5J2QA

Hiv-1 reverse transcriptase in complex with dna that has incorporated a mismatched efda-mp at the n-(pre-translocation) site
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
558
structure length
547
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase p66 subunit
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 154
structure length 547
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2qA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2qA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2qA05
4DSEA 3TAQA 2YNGB 3LPTA 4F4KA 3S3OA 2Z1HA 3OS1A 1U47A 1ZBFA 4FS1A 1TQLA 4Z4CA 5J2MA 2HMIB 1Q8IA 3GIKA 5DMRA 4MFBA 1JLGB 4WE1A 3FRZA 3H08A 1KTQA 3BJYA 3RB6A 4RU9A 4B9LA 3CM6A 4TY8A 4HVJA 1HJRA 3NH0A 3O3GA 2HWHA 2X78A 5CYMB 3SNNA 3V6HA 4FZXC 3MR5A 3AVIA 4NRTA 3NAIA 5KT7A 4DL2A 3D28A 1CZBA 4KB0A 3V9WA 4M94A 4RW8A 3G0ZA 3DLEA 1DTTB 4DTUA 3NF6A 4IH5A 3HKWA 4CHQA 5J1EA 1TKTB 2PZSA 5KFGA 3PW2A 4KKOA 4FLZA 1T3NA 3TVKA 3QINA 3QEXA 3O3FA 1HYSA 3V9SA 3UQSA 4B9SA 3AVLA 2HNDB 3C6TA 4R0EA 4QPXA 4CJVA 3L8BA 3K5MA 1RCHA 3BQ2A 2I5JB 4KAZA 3KK3A 3AVNA 3VQBA 1S9EB 4KHUA 1J5OA 4KHWA 3OLBA 1HYZA 3NFAA 2Q3SA 1RBTA 4DF4A 1D9DA 2IC3A 3O3HA 4J9PA 1IKVB 4K4VA 4W5OA 2IS3A 4KI6A 1ZBIA 3DI6A 1U04A 3DRSB 3N6NA 4CK2A 3KHGA 4CJ5A 3JYTB 3QNNA 3OYJA 4F4XA 2YNFB 3KJVA 3M9NB 2CKWA 3HVAA 1U4BA 4PWDA 3VA0A 3H4BA 4O4GB 4MKBA 5E41A 3OL8A 1VK0A 4W5RA 5KFJA 4O0JA 1RTIA 4H8KA 1KFDA 1X1PA 1FKPB 3KLEB 1SL1A 2YKMA 4E7HA 3OSNA 1XWLA 4NLYA 3OYGA 5C25B 1BGXT 2XGQA 4J2BA 3I0RB 2RPIA 4H4MB 1HPZA 2I1RA 3V6KA 2Y1IA 3IG1A 4EBEA 1RDBA 4O44B 1TL3A 3V6JA 5D3GA 4R8UB 2IMWP 2C2RA 3CJ4A 1QAJA 4E3SA 1KRPA 3SI6A 3H4DA 4FM1A 4B9VA 3DMJB 3LP2A 5KFIA 4CJKA 1LAVA 4CE9A 4ECTA 3MEEB 3IN5A 3ZT2A 4M41A 4ZVFA 2AQ4A 3AVMA 4I9QA 4J9LA 3U3GA 4C8LA 3A2FA 3GYNA 3TABA 1CXQA 1IH7A 4DFPA 3NF7A 2O4GA 2G8IA 4I7FB 4ED8A 1RT6B 1CZ9A 3SZ2A 4RNNA 5L1KA 4HUEA 4QWDA 3BSNA 5KTQA 4OKJA 5JS1A 3MR6A 2FVQA 4DTSA 1NOYA 1DLOB 1BI4A 1EETA 3OYKA 3OYMA 3EZ5A 4RW6A 5KFDA 1YTAA 3CDWA 3AA5X 4H54A 1LW2A 1U49A 4M3ZA 4NLUA 2D7SA 4NYZA 2HB5A 4CGDA 1LWFA 1KHWA 4ED3A 3ZT4A 1UA0A 1NJZA 3AA2A 4CK3A 4TY8B 1UA1A 3NMAA 1L3VA 5DG8A 2X6NA 1B9FA 4CFBA 1L3UA 3PX0A 4KHMA 4RW9B 3CWJA 2UVWA 5CYQA 4N76A 4C8MA 2R8KA 2OPPA 3RBEA 1S9FA 5DQIA 1RDRA 2QKBA 4QOZB 2WONA 4MKAA 4RNOA 4B9NA 3I5BA 1TGOA 4IG3B 2V9WA 1GOCA 1VSDA 1S9GA 4Z4HA 3QEWA 3ZSOA 3ZT1A 1S1VB 3ISND 1RTHB 1C0UB 2HVHA 4DTNA 1C1BB 1WAJA 4LSLA 2R2RA 1X9WA 1XHXA 2VWKA 3UR0A 2Z1JA 4M45A 1WSFA 1J9AA 4Y34A 1BIUA 1N6QA 2FBYA 4ZPAA 5F8LA 2W42A 1LW0A 4RW4A 3V1QA 4CESA 2F8TA 1RBSA 3L2QA 2JEGA 4E89A 4ID5A 3C6UB 2G8VA 3PUFA 3I0SB 2VG7B 1S97A 4JLHA 3KNAA 4CJLA 4IOBA 3HXMA 1RT5A 3KK1A 2YKNB 4HKQA 2BR0A 2HHSA 3DI6B 4DS4A 2YNIB 3HSTB 4C8OA 3QLHB 4XO0A 2B5JA 3CJ0A 2HHWA 3KJVB 3S3NA 5HROB 1SV5B 1RT4A 1JLBA 2BANB 4O3QA 3VQQA 3AO5A 1S6QA 4TY9A 2ZD1B 2C2DA 1HARA 3ZSZA 1D1UA 5J2PA 1IKYA 3PHEA 4J9MA 3G6VA 2IJFA 2AGQA 4NYFA 4CEFA 3ZT0A 2DPIA 4CJQA 3SJJA 5L1JA 5HP1B 3OY9A 3NH1A 3I5CA 4FLUA 3DLKB 3HL8A 3OL7A 3ZSRA 3FFIA 1ZTWA 2Z1GA 5D3GB 1N56A 4DQQA 4OLBA 4Q0BB 5J2NA 2ATLA 4JRPA 3S9HA 4HCCA 1G15A 3LP2B 5F8NA 1RTDB 3F9KA 3SUNA 5I3UB 1C1CA 2J6UA 4QW8A 3HPGA 4F50A 1BQNB 3G6YA 4Q8FA 3I8DA 1DTQB 1TK8A 3BDPA 3RBDA 4DSIA 1HQEA 4FXDA 3MR2A 1WSJA 1JXLA 3LP3A 4NLQA 1FK9B 1JIHA 1W0HA 3LZJA 2W8LA 3OHBA 1TAQA 5I42B 5HLFA 4FJHA 1R0AA 3G6XA 4C8KA 2FVPA 2X74A 3CDEA 1BISA 2CJQA 4AHVA 4DTXA 2OZMA 3E01A 1XR5A 5KFKA 2C2EA 4YR2A 4Y2AA 4M42A 2V4QA 5EU7A 1EP4A 2G8KA 3CJ3A 4DF8A 4E7JA 2ILZA 5FDLB 2VG6A 3DLGB 4EP5A 2AGPA 4URGA 3G10A 3OS2A 5L1LA 3OSPA 1WAFA 2UVVA 3VQCA 2XRIA 1T94A 2HNYB 1JXBA 4FK2A 3PW4A 3O4QA 3IGVA 3PW5A 5KFYA 3LP1A 4ED6A 3ASMA 4BWJA 3V81B 1WNEA 2P5GA 4RUAA 1FKOA 1VSFA 4AHUA 1S9GB 3AO4A 1O1WA 4KFBA 3QIDA 3H5UA 2VA2A 3VQ9A 3QIPB 4ECYA 4LSLB 4CGIA 1IKWA 5C42B 3KD1E 1U09A 4CFDA 2XGPA 3KLIA 4ZHRB 4NCBA 4HTUA 3KLHB 4FM2A 4MK7A 4IKAA 2B6AB 3BSCA 2ZQBA 1LW0B 4U6PA 1J53A 5DQGA 4Q45A 1K6YA 3DOKA 3AA4A 1C6VA 3SQ1A 3V4IB 1RT5B 4O5BA 2D0CA 4HUGA 3IRXA 3MFIA 2BGGA 4X2BA 1N48A 2FVRA 3V9XA 4JUZA 2FBVA 1GX6A 2XHBA 4J9NA 4Z0UA 4I2PA 4EZ6A 2JLEA 3H5YA 4FCYA 4IRDA 2DFFA 3OYFA 4KSEB 1T7PA 3V1OA 3H59A 4EEYA 4FK4A 1HNIA 3TARA 3HHKA 3O4NA 1VRUB 1Z25A 2VG5B 3SPZA 2W9CB 4J2AA 1RILA 5EWFA 4KV8B 5KG1A 1NK8A 1S6PB 3H98A 4F4ZA 1IKYB 4J9QA 4MIBA 3CJ5A 3L3VA 1SL2A 3LP0A 3MTKA 2DFEA 4ZP9A 1WSHA 1RDDA 4XIUA 3IS9A 