5J2QA

Hiv-1 reverse transcriptase in complex with dna that has incorporated a mismatched efda-mp at the n-(pre-translocation) site
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
547
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
molecule keywords HIV-1 reverse transcriptase p66 subunit
total genus 154
structure length 547
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2qA05
3DOLA 2QV6A 3V6DA 2OZMA 4F2SA 1N56A 3I8DA 1S1TB 4DQPA 1EKEA 3DOKA 3AVAA 3DYAB 1T8EA 3VQ7A 4F8RA 3SUQA 3IS9A 3KLIB 4NCAA 2XC9A 4R5PA 3AVBA 2NUBA 3IRXA 2ILYA 4ECSA 1SKRA 4IR1A 3G0ZA 4YQWA 3P5JA 2E9RX 3AVHA 2R2TA 4WYWA 5DQHA 2XY8A 5KFCA 2ZD1B 2HNYA 2HNDA 5I42A 4HYKA 5KG4A 4JS5A 1KSPA 1RBSA 1WSGA 1KLMB 4IH5A 1NJXA 4U7CA 2KZZA 4KHUA 3SZ2A 2XO7A 2HW3A 1VSKA 4LSNA 4I7FB 4BDYA 1S1WB 4ID5A 2WRMA 4IKFA 4NLRA 3VN5A 1TKZA 3U3GA 1F21A 4NLPA 4QW9A 2V9WA 3K59A 2XY6A 4DFMA 4DSIA 1C1BA 4CJQA 5T7BA 4TYBA 3DMJA 4OGEA 4TY9A 3KIOA 4AHVA 2AX0A 4EZ9A 1NHUA 3ULDA 1A5XA 2JEGA 2C28A 5J2NA 3CO9A 2HVIA 3NAHA 1QSSA 4CJPA 4TY8B 1R0AB 4RW4A 2G8WA 3MAQA 3OL8A 2IDOA 3NDKA 3VQAA 4K4SA 2YNGB 3TR8A 4WYLA 3H5XA 3RRHA 4FLYA 4AHRA 3DYAA 5KT4A 3TAGA 3RBEA 4E7KA 2RDJA 5KFKA 3OYLA 2V4QA 4ZHRA 3DRPB 4CF9A 4KO0A 1ASVA 3QEWA 3MEGB 2R8GA 3HVTA 2AU0A 4NCGB 3AVJA 3SQ2A 4WXOA 4CK1A 2ITGA 4L8RB 5KFDA 3M9OB 4TQSA 1JLAB 2AX1A 2KQ2A 3M9NB 4URGA 2HNDB 2IM2A 2QXFA 1S1XA 3V1QA 3OYFA 2J6TA 1SKSA 1D1UA 3O4QA 4N5SA 4ED7A 3V81A 5CZ2A 4H4MA 5J2QB 4TXSA 2HNZA 5KFMA 1D5AA 4NYNA 4BWMA 3NCIA 3ALYA 4E7LA 1J5OA 3KLFA 1C0UB 3QIPB 2JEFA 3QEPA 5I3UA 1S1TA 3OJUA 3GIMA 4ZMMA 1JKHB 3AA2A 4ED8A 4ECVA 4KFBB 3C6UB 3LP2A 4CEAA 3CJ5A 1HMVB 2W8KA 2YNHB 5KG7A 2O5DA 3HYFA 4CIEA 4ZVGA 4B9SA 3EPIA 3O3HA 3OYJA 4AHTA 4YFUA 3AVFA 1TKZB 1SL0A 1GX5A 3KK2B 3AVGA 1ZBHA 3HPHA 4K4UA 4RW7B 1C1AA 3C6UA 3PR5B 3I5CA 3PO5A 4J9LA 3IN5A 5F8IA 1LV5A 3Q8PB 5HRNA 1REVA 1VRTB 1JLGB 3MECA 3RB3A 2B6AA 4Y34A 3OL6A 2DY4A 3KLGA 1KTQA 4KBIA 3I0RA 2B43A 4ZVHA 4Q0BA 4O3OA 2FBTA 1WNSA 4OGCA 2OPQA 4Y1DA 3LP3A 4Y2AA 2D41A 3KNAA 4W5NA 1HNVA 2FJVA 5EUHA 4DTMA 3ZT4A 4HUFA 4CF2A 2Z1HA 4W5QA 2IC3A 1VSDA 4R5PB 3JSMA 4QWBA 2AGOA 2FJXA 1S0MA 2V4RA 3IGVA 4FW2A 5HBMB 2FC0A 5KG3A 2UVWA 3H08A 4DS5A 2OZSA 2B5JA 2XY5A 4K4XA 1U04A 3H2LA 4J9PA 2RKIB 4IR9A 3NGIA 4ZP7A 1NKBA 3L2WA 4Q45A 4E89A 3AVLA 1IKXA 1HYZA 4CGIA 2P5OA 3HPGA 4K4YA 4CGDA 4DSFA 2RN2A 2JLEA 1XR7A 3V81B 3V9ZA 3LZIA 2FLPA 4J9KA 1VRUA 1B92A 3V4IB 2W9CA 3KK1A 5KFGA 3ZT3A 3CYMA 1EP4B 3S3OA 3SPYA 4CFBA 1KRPA 4CK3A 2ALZA 4O44B 3SPZA 3L2QA 3AVKA 4MFBA 2GUIA 4F50A 3NF8A 4FJMA 3NH1A 4IDKB 1HNIA 4CF8A 5J2QA 3BQ0A 5HP1A 1K1SA 3OSNA 3K58A 3KOAA 2FLLA 3OLAA 1TK8A 3TABA 2JEIA 3M8QA 4JV2A 3KLEB 2YNGA 4WXWA 4CHOA 4O4GB 4CJLA 2GV9A 4JLHA 3D45A 4CJEA 4RZRA 3PZPA 3EPGA 3SNNA 1C1CB 2KFZA 1RTIA 2P5GA 5J1EB 3MXJA 1NK5A 1RTIB 3MEEB 1J9AA 2DFEA 3ZSQA 3KHHA 1ZYQA 3K5LA 4KO0B 3IAYA 4CFCA 3V6HA 1JLAA 1QE1A 1T3NA 4CERA 4CJFA 2P51A 2VG7A 3NAIA 4MQ3A 1RBUA 5KI6A 1L3SA 2IJNA 4Q44A 3OYHA 5KFZA 4ED1A 1RYRA 2EHGA 2FVQA 5C5JA 4CJWA 4ZVFA 2YNFB 3QLHB 1RT6B 3DLGB 1QSYA 1VSHA 4ECRA 2O4IA 2J6SA 4CEEA 3HT3A 4FM0A 4CECA 1WAFA 2B4JA 2W7PA 1XR5A 4KB7A 5DQGA 3PX4A 4KB1A 2GIRA 1BI4A 3TWHA 2BQ3A 1HYVA 3ZSWA 3G10A 2F8SA 4KFBA 4MIBA 4GC6A 1S6QB 4IH6A 5F8HA 4EYHB 3QERA 4K4VA 4O3RA 4ZTFA 1RBVA 1YVFA 4I9LA 5SZTA 3MTKA 4B3OA 3DOKB 4G1QB 1NKEA 4YR3A 4KRFA 3DRSA 2BRKA 1C0UA 3QIPA 4E1NA 1RT3B 3KHLA 4E19A 4KREA 1G15A 3VQ8A 2A1SA 3HKWA 1RT7A 4C8OA 3O3GA 3BQ2A 1VSFA 5C24B 4ZP8A 4BE0A 4WZQA 1HQEA 4FJJA 3AO4A 5DGBA 3N6NA 2VWJA 2VG5A 1L3TA 2RPIA 2AGQA 5CYQA 4DTJA 1WSJA 1ITGA 2FVRA 3V9UA 4B9UA 3VQQA 2X6NA 3DM2A 4O55A 3IRXB 1CXQA 4FS2A 5EWFA 4FJGA 4DL3A 1TKXB 4F4KA 2WTFA 3VQ6A 2JEJA 1TVRB 1IKVB 4CFDA 2BE2A 4F4ZA 3VQPA 2YNHA 4B3OB 1QUVA 3SQ0A 4CEOA 3WNHA 1S9GA 4FW1A 1LAWA 4Q8FA 4EBCA 5CYQB 4CJ4A 1NHVA 2HB5A 2GC8A 3BDPA 3LANA 4FBTA 4ECXA 4CIFA 4RW8A 4HUGA 3CDWA 3JYTB 4I2PA 4CF0A 2PZSA 3AA3A 3RBDA 4I2PB 4J9QA 3PJWA 1Z4UA 1XI1A 1WSEA 1U47A 4M41A 4Z4GA 3DLGA 3DRSB 3K57A 4DMNA 3NGZA 1S5JA 3KKSA 3KK3A 1TP7A 1DTTB 1S1UA 3SFGA 2HHSA 4NCGA 3RTVA 3NBPB 1T05A 3CJ2A 4WFZA 5C42A 1TVRA 2RF2B 2OPRB 4WFXA 3ZT2A 4HHTA 1IM4A 1TKXA 3DLBA 3F9KA 1TL1B 2ZD1A 2R8KA 4CEQA 3PV8A 1RT2A 3UPFA 2HHWA 1C1CA 4AHCA 3BGRB 1KVBA 4ECQA 5C24A 2FBXA 2ASLA 3CJ3A 3OYMA 3ZSZA 1Q8IA 2WOMA 3IGNA 3OYEA 5L9XA 4O3QA 4M42A 4JRQA 2DTUA 1OS5A 4LH5A 3B6PA 3N6LA 4N47A 1T03B 3I0SB 4PQUA 3MEGA 4QWCA 4O44A 4FZZA 5KRTA 1C1BB 4FM1A 3EZUA 3CM5A 2XGQA 3GIIA 1VSEA 4NLUA 1NOYA 1BQMB 4YMEA 4K4WA 3SUPA 1KVCA 2OPPB 4C8LA 1WNEA 4BWJA 1S9FA 3EZ5A 3LPUA 4RW4B 5KFNA 5FRMA 2ATQA 4DTUA 2G8FA 3PUFA 4CGFA 1HPZA 4FLVA 1C0TA 1I6JA 3QINA 1RT1A 3LP0B 3NAEA 2XI3A 1ZBUA 3ZCMA 3T5HA 3K5MA 3MFHA 4PUOA 4TQRA 1W0HA 4RNMA 1IKWA 1RT5A 5C25A 3ICLA 4F3TA 4Z4HA 1TV6A 3T5JA 3ZT1A 1RA7A 4F4WA 4X2BA 1RTJB 4DTSA 2R2RA 3SI8A 1UA1A 2E4LA 5J2PB 4YR2A 2VG7B 2IBKA 3KLHB 4MFBB 2LSNA 5FROA 3VQBA 2R8JA 1RA6A 4DL4A 5KFRA 3QIOA 4EYIB 4H4OB 1RTDB 4CCHA 3FFIB 3C95A 4JRPA 4TLRA 4CHNA 2VG6B 4FLWA 3F73A 3QGIA 5KFFA 2FVSA 4FM2A 1SV5A 