5J2QA

Hiv-1 reverse transcriptase in complex with dna that has incorporated a mismatched efda-mp at the n-(pre-translocation) site
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
547
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase p66 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 154
structure length 547
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2qA05
4IKAA 4RNFA 5KT5A 2ETJA 1A5WA 3SV4A 1VRTA 1S1UA 3C95A 4ED3A 4NLGA 3V1RA 5KFYA 1RBTA 5T7BA 4FS1A 4KHQA 1WSJA 2YNHA 3AVBA 3PUFA 4FW2A 3QEIA 4RW9B 1Z26A 3KLVA 1XC9A 1JIHA 4QPXA 5KFZA 4CEOA 1ZBHA 4RW8A 1S1XA 2BE2A 3G86A 3RAQA 2FBXA 3SV3A 1RILA 4KHSA 2JLEA 4Z4FA 4WFXA 1TVRA 2R2RA 3QIOA 2KZMA 3DLKB 2XGQA 3CG7A 1TV6B 4BE1A 3I0SA 5J2QA 4IR9A 4DL7A 2UUTA 3OY9A 2IDOA 4QWAA 4ELVA 1IG9A 1HNIB 1TKDA 4FBTA 2XI3A 3NAIA 1JLEB 1HNVB 2GUIA 4QWEA 1HNVA 2JEFA 2JEGA 4J9MA 3ZT1A 4LSLA 4FJNA 1BISA 3NH1A 5CZ1A 1BCMA 1KFDA 5K14A 4M3UA 2P5OA 3HYFA 4DG1B 4DG1A 5L9XA 1QSLA 2JEJA 4DL6A 4DL3A 3GIMA 3DRPA 4MK8A 3ZT4A 2DTUA 3M8QA 2F8SA 3KLGB 2E9TA 3QERA 1L3UA 2BDPA 4W5RA 4FJXA 5HLFB 4ED1A 4KHMA 3PVXA 3FDSA 2J6TA 5DG8A 4WXWA 1HMVB 5J2MA 4Y1DA 4XPEA 1JLCB 2WCXA 3RRGA 1S4FA 4HTUA 4DQPA 1XR7A 3SUQA 4FS2A 1LWCA 5KFKA 4LSNA 5HP1B 2HHXA 3NF7A 4LQ9A 4URQU 5KT7A 4EZ9A 2VA3A 5F8IA 1QAJA 3CWJA 3RRHA 1JLFA 2VG6A 3V1QA 4IG0A 3ZT3A 4O3SA 3NF6A 3GILA 4U7CA 2G8HA 4NLYA 4RW7A 4CHOA 5KFBA 1KVBA 2YKNA 4KB7A 4CF8A 3KLFA 3BREA 1S6PB 1S5JA 3VQAA 4EP4A 1S6PA 3AA3A 4FM2A 3TANA 4OVLA 2IM0A 4QW9A 1QSSA 2D41A 1RT7B 4B8AB 1HQEA 4KI6A 3AVMA 4DU4A 2HNZA 2OPQB 3AO3A 3K5OA 4TYBA 1RTHB 3FFIA 1UWBB 4ECXA 4BE0A 3OLBA 4CHQA 4B9VA 3C94A 4NRTA 2HWIA 1D0EA 3TABA 1TKXA 4O4GB 2GBZA 1JLBB 1ASVA 4O4GA 3RAXA 4CJVA 3SCXA 4E1MA 1NJZA 1WNSA 4MK7A 4KO0A 2BRKA 1YTUA 2R2TA 2W8KA 3JSMA 3NE6A 1S1VB 2FVQA 1FKOA 4FJGA 1IO2A 3BSOA 5DGBA 3MR2A 5EWGA 4TY8B 2IA6A 3HVAA 4FCYA 4Z4GA 1R0AA 3CVKA 4UQGA 5KFVA 3TAEA 2IJFA 2ASDA 3NBPB 2HMIB 2XY5A 4KRFA 2BGGA 1NK5A 1RT3A 4M3YA 2QE5A 4I2PB 3O4NA 3KIOA 4E1NA 4FLTA 5DLGA 1JXBA 4FM1A 4ECVA 4ICLA 3OYMA 3L8BA 3BSNA 3SQ2A 5I42A 2YNIB 1EETB 1J5OB 1SV5A 3KHGA 2R8KA 1EETA 1J5OA 1TKZB 1RT2B 2ILZA 3K2PA 4J2AA 4FK4A 3QNOA 3P83D 1IM4A 1FKPB 4B3OA 5CYMA 3HP6A 3VQ8A 4FJ5A 2ASJA 3PX0A 4DTPA 5DQHA 5KFWA 2JC0A 2W7PA 1C6VA 3NGDA 3TAGA 2WB4A 1CZ9A 2AGQA 1SKRA 3H5YA 4CERA 2WTFA 3NAHA 3UPFA 4GW6A 3KK1B 4B9SA 3MEGB 3KK2B 1VSLA 3VQ4A 1RT4B 2ITGA 3KLEB 1RT4A 3H5UA 3E51A 1C1CB 4CGJA 1C1CA 2EC0A 3V6DA 4YP3A 2BQRA 1GOAA 3KMQA 3BSAA 4EEYA 5C24A 3T5KA 1JLAA 3NDKA 3DLEB 5HROA 3PHEA 1RDCA 4MIBA 5F8JA 1JLGB 3NGZA 3K59A 1S6QB 2HHUA 4H4MA 3LPTA 1S6QA 2ALZA 4FK2A 1WAJA 4WZQA 4FXDA 4C8MA 5F8HA 3QYYA 2WHOA 4OPKA 3NF9A 1NJXA 3OL7A 1TGOA 1KLMA 4DF4A 2IGIA 4CFBA 2V4QA 1KLNA 4CJKA 3KLHA 1QE1B 2DFEA 1QE1A 4J9QA 4IFVB 4ECQA 4CGDA 5L1LA 4ED6A 2YNGA 3PJXA 3QGIA 4IDKB 2ZKUA 5HBMA 1K6YA 3T19A 4AH9A 4CEQA 3C6UB 3S3NA 4ZTFA 2R2UA 3PR4A 3KKSA 3T3FA 3T5LA 3VQCA 3HVRA 3OYCA 4CGFA 4CESA 1JKHB 3AV9A 2XHBA 2RF2B 3UDLA 4KAZA 2PZSA 3HO1A 2OPRB 1QTMA 1JX4A 2AJQA 3I8DA 2W8LA 3DRRB 5HRSA 3E01B 1I39A 3PZPA 2DPJA 3D0PA 1IKYB 4NLDA 1LWEB 1IKYA 2YNFA 5SWMA 1SL1A 3IN5A 3OYHA 2E9RX 4JV0A 3HVTB 3HSTB 4FJKA 3TR8A 1VSKA 4O4RA 3IAYA 3OL9A 4J9LA 4RNMA 3QLHA 3KHLA 4ECYA 2Y1IA 5J2NA 3WNFA 1RT6B 3LPUA 1HJRA 4CJFA 4QCLA 4N47A 1S1TA 3QEPA 5KFHA 3VA3A 5DMRA 4M94A 4I7FA 3MFHA 1GX6A 4ID5B 3UQSA 4DTRA 3U6FA 1DLOB 4TYAA 4CGIA 1TAUA 4HUGA 3RB3A 1RBRA 3K57A 3DMJB 3T5JA 5EUHA 3LP1A 3N6LA 3IRXA 2KQ2A 4KB0A 3OYBA 1J54A 3ITHB 3SJJA 1YVUA 1JXLA 1D9DA 2HHSA 1EP4A 3G6VA 5C5JA 3ZCMA 2HHWA 4ELUA 4W5NA 1TK8A 2ZD1B 1LAWA 1TL3A 4CJTA 3BR9A 1VSEA 4J2DA 4DQRA 3V6HA 3NH2A 3KOAA 3O3HA 4CEBA 4Z4HA 3PW2A 3OLAA 3QIPB 4RZRA 2VWJA 3QIPA 4FJ8A 4MKAA 4Z4IA 4AHSA 3DRSA 1C0UA 4CFDA 1BCOA 4GMJB 3ZSYA 3OS1A 3A2FA 4NCGB 3HK2A 3KHRA 2RN2A 4QAGA 3KK3A 1RDAA 1NKCA 3LWLA 3DOLA 1Q9XA 3OYKA 3AO4A 3KHHA 4O44A 4H4OA 3N6MA 5J1EB 2DY4A 4K4UA 4CHYA 1NJYA 1QQCA 1RDRA 1A5XA 1U04A 4PQUB 4J9SA 1Z4UA 5DQIA 4R0EA 4CK2A 4AHCA 3QO9A 4IG3A 5C25A 4IFYB 5E41A 4WE1A 4CFCA 2PY5A 4CJRA 4FYDA 1X9WA 2XC9A 3L2RA 3RB6A 4ZTJA 5CY4A 3ZSQA 1ITGA 4OLAA 2FC0A 2Z1IA 3PW4A 4DQIA 4EYHB 1Q9YA 2RDIA 2ZE2B 4M3RA 4FZXC 2IM3A 1MU2B 5D3GB 3M9NB 3P1GA 3VN5A 1BI4A 4B9UA 3DOKB 3M8SA 3SQ0A 1HQUA 3AO5A 1RDBA 4R5PA 3K5LA 4DTNA 1T03A 4CF0A 4DU1A 3MFIA 4U6PA 2AGOA 4J9KA 1HPZA 1WLJA 2JC1A 1N48A 4E7IA 3C6TA 4F4XA 3FQKA 1RT5A 1K1SA 1NOYA 5JS2A 4CF1A 4C8KA 3MEDA 3JYTA 1N5YB 4Y2AA 1N5YA 4DTXA 5KFGA 3MAQA 1SKSA 4F3TA 2FJXA 3KD1E 3M9MB 3AVJA 3BGRA 3OSPA 3QEXA 3D45A 4DTUA 1VRTB 1S1UB 4WFZA 4URSA 2GIRA 3OYDA 2YNHB 2UVRA 3K58A 3OYGA 4B9LA 4ED2A 2B5JA 2WONA 3LP3A 4FLXA 2V0NA 3CDWA 1GOCA 1RBUA 4ZP6A 3T5HA 3BDPA 4RW8B 1ZETA 4CECA 1QS4A 3RMBA 1S1XB 2BE2B 3V6KA 1TKTB 2G8FA 1TKTA 2BANA 4CEZA 1TVRB 1S1WA 4O5BA 4O0IA 2HHTA 4ID1A 4XIUA 3I0SB 3LP2A 5J2QB 2AWZA 4KB1A 3HPGA 3P5JA 3S9HA 4EYIB 2KFZA 4ECRA 3VQ5A 3WNHA 1XHXA 2FLPA 4KHUA 3CJ3A 1UA0A 4GVMA 1RYRA 4Z0UA 3LANA 1UAXA 1KCFA 4LSLB 1S0MA 3AVCA 3DLGA 4I9LA 3V81A 1U47A 4EBDA 3ICLA 5K14B 