA 3ULEA 2MKKA 2BTFA 3M8YA 2PY5A 3FBCA 1P6TA 2BJ1A 4HWIA 1NMEB 5M2PA 2X1GA 4CO1A 4QS9A 4AM7A 4CLSA 3FNNA 1UTAA 2O8FB 1B0PA 1VQLS 4OYWA 1PC4A 2J8SA 2R8GA 3RWUA 1IJJA 2F5GA 4FKXA 1FDDA 3EZUA 4WFYA 4M5GA 2IVMA 3ZYYX 1Y97A 2JVOA 2HIQA 3KK7A 4ATNA 1I5OB 1NGDA 5ADXA 5L9XA 1C6VA 2ZKUA 2GAGC 1Q16B 5FPEA 3D6RA 1FFGB 1LWCB 1W26A 1DBDA 4EU0A 4OQJA 1RAJA 2DD8S 4KE5A 1W9HA 2HB5A 5AZJA 4WZQA 4LF5K 2IRXA 2XCPA 4XEIA 3NS7B 3FZFA 2A3JA 2R7TA 4QOZB 2ATCB 1LFPA 3P83D 4XPCA 2MJNA 1HI0P 2JH3A 3OTBA 4WE1B 1U6ZA 2CVEA 2ZOFA 4Q45A 3CJAA 4BRPA 1S6OA 3AVMA 1PBAA 1XMOJ 2RDIA 4BRAA 3T5LA 4DFKA 3C15B 4M5HA 4X4SA 4LFCK 4GC6A 3NCIA 1RILA 2O8DA 2ZNZA 1KEKA 2W6LA 2ZVSA 5M2UA 2VOOA 1HBOB 1BDGA 4PRFA 5C42B 3RBZA 4K2JA 1IKXA 3VZIA 1VRTB 1IR0A 4K2XA 2O8EA 4X64J 3D5MA 3VVUA 3L3UA 3KZBA 4AQYJ 4KBIA 2LECA 3R5DA 2N4DA 2ITGA 1UVIA 4U8YA 5KFVA 3S3NA 4CECA 3H6EA 5AQMA 3DLBA 5EDWA 2NQPA 3WBZA 2UUBJ 4ELUA 1NEEA 4RU9A 2I6WA 1MMDA 2W40A 3KK2B 1W7WA 4YHHF 3FFIA 5GAEU 3UB5A 3UD5A 4EZ6A 2FF3B 3OYFA 2H3EB 3HMJG 3LGMA 1YJ9N 3SUNA 1REVA 2YWWA 2YKQA 4JD2A 5CZVA 2V63A 2ZE2B 4NASA 4DV0F 1YZ6A 4PG4A 3J7YI 3FEXB 4CF1A 4GKJJ 1S79A 4RCHA 2YNIB 1Q81T 3VZHA 4QQBA 2M8DB 2E4LA 1FRHA 2FHOB 1EKSA 3M6WA 2F1FA 1S9EB 4DBQA 5DQIA 4OYAA 5K8OA 4DCHA 2C2DA 2HLUA 3RMDA 3AO1A 4ED0A 3NY0A 1NU4A 3D9BA 1FJGJ 2ASPA 4X62F 3LAMA 2OH2A 3BSAA 5IT9O 3O9TA 2VFRA 4J7CA 4OYIA 3ENBA 2F7VA 2VC0A 3GTYX 4M5LA 4ISGA 1VSFA 2DY9A 2KXFA 1BWEA 3PRDA 4DV7K 2B5JA 1UP1A 2CG4A 1NK0A 1IBMJ 1IBKJ 1N5QA 5J1PA 2F40A 3OVNA 3BR8A 4OJHA 2YNFB 8AT1B 2VBXA 2MEWA 3H3OB 2VWBA 3WEEB 2Q0RA 3TSPA 3HLUA 5ETOA 4P2FA 3CXCR 2QA4N 4OZ3A 1REGX 2IVOA 4DR2J 3ZZZA 4HHUA 5CE3A 5JLHA 5IOLA 3DNCA 4DUZF 3BZCA 1XR7A 1FKOA 1YTYA 4QPXA 3G25A 4USWA 4FWQA 1FERA 