1KVAA 5KFIA 2JGUA 1HYSB 3QO9A 2GBZA 4B9NA 2IAJA 3ITHB 4DLGA 4Q43A 4KTZA 1ASUA 5KFVA 3QIDA 3IS9B 3QO9B 1GOCA 2YNFA 3CFRA 1LW2A 3P1GA 4FJ5A 2UUTA 2HVHA 1S10A 2GIQA 3H5YA 3PHEA 1BQNB 3QNOA 2R7YA 2FBVA 3CG7A 1N5YA 2R2UA 4J2BA 3GILA 3VQ9A 3RRGA 4OVLA 3LPTA 3SV4A 5J2MB 1FXXA 2PYLA 5DQIA 1CZ9A 1GOBA 4QWEA 1NK7A 4H4MB 3ITHA 1XHXA 5I3UB 2JC1A 4PA1A 4NYZA 4GW6A 4NLXA 4JV1A 4R8UA 4OKEA 1NKCA 2YNIB 4CGHA 1FK9B 4E3SA 2IAJB 3TAFA 1RTDA 2B5JB 4AILC 3SJJA 4ICLA 4RU9A 3H59A 1RCHA 5F8NA 3WNGA 1TL1A 3GIJA 3GV8B 4RW7A 3VQEA 4FCYA 2OYQA 2Q3SA 4CJ3A 4CHPA 3BJYA 4CIGA 3KLHA 1JLQB 2ILZA 1BL3A 4J9OA 3QETA 3ISNC 5EWGA 3JSMB 3GIKA 2VWKA 3T5KA 4DFJA 3HPOA 2W9BA 2YHBA 2YNIA 1WAJA 4XIUA 4LSLB 5DG8A 2D3ZA 3TAEA 1SV5B 1JL1A 4WE1B 2VA3A 2ASJA 5D3GA 4IFYB 4FJNA 4NLQA 4O3PA 4NLDA 1W9HA 1SL2A 2XHBA 2EX3A 4TN2A 3Q8RB 1IO2A 1SH0A 1NNDA 4JUZA 2XCAA 4TYAA 3OYIA 4B9LA 3KJVA 2Z1IA 2I1RA 3KK3B 3I5AA 2BQRA 2WHOA 1ZBFA 2ETJA 5KFWA 1TK0A 3KLFB 3TQ1A 1X9SA 1CLQA 1HQUB 1S49A 5FDLA 4F4YA 4FS1A 2HHQA 2WOMB 2HNZB 5C25B 1ZETA 5KG0A 3LWLA 1S6PA 3H4BA 2PYJA 4PUOB 4CGJA 4AHUA 3PX6A 2WONA 4ED3A 1KLMA 4CESA 5KT3A 1RT1B 4FLTA 1CSJA 1S1XB 3QZ7A 4NLYA 4FJKA 2AJQA 3DLHA 3UR0A 2OPPA 4DL6A 4M3YA 4RNHA 1S0NA 4KSEB 3DLKB 4OJRA 4NLTA 3SUNA 5C42B 5DK5A 4OLAA 1ZTWA 3V6JA 4PY5A 4QOZB 4FJ9A 1RTJA 1C6VA 2KW4A 4Z4FA 1S1WA 4EP4A 2OA8A 2G8KA 4NLOA 3KJVB 5DG7A 2OPQB 5KFLA 1WSHA 5EWEA 1RNHA 3OY9A 4W5OA 1U09A 3AO1A 4FK0A 3Q8QB 3RR7A 3HO1A 4DG1A 4DFKA 1NK4A 3MR6A 3RAXA 1BGXT 3FQLA 3V1OA 1JLEB 5KG6A 4U6PA 4BDPA 1JLCB 1FKOA 4KE5A 3SCXA 4TY8A 4NLGA 3KLIA 4NZ0A 3PX0A 2BR0A 3NBPA 3M8SA 1D9DA 3DMJB 3AVMA 3VQ5A 1RDCA 4BDZA 4ZPBA 5HRRA 2D0CA 3V9XA 1S1VA 5HRPA 4IH7A 1T05B 2IS3A 4DS4A 3QEXA 4I9QA 4IQXA 2EC0A 4CEFA 2YV0X 2R8IA 3P83D 5KG5A 4O4RA 4KHQA 1UWBA 4MK8A 5KTQA 5KG2A 4LSNB 1U4BA 3D0PA 2C2EA 4UQGA 4K8ZA 3NKYA 4DU4A 1RDRA 3G6YA 4Z4EA 1BIZA 4RW9B 3BSAA 2OPSA 1O1WA 3T5LA 3OYBA 4OLBA 5L1LA 1RT7B 2JC0A 3LAMA 1WLJA 4RNNA 5KFXA 1RDDA 4M3WA 1HQUA 3AVIA 1S9EA 4HKQA 4CEZA 4PWDB 5F8LA 2HHUA 1N4LA 2I5JB 3HP9A 4N41A 2FLNA 5KGXA 3VQ4A 4F2RA 1W25A 4KAIA 1MU2A 3EY1A 4EP5A 4CJUA 3ZSYA 3SFUA 1FK9A 4MIAA 1NJZA 1HQEB 1YT3A 3RMCA 2FJWA 1BQNA 3CFOA 3QLHA 4DU3A 4MK9A 3LZJA 1K6YA 3T1AA 4RUCA 4AHSA 4CK2A 1L3UA 1HARA 5D3GB 1UWBB 2G8IA 3OYNA 3H4DA 1VSMA 4DTPA 1NK6A 4IG3B 2VA2A 2BGGA 3TVKA 3HK2A 2D0AA 2WCXA 3DDKA 1JXBA 1IG9A 5F8JA 3OL9A 1TL3A 3RB0A 1KFDA 2BE2B 2ZQBA 3DI6B 4ZPDA 4E7HA 2W9CB 3RMAA 1B9FA 4NLSA 4YR0A 3QGGA 5I42B 3KHGA 4HVJA 1YVUA 4NLVA 2UVRA 2VG5B 3QESA 4J9RA 1SL1A 1LW2B 2E6MA 5L1JA 4HCCA 4ZPAA 3CJ0A 1RT6A 1TV6B 2FVPA 4ELVA 4DSEA 4ECYA 3PW2A 1U45A 4KV8B 4IDKA 1RT3A 3OYCA 3TAMA 3CVKA 3HVWA 3MF5A 3V9WA 4DTRA 4F4XA 4G1QA 1EX4A 3AO2A 4O3NA 4Y1CA 3LALA 4QAGA 2VG6A 4KHNA 3OHBA 2D5RA 1TKDA 3KMSA 3KLGB 3NHGA 2ZE2A 3OS0A 1KFSA 2P1JA 2HMIB 4DL5A 4KKOA 2HHVA 1NK0A 3AVNA 5KFQA 1CXUA 3S3NA 2J6UA 1YTAA 3HSTB 2F96A 2DPIA 4ID1A 4LY7A 1XC9A 1IKWB 1RT5B 3M8QB 3G6VA 3H5UA 4ZP6A 4Y2CA 4NRTA 1HNVB 3KTQA 4EEYA 3AV9A 1BIUA 3OYDA 4EO6A 3HP6A 3EYZA 2C2RA 3LP1A 4KI6A 1QS4A 5JXSA 1GOAA 3MECB 1HJRA 4J9SA 2AWZA 3NF7A 4B9TA 1SKWA 4QW8A 3CDUA 4M3TA 4HCBA 4ED6A 1A5WA 4NCBA 2X6SA 4ZP9A 1BISA 4O0JA 3RB6A 3OL7A 4K50A 2ZE2B 1DLOB 1D8YA 1VRUB 1T94A 5J1EA 3U6FA 4WE1A 4G3IA 3PW7A 4F3OA 1K1QA 4CJRA 3L8BA 4RNOA 4E7JA 2XY7A 4LSLA 2IGIA 4M3RA 5KFHA 4O4GA 4M3UA 3ASMA 2W42A 2CKWA 5KFAA 4O3SA 1D9FA 4DQIA 1UA0A 1X1PA 4IG3A 3WNFA 3PJXA 2W7OA 3HXMA 4IOBA 3ZT0A 2KZMA 3N6MA 3IG1A 5KFBA 1JIHA 3QEVA 1YTUA 2RKIA 4CHZA 2YKMA 1JLGA 1JX4A 1JXLA 3MEDB 5DLFA 3PW4A 5KT2A 4EBDA 3NE6A 1MMLA 1TGOA 4ZHRB 4M3XA 4B9MA 2IC3B 3HVAA 4WFYA 4R8UB 3LP2B 4DQQA 4FJHA 4IRDA 3FRZA 4JS4A 3I0SA 4K4ZA 4Z4IA 3K5OA 3D5MA 4IRKA 2E9ZA 1FKPA 3CFPA 3QGHA 5F9LA 4BACA 3CM6A 3TANA 3SQ1A 3FFIA 3UIQA 4Q5VA 4W5TA 3S9HA 1I39A 2FBYA 1SH2A 4CF1A 2IOCA 3ISND 4EBEA 1BQMA 1XHZA 2R8HA 1N48A 3OHAA 1S0OA 4HUEA 3NH2A 2XGPA 5KRSA 5L1KA 3PVXA 5F8GA 2X74A 4CJSA 3IG1B 1KLNA 3L2RA 4I7FA 4FLXA 2Y1JA 4Z0UA 3OYKA 1HMVA 3NF6A 3TI0A 5KFPA 1U48A 4C8MA 3DLKA 5CYMB 1ZBIA 1U49A 1J5OB 1UAXA 1JKHA 4KTWA 4KV8A 1RAJA 3OLBA 3K5NA 2E9TA 3H5SA 4DSJA 1LWEA 1L3VA 1C0TB 1WN7A 3OSPA 3RMDA 1WSIA 4BE2A 3M8PB 2YKNA 2ZKUA 2IM0A 3VA3A 1REVB 1VRTA 4FJLA 3CDEA 4FZYA 2IA6A 2R2SA 4RW9A 1BHLA 3QNNA 4E0DA 3I0RB 4DFPA 4CJTA 3TARA 3QYYA 1VSJA 4GC7A 3OVNA 4HTUA 2WB4A 3HVRA 1QHTA 1MU2B 4TSXA 4ECTA 4CEBA 4QCLA 1BCOA 3HJFA 3BSOA 2PY5A 3NH0A 1QTMA 1JLFB 3PR4A 4ED2A 3RR8A 4J9MA 3OS2A 3CQ8A 1SH3A 2UVVA 2C2DA 4BE1A 3DM2B 3LP0A 4K4TA 2HHXA 3JYTA 2O4GA 3NMAA 1DTQA 4DG1B 4DWIA 4KTQA 1C0MA 3S3MA 5EU7A 3NGDA 4FBUA 4IFVB 4FK2A 4FZXC 5F9NA 4DSKA 2BDPA 1JL2A 5SWMA 2HMIA 4CGGA 2IJFA 2RF2A 2BQUA 5F8MA 4H8KA 1CZBA 2Z1JA 3D28A 3OYAA 3Q8SB 4FJXA 3VQDA 3E51A 4ZTJA 4B8AB 5L1IA 1J53A 4ID5B 5HLFA 1KCFA 2BANA 3L2UA 3MEEA 2BANB 4KB0A 2V0NA 3HVTB 2IM3A 2D0BA 3L3UA 1S97A 1QAIA 1S6QA 2BRLA 3V6DB 3DLRA 3MR2A 3SV3A 4ICLB 2DFHA 3CWJA 1BI4B 1A5VA 3HM9A 2G8UA 4RUAA 1R0AA 4I2QB 3BSNA 4C8NA 4URSA 5KFJA 3ZSXA 4CJKA 2WONB 1IKYB 4H54A 2F8EX 1Z25A 4KAZA 4RG8A 2HWIA 