3M9OB 3GYNA 4OKKA 5FRMA 4ED0A 3DRPB 4QWCA 2GV9A 3NH0A 3L2QA 3RB4A 3M8QB 1BQMA 4KFBB 3SI8A 4KFBA 4ZVEA 1RT1A 3HP9A 4PY5A 4FW1A 2VWKA 1NK6A 1EX4A 1DTTA 5J2MB 1T94A 2XWYA 4FZYA 4QWBA 3QETA 1HYSA 4ECUA 4NLUA 3CJ4A 5KFDA 3BQ2A 1U4BA 3QEWA 2GIQA 1RTIA 4CEFA 2XGPA 2JEIA 1LWCB 3LAKA 1ZBFA 4DL5A 4LSNB 4OPJA 4ZVHA 1BIUA 2Z1GA 5L1JA 1VSDA 4ZP8A 3MEEA 1JLFB 4NLRA 4N76A 2DFHA 2VG6B 4IG0B 2IM1A 4CEAA 1TAQA 3NFAA 2HVHA 2VG5A 4RW7B 3QZ7A 2XRIA 2YKNB 3VQDA 1B9FA 3KLFB 1D9FA 3RR7A 3T1AA 3KNAA 2D3ZA 3VQPA 3LZJA 4WYWA 2WK4A 4DS4A 4URGA 1HQEB 2OPPA 3SFUA 3MXIA 1KVAA 4ECWA 2HNZB 1Y97A 1RCHA 3FFIB 1N6QA 4YR2A 4CHNA 4CIFA 4M42A 1TKXB 3I5AA 1W25A 4CF9A 4CEEA 4KO0B 1ASUA 5KFTA 4K4VA 4NLQA 4RG8A 3JSMB 1RTDA 3KLIA 4KHWA 2IS3A 1NKEA 1DTQA 3H2LA 1ZYQA 3MR5A 1FKOB 4E7JA 3UR0A 5KRTA 5DQGA 4J9NA 5KFCA 2X6NA 3IG1A 1XR6A 4ECZA 2G8KA 4Z4EA 1R0AB 3M8PA 5DGAA 2X78A 1W9HA 3IS9B 4RW6A 3IS9A 5KG1A 1RT3B 1J9AA 4KTWA 3KD5E 4W5QA 3IGNA 1S10A 4DL4A 3AVGA 4MKBA 2DFFA 4ICLB 2ILYA 3L3UA 1KSPA 3G6XA 5I42B 4O3PA 1SV5B 3V4IA 5J2PA 3GIJA 3G10A 4Q8FA 2QV6A 3HL8A 2OPSA 1B9DA 5FROA 2FBVA 1TL1A 3I5CA 4NLVA 3OVNA 3LDSA 4MFBA 2RKIA 4K4XA 2BRLA 4AHRA 4HYKA 4LH5A 4B3OB 2D3UA 1S9FA 5CYMB 1D8YA 4M3TA 4W5TA 4PUOA 1I6JA 4M41A 1IKWA 1X1PA 4CJPA 4O55A 3SI6A 3G6YA 3ZT0A 3CM6A 4KHYA 4ED7A 1NK9A 1QSYA 1XR5A 2P5GA 4ZPDA 3SQ1A 4TN2A 4RW4A 1QAIA 1SH3A 4BE2A 1NJWA 4R8UA 2W9CA 1WSFA 1KVCA 4J9RA 4F2SA 4L8RB 5F9LA 1BQNA 2X74A 3H08A 1YVFA 4FJHA 5HRNA 3L2WA 4Q0BA 3V6DB 4DQQA 4F4WA 4NCBA 2C2DA 3D28A 1LW2A 2F8EX 5KT3A 2C28A 4CGHA 3PX6A 1JL1A 4DFPA 4HKQA 3BSCA 5KFRA 5C24B 3SUOA 1JLAB 1L3VA 4MIAA 3RMAA 5HROB 5KFFA 3IGVA 5F8LA 4ELTA 3DDKA 4H4MB 3CJ0A 5KT4A 3LP0A 1TQLA 4ZP9A 2WRMA 4DS5A 4CF2A 2AX0A 4JRPA 3TAFA 1XWLA 1IH7A 1RA6A 3PY8A 3VQ7A 1KLMB 4KE5A 1S9EA 4H8KA 4O3QA 3OHAA 3QGHA 3KLHB 3CDEA 4OGEA 4NYNA 4CHZA 4WYLA 4JLHA 2UVVA 2X6SA 3AA4A 2YNGB 4DMNA 3OJUA 3VA0A 5C42A 2FVCA 5HBMB 2HW3A 5FRNA 4ZVFA 4EBEA 4TQSA 4KI4A 4Q8EA 4EBCA 2IC3B 2XCAA 4CJWA 4Q5VA 2IC3A 1VSHA 3S3MA 1YTAA 2Q3SA 3EZUA 4F4KA 1IKVA 4CK1A 2QKKA 1LWFA 3DI6A 3MECA 2JGUA 4RUCA 2FLNA 2YV0X 1RNHA 2VG7A 3VQSA 2HWHA 2HNYA 3AA5X 2Z1HA 1L3TA 1D1UA 2OYQA 2YNFB 4LD0A 1KRPA 3H4BA 2D0CA 3TAMA 4JUZA 4Q43A 5EWEA 4K8XA 4CJ4A 3QLHB 1CLQA 5J2NB 3MXJA 1ZBIA 4RNOA 1RTJA 3HVWA 1C0TA 1S1TB 4M3WA 1NNDA 3FRZA 3AVFA 5KI6A 4I7FB 4J9PA 2CKWA 5KFQA 1C1BA 3OYFA 1LW0B 3GIKA 4CJLA 3FQLA 4OJRA 1LW0A 4ZHRA 1JL2A 2IAJA 4QWDA 1LV5A 4KV8A 4IBNA 2BR0A 4ZP7A 3G0ZA 3LP1B 3IRXB 3M8RA 3CDUA 3DM2A 1S0NA 4YR3A 3NCIA 3BQ1A 1EP4B 4WZMA 3VQ9A 3HHKA 1WSHA 3RMDA 1TL3B 2XCPA 4FLUA 2ATLA 2RDJA 3QEVA 4MH8A 2XY8A 4BWMA 3DRSB 1C0UB 3SZ2A 4NLTA 4O3RA 4HHTA 3VQEA 4XO0A 4IH7A 3WNEA 4DSKA 5DK5A 4DSLA 2YHAA 1VRUA 3KJVA 3KK3B 3DOLB 3PW0A 2HNDA 4I2QA 2I5JA 1ZBUA 2G8VA 4O44B 2WOMA 4NZ0A 4H4OB 3CFPA 2HAIA 3HT3A 1REVA 3NHGA 2V9WA 4DFMA 1X9SA 3OJSA 5KFJA 5KG2A 3H98A 3AVIA 2UVUA 3QO9B 2J6UA 4IG3B 2O5DA 5C25B 3Q8QB 4WE1B 3K5NA 3EPGA 3DYAA 3V9UA 2R7YA 4CK3A 4Q44A 2D0AA 3WNGA 1T7PA 2OZMA 3GV8B 3LAMA 4TXSA 3MR3A 2G8IA 4BDZA 2DPIA 4CHPA 3TAQA 4HUEA 5KFAA 4TQRA 3I5BA 2R2SA 4B8CA 3RTVA 5KG5A 1F21A 1BI4B 4C8LA 1HQUB 2B6AA 3ISND 4R5PB 3V1OA 1T03B 4PWDA 3L3VA 3SUPA 1SKWA 3OYAA 3ZSRA 1T05B 1HPZB 2C22A 2C2EA 1T05A 3BJYA 3OS2A 3SPZA 2AQ4A 4YR0A 3C6TB 1RT5B 4CJUA 3MEDB 3VQ6A 3JYTB 4E3SA 4YNQA 4F8RA 5EDWA 3EY1A 1B92A 1O1WA 5EWFA 4E7HA 5CYQB 5CYQA 2FJVA 4G1QA 4JV1A 2W9AA 4RU9A 4O0JA 4Y1CA 3OL6A 4HUFA 2W9BA 3B6OA 2OZSA 1SUQA 3BGRB 1HYZA 3ZSZA 3ZSXA 1OS5A 1QUVA 4KHNA 4AHVA 3NL0A 1S9GA 3HKWA 3V9ZA 1C0MA 5I3UA 2CJQA 3KKRA 4CIEA 3AA2A 2B5JB 2WONB 3ZSWA 4F50A 4OKEA 5KFPA 2KFNA 4DTSA 1HARA 3AVKA 2RPIA 4FLYA 4M45A 5KG4A 4OLBA 2B4JA 2IM2A 5CZ2A 3MTKA 2KZZA 2BANB 4DFKA 1KHWA 4E7LA 2B43A 1TK0A 5L1KA 1S1WB 2QXFA 3LP2B 2F96A 3AVAA 4Z4CA 4RW9A 4DFJA 1SL2A 4OKJA 1RBVA 4NCAA 4GC6A 3PO5A 4QW8A 3PW7A 4WXOA 5F8NA 1SH2A 4ZPCA 3GIIA 3DLKA 4JS4A 3DLGB 1WN7A 2W42A 1TV6A 3V81B 4Q45A 2XI2A 2D7SA 4ZMMA 2EHGA 1HNIA 4AILC 3ZT2A 1D5AA 3HM9A 4C8NA 3U3GA 3CQ8A 5L1IA 3NGYA 1T8EA 4ZVGA 1BQMB 4N41A 1JLEA 3V9WA 1RT1B 4DQSA 3FSIA 4Y3CA 3SUNA 3V9XA 2QKBA 3PJWA 1NK8A 4DLGA 1DTTB 4QOZB 1HYSB 4FBUA 1RTIB 3AO2A 3RWUA 2PYLA 1LAVA 3KLGA 4F2RA 4HCCA 2VA2A 3Q8SB 1CZBA 5HLFA 3RBDA 1NK7A 3SNNA 4TY9A 1L3SA 3EPIA 2E6LA 3L2VA 5HRPA 1HMVA 2A1RA 3ZSOA 1JLCA 1UA1A 4CJEA 3QNNA 3MEEB 2J6SA 3PR5B 4I9QA 5KFMA 1A5VA 3OSNA 4FM0A 5HP1A 3S3OA 4M3ZA 2FJWA 5KG3A 2VG5B 4BDPA 4FLZA 4WFYA 4N56A 4FLVA 4DTJA 2E6MA 1RBSA 3HXMA 3TWHA 2Z1JA 2FVPA 4K4SA 1FK9B 4G3IA 1FK9A 4IQXA 2FLLA 2ATQA 4F3OA 2OPPB 4N5SA 2OA8A 1GOBA 2I1RA 3Q8PB 1ZTTA 1BHLA 4NYZA 1N6QB 4K50A 3THVA 4DTMA 4KSEB 2XO7A 3HPHA 4MQ3A 4ZPBA 1RT7A 1NOZA 2E4LA 2XY7A 3I0RB 3HJFA 3I0RA 2OPQA 1RTDB 2R8JA 3KLIB 4NLOA 5SZTA 1DTQB 1RTHA 1UWBA 3BQ0A 1BL3A 4CJSA 1JLBA 3IG1B 4CJ5A 3TARA 1WSIA 1ASWA 2YKMB 1NHUA 1S0OA 2YKMA 4ECSA 3M8PB 3O3FA 3ZSVA 1SH0A 3ASMA 4NYFA 2W7OA 3UIQA 4FJ7A 3OYJA 1S1VA 4RW6B 4HCBA 3CYMA 1WSEA 1BIZA 1CXUA 3NGIA 4NLWA 2GC8A 2E9ZA 1N4LA 1U49A 4TY8A 4F4ZA 2HHVA 4FK0A 3QZ8A 1T3NA 3CM5A 2KW4A 