5F8IA 5KRTA 4DS5A 4CHPA 4TN2A 2PY5A 1TV6B 4WFZA 3BGRA 4KHYA 3TAGA 2YV0X 1TKZA 5KFSA 1RDCA 4YNQA 3NF9A 2AU0A 4ZPBA 5J2NB 2HHVA 4DQIA 2ASLA 1CXUA 3F73A 2HVIA 4DSLA 2XWYA 3D5MA 1I6JA 4WYLA 4QWBA 3KOAA 4CGJA 2E9TA 3K58A 2QV6A 2GUIA 3LPUA 4ELTA 1NHVA 4IFVA 3D0PA 1S5JA 1RA7A 3OL6A 4M95A 3VQAA 2HHTA 5JXSA 1T03A 4O3NA 5C24A 3K2PA 4K8ZA 2QKKA 1REVA 4EBCA 4JV1A 1S1UA 4LSNB 5KFOA 2HNZA 2KQ2A 4LD0A 4DFJA 1TL1B 5K14B 3E01B 5KFAA 2V4RA 4OGCA 4KBIA 3HYFA 4FW1A 1N5YA 5CZ2A 2OPSB 2X6SA 2G8FA 3MXJA 2R7YA 2KZZA 3PZPA 2IBKA 2ZE2A 2G8WA 3KLGB 3AO1A 3DM2B 2B4JA 3AV9A 4CF2A 3SV3A 1VSHA 2YNHA 4LH4A 2ALZA 5HRPA 1LWCA 1TKXA 4OPKA 4MIAA 2P51A 2F8EX 5EDWA 4FJJA 4G1QA 4LH5A 5KFNA 4F2RA 3ICLA 1RDAA 3NH2A 4GMJB 4J2DA 4RW7A 1NJXA 3I5AA 3JSMA 4NLRA 3TQ1A 1JX4A 4K4ZA 2OPQA 5F9LA 2W9AA 1ASUA 4JV2A 3PR5B 1JLCB 3MECB 3TANA 2G8UA 3N6MA 3N6LA 1WLJA 4CGFA 3RMAA 1T05B 4N56A 4IQXA 3NL0A 2LSNA 4IDKA 3SUQA 3KK2B 5KRSA 4F4YA 3NKYA 3OLAA 4HUFA 2ASJA 4FZZA 3DRPB 1HYVA 1RT3A 4NLXA 4CJRA 4BDYA 4IFYB 1S49A 3H2LA 3CG7A 3C95A 3HT3A 1KVCA 3OYEA 4YR0A 4PUOB 4FLWA 2DY4A 4RZRA 3TAMA 5DGAA 3HVWA 3B6OA 2IJNA 3ZT3A 2KW4A 3DOLA 3V1RA 4ED0A 4E19A 5DG7A 1WNSA 1U48A 2OYQA 3M8QB 3Q8QB 3TI0A 1HNVA 4E7LA 2FC0A 1S4FA 2QK9A 1BCMA 1HNIB 2DPJA 4MQ3A 1QE1B 4J2EA 4IR9A 3NBPA 3PW7A 4B8CA 3HVTB 4CHZA 3KHHA 1JLFA 4YP3A 3OYDA 1NOZA 3QO9B 2ILYA 3S3MA 1GOAA 1RT7B 2W7PA 3NGIA 3QGGA 4Q5VA 1BIZA 5T14A 4CJTA 3AVFA 2QE5A 3V6DA 4ECXA 3CYMA 4AHRA 2RDJA 4GC7A 3SPYA 1XI1A 1RYRA 4XPEA 5KG0A 1TKZB 5F8JA 4KE5A 2OPRA 2FJXA 4IKFA 3ITHB 4IG0A 2IM0A 3PX6A 3QEIA 4FLYA 4H4OA 4ECUA 2BRLA 4ECWA 1MU2A 3AVCA 3MF5A 4NLVA 4FVMA 3HPOA 4E7KA 2ASDA 4EZ9A 3L2RA 4ICLA 5KG3A 5J2MB 1S1WA 2UUTA 5KT3A 4IFVB 2ETJA 2RKIA 4MFBB 1QAIA 4WE1B 2F96A 1RBRA 3DYAA 1REVB 4OPJA 4EO6A 3QZ7A 3LZIA 3DDKA 1KVAA 4O0IA 1XHZA 4RUCA 3LANA 5FROA 5F8HA 5FRMA 2UUWA 3OVNA 1XR7A 5KI6A 1WSIA 4FLXA 3DRRA 1N4LA 1YTUA 1XC9A 3MEDA 4NLSA 5HRRA 2RF2A 4R5PA 3CJ2A 3BQ1A 4RW8B 4FJNA 3OL9A 2PYLA 3DLEB 2YNHB 2D5RA 3RB4A 3AVKA 5J1EB 2DFHA 5SZTA 4KB1A 4KKOB 5DG9A 3H5SA 2JC0A 4DQPA 1HYSB 1NJWA 4G1QB 1RTJA 4QAGA 1TVRA 3C6TB 3DLRA 1ZBHA 4PQUA 1QUVA 2B43A 4CJUA 4ELVA 3Q8PB 3OYLA 1C1AA 4GW6A 3KLFA 1RT1A 3RMCA 5CZ1A 3KK3B 4DG1A 4WZMA 1TKDA 3SCXA 4DSKA 1J5OB 5HBMA 3ALYA 2FBXA 3GV8B 4NLGA 1NKCA 4F3OA 4I9LA 2IM3A 3MFHA 1BL3A 3L2VA 4QW9A 5KFUA 4ID1A 5KFWA 2IC3B 4DU3A 3M8PA 4TYAA 1WN7A 3GILA 4NCAA 1S0OA 4ECRA 1JLAA 1MMLA 1RAJA 2XC9A 4FJIA 3NDKA 2XY8A 3OYAA 3AVJA 4WFYA 2HHQA 4PWDB 5KFZA 2C28A 2Z1IA 5KT5A 2HHUA 4NCGA 4BE0A 4B3OA 4O55A 3E51A 1RTIB 3HM9A 1LWEA 1TK0A 2YKMB 4E7IA 1NKEA 5EUHA 1HNVB 3OHAA 4DL4A 4CEZA 4N5SA 3SUOA 4PA1A 4FJGA 1HPZB 3EZUA 4Y1DA 3IG1B 2RN2A 4CEBA 4WXWA 4DLEA 4CHNA 1TL3B 3EYZA 4WFXA 2W9BA 5T7BA 2WTFA 4O3SA 1KLMA 3OYNA 3G86A 4Z4IA 3QZ8A 5KFPA 1Q9YA 1NK7A 3HP6A 2IA6A 4RNHA 1UWBA 5JS2A 2FVCA 4CEQA 4CJ3A 1C0TA 2BE2A 3UDLA 4KTWA 1JL1A 1Z26A 3U6FA 4K4XA 2Y1JA 2D0BA 4H4OB 2FJVA 4HCBA 2PYJA 3MEGA 3MAQA 3KTQA 1CSJA 4BWMA 2IM1A 1HRHA 3OS0A 1MU2B 2AWZA 3T1AA 4Q44A 1BI4B 4FLVA 2JEJA 1EETB 4CJFA 2HMIA 4RW6B 1RYSA 4FJMA 1S0NA 2VWJA 2EC0A 4CJSA 5DQHA 2BQRA 1LW2B 2HAIA 5KFEA 1KFSA 2KTQA 1QHTA 1WSGA 5FRNA 3THVA 1LWFB 2GIRA 3SQ2A 4FJ9A 1K1SA 3QIOA 5J2QA 3GIIA 4CF0A 3DLHA 4EP4A 3AVAA 5CYMA 3VQSA 1SL0A 5SWMA 1BHLA 3UPFA 2QXFA 4IH7A 3PO4A 4DTPA 1FXXA 3PY8A 2R2UA 5CYQB 2OPPB 1NK0A 1ITGA 4EBDA 1DTTA 4R5PB 2WONB 2C22A 1F21A 1TKTA 4HHTA 5KFCA 1HMVA 3MXIA 5KG2A 3VN5A 2V0NA 1VSMA 4DU1A 2HNDA 4N47A 1JKHA 5HRNA 5KFFA 1RTJB 1TVRB 3SQ0A 2I5JA 1W25A 3K5LA 1N6QB 4DWIA 3SI8A 4RW4B 1JL2A 4ELUA 4DG1B 5HBMB 5KFQA 4ID5B 1YVFA 3FSIA 4TQRA 4GC6A 4JS5A 4DQRA 4AHSA 3KD5E 3BSOA 2EHGA 3BR9A 3VQPA 1IKVA 3KK1B 1QTMA 1RNHA 3QNOA 1NK9A 4IRCA 2GC8A 3DRSA 3OJSA 1L3TA 5DK5A 5EWEA 3M8PB 3JYTA 4OGEA 4B8AB 2BQUA 1I3AA 3WNFA 2YNFA 2ITGA 4BDPA 1SKWA 2B5JB 4CEAA 5F9NA 1D9FA 1RT4B 1JLBB 4O4GA 1VSJA 1NJYA 3T5JA 4ECVA 4G3IA 1S6QB 3OYCA 3VA3A 2AX1A 4LY7A 3LAMA 1FKPA 4NCGB 3KLEA 5J2PB 1RT2A 4B3OB 2IDOA 4CERA 3VQ7A 4J9SA 3RB3A 3NAEA 3CFPA 4CCHA 3PR4A 4I2QA 3HPHA 1I39A 4Y3CA 5C25A 5F8MA 1SUQA 3I0RA 4URSA 2WCXA 4FM0A 4H4MA 1X9SA 4ECQA 4AH9A 3V9ZA 1X9MA 2D3UA 4B9MA 4O44A 2HWIA 4R8UA 4ZMMA 3EPIA 3GV5B 2GIQA 3FFIB 4FJ5A 4CFCA 3TAEA 1NKBA 4ZVEA 2A1SA 3MEEA 1A5WA 1EX4A 2FVSA 4HYKA 1C1CB 4FLTA 1HQEB 3ZSWA 4I7FA 4DTMA 1RT6A 4Q43A 2BE2B 1ZETA 3GIMA 3K57A 2NUBA 4O3OA 3AVBA 2XI3A 4TQSA 4DSFA 3MEGB 4QCLA 1DLOA 2D0AA 4K8XA 