1RT2B 4LH4A 4IFVA 3THVA 1ZBLA 1HNIB 1UOCA 3NF9A 1FKPB 3SI6A 4NYFA 1IKVA 3O4NA 4B9VA 4GVMA 4E1MA 4M94A 1S1VB 4Y3CA 4ED0A 3I5BA 1TAUA 4FXDA 5CYMA 3SQ4A 3RB4A 1RBTA 5KT5A 4CE9A 3G6XA 5CZ1A 3OJSA 3MXMA 4ZPCA 4O5BA 3VQCA 3KD1E 2RDIA 1QE1B 5KGWA 2HWHA 4XO0A 4FJIA 3DOLB 5KFYA 4FJ8A 4IFYA 4DTXA 4KHMA 1RDBA 4DQRA 4ECWA 4URQU 3C94A 3MXIA 3KMQA 2YKMB 2X78A 1RBRA 5JS1A 4I2QA 3KLVA 2DFFA 1LWEB 2QKBA 1XWLA 5HROB 3L2VA 2XI2A 2W8LA 4ZVEA 3WNEA 3T19A 1QQCA 3RWUA 3LWMA 2FVCA 3BQ1A 2YKNB 3BREA 1DTQB 4QWAA 1ZTTA 1C2PA 2OH2A 4DU1A 3HHKA 1TAQA 1S6PB 1VSIA 4GMJB 3VQSA 4NRUA 1D0EA 4IG0B 2Z1GA 3PY8A 4E7IA 3GV5B 3OYGA 2A1RA 4M3ZA 4YP3A 5K14A 2DPJA 3GYNA 4DSLA 4C8KA 5KFSA 1SUQA 3RAQA 3T3FA 1EP4A 4LQ9A 3AVCA 3KK1B 4RW6B 2HAIA 3H40A 4XPEA 1JLCA 2WK4A 3LP1B 1N6QB 4DL7A 4OKJA 3TAPA 1LWCA 5HP1B 3G86A 1LW0A 2G8VA 3B6OA 3OS1A 4Q0BB 5JS2A 4EO8A 2E6LA 3CJ4A 1NOZA 4DF4A 1JLFA 3KD5E 2W9BB 3LAKA 3VA0A 4FJ7A 1LW0B 5DLGA 1IKXB 5CY4A 3GQCA 1Z26A 4YNQA 1XR6A 1VSLA 3A2FA 3MR5A 4CHYA 4J2AA 5KT6A 4MKAA 2UVUA 2D7SA 1JLBB 1RTHB 1TKTB 3AA5X 4DQSA 4CEDA 1DLOA 4IKAA 4MK7A 3DLEA 4K8XA 3GV7B 2KTQA 4DLEA 3AO3A 3KLEA 3BR9A 3DRRB 3LDSA 3FQKA 4DTOA 3PO4A 4OL8A 1S48A 1RT4A 3C6TB 3BSCA 3M8PA 4ELTA 3TAMB 4KHSA 1JXEA 3E01B 1LWFA 4O0IA 2ASDA 2QKKA 4M95A 1Q9YA 1BCMA 2ATLA 2CJQA 3V6KA 1NJYA 3ZSRA 1SUQB 3PW0A 1EETB 4OPKA 1HYSA 4H4OA 2AQ4A 4KKOB 1RT4B 3C6TA 4Q8EA 5J2MA 4MKBA 1JLBA 1RTHA 1TKTA 5T14A 3V4IA 1TQLA 3NFAA 3TAQA 3MEDA 1KHWA 4OPJA 1EETA 1QAJA 4DF8A 3KK2A 1GX6A 4M45A 4WZMA 2HHTA 1N5YB 5J2PA 3V9SA 4LD0A 3K2PA 3KHRA 4J2EA 1RDAA 4MH8A 4QWDA 1EXQA 1N6QA 5FDLB 5KFTA 4RW8B 3AA4A 1WSFA 4KI4A 2KFNA 2B6AB 4RW6A 4RNFA 1RILA 4NLWA 5J2NB 4KHWA 1LWFB 5EDWA 3H98A 5DGAA 2XCPA 4FVMA 4ECZA 2IM1A 4FK4A 1RYSA 1B9DA 2I5JA 4CFAA 1HPZB 5KT7A 1JLQA 1S9GB 2W9AA 2QE5A 1S9EB 5DMRA 4DL2A 3DLEB 1L5UA 5KFOA 1X9WA 4PWDA 2OPRA 3HL8A 3MFIA 5HBMA 1ASWA 4OKKA 4CHQA 4KPYA 3DRPA 1TK5A 4QPXA 4FYDA 3SYZA 4DTNA 1NJWA 1T03A 3NL0A 3MR3A 1T7PA 3M8RA 4AH9A 3E01A 4XPCA 1VK0A 3O3FA 2F8TA 4EZ6A 1LWCB 3U3YA 1S4FA 1IH7A 5KFUA 3ZSVA 4FLUA 3FDSA 2XRIA 1Q9XA 2AGPA 3QZ8A 1I3AA 2G8HA 4KHYA 2IMWP 2XWYA 3DRRA 1LAVA 4N76A 3CIZA 4FLZA 4ELUA 2QK9A 1TL3B 3SUOA 5HRSA 4CJVA 5HLFB 5JUMA 1QSLA 2Y1IA 1HRHA 4IG0A 1DTTA 5KG1A 3DI6A 4N56A 3QEIA 5FRNA 1NK9A 5DG9A 4R0EA 3NGYA 1X9MA 4Z4CA 4DEZA 1S1UB 3ZSOA 4J9NA 4PQUB 1JLEA 4IRCA 5HROA 2UUWA 4B8CA 4KHRA 1IKYA 1Y97A 2C22A 3FSIA 3L3VA 4IBNA 2OPSB 3V1RA 1FKOB 3M9MB 2YHAA 4LQ3A 2HNYB 3PW5A 1J54A 4B08A 4W5RA 3RMBA 3KKRA 3AO5A 1NK8A 2D3UA 3BGRA 5E41A 3UQSA 4JV0A 5K14B 1KHVA 4J2DA 3UDLA 5KFEA 4CJ5A 4ECUA
chains in the Genus database with same CATH superfamily
2RHQB 2DR8A 4NPOA 2QV6A 2YKOA 1VQ5N 2OZMA 4M5GA 3DOKA 4ID8A 3VQ7A 1KD1O 2MKKA 3SUQA 2DKOB 3IS9A 4NCAA 2CZ4A 4WCEQ 1XMQF 4CD3A 3IRXA 2ILYA 1NM1A 3H45C 2VOPA 2UV8A 2E2OA 2WBRA 3P5JA 3CC4S 4M63A 1BE4A 4MLHA 5IOLA 5DQHA 3ZTRA 3KG0A 2C2NA 2ZD1B 2HNYA 4HYKA 3EKSA 1KSPA 1KQSR 1KLMB 4U7CA 2HW3A 4GV9A 2ZVSA 1S1WB 2E5JA 3OR1A 4NXNF 2HBQB 4IKFA 3VN5A 4WTYA 1M1GA 4NLPA 2D0PA 2V9WA 5GMKa 3K59A 2LDIA 3GFZA 3O8MA 1Q8KA 4JYAF 3DMJA 4AHVA 2AX0A 2HLUA 3M6VA 1A5XA 5J2NA 2ZDPA 3OBYA 4DR5F 1CZAN 2XZDB 1FESA 2HGMA 2MY8A 5B08A 3F2KA 4K4SA 5FPNA 2B0GA 3U27A 3RRHA 5C7PA 2MKYA 3FCWA 4DUYJ 3THYB 5KFKA 4KR0B 3QBCA 4ZHRA 3D6FB 2BH1A 3QEWA 4LIRA 3MEGB 1NM2A 2CDQA 4ZCIA 4WXOA 5EY4A 4CK1A 1WOQA 3E1YA 2PFFB 3D2WA 4TQSA 2MXYA 1N5SA 2VKZG 3QAUA 4URGA 4P6QA 3V1QA 2F9TA 1NU4A 2B4OA 4L76A 4N5SA 3VGMA 1Z6RA 5CHIA 1J5EK 3TTFA 4TXSA 4NYNA 3VAHA 2BJ1A 4KC5A 4DR4J 5AQRA 4E7LA 1J5OA 3QIPB 3OBIA 4V19S 1BWVA 3T1HJ 3QEPA 4NA3A 1S1TA 4CW7B 3RYLA 3OJUA 2HBJA 2V52B 2BV3A 3UKRB 2H5IB 4ED8A 5AQUA 2R7TA 2DGTA 2JHEA 2RE1A 4CEAA 5KG7A 5BYQA 3EPIA 2HQFA 1HBNB 3AVGA 3CXCR 3C6UA 3EDQB 3I5CA 3PO5A 4C0OC 5F8IA 1LV5A 3H46O 4M5JA 1REVA 1VRTB 1EB0A 4IO9Q 2H1YA 2IY5B 2IRXA 4ERDA 4LF4J 2V2KA 3FLCO 4WBFA 2NXJA 1ZM2A 3FCHA 3G8TA 1HNVA 2DIVA 1JNRB 3ZT4A 4Z7CA 2DGQA 2MKIA 3FZLA 3TWZA 1Z05A 2GTDA 4W5QA 2IC3A 1VSDA 3T7ZA 2I0XA 1IN0A 4BRQA 5CQGA 2V4RA 3IGVA 1F2GA 3TA2A 2FC0A 3H08A 1RDUA 2O8EA 4F3MA 3HHLD 2LQBA 3FKBA 4ES1A 2GWJA 4JI4F 2C3OA 4IR9A 3L2WA 1S57A 5EVZA 1WUAA 1Y10A 1HYZA 1H0HB 4CI0B 4BREA 2F4VF 1DQAA 4ZJOA 3HPGA 1FDAA 2IDEA 4K4YA 4DSFA 3H8YA 3IFRA 3CMEN 4KH0B 4NX9A 2FLPA 1TU0B 3HHLC 3UN2A 2W9CA 5KFGA 2ZH6A 5JLHA 1DEJA 3Q7CA 4YY3J 4DUZJ 1T9YA 2QSWA 3ENAA 2KG1A 2CQCA 3R7BB 4O44B 3L2QA 3DDIA 2HRYA 5GAEI 2LFVA 3SSRA 2L48A 3NH1A 2BMBA 1CQMA 3LF0A 1HR0K 1HNWK 3OLAA 2FLLA 3JAMU 2VBZA 2F9DA 4PYDA 2GVDB 2YNGA 3BR8A 1I94F 2GV9A 4JLHA 4CJEA 3PZPA 1RKIA 3EPGA 3SNNA 2HHHJ 2WVEA 4DU7A 5J1EB 3MEEB 1N33J 1ZAVA 3MUTP 5HMYA 4AQYK 2RILA 2Z56B 3IO1A 4GKJK 3V6HA 1JLAA 4C1NK 3AXMA 4CJFA 3BYRA 2V8VA 4HR2A 3SBTA 3M05A 2FXUA 3SMZA 3UB5A 5KFZA 2OGUA 1M1HA 2RVJA 2FVQA 4ZVFA 5E3AA 3QLHB 2QLFB 1IBCB 2CPFA 1QSYA 3KUGA 1S22A 4ECRA 5D77A 3L4BC 4YOXA 1XR5A 4GKJF 5M1KA 3ULEA 2VFUA 1FXLA 4M5LA 3PX4A 4J91A 2EKNA 2GIRA 5LJ3Y 3C66A 2E1ZA 1AUSL 5K5MA 1HYVA 2NCKL 3W66A 1YLXA 2ASYA 3SBGA 4MIBA 4EYHB 2MZSA 3QERA 3EEQA 4ZTFA 