2YHBA 3GV7B 4E19A 4YQWA 4RNHA 3V4IB 4JRQA 5J2PB 3RB0A 4CJQA 3NBPA 4CEDA 1U09A 4KAIA 4BDYA 2OPSB 2HMIA 2P51A 5KGXA 1TL1B 1VK0A 4I2PA 4MFBB 2RKIB 1QHTA 5HRRA 1Q8IA 3LZIA 1RAJA 1HYVA 3CJ2A 4PUOB 2YNIA 4J2EA 4KHRA 3V6JA 1IKWB 1VSMA 1JLQB 1TKZA 1JLQA 5KFSA 4AHUA 4CE9A 1RT2A 4IRCA 1FXXA 5KG0A 2XY6A 1TK5A 4DSJA 3LWMA 4DSEA 3OYLA 3DLHA 4RW4B 4CGGA 5DG7A 4EO6A 1FKPA 4R8UB 2W9CB 4GC7A 3PW5A 4FJ9A 4DSFA 3H40A 1BQNB 1GX5A 3N6NA 4DWIA 3MF5A 2D5RA 1W0HA 5KTQA 2IBKA 4O3NA 4Q0BB 3NMAA 5JUMA 4AHTA 3EYZA 4DSIA 3SPYA 1LW2B 3B6PA 3KTQA 5KFLA 3KK1A 2AX1A 3MEGA 4KREA 1KFSA 4DEZA 3KK2A 2LSNA 3TAPA 2IJNA 3PO4A 3KLEA 3F9KA 1WAFA 3LP0B 1ZBLA 2KTQA 5DG9A 4FJIA 1EXQA 4K4ZA 5KG7A 3QESA 1NK0A 3VQQA 4W5OA 4LH4A 4M3XA 4DLEA 4FJMA 4Y34A 4FVMA 1SL0A 4LY7A 3U3YA 5JXSA 1S9EB 4B9MA 3DLEA 2R8HA 2FBTA 4HVJA 1JLGA 3H59A 4RUAA 1C2PA 5F8GA 4RNNA 3QINA 2BQUA 5C42B 4DU3A 2QK9A 1CXQA 4KKOB 4KKOA 5KT2A 5KRSA 3ULDA 4FZZA 4K4WA 2O4GA 3Q8RB 2OH2A 2UVWA 1X9MA 2HHQA 4NLXA 1RYSA 3H5XA 1IKVB 4IFVA 3TVKA 5KT6A 1G15A 4K4YA 5FDLB 3O4QA 5FDLA 1LWFB 3DI6B 3MECB 3MXMA 4IDKA 4OGCA 2PYJA 2HB5A 2VG7B 3RMCA 3C6UA 1RA7A 4DF8A 2HNYB 5KFEA 4C8OA 1RDDA 3MR6A 1JKHA 4BACA 1EKEA 2ASLA 2RF2A 3GV5B 3CIZA 2V4RA 1WNEA 4O3OA 3TAMB 2OPRA 2R8GA 4KTQA 4NLSA 1J53A 3SQ4A 2FVRA 3DRRA 1RTJB 4XPCA 3E01A 4EP5A 4ED8A 5DLFA 1C0TB 4IR1A 4CFAA 2D0BA 4ZPAA 1LWEA 3OYNA 3D5MA 5EU7A 1WSGA 3HVTA 4IRKA 3KMSA 1C1BB 3QGGA 4FLWA 4B9TA 4ZHRB 1ZTWA 2IAJB 1BGXT 3O3GA 5F8MA 4KV8B 4KBIA 2NUBA 2F8TA 1RT6A 4X2BA 4F4YA 1S48A 1UOCA 5KGWA 1Z25A 3DM2B 1NKBA 3F73A 4IOBA 1VSJA 4LQ3A 3LALA 4J9OA 4IRDA 3DLRA 1KTQA 4ID5A 3CO9A 4YFUA 2Y1JA 3AVLA 1DLOA 3AO1A 1U48A 5KG6A 3DMJA 4NRUA 3ITHA 3HPOA 4FJLA 4K4TA 4Y2CA 5T14A 2FBYA 3OHBA 1C1AA 1VRUB 1NK4A 3KJVB 4OL8A 2HNDB 2ZD1A 4I2QB 2I5JB 1JXEA 3RR8A 2WOMB 1HRHA 3K5MA 1REVB 4JS5A 1I3AA 4IH6A 1VSIA 4CIGA 1YT3A 4CCHA 3ISNC 4YMEA 4NCGA 4E0DA 4K8ZA 3NF8A 4EZ6A 1XI1A 2G8WA 2IMWP 2ZQBA 3AVHA 1CSJA 3H4DA 3DYAB 3SFGA 3OYEA 3NAEA 1MMLA 5J1EA 4NLPA 2R8IA 1XHZA 4M95A 5JS1A 3PV8A 1KHVA 1TP7A 4MK9A 3ALYA 4KPYA 4PQUA 5KFOA 2UUWA 4J2BA 1L5UA 5KFIA 2EX3A 3EZ5A 4PA1A 4KTZA 1NHVA 2IOCA 3CFOA 4IFYA 4E7KA 4IH5A 4BWJA 3TQ1A 2FVSA 2B6AB 4PWDB 3OS0A 5KFXA 5KFUA 4FJJA 2ZE2A 3GQCA 2P1JA 3SYZA 2G8UA 4JV2A 4E89A 1MU2A 5D3GA 3TI0A 4ECTA 1N56A 3DLBA 4IKFA 1S49A 3CJ5A 3DOKA 3NKYA 2HVIA 4B08A 1VSFA 3PX4A 4G1QB 5KFNA 4B9NA 4TSXA 3OYIA 2W9BB 2C2RA 4TLRA 1SUQB 3QIDA 3V9SA 3OL8A 1U45A 3L2UA 5F9NA 3H5SA 2BQ3A 2A1SA 4DL2A 1S9GB 3VQBA 4CJ3A 3AVNA 4H54A 5I3UB 3RBEA 2O4IA 4EO8A 1IKXB 1IKXA 4DTOA 1S97A 2AGPA 1K1QA 2AU0A 3CFRA
chains in the Genus database with same CATH superfamily
3RJMB 2ZNYA 4RNFA 5KT5A 1VRTA 1S1UA 2X1BA 2HQDA 4FS1A 1JXVA 4DV1F 1NU0A 5AQJA 2NQPA 4JKCA 4UY8T 3CIMA 2HIQA 3T69A 1MWZA 1HKCA 1V5VA 5TKYA 4LIWA 3QJLA 2P9NB 3KLVA 1XC9A 3R9PA 4QPXA 2UYTA 4CEOA 4RW8A 3H3OB 1Q78A 1F5CA 3DDIA 1RILA 3O1LA 2JLEA 1BDGA 4Z4FA 2EK6A 2R2RA 2IRXA 1V5IB 4CLZA 2B4UA 3UW1A 4QWAA 1YLXA 3EDQB 1HNIB 2CFXA 3F56A 4ZVRB 3SEOA 3HD2A 3JXOA 5H9EK 3OUYA 4FBTA 2XI3A 4P72A 2DNRA 1HNVA 2JEFA 2JEGA 3HLUA 4FJNA 3NH1A 2DO4A 2V5HG 2LLZA 5A6WA 2EFNA 3GIMA 3DRPA 2P9PA 3ZT4A 3EKSA 1GFWB 1Q82O 3KLGB 1NUEA 3UN2A 3QERA 1L3UA 2BDPA 4W5RA 4FJXA 4M5IA 3FDSA 1XNRF 4M5MA 2VU5A 2E5JA 3UR3C 2QSFA 1HMVB 5J2MA 5SUHA 4Y1DA 4XPEA 5CQGA 4HTUA 3RAMA 5IV4A 3GPAA 3CULA 2CGKA 2G4BA 3H1QA 1BA1A 3EZOA 3NF7A 2IVFB 4EIAA 2A2CA 4CLUA 5A0YA 5F8IA 5H1SQ 4OJGA 1QAJA 3UE5A 1Q8LA 2ZBIA 4WPAA 4CH0S 3EGWB 2LFVA 4O3SA 2CQ4A 2FJBB 1SJ1A 4NLYA 3W8PA 1H1VA 3CCSN 2LEAA 2DHAA 2YKNA 3ZNUA 2KI2A 1S6PB 4EP4A 4BRGA 1NZAA 2D41A 3AVMA 3PSFA 2B4OA 3AO3A 3MX5A 3K5OA 2FZKB 2WZ1A 1RTHB 3FFIA 3QRRA 1YGYA 4C3LA 4LF2A 2CQGA 1IM6A 4O4GB 1FEEA 1ASVA 3SCXA 1NJZA 1FO1A 3SLCA 1WNSA 2K7JA 3MM5B 4KO0A 5AE2A 2W8KA 3NE6A 3TTDA 1TL7A 4X4VA 1FRMA 3T6JA 5HMZA 3FCVA 3GSDA 2ZH6A 4YN3B 1X4BA 1NDPA 2FYXA 1HBMB 3TAEA 3NBPB 5M2PA 4KRFA 3KUEA 1NK5A 4ZKAA 1XEZA 3IP0A 4IQMA 1TUYA 2RILA 4OX7A 3W5ZA 4DPTA 5DLGA 3CJQA 3L8BA 1U8WA 1CEZA 2R8KA 2AIRB 1EETA 2V8VA 3RW6A 1U2VA 1TKZB 3THTA 4ZA1A 3T1YF 3K2PA 3MM7B 2UXCJ 2MQMA 2FGCA 3CF5Q 1VR6A 3T1HJ 1BQXA 4FJ5A 3PX0A 5KFWA 2DGXA 3H45C 1SKRA 1NPKA 4CERA 2B7BB 2OFGX 2NXUA 4I6MA 5T7LA 3UPFA 2ROEA 2AP6A 4PABA 4B9SA 1NXIA 2J9DE 4PG4A 3HTVA 4DV1K 4NL5A 3CCTA 3VQ4A 1WTFA 4GVBB 4RWWA 4CZFA 4CGJA 4FWLA 4OI3A 2CDRB 4O23A 1VQLS 1KVKA 1QY7A 1UEVA 3H7HB 1X60A 2NNWA 5C24A 3NDKA 1JLAA 4B1ZA 4MIBA 3QT6A 1S6QA 5LT5A 4FK2A 4ALZA 5FLXY 2ZHAA 4WZQA 3K2YA 1G7CB 3ENWA 3QATA 4KBOA 1NJXA 3OL7A 5GADI 3D1HA 4QIGA 4CFBA 3UNGC 2VODA 3VF6A 3MAAA 1U24A 4MLHA 2HFNA 2NLWA 1R8HA 3OXGA 3QGIA 1K6YA 2CGJA 3C6UB 4OIXA 5C10A 3PR4A 4FVCA 4CYUA 2CJAA 5AXLA 1UVNA 2UXCF 1XNRK 4ZK7M 3ZC4A 2B3TB 4MTPA 1WC6A 2LP4A 1FTCA 2K3IA 1BXNA 1PC5A 3HO1A 2OPRB 3T1HF 3H25A 2ZZNA 1R3NA 4CO4A 1TYQB 2OEMA 3FCHA 2DPJA 3D0PA 4MT1A 2JDJA 2E7VA 1IKYB 3G8SA 5SWMA 3IN5A 3Q89A 4CI6A 3HSTB 4M5KA 3NNCA 2P9GA 2QLJB 1SJRA 3KHLA 1YJ9N 4CJFA 1W7WA 2Z2LA 4B3MJ 3SQOP 2CQCA 3QEPA 1K44A 3VA3A 2O01C 4I7FA 4A8XA 1R59O 1Y9OA 1DLOB 