2FF6A 1IBLK 3BF4A 3EWGA 4HL9A 1VQ5N 3H25A 3P38A 2DISA 3D7SB 4DG1A 4NLYA 1T6DA 3L2RA 1VBZA 4RJVA 1XNRK 3GG4A 1Q53A 3ISNC 1KNZA 5BREA 2DKOB 3EICA 4FJ5A 4BR4A 4A8QA 4QIVA 3LALA 1RB0A 2DJWA 1HD0A 2WW8A 4BCAA 1AZSB 3QGIA 4RUHA 1S1XA 1UAWA 2G8VA 2DGVA 4DTRA 4MIAA 5KFAA 5AQOA 1XI1A 3OYHA 5GAGI 1JJ4A 3ZX3A 3JSRA 4CZEA 1ZPWX 2P9KB 2VYPA 4X4VA 5B0BA 2WVBA 1NLVA 4PKHA 1ZBTA 1PJ7A 3PJ9A 3UD3P 3OYKA 1RA7A 5IQ6A 4OIXA 4DTUA 3CJ0A 2JLGA 4BC7A 4LF5J 2ZWOA 2DITA 2XYPB 4RBUA 4FOEA 4YOEA 3RRGA 2WB1D 3ZEUB 3MEEB 1KTQA 2YPYA 1S9GB 3QQCD 4KHQA 1WSVA 1Y3JA 1VSDA 3TJ8A 1S99A 3CJRA 5AQZA 1DLOA 1TK5A 5CZXA 4EHUA 2WTFA 2RH3A 2Q6BA 4IDKA 4ZN3A 1XNQK 4LFCJ 2UXCK 2P9LA 3HM8A 2G2ZA 1XERA 4BROA 1T44A 3G10A 4ZVOB 2K1RA 1H2UX 3MCOA 1GX5A 4ED3A 3IMQJ 1X4FA 5B8HA 4DQ8A 2ZBCA 4I2QB 2OD6A 4FS2A 1CJKA 4CJ3A 4GKKF 5AFUH 2MKYA 3A12A 3RG6A 2BW2A 2EFVA 3KOAA 4LF6F 2EHGA 4G1QA 3MM6B 1NGAA 3VCDA 3NDKA 2XHBA 2OEJA 3SCKE 4Q2MA 4DUYF 4GMJB 2YWEA 4KBOA 3CTRA 4QBUA 4ZJOA 2JOQA 2Z1HA 2L9NA 3BS9A 3W64A 3CJKB 2V7ZA 3TWHA 4AH9A 4DSFA 3SZ2A 3OYBA 5C12A 2NXUA 3EDQB 1BHNA 2QRRA 3VGKA 4DV5K 3DCAA 1Z25A 3NXZA 2HVEA 2QX0A 3KNAA 2XO7A 1HARA 2C3UA 4F50A 2AYMA 3G6EN 4IOCL 1JB0C 3LW5C 4J9LA 5HQLA 3W8GA 3DMJB 2W9CB 4OV1A 1FDNA 4Y2KA 2MLXA 1HR0K 1S6PB 4ILLA 1Q9YA 3FSXA 1KAXA 4RNMA 2PE8A 2FVPA 4OX8A 3ZETB 3L2WA 3IRXB 2OJ3A 1ZOTA 4DV7J 5A8WA 4RW7A 2PI5A 3Q8PB 3IWXA 3LGHA 2RU9A 1EWRA 3RAMA 4IOCQ 1RCHA 1J9AA 2E2OA 4FLWA 5F8NA 2QA4G 5F8LA 1NGHA 5LXYA 4CGGA 4YDUC 4ZCMA 4ZK7M 5I3UA 3BO2A 1B9DA 1SKRA 4ED6A 3NBPB 3I9ZA 3QESA 4LH4A 1JLCA 5AQUA 5HVGA 1T9XA 4M5JA 1K8AO 4ZPBA 3WXJA 3P3DA 2V69A 1UEKA 5GIOA 2XMJA 4F4XA 5BPLA 2VB6A 2DFHA 2DFFA 3R1XA 3T6JA 4C8OA 3TUZC 3CCMS 1YJWN 3PJWA 4LIWA 4DTJA 1IBLJ 4FF1A 4ZP6A 