4G1QB 2UP1A 3QIPA 4E1NA 2MGZB 4E19A 5LMNK 2HRTA 2WBMA 1SS6A 1HNZK 2H5JB 5EX0A 3BQ2A 1VSFA 3T1YK 1U1RA 3FC9A 2MLYA 1MROB 2DHSA 2CZ9A 4C4WA 3FBFA 2DNQA 2PI4A 2VG5A 1FRLA 4CYUB 2P6SA 3A8KA 2AGQA 2AYMA 1KXPA 2P9IB 4ZVRB 4CM2A 1ITGA 2FVRA 4PG7A 2GUPA 2NRRA 1ZM3A 1HBUA 4ANCA 2GJFA 5B0GA 3OFFA 2VFTA 2KT3A 4DL3A 1U2VA 4DX6A 1IKVB 4CFDA 3VQPA 1DAXA 1QUVA 3IM9A 3MN5A 3GMGA 3WNHA 2QW9A 1X5SA 4FW1A 4AQYJ 4Q8FA 1WTBA 3D9BA 4WIQA 1NWKA 2X1AA 1NXIA 4CJ4A 1CJTB 1KC8T 3JTPA 2ERRA 1NGGA 1QVFM 3CCZA 2I7NA 3LANA 4ECXA 3LQVA 4O5FA 3KK7A 3JYTB 5E3CA 4I2PA 4CF0A 2PZSA 4LF5F 4C3MA 3AOCA 4LC9B 3CCQS 3VALA 3DRSB 3GONA 3L3CA 3O9TA 2R7SA 3NGZA 2HQ3A 3E9LA 3O80A 5KQ8A 3IP0A 2R7WA 4NCGA 2DH8A 3NBPB 3RTVA 3T69A 4WFZA 2DGUA 5D0HA 2O8BA 4FF2A 5EHHA 2VU5A 5GAHU 2B9WA 3NCQA 5BREA 5M1FA 1RT2A 1V5VA 5HN0A 1DZ5A 1UFWA 3RBXA 2WW8A 3BGRB 1JNZB 3DCAA 1HBOB 2XLJA 2ASLA 4JV5J 2DR6A 2NRXA 3ZSZA 2C1EB 4OX8A 4A61A 4KGVB 1FHTA 4JRQA 1YXQA 3CCES 3N6LA 4N47A 1T03B 3C6HA 4FZZA 1FNOA 2ROEA 4FM1A 3HFKA 3CM5A 2HWTA 1Z2ZA 2XGQA 3OUYB 1VSEA 3ZZ0A 1UFKA 4RCHA 1SJ1A 3MAHA 1V6HA 3ZTOA 2O8FA 4BY9C 4RWWA 4PYAA 1KVCA 4TU9A 3J7Z5 2OPPB 2QFJA 5D0GA 5LJWA 3LOUA 4JYAK 3PIPQ 4RW4B 5KFNA 4WFBQ 4HHUA 3CHWA 4ZLNA 5FRMA 4DTUA 3OVAA 2G8FA 3PUFA 1ACMB 1HPZA 3NNHA 4OJHA 3R1HA 4J8FA 2BM0A 5FPEA 4X4RA 4Y0FA 3NNAA 4ZIVA 3T5HA 1GH8A 3K5MA 4PUOA 4TQRA 4QYRA 1WF2A 1W0HA 1RT5A 1YJVA 4W90B 4Z4HA 1TV6A 3ZT1A 1RA7A 4DTSA 5LOQA 2O8EB 2IJRA 2E4LA 5CABA 2IBKA 1NDCA 4CH1A 5FROA 3VQBA 1UEUA 2R8JA 2V68A 4R79A 1RHRB 2ROPA 3BGFA 4LSZB 5HSPA 3HZGA 3WIVA 4CHNA 2VG6B 1O8BA 1UZDA 3T41A 4FLWA 3UI3A 1IBLK 4FPIA 4FM2A 4OPAA 5IS2A 3CCRS 3NGKA 2IAJA 4DLGA 3H7HB 3VF6A 4KTZA 2MB0B 5KFVA 2EFPA 3ENBA 2V34A 2Y1RI 1GOCA 2YNFA 4ZK7M 3HD1A 1CLFA 1K73O 2XSFA 1KWMA 3DRYA 3PHEA 4ETZA 3QNOA 2FBVA 4JKGB 3CG7A 1KN6A 2WSFC 4L75A 1SIWB 5LMNJ 4B3TK 3RRGA 3VQ9A 3ZZYA 2AJ4A 2XULA 3LPTA 4NEZA 1U1NA 3SV4A 3GSIA 1XQSC 2YJEA 3FSYA 2PYLA 4UT4A 4FWKA 2LXIA 1UP1A 1CZ9A 1R8CA 5JVHL 2QLWA 3ITHA 5L38A 5I3UB 2QL5B 4CBXA 3IBFB 5SUHA 1WOSA 1OSCA 4JB8B 4DV5K 4CGHA 2ZZTA 3HI0A 2MZJA 1X4BA 1RTDA 3D0IE 1CULB 3OQ2A 4AM6A 2WW4A 2EFOA 1PSDA 4ZOSA 1TL5A 1M0SA 3GV8B 2HURA 2OYQA 2Q3SA 4CJ3A 4EU0A 2RQMA 2YH1A 5BR8F 2XYPB 4OHVA 2QRRA 2QI2A 2L9DA 3BF4A 1VHFA 2H65B 2SXLA 2DYAA 2MKJA 2KYZA 4WE1B 2VA3A 5D3GA 2EPIA 3F56A 1IV0A 4IFYB 5E3PA 1QDUB 4NLQA 4O3PA 1W9HA 1I1GA 2XHBA 2EX3A 1HBNA 2HQGA 2L3MA 3Q8RB 2O8BB 2YX1A 1NNDA 4JUZA 2HFZA 2XCAA 4ES2A 1HBMA 1IBLF 3EZWA 4B9LA 3R27A 3KJVA 5CCMA 2Z1IA 4LR9A 3KK3B 1FTCA 1OH6A 1ZBFA 1I3OB 2AIRB 2B51A 1S72N 3KLFB 3ONQA 3MCSA 2WOMB 2HNZB 2JZ5A 3LWLA 5LSOA 1S0VA 3GG1A 3H4BA 4TNOA 1RHQB 4CGJA 2NRHA 3UNYA 1NGEA 2WONA 1KLMA 2BOAA 2ZH1A 1S1XB 4NLYA 5F41A 4LFBF 3TUPA 3DLHA 3EE8A 2OPPA 3VOVA 3B4MA 3JS6A 3KFWX 1QAXA 1RJJA 5EX3A 5DK5A 1FERA 4PY5A 1P6TA 2KM8B 4QOZB 1RTJA 1C6VA 5LSLA 1OVQA 4ZVOB 2VQFK 3QFWA 1XMQK 1S1WA 1TUVA 4FWNA 2G8KA 3H1QA 1YJ9S 2DNGA 2GQQA 2OPQB 1Y7PA 1TYQA 4HHJA 5HATA 3FEXB 3TOQA 1K0TA 3ZXWA 3ZZTA 4Y0WA 2OLWA 3PHTA 1R8BA 2EG1A 1JLEB 2J9CA 4BDPA 1KTVA 4U6PA 1JLCB 3T1HF 1AUDA 3TUJC 2RB7A 2V69A 2FZKB 4OHZA 3NBPA 1D9DA 1LOUA 4BDZA 2WVFA 5TKYA 5LSRA 2JFKA 1WC6A 2D0CA 2ZWHA 1B7YB 3PCOB 1IBLJ 3EM1A 2AJ2A 1FJCA 5C15A 1V4SA 1HA1A 1X5OA 3CCVS 3MM6B 2Q2RA 4I9QA 2EC0A 4CEFA 3MM5A 3ADAC 5KG2A 2GVZA 2GHPA 4UQGA 2XEXA 4DU4A 2ZGYA 2AHOB 4DR2K 1RDRA 4A8MP 2HEKA 4JI4K 3LGNA 4WJBA 2FHJD 2L9NA 5B7WA 2D0OA 1K9MO 1B64A 2V7YA 1PYOB 4OLBA 1RT7B 2B8QA 1WLJA 2OUGA 2VPZB 4Y2MA 3H42A 3GE9A 2ZITA 4ES3A 1U6FA 5A2QO 4IXCA 3PYGA 2HHUA 4BGAA 3EX7B 3D3CJ 3J7A1 4N41A 4PCQA 4F2RA 3VQ4A 1W25A 4PABA 4DV1F 3ZSYA 3H20A 1UETA 2QLBB 2PN6A 3RMCA 4FVUA 2ZH9A 3THWB 2VFVA 4MK9A 2OANA 3EE9A 4IYQA 3FGUA 1TYQB 1UWBB 3WXKA 2GW8A 3EVMA 1R89A 4DTPA 2IHR1 1UTAA 3O4WA 2N82B 4IG3B 1QD1A 4MYTA 5JVGQ 2D0AA 1FDBA 3BBFA 3FUYA 3MCMA 2LCWA 5AQVA 4OZ2A 1P90A 1JXBA 2J8SA 4KT0C 2KRBA 3OL9A 1NSKL 3RB0A 3CCLN 1KFDA 2FD2A 4DR6F 4E7HA 1B9FA 1BA1A 3QGGA 1P1TA 1SL1A 3G82A 1LW2B 3U02A 1VQPN 4OV1A 2H4WB 2EW9A 4HACB 2E29A 4YHHF 4ELVA 4U8VA 1Y00A 1WUUA 4DSEA 4H03B 4X64K 3SJHA 4IDKA 3TAMA 3V9WA 2YWKA 5HQLA 1YIJN 3JSYA 1EX4A 5IT4A 4KHNA 1QVGR 3OHBA 1TKDA 1MWMA 3KMSA 3KLGB 3SK3A 3A3NB 3FZHA 2P1JA 2HMIB 4UZCA 3JS9A 4KKOA 1NK0A 2E1RA 3C16A 3AVNA 5KFQA 3CPEA 3HSTB 4ID1A 1XC9A 1RT5B 4ZP6A 3PYFA 2Q43A 2VPYB 4NRTA 4OI3A 5JJBA 2G2OA 3QNWB 3S7RA 4GRSA 1SJ4P 4EEYA 2UXDF 5A6PA 4CBWA 4Z94A 1BIUA 5ETLA 3G9CA 2ZWPA 2C2RA 1B99A 1QLNA 4CLUA 3MECB 2XBPA 1KOOA 4J9SA 3C7NB 3GCXP 3THPA 1IBMF 2AWZA 3DGPB 2L08A 1LK7A 1RTZA 2LEBA 2ITMA 2UUBJ 4NB4A 1D8YA 1HI8A 2CG8A 4RBVA 3TA1A 3EGWB 3D66A 1PC5A 4KGZB 4A2BA 4E7JA 2XY7A 2IGIA 2VYPA 7AT1B 4P2MA 2ROGA 4O4GA 4TKTA 1EWQA 2CJAA 2CKWA 4O3SA 2UV8G 2W42A 1V3RA 1D9FA 4JKDA 1W2BR 1X1PA 4AYBD 4IG3A 2W2NP 3SDEB 3UDCA 3IG1A 4LVOP 3WQUA 3QRQA 4BRMA 1MWYA 2GO9A 4OYXA 2NR0A 1D3WA 3POTB 2XMTA 4YORA 2Y3YA 3MEDB 3PW4A 1XNQJ 4JKEA 1U0SA 1TGOA 4QU6A 2LU2A 2OEJA 3HVAA 1DBDA 4GO7X 2UXBK 1VISA 4IRDA 2QLJB 4GVBA 3FRZA 4B02A 4K4ZA 1X3MA 4DV2F 3CD6S 1K8AO 2VBYA 2V2ZA 