5D4PA 1Q7LB 4JK9A 4WCEL 4MDBA 3T5JA 1OY6A 2KQ2A 3ITHB 1JXLA 4GKJJ 1RHRB 1KP6A 3CCQN 5JVGL 2Q1LA 4ELUA 2ZD1B 2KXFA 4PZVA 4Z94A 2EWHA 1K73O 1VSEA 3S6EA 4DQRA 3NH2A 4IXCA 1H3DA 3KOAA 2QLBB 1R8BA 4CEBA 1I5OB 2C2ZB 3DRSA 3DFEA 2FJDB 4NCGB 3HK2A 2RN2A 5A8KB 2ABYA 3DWLA 2PAVA 3DOLA 2Y8WA 1Q9XA 3KHHA 4O44A 1VHXA 4H4OA 3D2FA 4WIQA 1QQCA 1B0PA 4JN4A 3M5RA 2GTDA 2V67A 3BYPA 4AYBD 1Z4UA 5DQIA 1GLFO 3QO9A 1HBUA 1SCJB 4DR2F 4YY3K 1VQ6S 3IR5B 3VQTA 3M2UB 1EWQA 1FJEB 1GLDG 4AT1B 4KRWA 3L2RA 3RB6A 4ZTJA 4OLAA 3T1YK 4CZGA 1WELA 1T9YA 4EYHB 4YEAA 3BBBA 2Y3YA 5KQDA 3AQPA 1F2GA 2QA4G 1SQEA 1ZM4A 5E3QA 1CQMA 4YOTA 2V68A 4B3MF 3VF2A 2EC2A 5JLHA 1Y64A 3AO5A 4R5PA 1RDBA 2VBXA 3M32B 3CC7S 2WVBA 4DTNA 1T03A 2HHHJ 4CF0A 1NJIT 4A8QA 2AGOA 4J9KA 1WLJA 5LM7E 5DM7Q 3AJDA 2ATCB 3CDAA 3D9BA 3C6TA 3FQKA 3MPDA 3MCOA 2F65A 3MEDA 3MM9A 4GKJF 4Y2AA 2ZJPQ 3NP5A 1RWKB 1ICEB 1V3RA 2P9IB 1SKSA 3QGPA 2GX9A 1HQ2A 2VC1A 1R7IA 3CJSA 2OAUA 4NLBA 3OSPA 2AJFE 4ER8A 4ZPVR 4URSA 5DDOC 3IMQJ 2GIRA 3OYDA 5GMEA 2UVRA 3K58A 4YOUA 3MTJA 2WONA 4BC5A 2PA8D 2YQ3A 3CDWA 2VKRA 2CPEA 4CNZA 3OTCA 1LK7A 3HOSA 5GINA 1S1XB 2BE2B 3V6KA 2G8FA 1TKTA 4JHDB 3CETA 2PE8A 2BUNA 1S1WA 4M5DB 2WTUA 4O0IA 2HHTA 3I0SB 3R97A 4UQTA 5DJBA 4KB1A 3ZNJ1 2A3ZA 2R4FA 2FLPA 2HRYA 2HPUA 2UXCK 5GAEU 3CJ3A 4ID8A 5DRKA 4Z0UA 3LANA 1UPPA 1KCFA 3ZXWA 2XSJB 3V81A 3T1HK 1U47A 2PEHA 3ICLA 5K14B 1AT1B 3M9OB 1YZ6A 1YJVA 5FRMA 2CWXA 3L2QA 4PYDA 3RB4A 2GAGC 2HHHF 4KFBB 3CGIA 4ZVSB 3SI8A 1M5PC 4FKXA 3HP9A 2PC6A 2YWHA 4FW1A 1X31C 1NK6A 1EX4A 2KLAA 1T94A 3QETA 5L39A 3QEWA 1RTIA 3BYRA 2DH8A 2XGPA 1FRKA 2F9TA 1K47A 4LSNB 1TUGB 1B4SA 2NXJA 1BIUA 2Z1GA 2APOA 5AE3A 2NYHA 4I6AA 5L1JA 4KC5A 1VSDA 3VPZA 5A2QO 2CNKB 2KM8B 4PWUA 2A10A 4WKRA 2HGLA 4IG0B 1HD0A 3G96A 1TAQA 4OZNA 3NFAA 3Q86A 1KN6A 4FKYA 1FESA 2CXEA 4K7QA 4FWOA 5HN0A 2GJ2A 3VQDA 1D9FA 2XMVA 4A4JA 1RAOA 1FJ7A 5IM0A 1P6TA 2WK4A 3P31A 4URGA 3VAIA 1HQEB 5M1PA 2OPPA 4JD2A 4CO5A 3SFUA 4D3GA 2AJ1A 3MOJB 1KVAA 2HNZB 1N34J 3CQYA 3LM2A 1Y3KA 3OA9A 1TKXB 3I5AA 4NA1A 4L6V3 1EKSA 2AKWB 1NEEA 1ASUA 1W97L 4K4VA 4RG8A 3JSMB 1RTDA 1SPBP 4DR2K 4B3SF 2YX6A 1MNEA 2MKKA 1FKOB 3L3CA 3UR0A 5KRTA 5DQGA 4J9NA 2W6KA 3K17A 1Y5IB 1DAXA 3IG1A 1CJUB 4CBWA 3HSCA 1O8BA 4CBUA 1JCFA 5KG1A 2DR7A 3ENQA 1D9AA 4ANCA 2KJVA 3MOZA 4X64F 2PI5A 3JTOA 4B3MK 4S0MA 4W5QA 4H5NA 4QIFA 4DL4A 3AVGA 4MKBA 2DFFA 3E9OA 4ICLB 3G6XA 4TU8A 1OH7A 4BG8A 5I42B 3TP2A 4O3PA 1SV5B 4BGBA 4Q8FA 3HL8A 2OPSA 4CW7B 3MGJA 3THWA 1VQLN 2EFOA 2RKIA 4GKJK 4A62A 2IPOB 3CCMN 2DKOB 2D3UA 4M3TA 1ATNA 1G2EA 2PO4A 3TJ9A 3LUYA 2XS5A 2GVZB 4ILRA 1QSYA 1WF1A 3SMSA 1XR5A 3OFGA 1WC4A 4KR0B 4RW4A 1SH3A 1UWAA 3MXHP 3E1YA 2E1RA 4R8UA 1WSFA 4OJ1A 1KVCA 1N34F 2OSRA 4L8RB 1Q86T 1YVFA 3C8YA 4FJHA 3GBTA 3L2WA 1FFSB 2CQDA 2O8CB 3BZCA 2N7CA 2C2DA 4BC3A 3H8YA 1YI2S 3WHIA 4H0TB 2C28A 4DFPA 1T95A 4CLPA 5KFRA 3MMCA 5D78A 3RMAA 1OH8A 3CDBA 5KFFA 1U25A 3UNYA 4LBHA 3L0QA 4PG6A 5KT4A 3LP0A 2RAQA 3A8JA 4DS5A 2AX0A 1X7VA 4JRPA 3TTFA 1FWPA 1IH7A 1RA6A 3PY8A 1KLMB 2ZBPA 4KE5A 5I4MA 4H8KA 4B1XB 3QAEA 3WEEB 4IJAA 3Q8UA 3IFEA 2Q6CA 2AF6A 3KLHB 1WHWA 1E4FT 4OGEA 2Q3PA 1RXOB 2QWNA 4JLHA 2MLXA 5LMNJ 5C7PA 2HHHK 3BZKA 3UWTA 4EBEA 4JI1J 2F4FA 1B7FA 4EBCA 2H9ZA 2XCAA 1T0TV 5AQRA 1VSHA 2MY8A 1YTAA 3BF1A 2OI2A 3H20A 8AT1B 4MDAA 4KGZB 4C6AA 1LWFA 2QLWA 2E1YA 2FLNA 3NS6A 1RNHA 2VG7A 3VQSA 3UKRA 3Q22A 1KVIA 2HNYA 3D66A 1PIEA 2DNYA 2GVDA 2VCPA 2B8PA 1L3TA 2M0GB 3D0HE 3FC9A 1BC6A 3EVMA 1KRPA 3U27A 4KHPJ 3TAMA 3VEOA 4JUZA 5EWEA 4BQZA 4HT5A 2OD6A 3FVYA 5HMYA 2QA4S 3MXJA 1ZBIA 2R7TA 1RTJA 1HBOB 4B1VA 3VZHA 4M3WA 4DDFA 3FRZA 1OY9A 3IBFB 4OJRA 3J7ZT 3RGIA 4IBNA 4TVAB 2BR0A 1C4CA 1LOUA 4PG5A 3DM2A 5HVHA 3NCIA 4WZMA 2ZFHA 1VQ6N 3HHKA 1YITN 3KJQB 2LMIA 3RMDA 2B8QA 2XCPA 4FLUA 2D74B 2ZHOA 4YOWA 2KT3A 2MQQA 4BWMA 2QRRA 3BKUA 4EHTA 4B3SK 5FJ4A 4NLTA 3US5A 4O3RA 3VQEA 4WBFA 2A42A 3KJVA 2W25A 4I2QA 2ZBCA 2I5JA 4JI1F 4CM0A 2G8VA 3DNCA 2NCKL 1REVA 1SZ2A 1UFKA 3NHGA 3A12A 2ALYB 3FLCO 4JKGB 2BXJA 3SCIE 1X9SA 3CC7N 4P2MA 1VLYA 3OJSA 4U95A 3H98A 2AYMA 1VHIA 5HSPA 4X64K 3UKUA 4KH5A 4K25A 5C25B 1F5BA 3UN3A 2FHKA 4ZVTB 1SKUB 4NI2B 3C14B 4J7CA 2VQFJ 3V9UA 3O9QA 5HL7L 2D0AA 3WNGA 2P6SA 4F02A 2IHR1 4KHPF 2D3O1 2O8FA 4ZIVA 2G8IA 4BDZA 2VONA 4NXNJ 5KFAA 3C0BA 5KG5A 2C2KB 1QQNA 5HJYA 4J9VA 4P2FA 2ZJRQ 2HHPA 4X65J 3SUPA 2DGOA 3OYAA 1HPZB 3SPZA 5ETVA 2POKA 3EX7B 1RT5B 1BOTO 4DN9A 1N34K 1ZM9A 4E3SA 4YNQA 3QMQA 1B92A 1EZZB 1O1WA 5CYQB 4JV1A 1LNQA 4RU9A 4H5RA 3B6OA 2OZSA 3F41A 3W66A 1J2VA 3JAMY 4C0HA 4WF9L 1VQ9S 4AHVA 1SC1B 4ZDNA 3NL0A 2VFRA 4A8KA 1WOQA 4CIEA 3AA2A 2PFDA 5D8HB 1MLAA 4OKEA 2KFNA 2HK2A 3W2WA 3CD6S 2RPIA 2DGSA 4M45A 4OLBA 1M1HA 5CZ2A 2MQPA 2J5AA 1X4GA 4UT4A 4B3TJ 3BBFA 4B9QA 1BO5O 2I6WA 3AVAA 4ILJA 2VQFF 2P9NA 1UVJA 1SL2A 5DDQC 3W1YC 4UOCA 4NCAA 3IAM9 3DRXA 4GC6A 5BR8K 1U26A 2CQ2A 4WXOA 5F8NA 3MCSA 4NXNF 3CJRA 4LF5F 2AEFA 3FR0A 4K8RA 3M6UA 3N4WA 2M5YA 3WXJA 3MPWA 3CJ7A 2F8HA 2DVIA 2EHGA 1HNIA 3GG1A 3IM9A 4X65F 3CJ1A 3HM9A 2RQCA 3TU5A 3FSIA 4Y3CA 4H0OA 2BJEA 5B0AA 4YOXA 4DV4J 1BMQB 