3NCQA 1Y4ZB 3IA0A 4PY5A 4YN3B 4V19X 3K57A 4NA2A 1XNRJ 1KN6A 4C9DA 2KFNA 3HHLC 4PPZA 3PJXA 1TL1A 2RJZA 4LF1A 1YITN 2VG7B 3Q2SC 4K4TA 3CC4N 2EVZA 2QMUB 3HSZA 2X3GA 2E6MA 1FCAA 3HKWA 4DTPA 4Z4FA 4K8ZA 1D8YA 3HVAA 4CK3A 1U25A 3AD7C 1TKDA 4Y1DA 2ROEA 2JWKA 2Z2LA 1YWXA 2E7XA 3OSPA 1TELA 3QIDA 3DOMB 3GZ7A 3KUEA 4C3KA 1O1WA 1KVAA 4QAGA 3EVWA 2CIMA 3DC2A 1UVNA 2IJRA 1EQMA 5F9NA 3HT0A 5T7BA 3AVAA 1SIWB 3CWJA 2IC3A 2IHR1 2HBMA 1YSJA 2BE2B 2OKQA 3LZIA 2AP6A 4MK8A 3T3FA 4NLDA 2ZFHA 2CQHA 3FQKA 5DGAA 1XNQJ 1RT1A 2NUBA 4ANDA 2UXCJ 3GOIA 1T95A 4GRSA 1NGGA 3GONA 3KWMA 4I6MB 5EWGA 3BUZB 3L7UA 4ZTFA 1F5AA 3H59A 1KVJA 4HVJA 4ZHRA 3PXGa 2JC0A 1U1QA 4DV3K 2J76E 5AQGA 4CHZA 3ENOA 1L3KA 3NWGA 1RWUA 4KV8A 1ZA1B 5KPTA 3FVYA 5J2QB 4PAAA 1WHXA 4RW8A 2M7SA 4DR1F 5HRPA 2MYFA 2P8IA 2YX4A 1S48A 5KT4A 3A5MC 3JYTA 2HVIA 3MEDA 1TUGB 1K1QA 1WNSA 2R7RA 2QWQA 2EC2A 5HJXA 4CT8A 3DXMB 3LP3A 2Y0SD 3C16B 5D4OA 2J0XA 4NLSA 5J2PA 2R7SA 3H90A 2NUUG 2QFIA 2MQLA 2DTUA 1VQ9N 3DLEB 2EFOA 5M1NA 2HNZB 1S5JA 3R3TA 1AW0A 4RKUC 4DV5J 3TQEA 4BACA 3DXKA 4DFJA 5L1IA 3MFIA 1A7GE 5ETTA 3GIKA 4BDPA 2AX1A 1JL1A 4NLQA 4DQPA 5KFCA 2YNGA 4USVA 4HTIA 4ZP8A 2RVJA 4LREA 3RBXA 1VQ7S 1T6CA 1BUXA 4V19J 2ZOGA 1QE1A 5E2QA 1HR0J 3A13A 3LP1A 2YCHA 4F3TA 4I6YA 1KC8T 3PYDA 1RT3A 1NOZA 4EO6A 3V4IA 5KG4A 1BO5O 3BN4A 4TY8A 3AO3A 4UQGA 2V67A 3HVTB 3G4SN 4HCCA 5J1EB 1UPPA 2X1BA 5AXNA 3M30B 2XRIA 2B56A 2NS1B 4NMXA 1SCJB 4NMLA 4MK7A 4LRCA 1IWAA 1VRQC 5JJBA 3MMBB 3K2PA 4XH5A 2GS8A 4WFAL 2GHVC 1BA0A 1CXQA 2OEKA 1LW2B 2VODA 1WB9A 4X62K 2BW7A 3FBFA 3CCUS 3EE8A 1XHXA 2N7YA 2WOMB 2DNNA 5HN0A 1HNXF 3U9DA 3FBEA 4CJUA 4JYAK 2O4GA 2QWNA 3UI3A 4WFAQ 4U7UK 4M3XA 5BR9A 4OZJA 4CFDA 1PCAA 1WHYA 3PM9A 1X3NA 1Z4UA 3QATA 2V2QA 3Q8QB 