3T6JA 2IVPA 3TANA 2OO4A 4PEOA 4Q5VA 5A8KB 1S4EA 4YB1P 1SI9A 4UOHA 5AXKA 5B0FA 4EBEA 5K8NA 1S0OA 4HUEA 5KRSA 2ZFHA 1M5VC 4FYWB 2X74A 1KLNA 1CC7A 1F9HA 1U7LA 5F0WA 2QWPA 1HMVA 2PFDA 3OYKA 2VKRA 3TI0A 4H0TB 4C8MA 1FEHA 3KWGA 1U49A 1J5OB 3TPQA 2XM3A 4KV8A 5H1SV 4DHYA 2ZGZA 2P9EA 3CTRA 3TX0A 1FF2A 1IWAA 3OSPA 3AAPA 5HAOA 1YI2N 1WSIA 4DV1K 2ZNZA 3M8PB 2KXNB 4PL7A 4BLGA 2IM0A 2ASPA 3VA3A 2KM8C 4FJLA 3CDEA 4FZYA 4M7YA 4Q2LA 5D0EA 1BHLA 3BDEA 1LFWA 4M7XA 2W6KA 1R8PA 1ELOA 1MU2B 2B4VA 2APOA 4PZVA 1S6UA 2B7BB 4BRGA 3HJFA 2RH3A 4A8KA 2JL9A 3MM6A 4K5SA 2F4VK 3NH0A 4ZCMA 3J81U 1JLFB 3NVMA 4ED2A 1W97L 4CRJA 3CQ8A 1WDDA 2H4YB 5FLXO 2UVVA 4K4TA 2HHXA 3D7SB 2O4GA 4DWIA 1XMBA 2JX2A 3ZTPA 3ATVA 4FK2A 4ZN3A 2BDPA 4BC2A 1UVKA 4X64J 2NREA 1RWUA 2FJDB 4BRIA 4CGGA 2RF2A 2AT1B 5F8MA 4AFFA 4N8OA 2Z1JA 2DTJA 1YJUA 3OYAA 1BOTO 4D3HA 4BGBA 1YAGA 3FEYB 3TTDA 3U8XA 4LF8J 3MEEA 2IM3A 2D0BA 1S97A 2BRLA 4A5BA 2X7IA 3DLRA 4ICLB 4LVNP 1B7FA 5FD1A 1YITS 2UUAK 4A46A 1BI4B 4RUAA 1R0AA 2WVCA 2WONB 3HDSA 1Z25A 3NWGA 5FJ4A 4LMZA 4KAZA 1YQHA 1H73A 4AQYF 2BKPA 2HWIA 3W65A 1RACB 1F60B 4UOFA 1ZBLA 5AZIB 2VOOA 3NF9A 4FL9A 4NYFA 3AHPA 4OYBA 4JNEA 4B9VA 4GVMA 1HWIA 2BTFA 3WUHA 4YDUA 1EHWA 4R25A 1RBTA 3I8BA 3WC2A 4ZPCA 3VQCA 4AE5A 4AL5A 5G0RB 4CTAB 2XNQA 4W98A 3K8VA 1VQYA 2CNLB 1SC3B 1BC6A 3SIPB 1NH8A 3IUCA 4AUKA 1RDBA 4WPAA 4ECWA 4NYOA 1KVKA 4WKYA 2WAQD 4V1Ak 4I2QA 1XWLA 1JJ4A 2F3JA 2ZHOA 2C2ZB 3C0BA 1P1LA 1QQCA 3BREA 1C2PA 2V6AA 3U7JA 1U1KA 2WFBA 1VBXA 2KLAA 3HHKA 1TAQA 1S6PB 1ZOTA 5U47A 3G4SS 3VQSA 2ZHAA 1RZMA 2FUG9 4NRUA 4ALZA 4JI7F 3I55S 2MLXA 2DGVA 3GV5B 1KAYA 4V19J 2A1RA 3CCMS 4BRCA 1PAEX 5ETRA 2V9KA 1K44A 3TU5A 4G1IA 4OZ0A 3RAQA 3T3FA 5AZJB 2PGCA 4S0MA 2NUHA 3SSQA 4RW6B 2HAIA 1N6QB 3VAMA 5HP1B 1LW0A 2KU7A 3M5RA 1X4CA 3HHEA 4KH6A 1NOZA 1GMWA 4ZVPB 1V4TA 3CJ8A 5KOXA 4G6VB 3LAKA 3VA0A 1QM9A 3FZFA 3PSFA 1N8RO 3GJRB 1YJ9N 2BUNA 5B0CA 3A2FA 3MR5A 1MWQA 4MKAA 3UN5A 1RTHB 2OTJS 1CS4A 3A0IX 1X9JA 4OI6A 4IKAA 4MK7A 2V5HG 3GV7B 4DLEA 3FMWA 3HMJG 3FQKA 3Q23A 3PO4A 1NUEA 2QMXA 4O23A 2ASMA 3M8PA 1GLAG 1F5BA 1JXEA 1TFYA 3TJAA 2ZUAA 4Y00A 2F9WA 4M95A 3UVJB 1SB6A 1M5PC 2CNNB 2D1KA 3MAAA 2ATLA 4BRPA 4EFHA 1T11A 4ETXA 4ZN1A 3V6KA 1AZSB 3ZSRA 3ID6A 1SUQB 3PW0A 4DR7F 3PXGa 2RQKA 4EWTA 1E4FT 1TKTA 1NZAA 3V4IA 2GQCA 1HNZF 2MMYA 5IWAJ 1EETA 1CPZA 4IO1A 2UXCK 2UXBJ 2W24A 3CMAS 2FDNA 2QA2A 2YWEA 3ULEB 4TU8A 4LD0A 4KBOA 3K2PA 3KHRA 3HZEA 1RDAA 4ILJA 1VQON 1JJ2R 3P45B 1EXQA 4H5RA 1WSFA 4RW6A 3TQEA 5J2NB 3H98A 4FVMA 3JQMA 2I5JA 5KT7A 4B1VA 1S9GB 2W9AA 3D2FA 3M2UB 2QE5A 5DMRA 3DLEB 2EEYA 1L5UA 3SMSA 1HI0P 1X9WA 3PLAA 3MFIA 1W7AA 2ZVIA 3MGJA 4CHQA 2QGFB 3DRPA 4QPXA 1NJWA 1T03A 1UJ5A 1TMJA 1OH7A 3G25A 4XPCA 3P6YC 1VK0A 1AT1B 4U7BA 4LF2A 3HOTA 2H54B 5JICA 1IH7A 4I1TA 3ZSVA 3EUNA 4OHYA 2AGPA 4USUA 3BB5A 3UNGC 1BO5O 3M7VA 3UE2A 1CS4B 2V4JB 2XWYA 3DRRA 3LH2S 2QK9A 4G1PA 1T3VA 1HI1A 3LA0A 2KH9A 3FRYA 3NGYA 2QSFA 4Z4CA 1NGHA 4E1JA 2UUWA 3VAFA 4B8CA 2AEJA 4KHRA 1SBRA 3L3VA 3FSIA 3L0QA 4EGLA 4C9DA 3M9MB 2JNJA 2DNNA 3PW5A 4OI1A 1SJQA 1VBKA 4MO4A 4DR2J 3BGRA 1VMBA 2XYHB 2XB2D 1G99A 2CJYB 3BF1A 3C14B 2V63A 4YY3K 5KFEA 4CJ5A 2QEXN 1FJEB 5F1XA 1RAIB 3BH7B 1VQ6N 5LJ5Y 1SCJB 3BYPA 1N56A 4DQPA 3AVAA 1N34F 2PC6A 2POKA 2QLXA 3CJBA 3BO3A 3AVBA 4MKVA 1CJKB 1N32F 4JI2K 4IR1A 1T9UA 3G0ZA 3PKMA 2E9RX 4LF6K 2R2TA 1WBDA 2XY8A 2NLWA 3T1YJ 5KQDA 2HNDA 3B8AX 2P9PB 3NOGA 4NO7A 4ISEA 3TSQA 1NJXA 4LF9J 3CCWA 2E2NA 1PO6A 5DRKA 2N4CA 5ETOA 3SZ2A 1H7XA 2A41A 1VSKA 1GXLA 3IAS9 3EVWA 2W40A 2QJ3A 3S8SA 1RGIA 2QTWA 3J8AA 2OP5A 1RFQA 4C1NI 2GA7A 3R8EA 1N88A 2KVQE 1LOTB 4CZHA 4FOEA 3UCUP 5A8KA 2DHAA 3HHNB 3KIOA 4NLBA 3CO9A 2A6MA 1VS3A 4TY8B 4DPOA 4RW4A 2IVOA 2J9DA 2IDOA 4FWMA 1AZSA 3NDKA 3M1FA 4JKHA 1GXTA 3TR8A 1ZA1B 9RUBA 1MROA 3ZC4A 3OTOK 5KT4A 2DCUB 1MN7A 4FYXB 2RDJA 3H3NO 2YQ1A 5C12A 3HVTA 2AU0A 2E1PA 2DNLA 3M2RA 3SLCA 4NMLA 2ITGA 3CPWM 5KFDA 3M9OB 2KQ2A 3P31A 3M9NB 3UW1A 2XNRA 4YB6A 2UUAF 1D1UA 5LL6d 4JAXA 3DGPA 3V81A 1S12A 2XYGB 5CZ2A 3CE8A 5J2QB 2NSBA 1IBKK 1D5AA 4BWMA 1MWZA 1FI4A 3ALYA 2HZAA 1C0UB 1SC4B 2VH7A 5I3UA 1T6DA 1JKHB 3AA2A 2HQCA 5DO2A 4KFBB 3LP2A 2O5DA 3HYFA 3KJQB 2JJ4D 2K3KA 3O3HA 3OYJA 2NQPA 4YFUA 3AVFA 2M52A 3EXYA 3CJQA 1C1AA 4JI2F 2G1HA 1QTNB 3IN5A 1C0GA 5HRNA 3RB3A 2B6AA 3OL6A 2OHDA 2FYXA 4KBIA 2QA4S 1PYTA 3HKZD 2RRNA 2FJVA 4DCJB 2OTLS 5EUHA 3Q2TC 2XS2A 4HUFA 4LUBA 3KYLA 2Z1HA 2EG2A 4R5PB 3R5DA 3JSMA 2J7WA 1RU1A 2FJXA 1HWUA 4USKA 1S0MA 1XNQK 5HBMB 4FW2A 4DPXA 5KG3A 4DN0A 4RJVA 4ATNA 4LFBJ 2OZSA 2VIHA 1XIQA 4OYMA 3O5TB 3MCOA 4ZP7A 1ATSA 2V50A 4TU7A 4Q45A 3VENA 3AVLA 2N7CA 1IKXA 1Q53A 1RWNB 2L9WA 4ZA1A 2NXCA 4DR3F 3EXCX 3DJCA 1Q86T 1XR7A 1YWXA 3F41A 3BGLA 3V81B 4JN4A 3V9ZA 4PPDA 4X4OA 4B3MJ 2ZH5A 3OTOF 4J9KA 2YBVA 3W9HA 4HDHA 5B8HA 3KK1A 4USTA 3LTOA 1R8AA 3R3TA 3CYMA 2VC1A 2XZTB 2IRUA 4CFBA 4RUBA 1NJIT 2ZKTA 2ALZA 2OIHA 3SPZA 4JI2J 2RDDA 2F8HA 4IOAL 3NF8A 4FWPA 2N7YA 1HNIA 2I8EA 5J2QA 3BQ0A 5HP1A 2XMJA 3K58A 3KOAA 1VDHA 4EK2A 1X4HA 1EQYA 1X5PA 1EQ0A 1MA9B 2MQLA 3RJMB 4CHOA 4CJLA 2XO6A 