1DTTB 3TUZC 4BRQA 3UO0A 4FBUA 3DDNA 1Q8BA 3HD1A 3AO2A 3RWUA 3Q83A 3I6PA 1Q1KA 2B9XA 3NOCA 4K43A 3KLGA 4HCCA 4DZ6A 1NK7A 3SNNA 4TY9A 2KT5A 1HMVA 4CJEA 2AEJA 2GJFA 4I9QA 1GK8A 2V50A 3THXB 1CPZA 3PXGa 3C16B 4Y00A 2BOAA 1YK9A 1L3KA 1HWIA 4FLVA 2DGVA 1HHSA 4DTJA 1RKIA 4ATNA 3HXMA 1XMQJ 2Z1JA 2RHQB 4K4SA 4JV5J 2VQEJ 4G3IA 1FK9A 4B3TF 3LPEA 3ENOA 2HSTA 1GMWD 3HDSA 3CCWA 4C48A 4NYZA 2EBEA 4JI1K 2NYIA 4P9SA 3HSGA 4KSEB 2XB2D 3VOVA 5HMXA 4MQ3A 4ZPBA 4WQ5C 2XLJA 4JKBA 5HQLA 1Q16B 2YWGA 1S7IA 2R8JA 2B9YA 1DTQB 1RTHA 2GHVC 3AD7C 1RADB 4OPAA 1BL3A 2FSNA 4U7UD 4CJ5A 3TARA 1WEXA 1PO6A 1ASWA 2YKMB 4H5TA 4ECSA 3MM5A 1S57A 4DV4F 4KHPK 1KOHA 2Q0UA 4NYFA 4PL7A 3UIQA 1NMEB 1VK8A 1VBXA 2V69A 4P75A 1RGVA 4EWTA 2MDAA 1FRXA 1N4LA 3R8EA 1HNZJ 2VFVA 3QZ8A 1B0TA 4EMDA 1R8AA 2ASYA 4E19A 4C8YA 2EW9A 3V4IB 5J2PB 3RB0A 2F1FA 1HBMA 4CJQA 4DV0J 3I56S 3NBPA 2P51A 1V4TA 2LQ9A 5DM6L 1YI2N 1CULB 4USKA 3WUHA 1NSAA 3EEQA 3GFYA 5IT4A 3NS7B 1RAJA 4WK1A 2OTJN 2FHMA 5KPZA 4J2EA 3VEWA 1JLQB 1FW6A 1TKZA 4CE9A 3F44A 1FXRA 1RHKB 1FXXA 1Q81T 1XMQF 3BO3A 2Q0RA 2YHYA 2HBQB 1KVJA 3JSRA 3MM7A 5E3AA 4JV5F 2VQEF 4DSEA 3D1OA 1LXJA 2CGLA 2W4DA 1RFQA 2UXDJ 3CW2C 4CLSA 4CGGA 4EO6A 1WF2A 2W9CB 3PW5A 2O3DA 1GMVA 2M70A 4Y65A 2IVOA 5E0OA 1P1TA 2D5RA 2ZJQQ 2IBKA 4Q0BB 3FBEA 1M1KT 5JUMA 2A18A 3EYZA 2ZBQA 1Q95G 3FZ2A 4ZOSA 1KFSA 3NCRA 2OEKA 4DEZA 2DITA 2HFUA 2ZUGA 4GVBA 2FF3B 4LBPA 2ZH3A 4FJIA 2VQFK 1X4EA 4EK2A 3VQQA 4Y34A 5AQQA 1O13A 4ZPWR 2JH3A 5JXSA 2E66A 4B9MA 1VQKS 3O5BA 2FBTA 1AA1B 3I4PA 2H65B 4NXNK 4QYZJ 2FHJD 4LF5K 2CNOB 3NOGA 3MWBA 5F8GA 3D6HB 4RNNA 3QINA 1HNZF 5E3CA 4X65K 2JJ4D 4C11B 4DU3A 1RAHB 4DV0F 1OPZA 2QA4N 4DCPB 2QK9A 2I0XA 4KKOA 2ROPA 4DCHA 3Q8RB 2O66A 2MEWA 4IEIA 4NLXA 2R7QA 3CPEA 4YORA 4YDDB 3FGUA 1IKVB 5KT6A 2K8GA 4PG7A 3A3NB 3VALA 5GAEI 3D68A 1G3OA 1Q7YT 3MDQA 8ATCB 3C6UA 4EUVA 2QWQA 1NCLA 2DGUA 2KXNB 1EKEA 2J7UA 1YIJS 2UXDF 5DDPC 3CIZA 5KPTA 2J0XA 3KG1A 2OTLN 2OPRA 4PL8A 2R8GA 4KTQA 4NLSA 1MMNA 1TL4A 2UZAA 3SQ4A 4PHTX 1TYQA 4LF8J 4XPCA 2QL5B 3PHTA 4X66J 4CFAA 2D0BA 2DXFA 3OYNA 2PMWA 2DEJA 3M05A 1FFWB 3KMSA 1OH5A 3QGGA 5D0GA 2HZVA 5ELZA 5I3QA 4KH0B 4B3TK 2IAJB 5CH7B 3R5AA 2COLA 4CO0A 3S1TA 3R6LB 4F4YA 3MCMA 2QWRA 2N4CA 1GQEA 1YJRA 5A8WB 3GOIA 4LQ3A 1T02A 1YQHA 4YFUA 2XHWA 3QT5A 2ACMA 1DLOA 1WKJA 1U48A 2DR5A 1E4GT 1VQMS 1UVIA 2KYXA 2QX0A 3CO0P 1TELA 3ITHA 3ZFVA 4FJLA 2HGMA 4Y2CA 5T14A 3W7BA 2FBYA 5DS7A 5E26A 1C1AA 3NWGA 3JSYA 3KK7A 1VS3A 1NK4A 3J7YU 4OL8A 2CQPA 2K2PA 2ZD1A 1GLJO 3IFRA 4HT7A 3RR8A 2XNQA 1HRHA 4CZEA 3DXKB 1K9MT 4DV4K 1YKWA 2FDNA 1I3AA 3KNGA 2ZZTA 2V8DA 1FCAA 1OYDA 3S8SA 4NCGA 1OJ4A 3NF8A 1XI1A 3G6ES 5A8KA 5BJRA 4FPRA 2ERRA 2H3EB 3SK3A 1ELOA 4YDXA 4NA2A 3DYAB 3SFGA 3VTIA 2R8IA 1XHZA 1KHVA 2NSCA 4MK9A 5F0UA 3ALYA 4DR5J 3MD3A 3HSDA 1SI9A 1L5UA 1VQ7N 1NHVA 3P5TL 3M2UA 4LF8F 1NB2A 4LF9J 1VQ9N 4CD1A 4X66F 4P2SA 1JJCB 2RRNA 2B6AB 3CMAS 1XMQK 4PWDB 2HF3A 4B3RF 5HAOA 4JV5K 2VQEK 4LFBJ 3GQCA 3CD6N 2P1JA 3SYZA 4KGVB 3FEXB 4L76A 1A6LA 4A8OA 1N32J 1X4FA 4IKFA 2QSWA 3GL1A 1XBWA 2RH3A 2NRRA 2UV8G 1URNA 4B08A 1VSFA 1GTHA 3M32A 3O6QA 2MZ1A 4ILHA 3ULHA 1P8ZA 3OYIA 2W9BB 1NU4A 4TLRA 2H3GX 3W5YA 1U45A 4RPFA 1X3NA 1YHQS 1KS2A 4NLCA 1S9GB 3AVNA 5I3UB 2P9IA 2CQ3A 2CAJA 2QZ8A 1PYOB 1IKXA 1DQ8A 3VWSA 1K1QA 1K0VA 1X0PA 4IKAA 3WIUA 1MMDA 3SV4A 1Q86O 3C95A 3TNVA 3TA2A 4C7QA 2DY9A 3TSPA 5T7BA 3GG0A 1GLAG 1HNZK 4IFEA 3BGUA 3AVBA 3P3DA 5THWA 3QICA 4GVLA 2WBNA 4RW9B 1FNOA 4ZCIA 3JS9A 1RAGB 3N4PA 4DV0K 1CC8A 1JIHA 1UVMA 4DR5F 3E2EA 1FX2A 5KFZA 1ZBHA 3OPKA 3CMEN 2YTCA 1S1XA 2BE2A 3G86A 3RAQA 2ZITA 3SV3A 3NXZA 4JHDA 4WFXA 2KZMA 4CVNE 3CG7A 4AL6A 4LF9F 4A8WA 4M5DA 2XMAA 1VBZA 3I0SA 4ZLJA 4DL7A 4WFAQ 1WUAA 2UUTA 3K89A 2IDOA 1A0OB 5B0FA 1IG9A 5CA5A 5FLXU 3OW2R 1TKDA 4A61A 4HH1A 3ZYYX 4XEIA 3IXQA 3JQKA 3B6BA 4B1UB 3KYLA 3NAIA 2HFSA 3MUVP 1HNVB 1SVDA 2UXDK 2VD3A 3ZT1A 3CCUN 2XSJA 2IJRA 2M9KA 5CZ1A 3ILJA 4LBIA 3QRQA 1BCMA 5K14A 2P2CB 1N32F 4GMKA 3TX8A 2P5OA 4DG1A 5L9XA 5CABA 4DL6A 4DL3A 5LSRA 2DTUA 2MSTA 2E9TA 2V7ZA 5HLFB 4ED1A 1EX8A 2L41A 5DG8A 2CQHA 3RRGA 3Q8VA 1ATSA 5K9FA 2ZDOA 4ZN3A 4FS2A 2CVEA 5FPMA 1U6FA 4LSNA 5HP1B 2HHXA 3CQXA 3EN9A 4URQU 4R79A 5AQLA 4QYZK 3CWJA 2LECA 3I33A 1KC8O 4ZLLA 4X62J 3V1QA 4IG0A 4KGMA 2G9OA 4DX8H 1HBNB 1CZAN 1T9WA 2VDHA 9RUBA 2IVNA 3FEZA 5KFBA 4KB7A 4CF8A 4X4NA 4GNIA 3BREA 3C2PA 3W9HA 3VQAA 2KG1A 4FM2A 1F5AA 1NPRA 2IM0A 2GWJA 4KT0C 4CNYA 2EFVA 1NSQA 4NO7A 4ED5A 1HQEA 5E2QA 3PDNA 4JI0J 2CADA 5GAHI 2HNZA 4ILGB 4N77A 2R7OA 5LSLA 2RT3A 3OLBA 1U2FA 1U1KA 3K8WA 4NRTA 2HG4A 3V2UC 3C94A 1TKXA 1RQ0A 1JLBB 2GBZA 4U67L 2CRLA 2D0OA 2BRKA 5A76A 2CQIA 1YTUA 2OGUA 1ZBTA 2DNQA 1QVGM 4FWQA 2OSQA 3JSMA 4BLGA 1S1VB 4LF8K 1FKOA 4KYZA 2MXYA 4X66K 3AD9C 2V51B 3VEXA 3HVAA 4FN5A 4Z4GA 1CJUA 3RYLA 4JI8K 3CVKA 4UQGA 4DCOB 4IO9Q 2YKPA 3IWNC 2ZOMA 3D3BJ 1G1XA 4H0YB 4B3RK 2KKZA 2GMLA 2WSCC 2ASDA 3FMBA 3HF5A 4M3YA 2QE5A 2YKAA 2YWWA 3O4NA 3J80Y 3B4MA 4E1NA 4JBCA 1WB9A 3FBBA 4ECVA 4ICLA 1SBRA 4FOIA 5I42A 2YNIB 1EETB 3KHGA 1SV5A 1NMNA 1J5OA 3IC1A 3EE8A 1SB6A 2G1HA 