5KG0A 3CJ1A 4B9LA 3HSDA 1RABB 5KFPA 4CH1A 1YXQA 3Q89A 1V9OA 1VQ8N 3NGDA 2DPJA 2RKIB 2P9UB 4O0NA 2ZH9A 3GG1A 4DR6F 2L9WA 1DEJA 5FDLA 1UZDA 5IS2A 3R5AA 4X65F 3PW0A 3TA0A 5I42A 3VERA 4CTAA 3VHQA 1SUQA 1OYDA 2XY7A 1ZBSA 3WUHA 4DL2A 4JKHA 4H0XB 1N88A 3CCWA 1M1KO 3TVZA 4C11A 3SDEA 1TGOA 4FJIA 5HBMB 3CIZA 2CUYA 2FQQB 2HS4A 4FO0A 2IIRA 3QIOA 1G4CA 4K4SA 1KAYA 2GJ2A 1NZAA 1W2BR 4V19S 4GV6A 4TYBA 2D5RA 4IFYB 1RDAA 3FCWA 4ICLA 1F21A 2B4UA 3M4XA 3CC2S 3A8EA 1UVJA 1VSLA 2HQIA 3SFGA 3US5A 3NF8A 3D0PA 4DQRA 3QBXA 3THXB 1W2BM 4XTTA 4DV3J 1FRLA 2HSEB 3AA9A 4NI2B 2EKNA 3PEJA 2HW3A 3CPWR 2KYZA 4XO0A 4BHQA 1GMUA 5C10A 1GQEA 1HNZF 3OPKA 2HNYA 1Q8KA 3CGIA 5LJWA 3PSIA 3O44A 4DL3A 4BRDA 4A46A 3CPWM 4GO5X 5KQ8A 1Q86O 3FRYA 4Q0BB 4CHYA 1VI7A 1NXIA 4ZVPB 3OS2A 3AHPA 4H4KC 4AE5A 3G6VA 3AT1B 2D0AA 1F9HA 1B99A 3VQEA 1VDHA 4M5DB 1HPZB 1NK7A 3WDOA 1B70B 1X4DA 5F1XA 3TAMB 2AHOB 4BR2A 2KZMA 3MFHA 3DRRA 2EPIA 3ZSQA 4KPCA 2WCXA 4GKKK 3PW5A 3D3CJ 1EETB 2YHBA 2HMIA 1KD1O 1T7PA 3C2PA 1NDCA 3OFFA 1MN7A 1S10A 1NDLA 2VFVA 3HD1A 3KMQA 2KG0A 2KFYA 3G0ZA 3NAIA 2NCKL 3D1OA 4NYZA 1G99A 4CZLA 2FJWA 1D3WA 4I4BA 3HVRA 2QC3A 1RFQA 2YWGA 1HHTP 3BV8A 3MEGB 1Q82O 3UIQA 4BR9A 5HP1A 2RF2A 5EVZA 3T1AA 3NWRA 4GVLA 1EARA 2ASYA 2DR8A 4USUA 3WQPA 4NYFA 1L3VA 2FGCA 2CNKB 2V94A 4CYUB 4LVOP 3WIUA 3RR8A 1R8AA 3DU5A 5E3QA 1LQ9A 3CYMA 1NO8A 4C8YA 3R5GA 3G71S 4CD3A 1HI8A 3UKUB 2BJEA 2I1RA 1B7FA 2WBMA 4CZFA 5JVGQ 3MWBA 1FD2A 3S01A 1CLFA 4X4UA 3EZOA 4X62J 1W7AA 1NDPA 1HBMB 2XI3A 1Q4RA 4DR4K 5JS1A 3QFWA 2BDPA 3U1NA 2ZH4A 5KOWA 3WX4A 4PG6A 4DPTA 4U7BA 3ZTOA 1SC4B 1YG0A 4WXWA 4CO2A 4HACA 4C3MA 4IG0B 3V1OA 4JYAJ 1U26A 1B92A 1V6HA 1DZ5A 1PJ6A 2VIHA 2EFPA 4XIUA 4E19A 3MM8B 1HJRA 4K42A 2V68A 3LQVA 3RZAA 