3JAMY 1IBKF 3D45A 2WVDA 1DFDA 3AA8A 1YITN 2DNZA 4RZRA 4GY2B 3CJAA 2ZJQL 2QO3A 1ZAXA 5JLFA 3MXJA 2DFEA 5ADXA 3KHHA 3GJTB 3K5LA 4KO0B 4CFCA 1MN9A 3D54A 1WG5A 4CO0A 2IPOB 3T9ZA 4CERA 2P51A 3NAIA 4JEPA 4DV6J 4DV7F 1L3SA 2IJNA 2FJAB 1QVGM 2ZH8A 3DOMA 4ED1A 1RYRA 2EHGA 4U67Q 2YNFB 1X4DA 2O67A 2CQDA 2A2CA 2P9PA 3ID8A 2MQNA 3RSEB 3PEHA 1RAAB 4KIAA 2DRBA 5M1OA 2FZGB 3S01A 1OYDA 5C2FA 4G65A 4B3TJ 2VF3A 1BI4A 3TWHA 3CB4A 4GC6A 4HWIA 3DHWC 3N28A 4IH6A 4F36A 2Q66A 3QMQA 4DR1F 4I9LA 4B3OA 3DOKB 1NKEA 4YR3A 2PSZA 3AY0A 1C0UA 2D74B 3KHLA 4KREA 1G15A 3VQ8A 3CCLS 4LF6J 3HKWA 1RT7A 4IWVA 3O3GA 2OFHX 5THWA 4BE0A 1X3NA 3EO3A 2YY3A 1HQEA 5DGBA 4RBUA 2C3PA 4LRFA 4JI7K 1I94J 1DT9A 4OLPA 1WSJA 4DR1K 3V9UA 2X6NA 4O55A 3IRXB 2WVBA 1CXQA 5EWFA 4QJVA 2K06A 4F4KA 3C46A 2VONA 2VFSA 1WC4A 3O3LA 3W5XA 2BE2A 1KONA 3PEJA 1N36K 4DQ8A 2DEIA 3M8ZA 4EBCA 3VVTA 3CO0P 1RAFB 5HMZA 5CE3A 3JTOA 4BR2A 1Q1KA 4QYZJ 4DV6K 4RW8A 4HUGA 4A8WA 3VAKA 1ZC6A 4PXEA 3CJCA 3ZZPA 4J9QA 3PJWA 4OLOA 3BZKA 1U47A 2CJXB 1WSEA 4WQ5C 4M41A 4Z4GA 2LP4A 2P9KB 3U1NA 1UJ6A 1N5QA 2NZTA 1Q7YT 1S5JA 1N54B 2LMIA 3KK3A 1TP7A 3AARA 3SAGA 3SFGA 4ZLPA 2QWLA 1U0HB 1Q5YA 1TVRA 3VF2A 1O6XA 4A48A 5IT9U 2DR9A 1FJ7A 3DLBA 3EGZA 3F9KA 2QL7B 4CEQA 3PV8A 2JRSA 4LBHA 1X60A 4OZ5A 1FW6A 1Y11A 1C1CA 3EWGA 2EWHA 1H72C 3ELHA 1PAUB 2AJ1A 2YX7A 1Q8IA 3IGNA 4PG6A 1DRZA 3D1OA 1FE4A 3I0SB 3MEGA 1C1BB 3EZUA 3QBXA 2VQFJ 2VPXB 1VQNS 3GIIA 1SAZA 4NLUA 3GE1A 2YI1A 1AXQA 5E3RA 1BQMB 4K4WA 1LEOA 3PIOQ 1HNXF 1OWXA 1VJWA 8ATCB 5EOYA 1W2IA 3EZ5A 3LPUA 2YX6A 4FNIA 5KPTA 3DLLQ 1Q5VA 4P9SA 4B1ZA 2YKQA 2KFYA 1C0TA 4NZ7A 1QQNA 1VC0A 1RT1A 3NAEA 2XI3A 4NA1A 2QIFA 1ZBUA 3ZCMA 4CBUA 1F0XA 4LIWA 5D4OA 2Q1LA 4DR4F 5MAOA 5C25A 3ICLA 4I6WA 3BN4A 4FPBA 2YPZA 4F4WA 4LT6A 2QWQA 1J6ZA 3SI8A 1UA1A 3B4DA 2VG7B 1MW7A 1VQ8S 3CF5Q 2LSNA 2G0IA 1Z1ZA 3P96A 5F2RA 4EYIB 3QIOA 1GLEG 4QBUA 5LXYA 4ZVUB 4UZBA 3QGIA 2OMLA 5IXUA 5KFFA 1N0VC 3Q83A 5KFIA 3HD2A 4H5WA 4P2XA 5ADXH 4DR7J 4OMFG 1KQKA 3N5FA 2ABYA 5AQFA 3C6AA 3CFRA 5HANA 2ZBQA 4X4SA 2V8GA 4JD2A 5GINA 4BVOA 1YI2S 3DXMB 3AGKA 1NDPA 2NYIA 1BQNB 1B0TA 4QIVA 2VQEJ 2ZJRQ 1N5YA 1HFEL 5D0RA 4QZVB 2FY8A 1ILYA 3G96A 1LWXA 1NGIA 4EFAC 2MQPA 4RL1A 4CLTA 2HIYA 4JYAJ 1HNWF 2KHDA 2OEMA 1MNEA 3WQPA 1YHQN 1OQ3A 2CPHA 1WACA 5CH7B 3X1LB 4ISFA 1NK7A 2HBMA 5JVHQ 4PA1A 1RWMB 4JOUA 2A6AA 4GW6A 3KXDA 1VFJA 1FK9B 3LPYA 3TAFA 2B5JB 3SJJA 4ICLA 3I96A 2HQIA 1UVIA 5IC4B 3EL2A 1OY6A 4HHHA 5AXLA 3GIJA 4UTGA 1R59O 5BN9A 3OW2M 4CHPA 5AQJA 1HNXK 1BL3A 4J9OA 3QETA 3RAMA 3ISNC 2DBBA 5A8RB 3GIKA 2VWKA 1SQFA 5A6WA 1JXVA 3NVKA 2W9BA 2YHBA 3K7RA 3O6WA 1WAJA 4LSLB 2D3ZA 3TAEA 3BKFA 3MWBA 1YZ6A 1RLDA 2UUCJ 2LKZA 3OPKA 4LFAF 3PIOL 1LK5A 1SL2A 1P9YA 4EMDA 3A5LC 2HFSA 4Y2KA 1RWKB 1IO2A 2V8PA 2ZM6F 3E9OA 1SH0A 4K0KJ 3M2RB 4JI3F 4RUHA 2BQRA 2WHOA 2BW2A 3JAMO 2KB2A 3TZWA 3X3UA 2HYIB 3CD7A 3TQ1A 1X9SA 1U24A 4F4YA 4FS1A 3FGVA 1O5JA 3OXLA 1S6PA 3RRKA 1W26A 2PYJA 4OI0A 3W61A 4MLEA 3R2DJ 1Y3JA 4CESA 3MCPA 4FLTA 2AZ3A 3QZ7A 1Y5NB 3R8YA 3QFPA 4DCPB 3P5TL 2LEAA 1YSJA 3TVZA 3BZCA 5C42B 1RWXB 3UO0A 2DNMA 5K8MA 1SKUB 1ZTWA 3V6JA 4FJ9A 1WHXA 4IEEA 2KW4A 3THYA 5M2UA 3BF3A 2Z58B 4ZJQA 3JXOA 3K9JA 4NLOA 3W9JA 3PKYA 4OJ3A 3VGLA 2PMZD 4H4KC 4JI0K 4LF6F 1S5ZA 1RNHA 4BVPA 3GFYA 3MTJA 3W60A 3AO1A 3RR7A 1RAOA 2CA9A 3OFEA 2LDYA 3D1QA 1WD6A 3MR6A 1BGXT 2K1RB 3FQLA 5KG6A 4JBCA 1KS2A 2PFUA 3W5YA 1RBOB 3D4JA 1IQTA 3DMJB 1RDCA 4O8KA 3WXMB 4OX7A 5HRPA 3CCEN 4F0MA 4FYVB 1RISA 2GGPA 2D9PA 5AQGA 4DS4A 1FRIA 3QEXA 2HPUA 1EJ7L 3L09A 4K0KK 2YV0X 2BW7A 2XG8A 4HTIA 4U96A 5KTQA 3MM9B 4LSNB 3W64A 1U4BA 1FA0A 1LNQA 4P75A 4ANDA 2NNWA 4FZVA 3DLLL 5E84A 1VQ9N 3G6YA 4Z4EA 2HBYB 3B8HA 1A0OB 1BIZA 1M5HA 4F7VA 2WSEC 3CCUS 2E1YA 1EWRA 5A2QU 3Q24A 3IDHA 5AE2A 3T5LA 4UF4A 5L1LA 3CJRA 2IYGA 2JC0A 4ILMA 5AE3A 5KFXA 4KJIA 1HQUA 3UKUA 4XDDA 5AT1B 3BKTA 1BG3A 1S9EA 4I6MB 2CVIA 2ZBCA 4RTFD 4HKQA 3QBWA 3SCJE 4FNHA 4PWDB 1N4LA 3MPUB 2P9IA 4GVLA 4DUZF 3EY1A 4EP5A 3M1VA 3GR0A 3TZZA 1HQEB 2FJWA 3CFOA 3TRGA 3QLHA 4GKKF 1K6YA 3T1AA 2KKHA 2GHVC 4AHSA 3P3DA 1H7WA 1HARA 5D3GB 3R5BA 3I56N 2CNKB 4W92B 4WP9A 2DNYA 2NRVA 4CTAA 2BGGA 4KGXB 2YHYA 2DGSA 2WCXA 3A8JA 3DDKA 1R6VA 1IG9A 4BHQA 2BE2B 3J7AN 4EHUA 2ZQBA 4XH5A 5F0UA 2W9CB 1EO1A 1RAGB 2ZOGA 1RDWX 4YR0A 1OH8A 1QJHA 4NLVA 2UVRA 1FVSA 2VG5B 3QESA 4I4BA 2BABA 5CZVA 1VQKS 3Q86A 3B6BA 4HCCA 2IBOA 4U8YA 4ZPAA 4YOVA 2JLFA 1TV6B 1IM6A 3AJDA 4ECYA 2K8GA 2ZM6J 3CPWR 4KV8B 1RT3A 2YWGA 3VF0B 4B9QA 3CVKA 3HVWA 4DTRA 4NZ6A 4F4XA 3WEEB 4G1QA 1VYAA 2DH7A 5D4LA 1VHIA 4B3MF 4Y1CA 2VG6A 2NPFA 4CM0A 3CMQA 2YCHA 3V2UC 2G9OA 3OS0A 4H5TA 1XJWB 4P74A 2WUSA 2ZJQQ 3S3NA 3J80Y 3FZBA 5AXNA 3M2UA 2RJZA 4LY7A 2FJBB 3F5TA 3H5UA 1FKAF 3UDEA 5HK4A 3K89A 1GLCG 5LMUF 2CH6A 3AV9A 3SAFA 4RX6A 2ZBIA 3OYDA 3HP6A 3LP1A 4KI6A 5JXSA 1T9XA 5E5NA 1DURA 2DHHA 4A4JA 3KKFA 3NF7A 2W41A 2K2PA 2Z4PA 3W8PA 4HCBA 1A5WA 1HD1A 2XMUA 2P9UB 2AF6A 3WX8A 4EHTA 5EXWA 4A47A 4GKKK 3OTDA 1K1QA 4LSLA 4M3RA 1EKSA 5KFHA 3VGTA 3ASMA 2GAHC 4DQIA 1UA0A 4OO1J 5B0BA 1MDUB 2VQEF 4H4KA 2G0CA 4MT1A 4RWXA 