5HLFB 2E9ZA 1EKEA 1R0AB 3PJXA 4DL3A 1VRTA 3T19A 3VQ6A 5KGWA 3NHGA 3MR3A 4FJKA 5KT4A 1ZBLA 2P5OA 1EP4B 3AVHA 2KFNA 2VG6B 5KFHA 3NGZA 5J2QB 4CECA 1NK5A 4TLRA 4YQWA 1YVUA 4K4TA 3QGIA 1D5AA 4IRKA 4AHCA 4N41A 4RW9A 3GQCA 4ZVGA 3HJFA 4DFKA 1D0EA 1VSKA 4K4YA 1QSLA 2FLPA 3FQLA 3LALA 4YR3A 3LP1B 4IG3A 3ZSYA 4ED1A 3KHRA 2BQ3A 2KFZA 1ZBUA 1FKOB 4NLPA 4OJRA 3MXMA 1S1VA 4NLTA 3VQDA 1U45A 3T5KA 1RTHA 1C0UA 2P1JA 2JEFA 4Y1CA 1BCOA 1HMVB 4KFBB 4FBTA 1C1BA 1IG9A 4LQ9A 1J54A 3NE6A 3RR8A 3FQKA 4O3RA 3CVKA 1QSSA 1TAUA 1IKWB 1JKHB 4JS4A 3KLIB 1EXQA 3KKRA 1ASWA 5DGBA 3T5HA 2XCPA 4K50A 3BREA 2OA8A 3C6UA 1TP7A 4KHRA 3DOKB 1RA6A 3I0SA 2VG7A 4FBUA 2R8GA 3VQEA 2WRMA 3Q8SB 2YKNA 2R8JA 5KG5A 4M3RA 4DSJA 3WNEA 3K5OA 3CIZA 2VA3A 2XI2A 4CEEA 2YNIA 3IRXB 3QLHA 3LWMA 4ED7A 4FK0A 4DTJA 4ZTJA 1L3SA 4I2PB 4RG8A 2R2TA 5HROA 1SV5A 5EWGA 2BANA 4JRQA 3LWLA 4EO8A 2FLLA 2ZD1A 4XPCA 3GIJA 4F4WA 3KLVA 4O3PA 4KHNA 3RWUA 1CLQA 3QYYA 4WXOA 4CK1A 1RT2B 1UOCA 2OZSA 1GOBA 1KVBA 3LP0B 4I2QB 3L2UA 5HP1A 4IH6A 4CF8A 5L9XA 3PO5A 2EX3A 3IS9B 4MK9A 1SUQB 5KG4A 4OLAA 3LAKA 3DLKA 3QGHA 3SFUA 4DTOA 3TR8A 2IM2A 2JEIA 5JUMA 3BGRB 5KFTA 3BSAA 2YHAA 3U3YA 4Q0BA 4QWCA 5DLGA 4J9OA 4TSXA 2IAJA 1NK4A 1RTDA 5I3UA 3SUPA 1S1XA 4ZVHA 4M3XA 3CO9A 4OL8A 2UVUA 1BQNA 1DTQA 4DL6A 1VSIA 3KKSA 3RMBA 1LAWA 1ZYQA 2R8IA 1FK9A 3HO1A 2WOMA 1HQUA 3HK2A 3P83D 3C94A 5I42A 3ZSXA 4W5TA 3T3FA 1T03B 5C24B 3M9OB 2YHBA 3RRGA 1S1UB 1A5XA 3RTVA 5HRSA 4QWEA 2BDPA 2HNZB 1VRTB 2FJWA 1SKSA 2DTUA 3D45A 3BQ0A 4C8NA 1JLEA 1KHVA 5FDLA 1N5YB 1S10A 3DLGA 4ECZA 4URQU 4ZP6A 3PW0A 4EYIB 4KPYA 2ZE2B 3SQ4A 4KO0A 1IM4A 2UVRA 1SKRA 4OKKA 4CFAA 3Q8RB 4K4UA 1A5VA 2HNYA 1OS5A 4IR1A 1LWCB 4W5NA 1XR6A 1TKXB 4B9TA 4BACA 5KFVA 3V81A 3RB0A 4JV0A 3HVRA 1VSEA 4CIGA 4KI4A 3ISNC 4DQSA 4RW7B 1B92A 4CJWA 3JSMB 1C0MA 2OPQB 4EYHB 3KMQA 1VSLA 4DTRA 2OH2A 1S1TA 3QIPA 4LQ3A 1LV5A 4L8RB 3RR7A 5C42A 4CHYA 4ZHRA 3KLHA 4GVMA 3QEPA 2RDIA 2E6MA 2B6AA 4IDKB 4TYBA 1QQCA 3SV4A 4FJ7A 3KHLA 4M3YA 4CF9A 1RT3B 4Z4GA 4Q8EA 4CEDA 2G8HA 4NLDA 4DU4A 3QESA 3EPGA 3V4IA 1W9HA 3AVGA 1BQMA 3CM5A 1L5UA 4DEZA 3OYIA 1RBUA 4DL5A 4FJLA 1QS4A 4AHTA 4CF1A 3TAMB 4DMNA 4ZTFA 4KHQA 3HP9A 2E4LA 3DOLB 4E1MA 3PX4A 4RNMA 4NYNA 1UAXA 4ZP7A 3QEVA 2O5DA 1VRUA 2HW3A 1S48A 2A1RA 2VG5A 2W9CA 3P1GA 4KV8A 1S6PA 4WZQA 3NBPB 4Z4EA 1JLQA 4KAIA 2F8SA 4OKEA 1JLFB 4CGGA 3DLBA 4M3UA 3L2WA 2IOCA 4B9UA 1TV6A 1IKXA 2XY7A 2XCAA 3H40A 3CFOA 3V6DB 1K1QA 4NLWA 1ASVA 3UIQA 3RAQA 3SFGA 2OPRB 2D41A 4IG0B 3AA3A 5KGXA 2IAJB 4KRFA 4CIEA 2W7OA 4FW2A 3OYHA 3EY1A 2YNGA 2FBTA 4BE2A 3PVXA 1S1XB 3P5JA 4RNFA 2AJQA 4J9KA 4K4WA 4TXSA 1S0MA 3CFRA 3RMDA 3VQ5A 4ED2A 4W5QA 3AO3A 3M8RA 2J6SA 1KSPA 4CHOA 4ICLB 1S1WB 2J6TA 2WOMB 1HQUB 1JLGA 5KFMA 4CGHA 3SYZA 4DL7A 2RKIB 3L3UA 4M3TA 2ZKUA 4LSNA 2GV9A 2D3ZA 3DYAB 3B6PA 1TL1A 1GX5A 5K14A 1RBVA 4CEOA 3H5XA 4FJ8A 2R2SA 1Q9XA 2OPSA 2R8HA 4CJEA 2HHXA 3NF8A 3KMSA 2JGUA 1JLEB 3IGNA 3DRRB 3ZCMA 2XY6A 3KLGA 3TAPA 3MEDB 2RF2B 3DM2A 1KCFA 1QSYA 4J9RA 3OJUA 4KO0B 4CJPA 1Z4UA 2W8KA 4CJ4A 2IGIA 4UQGA 4PY5A 2AX0A 1B9DA 2AGOA 1C2PA 4KREA 3ZSQA 3FDSA 4FJXA 5KFXA 3V9UA 4PQUB 3TWHA 1S9EA 5L1IA 3KLFB 4FZYA 1RT1B 4YFUA 2JC1A 3PJWA 4E0DA 1JLCA 1ZTTA 1D8YA 3WNHA 3MECA 1S1TB 1WSEA 4Y2CA 1JXEA 2E9RX 1T05A 3NAHA 4WYWA 3IAYA 4O4RA 1TK5A 3K5NA 3KK2A 4F8RA 4BDZA 3OYBA 4ZP8A 1SH3A 4KTQA 3DRPA 3K59A 1NNDA 4IFYA 1SH0A 5C5JA 1NHUA 1YT3A 4OVLA 5DLFA 3M9MB 2FLNA 3GV7B 3QETA 3TAFA 3NCIA 1JLAB 4MH8A 2GBZA 4KTZA 2WK4A 2O4IA 1BQMB 1IO2A 5F8GA 1NK6A 4PUOA 4FS2A 3VQ4A 1SH2A 4U7CA 3LDSA 4BE1A 5KT2A 2BRKA 3CQ8A 3PV8A 4CIFA 1LWEB 2XY5A 4DFMA 4E1NA 4MK8A 4NLOA 3M8QA 4ZPDA 3KIOA 3RRHA 3NGDA 4M3WA 2E6LA 5KFBA 3ZSVA 3AO2A 5KFRA 3M8SA 2WHOA 1QE1A 1T8EA 5KG7A 3RAXA 1KLNA 4F2SA 4FYDA 3HVTA 2WB4A 4Z4FA 3CDUA 1JLQB 3DMJA 3QO9A 3NGYA 5KG6A 4QWAA 2W9BB 4YMEA 3VQ8A 1RT7A 4K4SA 4AILC 4F3TA 4ECSA 1KLMB 2XO7A 3T5LA 1IKXB 1Y97A 3ULDA 4KB7A 5KT6A 3QERA 5KFLA 5CY4A 2ATQA 2KZMA 3WNGA 4DLGA 1UWBB 4KHSA 4NZ0A 3ITHA 4ZPCA 4IBNA 4B08A 1C0TB 4NRUA
chains in the Genus database with same CATH superfamily