3NF6A 1JK9B 1RBUA 3GYNA 3PYEA 4LC9B 4L3QA 1VQNS 3QAEA 3V81A 5BPMA 4H0PA 5H9FK 5GADP 2RRAA 3AXKA 3AO5A 1WEZA 1F3VA 4M5NA 3LM2A 3O2IA 4DPXA 3OYGA 5H9EK 4B9TA 1G1XA 2CQGA 3TYTA 3TUIC 4DMNA 2DH7A 2NXCA 2IDEA 4GNIA 2NRHA 4QIFA 4DI6A 5DG7A 4B3RF 3T19A 3S41A 3AD9C 3W8PA 4JRPA 4OI4A 2E6LA 2KLAA 1EP4B 5KFUA 2F63A 1P9YA 1YBUA 3BBFA 1RTIB 4KB0A 3N28A 5C2DA 3TWZA 4IR1A 2KKZA 3WQTA 3M1VB 4X4TA 4KB1A 4PKGA 2DRDA 2QO3A 1HQEA 1I51B 1VQLN 3P4UB 4CF8A 5IV4A 4M1KA 1J54A 2DNPA 2L41A 3B54A 2HZVA 4C0BA 1RWVB 1OH7A 5D3GB 4WKYA 4DHVA 3LUYA 4YP3A 4BS2A 3K5MA 2FC0A 2BQUA 4MFBB 5CYQA 5C24A 3F41A 4J9RA 3HJFA 3GR0A 2OTLS 2F65A 5LXRA 2ETJA 3DLLL 5BR8F 4OL8A 4OX9F 4ZLNA 3QGPA 1RDRA 3J8AA 2V4JA 3JQJA 3A8JA 2VH7A 5K8NA 3NLCA 3JQKA 3QDKA 2IAJB 3KLIB 3H1VX 2VHGA 4CJFA 3BR9A 1BI4B 3CDUA 3PFOA 2F9WA 1WUAA 3SQ0A 2HQ3A 3N5BA 4ECQA 3H5UA 1MWMA 4FF4A 4PXBA 1ZS6A 5A2QY 2B8PA 4NWBA 4UUXA 2JWNA 5HLFB 2Q3SA 1O6XA 4ECSA 4EFAC 2PT0A 4X4QA 1ULRA 3DLLQ 4AFFA 1UMJA 1E4GT 4M63A 4GKKJ 2GQQA 5K20B 1PO6A 3MZIA 2P5VA 4DPUA 3MXJA 4DR1K 1JLBB 4M5MA 2UUTA 1IXKA 4RUCA 3B6BA 4A5BA 3T5KA 2E1MC 3PYGA 1KLMA 2XSFA 2NZTA 3MM9A 5G4DA 2X78A 3KJVA 4HTJA 3MR2A 1WI6A 5EU7A 4JKEA 1ZBHA 3THPA 5FLXY 5FJ4A 5M1KA 4IKFA 2MKCA 1RWXB 3G8QA 1R6YA 4Y6IA 4NRUA 1RZMA 4PKIA 1O0PA 3C6UB 1R6VA 3D2FA 2CDRB 3HK2A 2K06A 4F9OA 2IPOB 4M3UA 4QCLA 3MPWA 3TR8A 2JEIA 1Z2ZA 2NRRA 3HHLB 3UCZP 3MI7X 4H5TA 3BGRA 4RX6A 2FC9A 4Q5VA 3VAGA 3M7VA 3ZSXA 3NOGA 5A6WA 4DR4J 4IO8A 2MY8A 4PUOA 1R7IA 3CJ8A 1RTDB 3TEGA 1JCEA 3MK6A 2Y1RI 4CZKA 2UU9F 2W6KA 3S7RA 4L8RB 1LWXA 2ADCA 2D9PA 1LWFA 1X4CA 1YJNN 1JXEA 1KC8O 4M3RA 3ASMA 1CULB 2OLWA 1TL7B 4HHHA 2UVVA 4BRGA 1JJHA 1RSCA 1FJEB 2W4PA 3EZWA 4NZ7A 1L3SA 3CCVS 5AJ3K 2A10A 3C3LA 4CI0B 2HOEA 2IOCA 