5F41A 1KAZA 2JZ5A 4X62F 3P83D 3HM8A 2BJ9A 3S7RA 1JCEA 2Q97A 1S3XA 4GV6A 3VGLA 2Y0BB 5AFUA 1VQKN 4IOXA 3R7BB 3HP6A 4ZCKA 4JI3F 4DTPA 2JC0A 3TAGA 2IDLA 2KHOA 1CZ9A 2GVZA 3H5YA 2LDIA 2BZ2A 3NAHA 3DHWC 2YPYA 3BH6B 3RUBL 4CLYA 4MAKA 4HDHA 4JEPA 1XMBA 3H5UA 3E51A 3ENHA 3BS9A 2F7TA 2O8CA 4Q7AA 4P7VA 1FNXH 3A4TA 3HRGA 4ZN1A 1E6YA 4DR5K 1RLDA 3SCLE 3I55N 4EEYA 1WACA 3DLEB 3TEHB 3TWZA 1RAAB 3D7EO 1A7GE 4KGXB 1HA1A 3PG9A 1JLGB 3NGZA 5BRHA 1S6QB 4LF9K 3LPTA 2XULA 4BR4A 3M7VA 3ZLJA 3QYYA 5D4NA 2WFBA 2ZZMA 3FSXA 2BE7D 2DNHA 1S59A 4ZS6A 1KLMA 4DF4A 3ZX2A 2V4QA 4JKHA 1KLNA 3WEEA 2BKPA 2HK3A 5K8MA 3KLHA 3E3XA 2MHEA 2DFEA 1QE1A 2CWKA 1N32K 3MHYA 2MY7A 4J9QA 2FC9A 1NGDA 1RU2A 4ED6A 3OBIA 1RDWX 1QM9A 3FRYA 4W90B 3T19A 1B0VA 2A0FB 4ZTFA 4DPWA 3T3FA 3HVRA 3VQCA 5ETNA 3OYCA 4CGFA 4CESA 3O1WA 1OQ6A 2AJ0A 3UDLA 2QFJA 1GH8A 1UFWA 4B1WB 4KAZA 2GA7A 1JX4A 4TU7A 4WQ4A 1VQMN 4CDIA 3W3DA 2ZKTA 3LQVA 1R8PA 2OIHA 3K9JA 4NE9C 3ILIA 2CA9A 4USWA 1LWEB 3HFVA 3RW7A 3OYHA 5D0EA 4JV0A 4FJKA 3AB2B 4AFFA 2KO1A 4O4RA 4X4RA 1YBTA 3OL9A 4USJC 2O8DB 2YHXA 4RUBA 2Y1IA 3LPUA 1RHUB 2XMJA 1NDKA 1HBOA 4N47A 4BR7A 3KFWX 2MZJA 3R2DJ 3G6EN 2BJ1A 1IBCB 3DU5A 4RJVA 1I3OB 1GX6A 2NREA 3OW2M 3U6FA 3CERA 2BTFA 3MM6B 4PWWA 3DC2A 4CGIA 1URRA 1RBRA 5LL6d 3N6LA 3OYBA 3SJJA 4QJVA 1YVUA 3CSKA 3MZIA 2KG0A 1FERA 3KDNA 5E5NA 1RDUA 3G6VA 3GLJA 3ZCMA 2HVDA 5AQTA 2DY1A 5K20B 1TK8A 1PC4A 3O2IA 3M4XA 3V6HA 3O3HA 4AXIA 2KM8C 2CPFA 3CMAN 4RZRA 3QIPA 3R5DA 1IBKJ 4Z4IA 2W2QP 4AHSA 5LJWA 2NR0A 4QAGA 3FGVA 1RDAA 1NKCA 3D1QA 3AFGA 1UW9A 2GHPA 2LU1A 1DBDA 2WAQD 3OHRA 2DY4A 2ZEJA 1RDRA 1A5XA 2JOQA 4JKGA 1BLUA 3TA0A 4OYPA 4ILLA 5B8HA 1H0HB 4FWSA 4CK2A 4AHCA 5C2DA 5C25A 2QXLA 2PD1A 4CJRA 2XC9A 3C14A 1FD8A 1YHQN 3ZSQA 3U9DA 1ITGA 2WVFA 2MQNA 2KFYA 4BC4A 4MYUA 2Z1IA 4U9RA 4DQIA 4X62K 4H4KA 2RDIA 2ZE2B 5IWAJ 5AQZA 2J0SD 5B0DA 4U7BA 2EKNA 3P1GA 4JI3K 4B9UA 3DOKB 4WFNQ 3HMJG 1YX2A 2D9OA 4DU1A 3GE9A 1HPZA 3JTNA 3WXMB 2JC1A 3SSQA 3CCLS 3EO3A 1RT5A 1K1SA 5JS2A 1Q4RA 1WC1A 4DTXA 4DX7A 3OR1B 5KFGA 5KOXA 3CF5L 4A47A 4F3TA 1NGAA 1N8RO 2VOOA 2FJXA 3L09A 4J91A 4YOVA 1JCGA 4I68A 1AUSL 2Y8YA 3H90A 1VC6A 5BN8A 3QEXA 3D45A 1IBKF 4RWTA 1MW7A 1VBKA 1T3OA 1NGBA 2VPZB 2YNHB 3G4SS 3OYGA 4B9LA 4ED2A 3NGKA 2DR9A 3D3CJ 4NA3A 1VOMA 1JNZB 1GOCA 3LDLA 5BRDA 3A8EA 1F9HA 3T5HA 1FNMA 3D7SB 2OCEA 3UDVA 1X4AA 1QS4A 3RMBA 1TKTB 3M1FA 3QNWB 1TVRB 3TOQA 3WX8A 4PXCA 3FUYA 1EKRA 4MKYA 1H7XA 2K1RB 4O5BA 1FRIA 5J2QB 2A6OA 3IR7B 1Q5VA 5AJ3J 3ISZA 4YHHJ 3A8IA 2KFZA 4ECRA 4P73A 4USUA 5CCMA 4KHUA 5IWAF 1YJNS 2ZOGA 4LSLB 1GXUA 3AVCA 4I9LA 3ETMA 3PCOB 2JWLA 3BV8A 2BMBA 4ED0A 2GV9A 3R5JB 3HCXA 1DFDA 1XNQJ 5HJXA 3ZX3A 3QJPA 4HACB 4BY9C 5AQMA 4C23A 1FRHA 3LDPA 3MN9A 4CZMA 4PY5A 3M6VA 3BGOP 1DTTA 2RVJA 2XWYA 3KG0A 3TJAA 4FZYA 1U7LA 2OFHX 4DHYA 4ECUA 3CJ4A 3WIVA 5KFDA 3BQ2A 1Z1ZA 3KUHA 2EWSA 1LWCB 1ZBFA 4DL5A 3TJ8A 3BF3A 1EARA 2KKHA 2KH9A 5MLCQ 1K8KB 1OMSA 3EE3A 3R2CJ 1XK8A 4WQ4C 4GO5X 3THXA 4C3KA 2JWKA 3I32A 3C16A 2QLXA 2FJAB 2ZH1A 5M1NA 3SQGB 2KU7A 1CQNA 2XBPA 4JD2B 1KONA 2DRAA 3MXIA 3IKMA 1Q18A 2EFGA 1TFYA 1RCHA 1Y97A 2CH6A 5AJ3F 3MI7X 2LEBA 4YHHF 4CHNA 1ZOTA 2ZNZA 3C6HA 4CIFA 4M42A 2M88A 1WC5A 3C65A 4CO3A 4WKYA 1W25A 1CJVB 4LRBA 4CF9A 4CEEA 3GMGA 4NLQA 1HJOA 2GO8A 1NKEA 1DTQA 2YX4A 1ZYQA 2Z56B 3G25A 1JJHA 5KFCA 1B3TA 5C0YA 1XNQF 1K9MO 3UN5A 4RU2A 5FLXO 2X6NA 1XR6A 4Z4EA 4XH5A 1R0AB 1ZA1B 2W1BA 3MX2A 4ZVUB 2X78A 1RT3B 1XTZA 4JI4J 3CCRN 1J9AA 4KTWA 3KD5E 1HHQA 3POTB 3TA1A 4K59A 3V5RA 1S10A 2W6LA 3CNQP 2PFFB 1N5VA 2ILYA 4U8VA 5ETLA 2QC3A 2YCHA 1JMTA 3V4IA 2SXLA 5J2PA 3GIJA 5A2QY 1RWUA 4DV6J 4I1TA 3KKFA 1B9DA 5FROA 5MLCV 4NLVA 3ILOA 3LDSA 1CULA 4K4XA 1HKAA 3TZYA 2DCLA 2E2PA 4PKGA 4B3OB 3UE2A 1D8YA 1FA0A 1NLKL 2I7PA 3T9NA 5GAGI 1X1PA 4CJPA 1PG5B 4O55A 2HURA 3SI6A 4LR7A 3ZT0A 4WP3A 4H4KC 1OO0B 3I82A 1NK9A 1IBKK 3PNIA 1QQMA 2P5GA 3H0PA 4TN2A 1QAIA 2GW8A 2W9CA 4C4WA 5DM7L 1CG2A 5F9LA 2X74A 1CBKA 2MZRA 3B54A 1AXQA 1YBAA 1QVFR 2OELA 4Q0BA 2I2YA 4KQZA 3V6DB 4F4WA 4G65A 2XWXA 3D28A 2F8EX 3PX6A 1RJJA 5K8NA 3SUOA 4X84A 1KNZA 3CJ9A 4ELTA 4H4MB 2XMMA 3NGUA 3QPIA 3CJ0A 2Z4PA 2IMOA 4JI7J 3VGSA 3VETA 2HQCA 2XYPB 3TAFA 2M4MA 2JFKA 4FPAA 3EVWA 2YXLA 3MMBB 5IWAK 3MCNA 1V4SA 4Y28C 4JI4F 2Q1NA 4BRDA 2OKQA 3CDEA 1A9NB 3LA0A 3DLLQ 5AQFA 2V9KA 2HLUA 2QG9B 2X6SA 1VQNN 3SBGA 2YNGB 4DMNA 3QWPA 3MD1A 4OHZA 5HBMB 2HW3A 3R5BA 5FRNA 2PA3A 4DV6F 3K0JA 4Y2KA 4CJWA 4F36A 1M5HA 2VJUA 2Z8QA 2Q3SA 1IKVA 4CK1A 2FF6A 2QKKA 4RUCA 2YV0X 3NNHA 1QDUB 2HWHA 3GU0A 2XEXA 3E9PA 1V6HA 3AA5X 1JJ4A 1N0VC 2AHOB 3P6YC 4OJ3A 2F9JA 3H4BA 4B17A 3LW5C 3QLHB 4C3MA 2Z2MA 3O9SA 5J2NB 2DT9A 2VFTA 3PFEA 3AXMA 4D3HA 2X3GA 3OXFA 1Y3JA 5KFQA 2KHDA 1LWXA 3OYFA 3GIKA 1LW0A 2IAJA 4QWDA 5DDRC 5IQQA 2C3MA 4JI7F 5AJ3K 4YHHK 2MKIA 1VJWA 3QB0A 2CUYA 2UU9F 2CQ1A 5A8WA 1EP4B 4UUWA 1TL3B 3VAMA 1HWKA 2ZM6J 4MH8A 4KH6A 2ADBA 2XY8A 1X3MA 1C0UB 3SZ2A 5FPNA 3X1LB 4HHTA 4HL9A 2B4PA 4M5NA 4I6YA 1G4CA 5J1PA 3H3NO 1XNQK 1NGFA 5F0WA 3PW0A 2J7WA 5B0EA 2JVRA 2JX2A 1VAZA 3M8YA 3DXKA 4HI1A 5AQIA 2QM1A 1NO8A 1OH6A 