3MN7A 3W2WA 2ZC3A 4DR5F 2YNGB 1YIJS 4UOHA 3C66A 4CYUA 4CRJA 1PYOB 4I64A 4Z4CA 3P38A 1YHQN 4F02A 2W6LA 1Y3KA 2F65A 1RLCL 2V34A 4C8YA 3H08A 3ZEUA 3PIOL 2Z56B 3BJYA 3SBTA 3OTEA 3EKSA 3IA0A 3NH0A 2ZKTA 2ZH2A 2NYIA 3R5AA 3O3GA 1ZM9A 3U9DA 3SNNA 4OYZA 3V6HA 2DH7A 2RQ4A 5DDQC 2XEXA 1N52B 1G1XA 2QW9A 4DHYA 1CZBA 4LF6K 2Q1LA 4IWVA 3DLEA 4DR6K 3H25A 3SXLA 1TKTB 5KFGA 2E1MC 4ZN3A 4HTIA 1Q82T 4FLZA 2JRSA 3O3FA 1HYSA 1L3KA 3V9SA 3UQSA 1VQ9N 1I94F 3KJQB 3U27A 1H0HB 4DR4J 1VBZA 3C6TA 3DC2A 1KXPA 1KAXA 4LRBA 3RW7A 3K0JA 2Q6CA 3EGZA 3KK3A 3AVNA 4KHUA 3QWPA 4KHWA 4CLZA 1HYZA 3D6MB 1RBTA 2FHJA 5E3RA 3DJCA 2IC3A 2BVZA 1FRJA 3BH6B 2CG4A 1M90O 4MIWA 3NLCA 4KI6A 2FY1A 4BQZA 4CK2A 3JYTB 3CJTA 4QBUA 3HVAA 4BC4A 1YHQS 1U4BA 1PIEA 2VWBA 1IV0A 1VK0A 2F63A 2YI1A 4W5RA 4O0JA 3CE8A 3TZWA 1FKPB 1SL1A 3W62A 3KG1A 2HYIB 2YKQA 1ILYA 3OYGA 1BGXT 4X64J 4JI3F 3AAPA 2VU5A 2ASMA 1SC6A 4L76A 2RPIA 1FRIA 3V6KA 3IG1A 3N9UC 1YX2A 5DDOC 4UY85 1RDBA 1TL3A 4TU7A 2C2RA 3CJ4A 3HTVA 3DMJB 3PRVA 5HO4A 3VF6A 1WG5A 5F0WA 1DEJA 1MWZA 2B7CB 1LAVA 4CE9A 3D68A 3IN5A 3ZT2A 2MSSA 4M41A 3K9JA 2AQ4A 4JI1K 3FC9A 1K0VA 3GYNA 1RAIB 1XIQA 1PBAA 1CXQA 1NH7A 4I7FB 3OW2M 2J9DE 4ED8A 4M7XA 5L1KA 3KWMA 5KTQA 3BSNA 3W2WB 4OKJA 3MR6A 4B3MK 2GTDA 1VAZA 3R3LA 3S6EA 4FWRA 4NEYA 3DAWA 2UU9J 1BI4A 2R4FA 4LIRA 4RW6A 1Q16B 1WI8A 5KFDA 2B4VA 3CDWA 3TVZA 3BGOP 4FO0A 4LJMA 4JI0J 4M3ZA 2D7SA 3DGPA 3CI5A 2PE8A 4DR3F 5AXNA 2JDJA 1E4GT 3CJ8A 3GR1A 2P9GA 3H2VE 4WPAA 4CK3A 1P9QC 2QWRA 1L3UA 3ETMA 4X4QA 1RFQA 4B1VA 5ETMA 2D0OA 2UVWA 5CYQA 2RNEA 4N76A 2P9PA 3RBEA 4DPOA 4QOZB 1TGOA 5CHCB 3CD6S 1GOCA 4I69A 4B1UB 4M5IA 3PEJA 1C0UB 4A2BA 3UDCA 4CLFA 2VONA 1KD1T 3JAMY 1WAJA 1Y7PA 4JI2F 1GLEG 2BABA 2J7KA 2MKHA 2Z1JA 1QJHA 4M45A 1JCGA 4Y34A 1N6QA 1ZM3A 4RW4A 4CESA 1ZA2B 4OHWA 1YLXA 5D78A 1LFPA 3I0SB 1KR4A 4JI8K 2MLXA 1OH5A 4UOGA 4EFAC 4LFAJ 1MN7A 3C0BA 2BACA 5F1XA 4DR2F 2DH9A 1GTHA 1M1KO 3NWGA 1SKUB 4F25A 4XO0A 3C15B 3CJ0A 4OI3A 3CDAA 1NXIA 3D3CJ 3VEZA 1FA0A 2J7UA 2ZD1B 1U2VB 2J0SD 1GXLA 1RXOB 3AGRA 4HR2A 2KHCA 1D1UA 3DLLQ 2NCKL 3PYGA 5AZJB 5J1PA 3ZT0A 2DPIA 3UKRA 4JD2B 2CPEA 3OUYA 4CJQA 2H48B 2X1BA 5HP1B 2MQQA 3C16A 3HL8A 4WFBL 2Y0SD 3FFIA 3QT5A 3TPQA 3BYPA 3VALA 3UFCX 1H2TZ 2Z1GA 3CXCM 2EC2A 1HNXK 4OLBA 4X4UA 3S9HA 1RHRB 3L95X 1VBYA 2DR9A 4DR7K 1G99A 2BJ9A 2BOPA 4X62K 1RTDB 3HHEA 3SUNA 3UVJA 2DNNA 3I55S 3U02A 3G6YA 1KAYA 2C2NA 2ZITA 4ZLNA 1JXLA 7FDRA 1W0HA 2W8LA 4ID8A 5I42B 4HL9A 5HLFA 2H54B 3EVMA 1R0AA 4ZIVA 2DNQA 1T02A 2CJQA 4DTXA 3E01A 4USUA 3R2CJ 1E6VA 4P2FA 3DGPB 3ZTRA 5MAOA 4M42A 2V4QA 1EP4A 1RE1B 2HSTA 5FDLB 2G1HA 4EP5A 2A42A 3G10A 2IDLA 3OSPA 1WAFA 2IVYA 3CCVS 3VQCA 2E7VA 2UUCK 1T94A 2Z4PA 3IBWA 2K1RB 3ONQA 3LP1A 2CRLA 4L75A 4RUAA 4BC5A 1VSFA 4AHUA 4IQMA 4JI6J 4DU7A 2CQGA 3QAUA 4PQAA 3H5UA 2VA2A 2HHHF 1KC8O 3VQ9A 1V3ZA 3HJVA 5GADP 2EKYA 2AHOB 1RAEB 4CGIA 5C42B 2GHPA 2VQEF 3KD1E 4CFDA 1WG4A 2XGPA 4ZHRB 4ZJQA 3HFVA 4NCBA 3EJMA 3KLHB 3W5ZA 4M5KA 2NUHA 3UD3P 1K6YA 1IBLJ 5E5NA 3DOKA 1LEOA 3E66A 5C0YA 3ZZUA 1T9XA 1JJ4A 1RWKB 4JYAJ 4TVAB 3NS5A 2XLIA 4ANCA 2HZVA 2AEMA 2KT3A 4HUGA 2BGGA 4CQ1A 5AQOA 3ENQA 4X2BA 1N48A 1RAHB 2GJIA 2R7RA 2CH6A 4JUZA 2FBVA 2GAGC 2XHBA 4J9NA 2KRRA 4EZ6A 2JLEA 3CJ9A 4FCYA 1SQGA 3OYFA 2BZ2A 2XBPA 5HJXA 3O4NA 5F2RA 3SPZA 1NZAA 5EWFA 4NO7A 2MEWA 3H98A 2ACYA 3MTKA 2DFEA 5FIIA 4ZP9A 1WSHA 2XMAA 2DXEA 3OUYB 5F8IA 4B1ZA 2K3IA 4LRAA 5LMNK 3GMGA 1Y00A 1RHQB 4EMDA 4TN2A 1TV6B 3NY0A 1DKGD 4MYTA 4KHYA 1HLWA 2BKOA 1LFWA 1W2IA 4YNQA 2Y8WA 2VQFK 3TOQA 4ZPBA 3NGUA 1ICEB 3PIOQ 4DQIA 3QATA 1CXUA 3F73A 2HVIA 4WQ4A 3MI7X 3CCSN 4H5TA 2C2OB 3LPUA 2QXLA 4F0KA 2HG4A 4CZIA 1FWPA 2DT9A 2JWKA 1YKWA 4KQZA 3SK3A 2C3MA 4XH5A 3VQAA 5JXSA 4UQTA 1J6ZA 5C24A 3K2PA 3ULEA 2E5LK 2QKKA 1REVA 3QT6A 4LSNB 5KFOA 4DFJA 1TL1B 1Y4ZB 3E01B 3CMEN 3L4BC 3DU6A 1D4XA 1N5YA 3MXJA 3CPWR 2KZZA 1WEXA 1T0TV 2Q0UA 2LA6A 2F9JA 3RAMA 3SCKE 3UCGA 5HVHA 3OVAA 1VMBA 4FOIA 2NXNA 4H0XB 2ALZA 1BO5O 1NSQA 4P2MA 2YQ1A 1D3WA 2Z0GA 4FJJA 4G1QA 2F8MA 1C4AA 3ICLA 2P8IA 4J2DA 4MKYA 1RAAB 3I5AA 2ALYB 4GKJF 4OX8A 1HKBA 1JX4A 4K4ZA 5B09A 1X31C 4JV2A 3PR5B 3THXA 1SQEA 3N6LA 1T05B 1U7LA 4IQXA 2LSNA 3SUQA 1EAYC 3NKYA 3OLAA 4F3MA 4IOAL 3FBEA 4HUFA 2ASJA 4B17A 4QU6A 2GQ2A 4NLXA 4CJRA 2HRUA 1S7HA 3ET6A 1S49A 4NYOA 3AD7C 3EL2A 1DT9A 5AQIA 3C95A 3HT3A 2CQHA 4DPUA 3OYEA 1T9YA 4YR0A 4PUOB 4FLWA 2OTLN 2DY4A 4RR5A 3TAMA 2IJNA 3ZT3A 5GAGI 4OPHA 1F3FA 4PG8A 1S72N 4E19A 5DG7A 2CXEA 1WNSA 3MM5A 4CZKA 3M8QB 3LDQA 4E7LA 4HDHA 2VBYA 4JKAA 3KXDA 4MQ3A 1S6UA 4C48A 2U1AA 1CJTA 4X66F 3DXMB 1ZM4A 2ILYA 2MJUA 3S3MA 1GOAA 2E1YA 5JICA 5HL7L 3B4DA 3UCZP 1BIZA 5T14A 4AHRA 1GXTA 1RYRA 3T1YJ 1MSWD 5L46A 5F8JA 2OPRA 2FQQB 4NE9C 3QGPA 3EGNA 3ITHB 5BN8A 4CZCA 3QEIA 4FLYA 4H4OA 4YY3F 1G4CA 4ECWA 4LVOP 3D0GE 4HTJA 