2LEPA 1SJ3P 1C1BB 4BRQA 3EXYA 2E5HA 5H9FJ 3S6EA 4KFBA 5EY4A 2J6UA 2GUPA 2FD2A 5H9EJ 1HWLA 4LVNP 4DR7K 1X9SA 1OY6A 1Q7LB 1NDKA 2G1HA 4DZ6A 4IWVA 3X3UA 3HPHA 3NGTA 1KQKA 1HBNA 1IN0A 3UW1A 4GY2B 1WOSA 1GXTA 1DQ9A 4IOAL 4CBWA 4QR1A 1RAOA 3UN5A 1EX8A 2VF3A 4IOXA 3F56A 2NNWA 1JX4A 2XWYA 1DURA 4FWRA 2CPZA 5KG1A 5KGWA 4F3MA 4DR3F 4BLGA 4IZ9A 5BYRA 3JS6A 4OFZA 2GWJA 3CJ5A 1WAFA 4TKTA 4LR7A 3L4QA 4F25A 1FKAF 2B9XA 1SH3A 1RTJA 3MDQA 2VC1A 3JTPA 4B17A 5K8MA 1EHWA 2ZH1A 4KPYA 1BG3A 3GV8B 1TL5A 3OA9A 2OPRA 3GIIA 1N32J 4FZXC 4LF2A 3THVA 4DN0A 3TAPA 2FY1A 4A8SA 3TX8A 4X65K 2GA7A 3IAYA 1KKHA 3HF5A 1F3FA 4K41A 3OFGA 2PFUA 5LJ3Y 2AGOA 3PRBA 2HHWA 4DV4F 1UVKA 3W2WB 3D6FB 4A8KA 1D5AA 2BBEA 1EXQA 4IOBA 1RT5A 2YKOA 2D69A 2A6MA 1QSSA 4O44A 2NLWA 3GU0A 3GSDA 2ZM6K 1OSCA 2C2MB 2PFDA 4IJNA 2R9LA 1DT9A 4Y2CA 2ZJRL 3SQ2A 5IM0B 2MQQA 5JUMA 3CD6S 4J2BA 2O8BB 4HUFA 1OQ3A 4TVAB 3QIPB 2M2BA 1YZ7A 1HYZA 2GO8A 4FJ7A 3PYFA 2V2ZA 3IP0A 1WHWA 3V1QA 4K8XA 3BSCA 4NLUA 2NREA 4CERA 1VSIA 1VBYA 3OHRA 1K9MT 3C95A 3ISND 3I0RB 4YOWA 2VFSA 5ETRA 2ZJRQ 4DR1J 1NK4A 3K2YA 1HNZK 1S0VA 4CJKA 1YHQS 2R2SA 1FXXA 1TKXA 1TFWA 2YHAA 2C42A 5BRHA 3KDOA 3BQ1A 2EW9A 1QUPA 1VQKN 1JLEB 2LQ5A 4H4MB 4UW2A 3AVIA 2YY3A 4JI5K 5A0YB 3VQBA 1F9FA 1ZBUA 2MQOA 5D0HA 1FHTA 4Y0WA 5KFIA 2G8UA 1N6QB 1YKWA 3E9LA 1F5CA 2GW8A 3K8VA 3OTOF 1U1MA 2D0PA 1BA1A 3BKFA 1C0UA 1V3ZA 1J5OA 3NNCA 1YX2A 3EE9A 3H2UB 1Y00A 1ZBIA 2YPZA 4IO1A 5M1PA 1RKJA 1WC0A 3PTWA 3NGSA 4N7TA 4L73A 3SI6A 3KLHA 4Y1CA 3PR4A 1R8HA 4DSJA 2IM3A 2LFVA 4P2MA 4MLHA 4AHRA 3RW6A 2KJVA 1H0HB 3CCQS 3BY5A 3OY9A 2WTUA 4CT9A 3BZKA 1GLCG 2UV8G 3GILA 1RXOB 5GMKa 1A6LA 4GV3A 3QLHB 1S1WB 3RAQA 1LW0B 1TL3A 1EAYC 3H5YA 3R5BA 3VAMA 4IXCA 2UUWA 2WBRA 3MCAB 2B4PA 2KVIA 