2V9WA 2V63A 4DFMA 3UB5A 2GQ2A 1GMUA 5KFJA 1U1NA 3U9ZA 1RBAA 3EWGA 2DIUA 3AVIA 1WD6A 2O5DA 3G82B 3SIPB 2XNRA 3Q8QB 3SJHA 2KN4A 3Q23A 1S7HA 2VC0A 1WHVA 3H42A 1IJJA 3DYAA 2IVMA 4XDDA 2R7YA 5K5MA 4Q44A 3R7SB 4CK3A 1NGIA 3CPWR 1IG8A 1TUWA 2VV5A 4OV6A 2DPIA 4HUEA 4TQRA 1HI0P 3WBZA 5HQMA 1SJFA 1F21A 1BI4B 3E66A 3WT0A 4C8LA 1P9QC 2DYAA 2A2DA 2B7CB 2BW7A 2B6AA 2RRAA 4FVUA 1J6ZA 4PWDA 3L3VA 2YWKA 3ZSRA 4FPIA 1T05A 3WZ0A 4ZPTR 2AQ4A 2OP5A 4YR0A 4BVOA 4LF4K 2V4JB 1WI8A 4CJUA 4LREA 2V8PA 4WP8A 1RWPB 2FJVA 5C2FA 3AY0A 4HLBA 4BVPA 1U1RA 4O0JA 3GFHA 1JNRB 4HUFA 2W9BA 2G0JA 2ZM6F 2FZGB 3LPYA 3ZSZA 4KHNA 1OS5A 2A6AA 3GCXP 2UXBJ 1S9GA 4OYZA 5F1XA 1C0MA 5I3UA 1KWMA 3KKRA 3O9RA 3AJ2A 4FPBA 5AXNA 1IQZA 3JTPA 5KFPA 4BC7A 4DTSA 2XQCA 1HARA 4MJKA 3DXSX 2IM2A 2GUPA 3MTKA 4JI4K 2KZZA 2BANB 4DFKA 4CLKA 4E7LA 1TK0A 3IUCA 2CZVC 2QXFA 3LP2B 1M5OC 4RW9A 1LFWA 4I56A 4UW2A 4DFJA 5BREA 2Z0GA 3M30B 4DV6K 5AQXA 2OLWA 3PO5A 2DEIA 4FSVA 3PW7A 2VHGA 1SH2A 1X4DA 1TL5A 3R7NB 2AEMA 3SMZA 4JS4A 3DLGB 2P9EA 2W42A 4Q45A 3KWMA 2G13A 2D7SA 2XI2A 3LM9A 2CPDA 3CCJS 1FDAA 4ZMMA 5B0GA 3TSQA 4AILC 3NGTA 1N0UA 2D9PA 4C8NA 1DZ5A 3O08A 3U3GA 2FQQB 5L1IA 3PYDA 1BQMB 3V9WA 1QVFM 2WW8A 4K0KF 5AE1A 2QKBA 3PJWA 2FY8A 1SQKA 3KWGA 2KJWA 4QOZB 3A3OB 3J81j 1HL6A 2PYLA 1K8AT 3MUTP 1LAVA 1B64A 2VA2A 3PIOL 1CZBA 5HLFA 3RBDA 1ZM3A 2W2OP 3QFPA 2OJ3A 3EPIA 4F0KA 3L2VA 3CTRA 5HRPA 3FMWA 5LSOA 1WC0A 2UXBF 3EGNA 2DNNA 2CPYA 3QNNA 3PR5B 4JI7K 5KFMA 4YY3J 2BACA 4F7VA 4FM0A 5HP1A 2UU9K 4M3ZA 2Q66A 1WKKA 4G9ZA 4BDPA 2F63A 3MAHA 5ETOA 2R42A 2E6MA 3OFFA 3T1YJ 2XLIA 4DQ8A 3N01A 1VQOS 2FVPA 5DETA 1FK9B 2FLLA 4F3OA 4KY3A 4ZVQB 3PRDA 1HBNA 4J9UE 2HRTA 4DTMA 5GAHP 2M8DB 2WSFC 3CC2S 5DZ6A 3OBWA 3D6FB 2XY7A 3HJFA 3I0RA 3IAS9 2XLKA 3KLIB 4CI0B 4NB4A 2LDYA 2AYBA 5IXUA 2BJDA 4TLQA 2RE2A 4IWVA 1JLBA 1QAYA 1NHUA 1S0OA 2QI2A 3ID6A 5GIOA 4OX9J 3ZSVA 3ASMA 4FJ7A 2CZ4A 2B56A 1NLVA 2EBGA 1S1VA 1TUVA 4RW6B 3HHLA 4BHQA 1WSEA 2W7AA 1CXUA 3NGIA 4NLWA 4CT9A 5LY3A 3N5FA 3E8OA 4F4ZA 4FK0A 4DR3J 4CD3A 3GV7B 4YQWA 1SQGA 4DU7A 4DMZA 4AL7A 3HFZB 2H48B 2CIMA 1WOSA 4KH1B 3MEKA 5L9NA 1U09A 1F9EB 3BUZB 4YY3F 4MFBB 4L3QA 1WEZA 4IZ9A 3LZIA 3D54A 3CJ2A 1WHXA 4PUOB 2YNIA 3P4UB 3ZETB 4KHRA 3V6JA 1IKWB 3BO4A 4IRCA 2ZM6K 2GJIA 2XY6A 2ZJRL 1ITPA 2MKHA 1TK5A 2C1EB 3D6RA 3OYLA 3DLHA 1GLEG 2WUSA 4GC7A 3C6AA 4DSFA 1IR2A 1BQNB 2UUBJ 4LC9B 3GSIA 2ZVSA 1WBBA 1W0HA 4NYPA 5KTQA 4FF2A 5E84A 4GRSA 3NMAA 2HMPA 2DGWA 1VQ8S 4LJMA 1LW2B 3KTQA 2E1CA 3AQOA 2FSJA 2AX1A 2V8GA 2YBVA 1KQSR 3TAPA 2LSNA 1R43A 2IJNA 4RUHA 2U1AA 3PO4A 3UFCX 3VAKA 3CPWM 3UD4P 2CJBA 6FD1A 1RACB 5DG9A 2J4RA 4DX5A 3EICA 1D8ZA 4DXLA 3QESA 4M3XA 4LH4A 5DO2A 2KDOA 3PYEA 3ETOA 3CCMS 1D09B 2CYYA 1SL0A 2V94A 4OX9F 3BR8A 1S9EB 2ZUAA 3DLEA 4HVJA 2AYEA 3DXMB 1JLGA 5FPEA 3GTYX 3H59A 3R6MA 5I9EB 3DGPB 3K9KA 4RUAA 4Y6IA 1C2PA 4DR3F 2NLXA 4L73A 7AT1B 2DNLA 2AMCB 4X4PA 4UOFA 3SCJE 4TU9A 1X8DA 5M2UA 4KKOB 4I64A 5F3TA 5F0XA 5KT2A 5KRSA 3ULDA 2XMUA 4K4WA 2JWNA 4K0KK 1T9XA 3I87A 2P9KB 5ADXA 1X9MA 2HHQA 3GE1A 2DNOA 4Z37A 1RYSA 1LKZA 3NGSA 4TKTA 5GMKa 4IOCL 3O4QA 5FDLA 3MECB 3UCZP 2VJVA 4OGCA 1RK8A 1RABB 4PKHA 3J81Y 3TEGA 4BRIA 3RMCA 4QS9A 4DN0A 4DF8A 3JQJA 4IUFA 1RP5A 3C15B 2IRYA 1T9VA 1RDDA 3MR6A 3R1LA 2VDIA 3JSBA 3X3UA 4ISEA 1R6YA 3GV5B 2V4RA 2UXBK 1F0XA 2F8MA 5CHIA 4CH1A 2UUBF 3M2RB 4DR2J 3JXUA 1UEUA 2L3MA 5HANA 4P52A 1IR0A 4Z7YA 5DLFA 1U6BA 1C0TB 2EPIA 2E44A 4IO1A 4ZPAA 1LWEA 3BN4A 3PJ9A 2YVSA 1BY9A 1WSGA 4IOAL 4PCQA 2IFXA 2O8DA 4B9TA 4ZHRB 3QMLA 5JVHL 1BGXT 3O3GA 4KBIA 2NUBA 5CHCB 5KGWA 2KYZA 4A5BA 1VQ5S 2VKZG 2Y1JA 2IA0A 5LJVA 2E5IA 3MM6A 1UZDA 2YQ0A 3B4DA 3HHNB 1NGEA 3CD7A 4CZHA 1YDLA 2HQFA 1VRUB 3TUPA 1NHKL 2HNDB 1AFJA 3VENA 1JXEA 2ZVIA 1DQ9A 4JS5A 2DNZA 4X4UA 2UUCJ 4LVOP 3W9IA 1YT3A 4HHHA 2EFPA 4YMEA 3SBTA 2YH0A 4K8ZA 2DGTA 4EZ6A 4F0HA 3OXLA 1O6XA 1IBMJ 3AVHA 1HNWJ 1CSJA 3PTWA 4BRMA 2OANA 2BW2A 3PV8A 2NPIA 4KPYA 2H5EA 3DOMA 5KFOA 2UUWA 3NY0A 2YPZA 4U96A 1FEHA 2IYIA 1SC3B 3OTEA 1YITS 1MWYA 1NGJA 2N7YA 4AF1A 3QQCD 2R9LA 1YJWS 1NBEB 3O9TA 4C1NK 4RBVA 3OS0A 1NM2A 3NLCA 3FBFA 4FJJA 2ZE2A 4PPDA 2G8UA 4JV2A 2KXHA 2HS4A 2WB1D 1N56A 3DLBA 1XC3A 2D69A 3DJCA 3DOKA 5EOYA 1IBLJ 4G1QB 3J80U 4B9NA 4TSXA 3N4QA 1VQYA 3L2UA 4AD6A 2NUHA 2YX7A 3H5SA 2BQ3A 4DL2A 5M2RA 3OR1A 2JVOA 1IKXB 4IYQA 3BB5A 4YS2A 2AU0A 5B7WA 3CCJN 4OX9K 5L38A 2UUCF 2ETJA 1A5WA 1EJ7L 4LR9A 1B7YB 4OI2A 4NLGA 4V19X 4KHQA 2BABA 2YNHA 2AZ1A 1ZC6A 4DR3K 4F4AA 3PUFA 1ZS6A 4PPZA 1IBMF 4C2MA 1HNWF 3TSUA 2DNKA 4LMZA 2E2OA 4NPOA 4CTAB 4UY85 2XYHB 3BKTA 2RDDA 1U2RA 1NGCA 1TVRA 1NPPA 2CJ9A 2LXUA 2XGQA 2V2ZA 4HI2A 3A5MC 1TV6B 2K1RA 4BE1A 5J2QA 4IR9A 2QTDA 4I69A 3OY9A 2JLGA 4ELVA 3CXCR 2ZDPA 1HX1A 4OYOA 1JLEB 4QWEA 1F60B 4LSLA 4NXMJ 3CD0A 1TTHB 2UUBK 2L08A 1U1OA 4B3SJ 4QU6A 3HYFA 1KQSM 4DG1B 4K2JA 2JEJA 1VQON 1IBLF 2M8HA 3F5TA 1UEKA 2F8SA 3VGVA 2RU9A 1QD1A 4HACA 3DRYA 1CC7A 4H0XB 2VOPA 3PVXA 3RBZA 2J6TA 2NRWA 3C7NB 2GFFA 1EWRA 4DQPA 2MKJA 3CC2N 4X64J 3TYTA 4QU7A 4PKIA 1LWCA 4PR6A 2FSKA 5KFKA 2HWTA 3LTOA 4LQ9A 1K8KA 5F2RA 5BYQA 