4LF7K 3P96A 4S0MA 4DPXA 4FVMA 3HPOA 3L09A 1NGAA 2ASDA 4ICLA 3Q24A 1S1WA 5E2QA 2UUTA 3FKBA 2MGZA 4A62A 4MTPA 3EGVA 1R6VA 3LTOA 2RSQA 2F96A 1RI7A 4RBUA 2CFXA 1REVB 1ZBTA 2M8DB 4EO6A 3A4TA 4JK8A 2MQ8A 4OI2A 3NXZA 3DDKA 3QFPA 3QRRA 4IXCA 3LANA 1XNQK 2NPFA 1N36F 3OVNA 3H8YA 4FLXA 1N4LA 1YTUA 1XC9A 1X7VA 2RF2A 4R5PA 5ETLA 4TU9A 1VQ4S 4XH4A 4RW8B 4FJNA 4NWBA 2I9SA 1S72S 4KKOB 3LGNA 1KBRA 5BPNA 2C3UA 3H5SA 3VMFB 2JC0A 4J8FA 4DQPA 1QVGM 5ETVA 1X4AA 2IVNA 4G1QB 2XYPB 4OHZA 1CPZA 1RTJA 2ZM6K 4A61A 5AQNA 3DLRA 1QUVA 2B43A 4CJUA 5M2RA 4GW6A 4IZ9A 2CADA 4DOZA 3RMCA 2L48A 5CZ1A 2C2ZB 4FDFA 5HBMA 1UW4A 3GV8B 4DV1K 2EBEA 4F3OA 2LEBA 5A0YB 3MFHA 3R9PA 3M6GA 4G1IA 5KFUA 3VOVA 3UO0A 2DHHA 3HZGA 1S57A 4ZVQB 4Y28C 4C1NI 4Y00A 2C3PA 1HNWF 1O8BA 5HMXA 1JLAA 2PT0A 4BRAA 1UJ6A 2IPOB 3QBCA 4WFBQ 1JMTA 1OY8A 4WFYA 3P6YC 5KFZA 2C28A 3R27A 2Z1IA 4ZJLA 5KT5A 4KHPJ 4NCGA 1V9OA 3OPKA 4EGLA 1WSVA 3OR2B 1WUUA 1TK0A 3CC4S 3QBWA 4UOFA 1SXLA 3W7BA 2XZWA 4N5SA 3S41A 3EZUA 2D4WA 1TUYA 4WU3A 3EYZA 8RUCA 1T9VA 3D4JA 3KVGA 2MHNA 1KLMA 2HFSA 2SXLA 4Z4IA 5KFPA 4NASA 2XMMA 5CHIA 3BKTA 1X4FA 3D2WA 4WFNL 3FZKA 1YQHA 3NWRA 5EX3A 2BE2A 4JI4J 2B8QA 4KTWA 2E44A 2Y1JA 4H4OB 2ZJQL 3EN9A 2KHOA 1FRLA 2IM1A 2ZGZA 3OS0A 1S59A 1EETB 1S0NA 1UEKA 2E5GA 1LW2B 1NDCA 5D0GA 3THVA 1LWFB 2F9DA 3SQ2A 4FJ9A 7AT1B 3H6EA 1NO8A 3QIOA 1XBWA 3UNGC 4CF0A 3GB0A 4XK8C 2PO4A 2V68A 1SL0A 3RW6A 2UUAF 4WYBA 5SWMA 1BHLA 1RWOB 3CCUS 3HLUA 3PO4A 4DTPA 1FXXA 2HBZB 4OYIA 4KH5A 2VODA 1UW9A 1DTTA 4R5PB 1CJKA 3J7AN 4U9RA 4CT9A 2JLGA 2KLAA 3E9PA 1SIWB 3TA0A 4LFBF 2N4DA 2W1BA 1WJ9A 3K8WA 1N5VA 4DU1A 2FZCB 5B0DA 1NPKA 1JKHA 4Z94A 2R7TA 1RTJB 1NGFA 2KM8C 3TSPA 3SQ0A 1W25A 1NPPA 3O08A 4MT1A 2WFBA 4WK1A 4LBHA 4M5LA 3SDEA 5HBMB 3B4MA 1WDDA 1YVFA 3U1MA 4TQRA 3H90A 1S22A 4DQRA 3VQPA 4BRLA 3BZKA 3R5GA 1QTMA 3QNOA 2GC8A 5AXLA 3DRSA 2UXBF 1ZOTA 5EWEA 4AQYF 4DR4K 3IRWP 4X4TA 4BRPA 4A57A 2B5JB 3MAAB 3F0NA 3BH7B 3W65A 1APSA 4N8OA 4O4GA 2HOEA 3T5JA 2RDDA 3OYCA 1QVFR 1Z6RA 1T9WA 2AEFA 1XMQF 4NCGB 3AA9A 3EXYA 4HACA 4WCEQ 2IDOA 1RWXB 4RCHA 3M05A 3RB3A 4I2QA 3HPHA 1PJ7A 5C25A 4JKGA 1SUQA 3I0RA 2AMCB 2NSCA 1ZH5A 4H4MA 3QFUA 4ECQA 1KEKA 5IV3A 4DV3F 1X9MA 1V4TA 4O44A 2HWIA 4PPDA 4R8UA 4ZMMA 2KH9A 2XO6A 4FJ5A 1RGVA 5CXTA 1PYSB 3B54A 4J5OA 2ITMA 2DR7A 1OWXA 3ILJA 2FVSA 4F04B 3F41A 2YX1A 2Q36A 1ZAWA 2OFGX 4PXBA 4FLTA 2A40A 1SQKA 1W7AA 1HQEB 4X64K 4PWUA 4K43A 2BE2B 4V19X 2V94A 2D0PA 4O3OA 4KGVB 1YJVA 2E1CA 1U1PA 2DRBA 3TX0A 3FSYA 2XMWA 1RQ0A 3I9ZA 3W2VB 4BC7A 3UB5A 3DNCA 1WHYA 2R7QA 3NHGA 3HT0A 4FJKA 5KT4A 1ZBLA 3SBMA 2P9SA 2VDIA 2DIUA 4DR3J 1SJ4P 3FJ2A 4JNEA 4FPAA 3W8GA 3QGIA 1LQ9A 1D5AA 4AHCA 1GMVA 5DM7L 4I6AA 2APOA 2X1GA 3IWLA 3IM8A 2V6AA 2UU9K 2KT5A 4IOAQ 1NB7A 2KFZA 1CJKB 1GT8A 2LFVA 4JI0K 1U45A 4ZCMA 1ZS6A 3C2PA 4YEAA 4LQ9A 4FZVA 3T41A 3RR8A 3CVKA 1OMSA 4L3NA 1IKWB 1JKHB 1NDPA 4JI2J 4DPTA 3KLIB 5LOQA 3KKRA 2HFZA 5DGBA 2RT3A 3A3PB 3BR8A 2OA8A 1XNRF 1AA1B 1VQ7S 4A8OA 3BGFA 1TP7A 2QYCA 2MXYA 3D3BJ 4KHRA 4PRFA 2VG7A 3SDEB 3PIPL 2R8JA 3MEKA 3CQYA 3IM9A 3QWUA 5K8OA 3IWNC 1H1VA 2XI2A 2RU3A 2YNIA 1QD1A 1X3MA 1B7FA 3QLHA 2ZGYA 4ZK7M 1K9MT 4DTJA 2VGMA 4ZTJA 1L3SA 5IXUA 4CWBA 4RG8A 5HL7Q 2CPDA 5HROA 5A76A 5C2FA 3M2VB 4EI2A 4EO8A 2D9OA 2FF6A 1KQFB 2NRTA 3KLVA 3CJ7A 4LR9A 4PKHA 3A8IA 1UOCA 1P8ZA 2AP6A 3QDKA 4LFAK 1S99A 4I2QB 1WBDA 4CF8A 4ZLPA 4JKGB 1J5EF 1FNXH 4MK9A 1SUQB 1G3OA 4LF1A 5KG4A 3SFUA 4KYZA 5JUMA 2HF4A 3BGRB 5KFTA 3WXLA 3TO8A 4FWSA 4Q0BA 4J9OA 2IAJA 2OANA 2GMHA 2ZDPA 4HWIA 4GVEA 2HVEA 4M3XA 4FPBA 2QT7A 3VEOA 5IT9U 1DURA 1C4CA 2H5JB 1IBKF 2ZH9A 1LAWA 1HX1A 3ZZYA 1FK9A 4OYPA 4XDDA 3HK2A 1QZ6A 4PL8A 3C94A 1Y9OA 3PTWA 2UUBF 4BRKA 1T03B 3M9OB 2YHBA 5A8KA 2CIMA 1Q4RA 4IO9L 2BDPA 2HNZB 1V5VA 4PXCA 2QLFB 2FJWA 3ZZPA 2VJUA 1LOTB 3IP0A 3BQ0A 1KHVA 4OZ2A 3DLGA 4URQU 3P4UB 3MMCA 1XK8A 3P45B 1MA9B 3SQ4A 4LRCA 4L6V3 5GAHI 3NNAA 3Q8RB 1NEEA 4W5NA 1SPBP 2DNKA 4N77A 3HVRA 2XZTB 3ISNC 4DQSA 1FDAA 3AFGA 2KB2A 4EYHB 3KMQA 2F5GA 2LVWA 4DQ8A 3VGTA 3J81j 4CZFA 3RR7A 3V4MA 5AQLA 3TP2A 4F26A 3GP9A 2HHHJ 4UZBA 2EK1A 3QT8A 5LJWA 2RDIA 2LA4A 2B6AA 4IDKB 3M32A 4PEOA 2VQEJ 4TLQA 1N5TA 3EVOA 3GJTB 3SV4A 3AQPA 3CJQA 3IR5B 4FJ7A 3KHLA 3GCWP 4GKKJ 4M3YA 3VGMA 4CF9A 4Z4GA 4J90A 4DU4A 3QESA 3EPGA 3V4IA 4V1Ak 4JI6K 4ZVTB 4UOCA 1HBMA 2MHEA 4HLBA 4HH1A 3FEYB 2P5VA 2MPUA 4CF1A 2WW4A 2G13A 3PKMA 3HP9A 5IT9Y 3IR7B 3HSJA 1UAXA 3ZZOA 4L74A 3WEEB 3MM8A 4I68A 