2V6AA 2WONB 1HQUB 3BDPA 2HK2A 3D1QA 5AJ3J 3MD1A 5EXWA 4CESA 3PLAA 3A5LC 4A8YA 4NXNK 3GJRB 3GE1A 4JKDA 4YDDB 1M0SA 2MY7A 1Q7YO 3EKSA 2XY5A 4DR7J 4M3ZA 2SXLA 1SKUB 3V6DA 1M1HA 3GJSB 1WLJA 2Q43A 3K17A 3HI0A 3ETMA 2X1FA 4JI3F 2QTDA 3RMCA 1RT4A 3N4PA 2ZZNA 2BXJA 4Z2XA 1CJVB 3R6LB 3WHIA 3VR1A 1C4AA 1RU1A 1PYOB 2HVDA 3V9UA 1OYEA 1RI7A 4FJNA 2BQ3A 3PKMA 3E51A 1TVRA 4MO4A 3MM5A 2KFZA 4KTWA 3VEZA 1K0TA 1S0NA 2AZ1A 3HBTA 2EWHA 1D9AA 3WX8A 1QDUB 2E20A 1S6UA 3G96A 1A5VA 1S6QB 2ZNYA 5BRDA 1U48A 4F8RA 5AQKA 4D3GA 1GOAA 1NKBA 2FLPA 3PY8A 5DDRC 3M8PA 4FJKA 4X65J 3FLCO 2KHOA 3AV9A 4OI1A 4AD6A 6AT1B 2GV1A 1NM1A 4I6AA 2F8TA 4FLVA 2D1KA 5HSPA 4FM1A 1VQ4N 4MKBA 2HHUA 2D3OR 2XHWA 1N5YB 2Y8WA 5EX3A 3JAMY 1DTQA 3DRSA 4CLZA 3LDPA 4Y2IA 1HNIB 1OMSA 1IG8A 4B1UB 1KQFB 1NG9A 2Z57B 3AA2A 2NSCA 2OSRA 1C1AA 4KT0C 2ZM6J 3SK3A 5GINA 1U8SA 1CJTA 3VN5A 1E6YA 4JI8F 2W9BA 3EZ5A 3O6WA 4B1XB 3AB2B 3AXMA 1YJ9S 1VLOA 1X4EA 4E1MA 5MLCQ 3AVNA 3SI8A 1UFWA 3PG9A 1KP6A 4DPOA 1WOQA 1T94A 2OHDA 1TUUA 3O5TB 3L7PA 1S72N 4RW6A 3MX5A 3MTKA 4N8NA 4BY9C 1B0TA 1VQYA 5DQHA 4XAKA 4CW7B 1CEZA 3THYB 1R27B 3HHLD 1HNZJ 3O3GA 1BWFO 1Y11A 1X0PA 1VR6A 1PYSB 4A2BA 5BR8K 1UCNA 2C2RA 5L46A 4ZA1A 3OBYA 1JKHA 4TU9A 1BC6A 2P9EA 4DTMA 3OSNA 3U1MA 3F9KA 1ITPA 2V4QA 3OYCA 1IKYB 5ETPA 3KLVA 4ZPCA 2V2VA 4U9RA 3ZO7A 4Y2AA 4C4WA 4Z0UA 2XZDB 2H1YA 4JI5J 3JXOA 3I82A 3TZZA 4H8KA 3CMAS 1KFSA 2RN2A 4J9KA 1ATNA 3OUYA 3K5LA 5AQYA 5IC6B 1SL0A 2VASA 3LGNA 2I5JA 3IKMA 1HNWK 1MWQA 4BDZA 5CH7B 4ECUA 5AE3A 2F4VJ 3BP8A 9ATCB 1H74A 1CLQA 3ZZUA 1N56A 2UP1A 3QRPA 1UFKA 4LRBA 1S77D 2WVCA 1NGFA 3NGZA 4ALZA 2YKAA 4KJIA 1IKVB 1VJQA 2BZ2A 3E2EA 1VQ5S 4EHTA 2KYXA 3D0HE 2XY6A 3UR0A 3VQSA 2APOA 4B9NA 1N34F 4BRIA 3RRKA 2WVEA 1VSKA 