4K2XA 1T3VA 1HI8A 1NDCA 4X4SA 3G9CA 1K73T 3ZT3A 2XMKA 2FPHX 3NF6A 1YTYA 3GILA 2KVQE 2G8HA 3I4HX 1KD1T 4CHOA 2PN6A 1WKLA 3OV7A 1KVBA 3VAHA 2F9WA 1TMJA 3AA3A 3SQGA 3VHQA 4QW9A 1QSSA 3CD5A 5TKWA 1RT7B 4KI6A 2DBBA 2C2NA 2OPQB 5IT9Y 5EGYA 4KIAA 1UWBB 1NZ8A 4B9VA 4OYIA 1D0EA 3TABA 4OV1A 2P9SB 4E1MA 2VPYB 4M5HA 1FVSA 1CJVA 4NXMF 1ATRA 3GIRA 2GGPB 2DO0A 4CLWA 1SIZA 2FVQA 1VQSA 4FJGA 1IO2A 1F2HA 5DGBA 1WOOA 3RG6A 5A8RB 5EWGA 2IA6A 4DHVA 1DGKN 1R0AA 2FY1A 2CVIA 4ZITA 5KFVA 1SJQA 1M1GA 2IJFA 3AAPA 1W2IA 2HMIB 2XY5A 2BGGA 1RT3A 1VQ8N 3POTA 4WK3A 4P7TA 3BPDA 3KIOA 4H0VB 5IFMA 5BXIA 2DNPA 3OYMA 4USTA 4F0MA 1Y00A 1J5OB 2VIHA 1RT2B 5BR8J 2ILZA 4M1KA 4J2AA 4FK4A 5GAGP 3ILLA 4OLOA 2FXUA 4B3OA 3MM8B 3VQ8A 1WJ9A 2H1YA 2ASJA 3CJ8A 1GAOA 3UVJB 4P2XA 1OPIA 2W7PA 1C6VA 3NGDA 1F3FA 1SC4B 2WB4A 2UUCK 1NGHA 1T9UA 4WTYA 4U8YA 3U7JA 1H2UX 4GW6A 1WUUA 3KK1B 3MEGB 3KDOA 3KK2B 1KAYA 1VRQC 1SC6A 2ITGA 3KLEB 1YRXA 1RT4A 1LOTB 4OZ3A 1IBMK 1ZAXA 1HNWK 3SDEB 1C1CA 4RO0A 3FCWA 3V6DA 4YP3A 1E6YB 2JRSA 2BJ7A 5BPLA 3KMQA 1Y11A 3BSAA 2QL7B 3T5KA 2OTJS 5AQYA 2XG8A 2P9LB 1WG4A 3OTDA 3K59A 4RX6A 2RSQA 4H4MA 2ALZA 4O8UA 4DPYA 1N5QA 1KTVA 5F8HA 2NXNA 2WHOA 4OYBA 2ZWHA 1TZ0A 3LF0A 1H73A 4N8NA 3MMBA 2R7WA 2Z57B 1ESVA 4UY8O 3LDOA 7FDRA 1RTZA 3PKYA 4CJKA 2W4PA 1QE1B 2H4YB 1B70B 4I4BA 2Q31A 4ISFA 5ETQA 4ECQA 1IBLK 2YNGA 3PJXA 3TO8A 4IDKB 2ZKUA 4EAHD 5HBMA 2OHDA 3BGFA 3S3NA 3KKSA 4WFAL 3T5LA 5BR8F 4USHA 1FDDA 3R27A 2DRBA 2F4VJ 4BR5A 4LT6A 1VQ5N 2LQ5A 2ZGYA 2J0QD 1QTMA 3J7AP 2PMZD 5D0HA 1ZXOA 1GXTA 3SSRA 1ZH5A 3AOCA 5HRSA 3EJMA 3E01B 5JJBA 1Q79A 3M1VA 3AA9A 3NVMA 3GJTB 3BO2A 3D0GE 1SL1A 3HVTB 1FDBA 2FIUA 3IAYA 4LRDA 4J9LA 4RNMA 2BA9A 2CG4A 2V7YA 2DNMA 3QLHA 1NGGA 4QZVB 3VGMA 2RUSA 5J2NA 2ZGZA 1RT6B 1HJRA 2HFZA 4QCLA 3JQMA 3WQTA 1KOOA 2ZC4A 5DMRA 4M94A 2WW4A 1S22A 1R8CA 3MFHA 1FF2A 1RGIA 4BBYA 3CXCM 4DTRA 3VMFB 4IO8A 1TAUA 3RB3A 3DXBA 3DMJB 1W26A 1D9DA 1IN0A 1HFEL 2HHSA 3G8TA 1AUDA 3EGZA 2BE9B 1EP4A 5C5JA 4W5NA 2OTLS 1J27A 4NEYA 1TL3A 2YWEA 4M8LA 5GVQA 2D1CA 3QJJA 3NS5A 4J2DA 4NXMK 2HOEA 1YJWN 4Z4HA 3PW2A 3QIPB 2VWJA 3R3TA 4FJ8A 2CNLB 3DAWA 3H2VE 1C0UA 3OS1A 1Y0HA 2YKQA 3PM9A 3HZ6A 3LWLA 1GLLO 3OYKA 1NH7A 4K4UA 4M5GA 4CHYA 1NJYA 2N4DA 1IWGA 4HTJA 2F4VF 4PQUB 4J9SA 1KQGB 3F9MA 1MG7A 5BRFA 2CPJA 4XTTA 3G82A 2E5LF 3ZEUB 5E41A 2VL1A 4CFCA 1X9WA 2M52A 1NG9A 5CY4A 4OZ5A 3L4QA 4G6VB 3BP8A 2RJZA 4MYTA 2GQCA 1Q9YA 4IO9L 2GX8A 1EHWA 4FZXC 1CJTB 3GFXA 4L3NA 2LKZA 5D3GB 4LF5J 2WBRA 1E3MA 1BI4A 3VF4A 2R7UA 5BN9A 5L46A 3PACA 3RRKA 4JI6K 4MIWA 2V2QA 1U02A 4U6PA 5AZJB 4HEA9 5HMWA 2LQBA 1N48A 4E7IA 2K3KA 2V4JA 1NOYA 4DV7J 4C8KA 4CF1A 3FNNA 1N5YA 1DQAA 2CDQA 1HLUA 2VYPA 2RB7A 3MAQA 2HBRB 1FDNA 3PYFA 3KD1E 3M9MB 1OQ3A 1VQ7S 2PGCA 3L7PA 4HDGA 1TU0B 4DTUA 5IT0A 4DKWA 4P6QA 1U2CA 4CWBA 3GR1A 2ASPA 2VH7A 1RBUA 2HIYA 4ZP6A 4FYXB 3VAJA 3PIPL 3BDPA 2QO3A 1ZETA 4CECA 3AAQA 3HULA 1P90A 4MLEA 2BANA 1N5TA 3MWPA 3ZO7A 1DY3A 1HD1A 2PT0A 4N8OA 4ID1A 3LP2A 1X4HA 1S72S 1S6OA 4EYIB 3M30A 3VQ5A 4OI1A 3M6GA 1KKHA 1PCAA 1UA0A 1RYRA 2XMWA 1OIAA 3MCPA 1S0MA 3DLGA 1RZMA 2P6TA 4EBDA 1PBUA 2ZH7A 1XMOJ 2P8IA 4OKKA 4QWCA 3NH0A 3FBCA 3M8QB 4QYRA 1BQMA 3HBTA 4ZVEA 5T41A 5ETPA 4DV7F 4FYWB 3QSIA 4NLUA 1EIYB 1U4BA 2GIQA 3CMES 4CEFA 4N7TA 2JEIA 3LAKA 3J80O 4OPJA 2DR6A 2QL9B 2FUG9 4DV5J 4EU0A 4LRAA 3EVOA 2LA6A 4ZP8A 3K8VA 2ASOA 1JLFB 3NEKA 2FZCB 2VG6B 4FP9A 3PEJA 4JKDA 4ES3A 1NMDA 3CCUS 4RW7B 1LXNA 3MMAB 2AD9A 3KLFB 3T1AA 2MZTA 2IDEA 2XM3A 4BG9A 3VGUA 3AA8A 4ECWA 1PSDA 4DB3A 2AYGA 1PAUB 1Y5NB 3GDQA 2BEFA 1BWFO 4BRKA 3CIPA 2YHWA 2KVIA 5GIPA 4NMLA 3MCAB 4LRFA 1PGZA 2F4VK 4UOGA 1QZ6A 1W7AA 2NXCA 4FDFA 3OR2B 4F26A 3KLIA 1XMOF 3BZQA 2IS3A 4CJ7A 3H2LA 2E5LK 1MWQA 3D67A 5IZHA 2C42A 5IOLA 2G8KA 2DIVA 1WF0A 4V19S 4NEZA 3KVGA 1HUXA 3THYB 1C4AA 2MKYA 1S79A 1W9HA 4RW6A 3IS9A 2HFOA 4ANEA 2C3UA 1VC5A 3QFUA 1D4XA 4DUZJ 1KSPA 3L3UA 4FYVB 1UAWA 2P5VA 4BRNA 5I3PA 4DV5F 4JYAJ 2XTJP 1N33J 2MQOA 4MFBA 5H1SV 4AHRA 4HYKA 1IV0A 5CYMB 4W5TA 4PUOA 1I6JA 2DTJA 4W98A 1RHMB 3ZETA 1IKWA 1NNEA 4I0WA 2VASA 4ZJOA 3MURP 2EK1A 4WFNL 2FB0A 4QBUA 4ZPDA 2EI5A 1NJWA 1BQNA 3H08A 1NJIO 3A5OC 4GV9A 4C8ZA 4DQQA 4LFCJ 2E20A 1LW2A 5KT3A 2Y0SD 4HKQA 3BSCA 1L3VA 2VWBA 4EFAC 5HROB 1FE4A 4CZIA 2X1GA 3CJTA 3IGVA 5F8LA 2I7NA 3DDKA 1UP1A 4OYMA 4ZP9A 2WRMA 3KJNB 4CF2A 3T6BA 1XWLA 2QA2A 3VQ7A 1S9EA 2MZQA 3O6WA 4O3QA 3OHAA 3WQUA 2NSBA 3G8QA 3DXMA 3BBCA 3DGPA 5GADP 4NYNA 2HQIA 2RS2A 4WYLA 2NS1B 4DUZF 4H03B 4DI6A 3AA4A 4YB7A 3OJUA 4ETXA 3VA0A 4YB6A 1IQTA 2FVCA 3U1NA 4ZVFA 1NDLA 4JYAF 1ZPVA 1S77D 1N33F 2P9KA 2K7KA 4Q5VA 2IC3A 1T6DA 4DV7K 3S3MA 2C3OA 3AXKA 4F4KA 3BDEA 2AV5A 3DKDA 3MECA 1HNXJ 3I55S 2JGUA 4CZCA 2RQ4A 3K5PA 3KHYA 3FZHA 3C15A 3TUJC 5M1QA 2Z1HA 1WTBA 1S99A 2OYQA 2YNFB 1RWXB 4ED4A 2AP1A 4CZJA 1EO1A 5CZVA 3FEYB 1WC3A 1F3VA 4QQBA 3Q24A 2VFUA 3M2RA 4K5SA 2W40A 4ZCLA 5D6GA 3O1BA 5B0CA 4BC2A 1FJCA 2IIHA 3B78A 4RNOA 3HVWA 2HRUA 2E1ZA 1C0TA 1S1TB 4LFCF 4QIWD 1QVGR 2WSEC 4JI8J 5KI6A 4J9PA 2CKWA 3GB0A 4B3RJ 1T11A 1LW0B 3FQLA 4ZHRA 1JL2A 4QR0A 4ZP7A 4Q2LA