2HW3A 1IBLK 2VG5A 2J5AA 5C12A 1R31A 4WFNQ 4KV8A 4WZQA 4QU7A 2CQPA 3NBPB 4Z4EA 4GV3A 1JLQA 3HBTA 4OX7A 2ZJQQ 2XNRA 4OKEA 4JYAK 4C3MA 1JLFB 2F9TA 4CLWA 4M3UA 3L2WA 2HRTA 1FVQA 5K20B 1F5AA 4ZCLA 1IG8A 4DUYF 2XCAA 1KQSR 5CE3A 2E2PA 5D6GA 3K5PA 1NHKL 4ZVUB 1WTBA 2D41A 3GJSB 2IAJB 2W7OA 3WHIA 3PVXA 2XB2D 4OLOA 4YORA 4QS7A 3CFRA 1Y64A 1F9FA 2K7KA 2O8DB 1X8DA 2J6TA 3HZ6A 1JLGA 3ZC4A 4P73A 3POTA 2AZ1A 2F4VF 2A6OA 1AYEA 3B8HA 4DXLA 4FJ8A 3Q8UA 2HS4A 3GCXP 2R8HA 4CJEA 2HHXA 3NF8A 5JMVA 1X4HA 2G2YA 3VAIA 3KLGA 4DV2F 4GNIA 3DM2A 2YQ0A 4CNZA 3D2EA 3O1BA 3OR1A 1Z4UA 2V2VA 2ZVSA 1ULRA 3CMAN 3MOZA 2GVDA 3GJRB 4OYOA 3ZSQA 4ZCKA 2W25A 1U0HB 3BV8A 2J0QD 2P9LB 2HVDA 1S9EA 3KLFB 1IM6A 1RT1B 2JC1A 4C11B 2YKPA 4UT4A 4GKJJ 5K8MA 4ZVSB 1RKJA 1SS6A 2PBDA 4YDUA 1FRXA 3MMAA 2AJFE 3K5NA 5B0BA 2HS0A 4ZP8A 1HKCA 3K59A 4OYMA 1HWJA 2OTJN 1YT3A 1NHUA 5DLFA 3D6TB 3M9MB 4K25A 4PCQA 4BBYA 1HWUA 2IYIA 1IO2A 5F8GA 1N33F 3BF3A 5B08A 5FLXO 2GV1A 4FS2A 3M6WA 3VQ4A 2CDRB 2HQCA 4U7CA 2XTJP 3LH2S 4LF9F 3H20A 3MM7A 1GLCG 3RZAA 3O9SA 3CQ8A 1UJ5A 1RLDA 1LWEB 4RBTA 4ES2A 2I0XA 4DFMA 1VHXA 2B9YA 3ZZ0A 4OZLA 4AXJA 3GTYX 5JVHL 3JQJA 2E6LA 2FXUA 3M8SA 3AO2A 2WHOA 1QE1A 1T8EA 4OYAA 1KLNA 4FP9A 3HVTA 1YBAA 4MDBA 1DQAA 3GG1A 2MZSA 3CDUA 2IY5B 1JLQB 3QO9A 5AQXA 4DX5A 2W9BB 4AILC 4F3TA 2XO7A 5AQFA 4BRGA 1K8KA 1Y97A 5BPLA 4YOTA 5CY4A 4I56A 4FL9A 4DLGA 1NSAA 4NZ0A 4B08A 2LQ8A 1PYTA 3RUBL 3PJ9A 1M90T 3VGSA 2D1CA 1KQKA 3TAQA 3LPTA 4F4KA 2V69A 2Z1HA 1FESA 1ZBFA 2YCHA 5DM7Q 1HI0P 3TU5A 1PSDA 3BS9A 4P7VA 4A8MP 4MFBA 3PSIA 4LRDA 3PRDA 1JLGB 4WE1A 3FRZA 2DVIA 2VFSA 1KTQA 3VGUA 5LJVA 4B9LA 3T1YK 3CM6A 4TY8A 3A8JA 1HJRA 2HWHA 3HOSA 3MXHP 3TYTA 2YJFA 1WBBA 6FDRA 2FDNA 1TUGB 4DL2A 1QAYA 3OVSA 1N88A 3JS6A 4DTUA 3D2EB 1HHQA 1Q53A 5AQJA 4I4BA 4LC9B 1QQOA 3PW2A 1OIAA 2Z57B 3LF0A 3TVKA 2ZF5O 2C3YA 3PIPQ 1OKJA 1U1LA 2LEAA 2W01A 4B9SA 3AVLA 3JSYA 2GVDB 2HNDB 3VAHA 4R0EA 2LCWA 4LF8J 3ZTSA 4CJVA 1BOTO 3BQ2A 2V2QA 2DY9A 5B0EA 4K42A 4KAZA 3CETA 1S9EB 3OW2R 1J5OA 2YKOA 3BB5A 5I3PA 1VBKA 3VTHA 3BGLA 1BG3A 1RCXB 1X3NA 5IM0B 1B0TA 3CCTA 3MMAB 3IBFB 4BROA 4B9QA 1IKVB 4K4VA 4W5OA 1ZBIA 3DI6A 4CLTA 1RBAA 3MOJB 3CUNA 4L73A 4AL6A 2CDQA 2RE1A 3QNNA 1CEZA 3DRXA 4CO5A 2W2NP 3GOIA 3J7ZO 5HMZA 2MZRA 3VAFA 5A2QO 2ZC4A 2DNGA 5BR8F 4H8KA 1ELOA 3U1LA 3KLEB 2YKMA 4BR0A 4Y6IA 3BM7A 2FYXA 3BEGB 2XSJA 2LQJA 2CZVC 2HBKA 4OZNA 2WSFC 4USWA 1VQKS 4NI2A 4FWPA 2I1RA 2NUUG 2Y1IA 3MM6A 3AHPA 4LF5F 4YOWA 1NM2A 1UFLA 1FFWB 1WI6A 1SJRA 3ZX0A 1QAJA 4E3SA 3H4DA 4C3LA 4B9VA 3LP2A 5KFIA 3P5BP 1DHMA 2DNRA 4CJKA 3VVTA 3MEEB 4IO9Q 4KHPK 2AZ3A 4I9QA 3CERA 2I7PA 1IH7A 3OQ2A 4DFPA 2GVZA 2O4GA 1SIZA 3SCLE 2ZVIA 2ZHBA 3SZ2A 2OUGA 2HGMA 2W41A 2FVQA 4DTSA 1NOYA 2MYFA 3FCHA 1DLOB 1HIYA 8ATCB 3OYKA 3LUYA 5L39A 4H54A 4OI4A 4KT0C 3ZXWA 4NYZA 2O8BB 1U2FA 4CGDA 3Q83A 3FLCO 1GTEA 2UXDF 3HKZD 2YX6A 2E20A 2VBXA 1RCOB 3GU0A 4YHHF 1NJZA 2DGTA 1ZXOA 4TY8B 1L3VA 3NMAA 1E6YB 4GV9A 4JI4K 4CFBA 2V4JA 4KHMA 4RW9B 3S1TA 4MKVA 1EQMA 4BRDA 4K5RA 1RJJA 4P52A 2IA0A 1A0OB 2WONA 4MKAA 4RNOA 4B9NA 3I5BA 4YOYA 2YVSA 4DPWA 2V9WA 2FIUA 1XUPO 3RBZA 4Z4HA 3CXCR 4KGMA 1S1VB 4LBPA 4O23A 1FX4A 3ISND 4H03B 2QRRA 4IDHA 1C1BB 4KPCA 3R1XA 4LSLA 2R2RA 1WHWA 4ZKAA 1X9WA 3IMXA 4ZN1A 4M8LA 2O8CB 1J9AA 4RWXA 3M2RB 2HF3A 2FBYA 2KYXA 1WOSA 2DD8S 2MQPA 1Y5LB 1WOQA 2F8TA 5DDRC 5CZVA 4E89A 2MLZA 1FJ7A 4ID5A 1UTAA 2G8VA 1S97A 4JLHA 1KONA 2EI5A 3H46O 3CCRN 3KK1A 5AE2A 4EWTA 2YKNB 4HKQA 2D69A 3J81O 2E5IA 4A48A 1YF5L 3DI6B 5AZIA 2RE2A 5G0RA 2MZJA 3HSTB 4BS2A 2UXBJ 4B3SF 4CBXA 2BTFA 1UPPA 1RT4A 3D0HE 2BANB 3VQQA 1OSCA 2RH3A 4OHVA 4H0TB 1HARA 2C1EB 3ZSZA 1A7GE 3MWPA 4M5NA 5J2PA 3CTRA 4J9MA 3OTOJ 4NYFA 4CEFA 2HS3A 1EB0A 2NLXA 3C65A 2YXLA 9RUBA 3SJJA 2PMZD 3VQTA 1N32J 2R7XA 2YWKA 3ZSRA 4Y0WA 1IWGA 3FK4A 4HHJA 1ZTWA 4DV3J 3H0PA 2DH8A 4DQQA 2KYZA 4N7TA 5J2NA 3QMQA 5L8RC 1G15A 3LP2B 4LF6F 1JB0C 5EXWA 5I3UB 2GO9A 4ZJOA 2J6UA 2F7TA 1EARA 1SJ3P 3IFEA 4A8WA 4Q8FA 1TK8A 3BDPA 3RBDA 1FXDA 1X5OA 4FXDA 3MR2A 3M8YA 1JIHA 1YWXA 2DGUA 5M1KA 5ETOA 2A3ZA 3CDEA 2X74A 3J80O 2GWKA 2CVEA 5KFKA 4U96A 2C2EA 4YR2A 3CCES 4Y2AA 5EU7A 1G6BA 2RHSB 2G8KA 5ELZA 2EWSA 2AGPA 1FKAF 3ZX2A 3OS2A 4KGXB 1X5PA 5ETNA 5LSRA 1R7IA 3NGSA 2O66A 4X4PA 4KR0B 2HNYB 2PIIA 4ED6A 3ASMA 4BWJA 3V81B 2P5GA 1FKOA 1JCFA 5L9NA 2FHMA 4OZ3A 3AO4A 1KWMA 3QIDA 1B70B 3G25A 3KHYA 4DR3K 4ECYA 4LSLB 3GPAA 4W4MA 4M5DB 1BA0A 4HTUA 4L3KA 3Q89A 4JI5F 2ZQBA 