3OW2M 4FVUA 3Q0AA 1VQ7N 2B6AA 5J2NB 1HRHA 4B8AB 4FYVB 4OV6A 3MPDA 2KH9A 3G86A 3LOUA 4OHYA 4MKYA 1PGZA 1O8BA 3K7RA 5IQQA 3LDLA 3D6HB 3T6BA 3I5CA 4Y3CA 2AF6A 4CLLA 3P1GA 5JVHL 3QNOA 3C6TA 4YMEA 3Q8VA 1HW9A 2MGZB 2VCPA 4CO3A 3H4BA 3EE3A 2FJAB 3LDOA 4CJ4A 4NXNJ 1FXLA 5KG3A 3DYAA 2OZSA 3PUFA 4DSLA 2UU9K 3ZSZA 3I56S 3W0LA 2GVDA 3POTB 1MNEA 3MAHA 4X4NA 3IR7B 1X9JA 4U67L 4HHJA 1C0FA 5GAEP 5JVHQ 2XCAA 4ID1A 4YOXA 4RWTA 5KT3A 3R5JB 4WPAA 2KT2A 1WSGA 2QWRA 4LF8K 3QJPA 3BGFA 2U2FA 1DQ8A 1KTVA 1X5TA 2VU5A 3D66A 3OTDA 4Y34A 1KOOA 2Z2ZA 3JB9k 3NGYA 4JNEA 2WC9A 2QSWA 4C6AA 2CFXA 4TSXA 3W2VB 4U67Q 1WWHA 1HBUA 3DI6B 2VG6A 5B7WA 2D74B 5AQNA 4A57A 3J7AN 5KFRA 4C1NI 3Q24A 4JV1A 3HO1A 2AYBA 1K8KB 4CJTA 2CJQA 3G6XA 2IBOA 4FPRA 2W8LA 4JV5F 2G0IA 4A48A 3ZC4A 2RUSA 2O8FA 2OTJS 2YBVA 3I5BA 1CS4B 4F2SA 3R97A 1WF2A 3KUGA 1RU2A 3O4WA 1XQSC 3RMAA 3QAUA 2NLXA 5E7OB 1X1PA 1OWXA 4CLFA 4PQAA 1SBRA 2HHQA 1HUXA 3RBDA 3AOCA 1P27B 2XZWA 1HIYA 3AY9A 1LWCA 4FYWB 5HMZA 2C1EB 4B3SJ 4QYZK 2DGOA 1NGBA 1VHIA 4OKKA 1RWNB 2B7BB 2VBZA 1JCFA 2EFNA 2W9AA 3UWTA 3CFRA 2HQDA 3L9ZA 2R8JA 2XBPA 4KRWA 4ZVGA 3CO0P 4JI4F 2OUGA 1GLLO 3QFHA 3VVTA 2UZAA 5F3TA 3E66A 4NO7A 2EKYA 2P9NB 3IO1A 2AA4A 5E3PA 4WQ4A 1X7VA 3G6ES 4DV4K 3N9UC 2OFGX 3Q8UA 4WE1A 4KQZA 3HX9A 2H5IB 4WTOB 3A8IA 3MAAB 2ZZMA 1HJOA 4B1VA 5BR8J 3T1HK 1YJ7A 2ILZA 3C15A 1SL2A 2D0BA 2GELA 4PWWA 5M1OA 2C3PA 1WORA 2Q0UA 1RLDA 1RBAA 5DDPC 4RTFD 4UOCA 1HBOA 1RBLA 4USMA 2I0XA 2P9SB 1IKWB 1RWWB 2F9TA 5C42A 2FVCA 3V9ZA 3QETA 4HEA9 5C25B 3FK4A 4HLBA 4TLQA 4FBTA 1QHTA 4J90A 4FBUA 2E1AA 2Q2RA 1PYTA 3MOJB 4GVEA 1Q95G 3M05A 3FKBA 2KDOA 3VV2B 4I69A 4G3IA 1Q8BA 3TOQA 4H5WA 2FVRA 1RAHB 5L39A 1VSMA 1UWBB 3S1TA 2O67A 2DNZA 3MN9A 3FEZA 1HNWJ 2HQGA 2CPJA