4IOBA 3FBEA 2PAVA 3ZT0A 1TUWA 5KFBA 1WC5A 3E3XA 2PD1A 2RKIA 2CJBA 1YTUA 3JQJA 3TNVA 4CHZA 2MQ8A 2QMUB 1M90T 2ZZNA 5D6GA 5AFUA 1HBMB 3QPIA 5KT2A 4EBDA 1VQ8N 1WHVA 2CWKA 1YTYA 4ZHRB 2DB1A 3J7YI 5IWAK 4WFYA 1OY8A 4R8UB 3TSPA 4DQQA 4FJHA 2FF3B 4A5AA 3NGSA 4JS4A 2FSNA 2HSTA 2ALYB 1HWJA 2P9SA 4Q7AA 5BXIA 2O66A 2M88A 4B3MK 1FKPA 3CFPA 4BACA 4LBIA 3MMCB 3SQ1A 4JI3J 3E66A 3UIQA 4ED5A 1CJUA 1RB0A 3ISND 1I94K 1N48A 3OHAA 2I6WA 3I31A 3NH2A 2XGPA 1T6CA 3PVXA 1N36J 3DAWA 2B9EA 3CDAA 3L2RA 3NXZA 1RABB 4FLXA 4Z0UA 1IQZA 4BRDA 3R9PA 3O1LA 5KFPA 1U48A 3DLKA 1ZBIA 1VQPS 2GV1A 3UVJA 3H5SA 4DSJA 1LWEA 3GJSB 1L3VA 4IJAA 1C0TB 3UCGA 2U2FA 3D2EB 4IQMA 2YKNA 1REVB 1VRTA 1WC0A 5AZIA 2HFOA 2NXNA 1S3XA 4RW9A 2B7CB 4CJTA 3TARA 3QYYA 2HBRB 1VSJA 3MM8A 4PAAA 4MAKA 3RBZA 4GC7A 2EVZA 3OVNA 2ZWOA 2WB4A 4JI5K 4PKGA 4BRHA 1R3NA 4TSXA 2LXFA 2A10A 2NPIA 1BCOA 3BSOA 3ILLA 1NG9A 1SQEA 3VAJA 3HSDA 4AD6A 1A7GE 3K17A 1SH3A 2KG0A 2BACA 3QDKA 2DO4A 2RQ4A 2GMJA 2GJ2A 1ZXOA 2E8AA 2DHGA 3DM2B 3LP0A 1NPRA 4DMZA 4OZ3A 3HBTA 2DY9A 3L7PA 4KTQA 3S3MA 3ET6B 1FEEA 4F67A 2GNKA 4IFVB 3GJQB 1U1QA 3J7ZT 3OFHA 1JL2A 1X0PA 3EMTA 2MYFA 2NUUG 4OX6A 2IJFA 4H8KA 5IV4A 4K5RA 1CJKA 1E6VB 1HHTP 4FJXA 4K43A 2X1GA 2IYIA 4B8AB 4ID5B 1KCFA 5E33A 3L2UA 2BANB 4KHPF 3HVTB 3KZBA 1S6QA 3R6MA 1AROP 3V6DB 1CBKA 2VPWB 2DFHA 3CWJA 4ZPWR 4P2FA 3EGVA 1Z2LA 2MLZA 4YOYA 4R0JA 4URSA 3ZSXA 4B17A 4J5OA 3A3PB 2EFQA 2BJEA 4DR1J 1RT2B 1WJ9A 3P4UB 4CWBA 5BJRA 3H1VX 4LF4K 4G9ZA 1Q0NA 1FKPB 4DV1J 3SI6A 5FPDA 2X1FA 1IKVA 3O4NA 2VDIA 1CG2A 4C0HA 1NB2A 4ED0A 3I5BA 4FXDA 5CYMA 4RO0A 2P6TA 3VAGA 1FNMA 4USHA 3UD4P 3SQGB 2RDIA 4USIA 3B78A 4WWSA 4FJIA 3VMFB 3KDNA 4FJ8A 4IFYA 4DTXA 5DJBA 4DQRA 1BUPA 3KMQA 1KP6A 1S79A 1K8KB 1RBRA 3KLVA 2WTUA 1LWEB 3L2VA 2XI2A 3BQ1A 2YKNB 3SAHA 4QWAA 1QVFR 1ZTTA 2AMCB 2R7OA 2VQEK 1FVQA 4DU1A 4KPCA 1VSIA 1U02A 1D0EA 2OKQA 4IG0B 2MZTA 3G87A 2AD9A 2DPJA 2UXDK 3GYNA 3CULA 4NXMF 5KFSA 2CQGA 1KR4A 3AVCA 4DUZK 1BD6A 4DHVA 5I3PA 2QYCA 4JP8A 1JLCA 2AJ0A 2WK4A 5D8HB 3LP1B 2HSEB 2K1RA 5E0OA 4OKJA 3M3ZA 3NS5A 2CADA 1IR2A 2IVYA 3VQTA 4LF9K 4Q0BB 2V2VA 1N5VA 1SXLA 3JSBA 4EO8A 3CJ4A 2E6LA 3K2YA 5DDOC 1IBKJ 3WIUA 1LW0B 3MXHP 4NXNJ 2GEMA 4CHYA 3LL3A 3MD3A 2D7SA 3CNQP 1JLBB 3PYDA 3AA5X 3HFZB 4P2SA 4DQSA 1GLLO 4CEDA 3ZNJ1 3VGUA 5CHCB 2CGJA 2KTQA 1JMTA 1O51A 1FCAA 4C3KA 3UKRA 3LDSA 1V9OA 4MJKA 2RHKA 1S48A 1HW8A 3BSCA 2HOEA 3O8WA 1LFPA 1LWFA 4BS2A 1Y5IB 2QKKA 4J9VA 3EDRB 3MPWA 4A8OA 2CQ2A 4P52A 1D9AA 3VHQA 3R1LA 3TJ8A 1XQIA 3MAAB 3KHYA 1ATRA 1BCMA 4RKUC 2Z57B 5HMXA 4BR5A 3H2UB 5E7OB 4K7QA 2HVZA 1AYEA 1UW4A 3C6TA 4Q8EA 5J2MA 1TL7A 3HF5A 4MKBA 5HO4A 3MEDA 2E66A 1KHWA 4P71A 3AD9C 5ETPA 3VTHA 1QAJA 3LM9A 3QATA 2PEHA 5F3TA 2HHTA 2IVNA 2Q31A 1OQ6A 1HUXA 3G71N 5I9EB 4QWDA 2Z2MA 5FLXY 3QT6A 4KI4A 2B6AB 4RNFA 3AY9A 2P2CB 4NLWA 4ISGA 3OVSA 4USWA 5IQQA 5EDWA 2BEFA 4ECZA 5GIPA 2M4MA 7FDRA 1VBZA 4X4QA 3VF4A 1HPZB 4JI8J 2DXEA 4QS8A 2XLKA 1RLCL 1S9EB 4BQLA 4CLZA 1XBWA 2ZF5O 2R7RA 3ZZZA 4C11A 4PWDA 4OJGA 4CO5A 2OPRA 3FNNA 3HL8A 5HBMA 3R5JB 4OKKA 2QYGA 4ILGB 1TK5A 4FYDA 3SYZA 4DTNA 1E6YA 3NL0A 4H0XB 4CZKA 5HQMA 3CMES 3RG6A 2PA8D 3O3FA 2F8TA 4DV2J 2NS1B 3OTEA 4GV3A 1RSCA 2H48B 2EXUA 3FDSA 2PI5A 1I3AA 2QFIA 5IC6B 4CO1A 4A8QA 2G8HA 4YB5A 4KHYA 2IMWP 4N76A 4FLZA 4ELUA 3SUOA 5HRSA 1HRHA 1TFWA 1IUJA 5KG1A 1YX2A 2J0SD 4N56A 5DG9A 2XMVA 1QHAA 3C14A 2KRRA 3VERA 1NGJA 4DEZA 3KVGA 1TUUA 5GADP 2HK2A 1N34K 4PQUB 1JLEA 1UEKA 2CPXA 4B1XB 3N9UC 3HLUA 3JSRA 4LRBA 1IKYA 1Y97A 3IC1A 4IBNA 3EE3A 1VRQC 4QIGA 1FKOB 3S6EA 4LQ3A 2HNYB 3RMBA 5CA5A 2OAUA 2D3UA 3CJKA 2VICA 3W7BA 3UQSA 3MZIA 5L46A 5K14B 3AJ1A 3MMVA 1F9FA 3UD3P 3HFVA 4J2DA 1X4AA 4F9OA 3UDLA 4ZVTB 4PG5A 4DV5F 3QJPA 3V6DA 3MWTA 1B0PA 3I8DA 1S1TB 3BGUA 3DYAB 4F8RA 1X0FA 1IBMJ 3KLIB 3K0SA 3A8YA 2XC9A 2H5EA 1LKZA 1HJOA 1JQGA 2R9LA 4LFCF 1F2HA 3DXKB 4WYWA 2J4RA 4UY8O 3RW6A 5KFCA 3MMCA 3TYTA 3SQOP 5KG4A 4JS5A 4IOCQ 1WSGA 2CVEA 1WOOA 2KZZA 3TZYA 2PT0A 2XO7A 4DR5K 2GVZB 2HFNA 4BDYA 2NRWA 2WRMA 3T1YF 1U6ZA 4NLRA 3SXLA 4WFBL 3U3GA 4L6V3 2YX4A 3TEHB 2XY6A 1R31A 2CXEA 4DFMA 2Q0RA 2W7AA 4CJQA 5T7BA 5F0XA 4DPWA 4CLLA 4TYBA 3GIRA 4TY9A 2AKWB 3A5NC 1DGKN 3M30A 2C28A 1GLFO 4KY3A 3NAHA 1QSSA 4CJPA 1NPKA 3U1LA 2G8WA 2GX8A 3BPDA 3MAQA 4CZJA 4K2XA 3VQAA 1FWLA 2N3LA 2YNGB 4PL8A 4WYLA 3H5XA 4J7CA 5B0AA 4FLYA 3LDNA 3MURP 3TAGA 4DR2F 3RBEA 4E7KA 4I6YA 5GAEP 1ZM4A 2V4QA 3A5OC 2BJ8A 2R8GA 2FY1A 1TTHB 2QTDA 3PFOA 2DGWA 1UFLA 3AVJA 3UCZP 4WFAQ 2UUCF 2EFNA 4KHPK 1U25A 4I67A 2HNDB 1H3DA 2IM2A 1S1XA 1ITPA 3OYFA 2J6TA 1SKSA 2ZDOA 1JB0C 3CUNA 2ZJPL 4ED7A 3D7EO 4UY85 4FWSA 4H4MA 4GMKA 2HNZA 5KFMA 1Q16B 4JI8K 5HVGA 4CD1A 3ZEUA 2JEFA 3Q89A 4QS9A 3ZLJA 4DB3A 3FE1A 4ZMMA 2E44A 4ECVA 1T0TV 1VQ7S 1S59A 3QICA 4BRKA 4CIEA 1TKZB 1GX5A 2ZH4A 3W1YC 3HPHA 4K4UA 4RW7B 2XS5A 4RR5A 2LXUA 3PR5B 2DR7A 2VUGA 4MKYA 4P7TA 3Q8PB 4WU2A 3MECA 2I2YA 4Y34A 1VAZA 3KLGA 1KTQA 4DR6K 3I0RA 3BKUA 4O3OA 2J9DE 2FBTA 1WNSA 4M1KA 2GWKA 5ELZA 4TVAB 2OPQA 1OPIA 4Y1DA 4XH4A 3WBZA 3LP3A 1HNWJ 1QQMA 4HLBA 3CCVN 4OZJA 2CAJA 3H25A 1HWKA 