4U6PA 1J53A 4NLBA 4Q45A 3WIVA 2CGLA 3QPIA 1NGJA 3AA4A 5JVHQ 2UV8A 3IAM9 1XNRJ 4CW7B 3SQ1A 1UVMA 1GMWA 4EFHA 4O5BA 3A13A 2H9ZA 4K8RA 5LXYA 3IRXA 1EKRA 4JI1F 3WQPA 1CBKA 2N3OA 2FVRA 5G0RB 1H6KX 4I2PA 3V5RA 3H5YA 5IOLA 4AFFA 3VWSA 4JKBA 4JI2K 4LUBA 4B3MF 1FRMA 1PO6A 4R25A 4FWLA 4J37A 3TARA 2YHXA 3LPEA 2BM0A 1Y11A 2E7XA 2W9CB 1HNZJ 5KG1A 1S6PB 4DDFA 4C3KA 1U8SA 4MIBA 1SL2A 4BRHA 4DJBA 1S6OA 2QLXA 3IS9A 3OXFA 1ACMB 4PAAA 2P9NB 2X51A 4WFZA 2Y9HA 1MNEA 2Y1RI 1J5EJ 3TAGA 2YV0X 1TKZA 5KFSA 3D0IE 5FPDA 2OHDA 3NF9A 2AU0A 2HAFA 3M6VA 4BRFA 5J2NB 1P27B 3KDOA 4DSLA 1HWKA 2P9CA 3CCWA 4AUKA 1FVSA 2NZCA 2XWXA 4QWBA 2E9TA 2UXCF 4FNIA 1YG0A 4NPOA 3HRGA 4ELTA 4BR9A 2VF3A 2DO0A 1IBKJ 3D0PA 1S5JA 1RA7A 2BM1A 2ZFHA 4K8ZA 4O3NA 3G71S 1SI9A 2AJ4A 4JV1A 2UUBJ 1MG7A 3EGWB 4LD0A 2IYGA 3L3CA 2FLOA 1Q8BA 5KFAA 2V4RA 4OGCA 4KBIA 3MMJA 5E3PA 3M1VB 2KXFA 2OPSB 2M2BA 3AB4B 3HCXA 2LQBA 3BPSP 1SBRA 5FLXU 2IBKA 1HLUA 3U1NA 5AQZA 8AT1B 3SV3A 1VSHA 2YNHA 2J9EA 1KVKA 1RZMA 3RSEB 1YK9A 2P51A 1Q86O 3FE1A 2F8EX 1RAGB 5EDWA 3RBXA 4BG8A 4GMJB 1U1QA 1NCLA 3N01A 4RW7A 1NJXA 3JSMA 3DRYA 4NLRA 3TQ1A 1TELA 2OPQA 1M1GA 3A5OC 2G4BA 2G8UA 2V8VA 1YJ9N 2ZHOA 3LDLA 3NL0A 1X4DA 2HGNA 4ZIWA 4CBWA 2YWFA 4DUTA 2O8FA 3DRPB 1OYDA 1RT3A 3PYDA 3MCSA 3CCQS 2XLJA 2RIJA 4IFYB 3JQKA 5AQGA 1VC5A 2CAJA 1YBTA 4USJC 3UN2A 2X1AA 3PCOB 4QQBA 1RISA 3T1HJ 4D3GA 5DGAA 3HVWA 3B6OA 3D54A 1VQYA 2KW4A 2IJRA 2HHHK 2UV8G 2P9KA 4G6VB 4ZPTR 4IO8A 2OYQA 4DX6A 4UUXA 2VQEK 3TI0A 1HNVA 1QLNA 1WEZA 4UW2A 2FC0A 1NMDA 1S4FA 4USTA 3C6AA 1BCMA 4K7QA 1OY9A 1WKKA 4GKKK 4J2EA 2ZZMA 1LKZA 3DCAA 2DNYA 1XN9A 1Q18A 4LMZA 2BUPA 4H0OA 3KHHA 3MN9A 2CNLB 3UI3A 1NOZA 1Q82O 2E2NA 3O44A 3IDHA 2ZH8A 1HW9A 3US5A 2CWKA 2LP4A 1P9YA 3V6DA 1S12A 2RDJA 3SPYA 3SJHA 5KG0A 1TKZB 4YOUA 3JTNA 2HHPA 2Z2MA 4OLPA 2BRLA 2GWJA 1MU2A 4A8KA 2CJKA 5KPRA 1P1LA 4E7KA 1YJ9S 1IBMJ 3L2RA 5KG3A 3KKFA 5J2MB 2RKIA 3DKDA 1RBRA 5G4DA 2QG9B 3DYAA 4OPJA 2M9KA 1GK8A 3LZIA 1KVAA 2QTDA 4JP8A 5H9FJ 1XR7A 3AGKA 5F3TA 1WSIA 1MROB 2KG0A 3DRRA 1HR0K 2IVFB 3MEDA 1VLYA 2OFHX 4DCHA 5A2QU 2EWHA 2WVBA 2CZ9A 1DRZA 3OL9A 2PYLA 4DV2J 2XM3A 1BLUA 2YNHB 4A8YA 4NB4A 5J1EB 5C10A 5DO2A 3CCMN 3TUPA 2VH7A 5ETTA 1LNQA 2UYTA 1IJEB 4KJIA 3N79A 1FRKA 3G4SN 1VQPN 4DG1A 4WZMA 3SCXA 4CD1A 4O0NA 3ALYA 3THWA 2B51A 1CC7A 2QL5B 4I9LA 3M30A 2ZBIA 2IM3A 3R97A 3Q7BA 4MO4A 5AT1B 1K8AT 4B3RF 1TL7A 1IR1A 2QEXN 4WWSA 1KDNA 1WN7A 3GILA 2BJ8A 3A8KA 2AEJA 2Y0BB 4NCAA 2CJYB 4DBQA 1S0OA 4ECRA 1VQ5N 1RAJA 2PA8D 4FJIA 2XY8A 4RWWA 3AVJA 2HHQA 4PWDB 3MPWA 3DXSX 3SIPB 4Q7AA 1AZSA 4ETXA 5E84A 4GKJK 2ZZTA 4BE0A 1N33J 4B3OA 1RTIB 5FJ4A 2VFUA 3AARA 4C7QA 2M70A 5LL6d 3BZQA 4LF9J 2V2KA 2AV5A 2RU9A 2M0GB 5EUHA 4DV6F 1HNVB 3LDOA 2DO4A 4HDGA 1S0VA 4PA1A 1HPZB 2RN2A 4DLEA 4CHNA 2M5YA 5D77A 1O0PA 1K73T 1R8CA 1KP6A 2ATCB 3CJCA 3PFOA 5LJ5Y 3W8PA 1CJUB 3TUJC 1HBUB 4Z7YA 3OYNA 3TZZA 3Q86A 1Q9YA 1NK7A 2IA6A 3I56N 3VETA 1OO0B 3CCMS 2EXUA 4A5AA 3F5TA 2B3TB 4C9DA 1UWBA 2A41A 1PCAA 4CJ3A 1C0TA 3UDLA 1Z26A 2HPUA 4HCBA 1VC0A 2PYJA 2HBJA 3MAQA 3G4SS 1VQPS 2P9IB 5AQVA 3KTQA 4BWMA 1MU2B 2QWOA 3NGKA 5IZHA 2RVJA 1VJQA 4CJFA 5D0EA 3CQXA 2EC0A 1DZ5A 2F8HA 1CQMA 2F40A 1QHTA 1QQNA 3HSGA 5FRNA 4EK2A 2BJ3A 2GIRA 3J81U 3LL3A 5J2QA 3HMJG 1NGCA 2MJNA 4DV0J 5HOOA 2G0JA 3NMRA 1MWKA 3ZTPA 4QYZJ 3BN7A 4LR7A 2PEHA 2EFQA 2OPPB 3M1FA 2LYVA 1ITGA 2DB1A 3NS7B 1KVIA 1F21A 1TKTA 1CJVA 4HHTA 4ILRA 5KG2A 5GAEU 3VN5A 2QA4N 1VSMA 4A5BA 2EFNA 4N47A 4UUWA 5HRNA 3A5MC 3KK7A 4A59A 5HJYA 4HT7A 2AT1B 5IC4B 2VKRA 3QJPA 3K5LA 4ALZA 5AQKA 4DX8H 4GVLA 4DWIA 3SI8A 1YIJN 4QZVB 5C7PA 4DG1B 4OQJA 1NAQA 3NP5A 3PLAA 3CC2S 5HVFA 4GC6A 5DRKA 2PA3A 1R43A 3BSOA 3GFYA 1RNHA 3GG4A 2G2OA 5D0RA 4IRCA 3JYTA 4B8AB 2DK2A 2B7BB 1I3AA 3CULA 2GGPA 4AF1A 2ITGA 4LF8K 1SKWA 1NU0A 3CEDA 4P2XA 4CEAA 1PJ6A 3AODA 3J80U 1D9FA 1JLBB 4GO5X 3UD5A 5AE3A 4LF7F 1NJYA 4LF2A 4G3IA 1S6QB 2AX1A 3LAMA 2QWPA 5GAEP 1FKPA 3HSDA 3KUHA 1RT2A 4B3OB 4CERA 4FWKA 3VQ7A 3HSZA 1I39A 1XEZA 1RB0A 5F8MA 2B9EA 2Y3YA 4RKUC 1NJIT 2WCXA 4FM0A 2LU2A 4IEIA 1V3SA 4Z37A 2MZ1A 3F44A 1VHIA 4NXNJ 3EPIA 3GV5B 5DZ7A 5GAHP 2ASPA 2BXJA 3R8YA 3VVUA 4CZJA 3HHNB 2A1SA 4HYKA 1C1CB 4F3QA 3TUZC 3LM9A 4IYQA 4I7FA 1ZETA 3CCLN 2ZM6F 3GSIA 4QCLA 2XYHB 2D0AA 3U7JA 1R8PA 1EKEA 3CCJS 4JKFA 3O4WA 2FHOB 2E66A 3T19A 5KGWA 4DV1F 5D8HB 2VC0A 3L7OA 2VG6B 3MD1A 2NSBA 5KFHA 5J2QB 2A0FB 2CQ4A 2PDAA 2QLBB 1UPMB 2XS5A 1YVUA 4IRKA 4DUZJ 3GQCA 