3MCAB 4QWBA 2AGOA 4OHWA 5GAHI 3Q8VA 4CJ7A 2BXJA 1Q8BA 3QFUA 4EUVA 2QWMA 5ETNA 2UVWA 4JHDB 4DS5A 4JKBA 4FF1A 4NI2A 2XY5A 2V7ZA 3TUIC 1XTZA 4J9PA 2FHOB 1M1KO 3Q22A 2RKIB 4WIIA 4C48A 1NKBA 4HH0A 1A6LA 4E89A 1X31C 1BUXA 4CT9A 4PKIA 4CGIA 1YHQS 3BV8A 1G3OA 2EC2A 3MMAB 3U1MA 4DX5A 1X8DA 1OVYA 3CJSA 4CGDA 3FZ2A 5KPZA 2FQQB 1PKUA 1ICEB 1P8GA 2JLEA 5A8WA 2DH9A 4X4NA 1VRUA 1EQMA 2A18A 3V4IB 2IRYA 3CD0A 1EP4B 3S3OA 4JI1J 3SPYA 1EZZB 4DX7A 3ZTSA 2YWFA 1KQSM 4I64A 2RE2A 1QUPA 5A0YB 2PO4A 1NO8A 1S77D 5G4DA 4EAHD 3WHIA 3O5BA 2GIFA 5AXMA 1YUWA 1T9TA 2FC9A 1RCXB 2QA4G 1LQ9A 1RGVA 1VHXA 3IKMA 1TK8A 2JEIA 4WFAL 3JTNA 1BHNA 1X4GA 3M8QA 4JV2A 3KLEB 2YPYA 4U95A 1PCAA 3TUZC 4WXWA 4N7TA 5T7LA 3HCXA 3MOJB 1NK5A 1RTIB 1NGDA 1J9AA 2LQJA 4LR8A 3CXCM 5L8RC 1ZYQA 2ZJPQ 2PA3A 1WKKA 4QQBA 2HF3A 1T3NA 4OYPA 3QSYB 5DDQC 4CLFA 4MQ3A 3P4IA 3A12A 3GFXA 1SQKA 5KI6A 1T3OA 4Q44A 4FKXA 4OQJA 1WKLA 4CJWA 3BPSP 3US5A 3HRGA 2KXFA 5EN1A 1VSHA 4JK8A 3VPZA 3HT3A 2CJ9A 4CECA 1RUSA 4L72B 1NH7A 2MQOA 4M5DA 4HEA9 4JI4J 2JOQA 1DQ8A 1WORA 2CPDA 2WC9A 1R6YA 3RVCA 1PYSB 5AQTA 2B8PA 4USMA 3A13A 1Y3KA 4JKGA 2BQ3A 3G10A 2F8SA 2XSJB 3C65A 2F4FA 2HRUA 1S6QB 5F8HA 1IBMK 5GMEA 4K4VA 4O3RA 1YVFA 5SZTA 4KRFA 2BRKA 5JVGL 1RT3B 4P72A 4JI1K 3L7UA 1SJ3P 2RRBA 1FFGB 2W6LA 4WFNQ 1Q82T 1SVDA 1VQ7N 3OHRA 4ZP8A 4NA2A 3FEZA 5AFUH 4FJJA 3N6NA 2VWJA 1L3TA 2AYGA 2DGOA 2RPIA 1J27A 3CD5A 5FPMA 4DTJA 1J2VA 3VEWA 4AL7A 2CQIA 4B9UA 3VQQA 3VCDA 1U0HA 3LDOA 5BR9A 2CYYA 3RW7A 5CXTA 1Q95G 4FS2A 2DPNA 3BBBA 3QGPA 4C11B 4PRFA 3CW2C 4B3RJ 2WTFA 3VQ6A 1V3SA 2MKHA 4F4ZA 5BPLA 2MKCA 2YNHA 3SQ0A 4LFCJ 2GELA 2DCLA 2X51A 3DXSX 1HX1A 4OX9K 4ILHA 5H9FJ 3L6QA 4ZDNA 5CYQB 3BDPA 3AD8C 4ZPTR 4CIFA 3M1VB 3CDWA 2UUCK 4X65J 3M6WA 3N01A 1UAWA 2AA4A 2KO1A 4PHTX 3K57A 2QZ8A 5KPRA 2AP1A 3KKSA 4DUTA 3MEKA 3W2WB 2RAQA 1S1UA 5K8PA 3ATUA 1NSQA 4IOAQ 1XNRK 2WSCC 1T05A 4QPTA 1R8HA 3CJ2A 2DHXA 5C42A 4DR3J 1GNKA 4WFXA 3MUVP 3TVYA 2R7QA 1TKXA 2YWHA 2HQDA 3TA0A 3ILOA 1UZHA 3G8SA 2ZD1A 5JMVA 4AT1B 4A57A 5HOOA 3UPFA 1X5TA 1MSWD 3QAEA 1RBAA 2K3IA 1V5IB 3C19A 4ECQA 5C24A 8AT1B 4B3RF 3OYMA 1M1KT 4B1YB 5K8OA 3MM5B 2WOMA 1VQLN 2G1DA 5A8RA 2A40A 4WK1A 5L9XA 2BJ7A 1WDTA 3P39A 2DTUA 4LH5A 3B6PA 3F44A 1AFIA 1K0VA 4PQUA 4O44A 3M6UA 3ULHA 3M2VB 2H9ZA 1Y4ZB 2B4PA 2XTJP 2AZ1A 2AYEA 2JFDA 4YMEA 3UR3C 3SUPA 4OYAA 5BR8K 2Q79A 5ETSA 1DJ0A 4C8LA 1WF1A 2OFGX 3PFEA 2UUBK 1S9FA 3LDPA 4IOXA 2ATQA 4CGFA 3M6GA 4CDIA 4JV5F 2LA4A 1EX8A 2BM1A 4GKKJ 3LP0B 1U8WA 4YDDB 4BROA 3TEGA 3VEOA 2FZCB 2YH0A 4CVNE 3CCMN 2GJIA 1REGX 1IKWA 4Y6IA 4YDXA 3T5JA 2EK6A 2V8HA 4X2BA 1RTJB 3J7ZO 1GMUA 4XAKA 3KLHB 4MFBB 3AT1B 2R7VA 1RA6A 4DL4A 3CF5L 5KFRA 4M5NA 3OR2A 3FFIB 1NDKA 2XMAA 5BPNA 1SV5A 4A8FA 4P7VA 3TP2A 1BWFO 2JGUA 3CETA 3QO9A 2VJUA 2OTLN 3OW2R 4J9UE 1IJEB 3ITHB 3VZIA 5L39A 2E7VA 2YQ3A 2E5HA 3QIDA 3C2PA 4JI8F 3D6RA 3J7AP 2HZVA 1LW2A 4FJ5A 1U8SA 3NCRA 2O1PA 2M5YA 2GIQA 2R7YA 1UWAA 1VK3A 2CJKA 3AGRA 1WTFA 1G7CB 5AQIA 4F04B 3MX5A 4WQ5A 1SJRA 2B4UA 4X64F 3GILA 2MKSA 2C3YA 4OVLA 1XMOK 3I82A 3VWSA 3IWNC 1XERA 1FXXA 4QU7A 3HSJA 5I3QA 4FP9A 4BQZA 1YKWA 2P9CA 1H38A 3IR5B 1T02A 2RT3A 1SJFA 1GOBA 3ILJA 3R1XA 4DV2K 4H4MB 3T1HK 2RHSB 1VIXA 4I0WA 4NLXA 5AR0A 4OKEA 4Y2IA 5GMDA 2YNIB 4E3SA 2BJDA 2F7TA 2IAJB 4AILC 1VC5A 2LYVA 3IBWA 1I5OB 3O44A 4RU9A 3ZYYX 1NEEA 1RCHA 1Q81T 3VTIA 5F8NA 3IMXA 3UN3A 2UYTA 1TL1A 1Q7LB 4RW7A 3MR7A 2HBLA 2A1BA 4U7UK 3GG0A 2V67A 1CC8A 4CIGA 3Q8UA 3KLHA 2W2MP 3GYGA 1M5SA 1JLQB 2ZH2A 1N32J 2E2QA 5EWGA 3JSMB 1HW9A 1C4CA 3HPOA 1O0PA 2YNIA 4XIUA 4A2AA 5DG8A 1N34J 4K25A 2E1AA 1SV5B 3ETMA 3NY0A 4QS7A 3CJ7A 3KJNB 1Y0HA 7FD1A 4O0NA 2FJEB 4FJNA 2KJVA 4NLDA 1NAQA 1NMNA 3L4IA 1UMJA 1GAOA 4TN2A 4M63C 4CZGA 4YHHJ 2I1RA 3ZO7A 3I5AA 1KQFB 4ER8A 1YVNA 2O8DB 1B3TA 4L3QA 2BYCA 1QZ6A 1ZETA 5KG0A 3DXBA 4WK3A 4OI4A 2JWKA 2OEKA 4PXCA 4AM7A 3PX6A 2LQ5A 3C8YA 1Q78A 4BR4A 2BE9B 4ED3A 2VL1A 5D15A 1WC3A 1CSJA 2CGKA 2AJQA 1GEHA 3UR0A 1DY3A 1NRKA 3R6GB 4P10A 4RNHA 4KSEB 3DLKB 4NLTA 4OJRA 3SUNA 1GFWB 3QRRA 3N79A 4OLAA 3R97A 4PWWA 3W0LA 1BLUA 4CZIA 1HNXJ 4M5MA 4EP4A 2I38A 2KYXA 3CSKA 5DG7A 2RMLA 5KFLA 1WSHA 3OY9A 1U09A 4FXVA 4FK0A 3NGUA 1WC1A 4DG1A 2AP6A 2QA1A 1EKRA 1G1XA 4MIWA 1NK4A 2EI5A 3RAXA 3V1OA 2DNKA 1FKOA 2RSQA 3SCXA 4NLGA 2W4CA 2P9NA 2UXCF 4NZ0A 3DRXA 3M30B 4I6MA 5D4PA 4OI2A 2W2PP 1K73T 3M8SA 3G71S 1NZ8A 2KI2A 3DOMB 3VQ5A 3VEVA 2ZC4A 1GMVA 1RBLA 2IS3A 4JI1F 1NLKL 5GAGI 4CO4A 4IQXA 1G4CA 2R8IA 5KG5A 4KHQA 1UWBA 4CYUA 2Y0SD 2DGXA 3D0PA 1R7IA 3NKYA 4IFEA 1YZ7A 3FBCA 3GCWP 4RW9B 3MN7A 1WG4A 1ZBTA 3OYBA 3WDOA 2H3GX 4F02A 4V19X 2RUGA 4P73A 3F9MA 3UKUB 3JB9k 3JXUA 2Q6BA 3AVIA 3BP8A 3IR7B 2F65A 1YJ7A 1RI7A 1EIYB 1QAYA 3DU6A 3GOIA 3PRDA 1KOHA 5KGXA 2DNPA 4KAIA 4DKWA 3DU5A 2PIIA 3SFUA 1NJZA 1YT3A 1BQNA 3M8YA 2J8AA 2KHCA 3BM7A 4RUCA 3ISZA 4CK2A 1RP5A 3OFGA 4JI0J 4PR6A 2G8IA 3O08A 3RSEA 1F5CA 1VSMA 1K47A 1UJ4A 3HK2A 3N0VA 1WSRA 5AQWA 2VZ9A 1BMQB 1ZPVA 2XLIA 3A4TA 4USVA 2Z2ZA 5F8JA 2FB0A 1Y64A 2JWLA 5CZXA 5B0EA 3OTCA 1VQMN 4ZPDA 3RMAA 2XMMA 2RRAA 4HVJA 2Y1LB 4FKYA 4J9RA 2GVDA