4A8XA 4ZVGA 1D0EA 4DCPB 4Y2KA 2J76E 2MKJA 3ATVA 3FQLA 3SSQA 2VCPA 2VV5A 4NOHA 2V7YA 2HLTA 1ZBUA 3MD3A 1J27A 4NLPA 4OJRA 4WKYA 3T5KA 4FF3A 1TMMA 1C0UA 2JEFA 1CJVB 1B64A 3A1YG 4KFBB 3CD5A 4O3RA 3VZHA 1TAUA 1E4FT 1XMOF 4KIAA 2JWLA 3VF4A 1ASWA 3T5HA 2XCPA 4K50A 3M8ZA 1UEVA 5MLCV 1RA6A 3I0SA 2R8GA 3I6PA 3VQEA 2WRMA 3UKUB 5IQ6A 5ETSA 5MLCQ 2R42A 1VQ8N 2D3OR 3MHYA 3K5OA 3CIZA 2VA3A 3P3DA 3GBTA 3CCLS 5LMUK 1HA1A 3LWMA 1BDGA 4FK0A 4RJVA 3C15A 1EIYB 3WX4A 2GGPB 2FJEB 1PC5A 2BEFA 2QWLA 4LR8A 2ZD1A 2PAVA 4B3SJ 1U2VA 5JMNA 2B9WA 2XMKA 2Q6BA 3ENAA 3L4QA 3RWUA 3QYYA 4WXOA 3TX8A 4EUVA 3CD6N 2QI2A 5AZJA 1RT2B 4BHQA 3Q23A 4JD2A 1RP5A 2EBGA 3GFXA 1S5ZA 3LP0B 2H65B 1EWQA 2ROPA 4CO0A 5HP1A 4WTYA 1Q79A 4FF4A 3TR8A 2IM2A 1S7IA 4LF4J 2YX4A 3CJRA 1Y5IB 3GLJA 1TL4A 2UXBK 1T3VA 5CR4A 2OIHA 3OFFA 3U3YA 2JWNA 4QWCA 2KL8A 4TSXA 4CIOA 2HFVA 1NK4A 1AB8A 2VPZB 1RTDA 2N82B 5GMKa 3E9OA 4KH0B 4ZVHA 1F60B 3S8SA 4LF6J 4FF2A 3GE9A 4K41A 4DL6A 3OTOK 3W64A 3PYEA 3ZZTA 3RMBA 1AW0A 4DMZA 2J9CA 4V19S 1RAFB 1JJHA 1N32K 1TU0B 2XHCA 1NB2A 5I42A 4P6QA 4Q2LA 4Z2XA 2IDEA 3T3FA 2Q97A 1WC1A 3FCWA 1S1UB 4QWEA 2ZUAA 2PMWA 2Q31A 3D45A 1VQ8S 1S79A 5FDLA 3FZ2A 2DTJA 4ZP6A 4ZLLA 3H2UB 4DR1J 3PW0A 2I6WA 2ZJPL 4GY2B 2ZE2B 2ZBPA 3VEYA 4FVUA 3MPYA 4OKKA 1XC3A 3KYLA 3O9TA 1A5VA 1OS5A 1LWCB 1TUWA 4DR4F 1TKXB 2G0IA 2K1RA 4E8UA 2V63A 5KFVA 1KOOA 1SCJB 2AF6A 4KI4A 1WOPA 2BKNA 5F3ZA 4ZVPB 2H3GX 2MSTA 2NXCA 3KZBA 1C0MA 2R3VA 1Y5NB 2FHJD 3I55N 4WP3A 2DR5A 4ZVRB 4LQ3A 4CO2A 5C42A 2GMJA 2KN4A 4JI7J 1NGBA 2CQDA 4ZHRA 4AE5A 1U0SA 3KLHA 2Q3PA 4YUDA 5U47A 4TYBA 3WXJA 4CBUA 2RRNA 3NVMA 3MCMA 3OT9A 5AQMA 3TUIC 4JI5J 3PKYA 2AP1A 2RMLA 4ER8A 4Q8EA 3Q8VA 3SAHA 2G8HA 4NLDA 3TA1A 2RUSA 5ETKA 1W9HA 3AVGA 3CM5A 2QLJB 1L5UA 1I51B 3OYIA 4ZCIA 1RBUA 2GEMA 1NMEB 1R27B 3H3NO 4NEZA 4FJLA 5H1SV 4ZTFA 3W5XA 4KHQA 4X64F 1N34K 3QNWB 3DOLB 1NUEA 3PX4A 1LOUA 4RNMA 3CCVN 5BYSA 1P8GA 4ZP7A 5H1SQ 4FNHA 2O5DA 3PYFA 4FOEA 3AAWB 2A1RA 2J0XA 3P1GA 4CZEA 3I33A 3BGUA 2WAQD 2F8SA 1FEHA 3EXCX 4CGGA 2DJWA 5DS7A 4H4KC 4B9UA 3OBWA 1TV6A 4USHA 1OY6A 3TQEA 3FR0A 2V9KA 3ADAC 3AXMA 3CFOA 1K1QA 3R7NB 4AT1B 1VHFA 2EVZA 3BO4A 4IG0B 4BR2A 2UU9F 4BE2A 5BN9A 1HNZK 2HFOA 4JI0F 4K4WA 4TXSA 1S0MA 3WIUA 3J7AP 1KNZA 3T6JA 2ADCA 4ED2A 3M8RA 2QLWA 4EHUA 2UXCJ 2MKKA 2BYCA 1NGEA 3SYZA 4DL7A 5CAAA 1N54B 1BE4A 1J5EK 2ZKUA 4LSNA 2D3ZA 3B6PA 1TL1A 4NX9A 1RBVA 4CEOA 5LT5A 3NMUA 3H5XA 5ADXA 5HMWA 1SJ1A 3P8BB 2C2KB 1FTRA 3KMSA 4EIAA 2JGUA 4B1WB 1U1NA 3IGNA 2XY6A 1EHWA 4CT8A 4F7VA 3M6XA 1QSYA 1I1GA 3GWCA 2A1BA 2WZ1A 4MYUA 1AUDA 1Q8LA 2ZOMA 3UW1A 4BRIA 4CJ4A 2IGIA 1IBKK 4UQGA 1FHTA 3O1WA 2MQMA 4PY5A 2AGOA 2YPZA 2LQ5A 2UUBK 2FZGB 5B0GA 4FJXA 2A5XA 5KFXA 3V9UA 4PQUB 3TWHA 4USVA 4YFUA 3PJWA 1A9NB 1D8YA 2DEIA 1URRA 2W24A 2R7OA 1FO1A 4LFAF 4Y2CA 3T9ZA 1BWVA 1T05A 2MKSA 3IAYA 4O4RA 1WUAA 4LFCJ 3VHQA 2OI2A 3ZTQA 2DRDA 1URNA 1NNDA 2V8DA 4IJAA 4WIQA 3BKFA 4OZ5A 4OVLA 2M88A 1VQNN 5AJ3J 3TAFA 4MH8A 4CP5A 2GBZA 4KTZA 5J1NA 1HKGA 4C6AA 1VK8A 2DY1A 4PUOA 4QJVA 3A12A 1WF1A 1TR0A 2P9UA 1WHXA 1ZA1B 4Y65A 4FF1A 3PV8A 4CIFA 3G8TA 2XY5A 4E1NA 4NLOA 3M8QA 3KIOA 2YY3A 3RRHA 3NGDA 5KFBA 3ZSVA 3J7YU 2AYGA 4F67A 5HMYA 2RQCA 4HHHA 4FYDA 3EZWA 2WB4A 2V7ZA 1Y3JA 2Q1NA 3DXMA 5KG6A 4YMEA 2FC9A 4K4SA 3T1HK 3WXKA 4WF9L 4OFZA 5A6WA 1MWMA 2FC8A 4ZVOB 1B7YB 4CZLA 2GUPA 2KZMA 1IQTA 3WNGA 3FZBA 3ISZA 4KHSA 3ITHA 4ZPCA 2HK3A 4IBNA 2JLFA 3VGLA 1T9UA 4RWTA 2YWHA 2HBMA 2HQDA 2HMPA 4P75A 2IFXA 5D4LA 2VDHA 2CPXA 1SJQA 1U47A 2VGNA 3FUYA 3QQCD 1T3OA 3JAMO 2A2DA 2RD5C 1ZBSA 2HMIB 3G87A 3GIKA 3J7ZT 3TZXA 2VYPA 3J7YP 1V5IB 3RB6A 3BP8A 4RU9A 2QIFA 2JFKA 3R7SB 3Q0AA 2FPHX 3SQGA 2NXEA 1VQNS 2CQ1A 5DETA 2X78A 3AAQA 5CYMB 3W61A 3MR5A 3AVIA 4NRTA 3NAIA 5KT7A 5KQ8A 3D28A 1U8WA 4KB0A 4JI6F 4NMXA 4RW8A 3G0ZA 1IBMK 3NF6A 5GVQA 2M52A 3HKWA 4CHQA 4KKOA 1GLAG 3QINA 3QEXA 3T69A 2XG8A 4ILHA 2M8HA 5GMDA 3FSXA 5DJBA 4H0YB 4I67A 4QIVA 2B9XA 4CO4A 3TTDA 3L8BA 2HKEA 1IBLF 2YKAA 2I5JB 3R5JB 5H9FK 3VQBA 3FRYA 2GNKA 1HL6A 2KG1A 3HHLC 2OAUA 3R6GB 4JYAF 3DFEA 2HGLA 5A0YA 4X4NA 3M6UA 1SAZA 1I3OB 4DV2K 3FMBA 4UZCA 5A8RB 2W40A 2IS3A 4C8ZA 3UR3C 3TSQA 4B3RJ 3TJ8A 1U04A 2QWQA 3QMLA 2VHGA 2W2PP 4F4XA 2YNFB 2FJAB 3KJVA 3W5YA 3M9NB 4UTGA 3TRGA 2VOPA 2CKWA 3ETOA 3MMVA 5CH7B 4MKBA 2F7VA 1VR6A 3IMQJ 2LQ9A 2VFRA 3OL8A 5GINA 5KFJA 2DNHA 4ETZA 2VOOA 2P9UB 1VQ4N 3OR2A 1KFDA 1X1PA 1DBDA 1H38A 3O9RA 2DIVA 1TYQB 3F56A 1XWLA 2RHKA 1REGX 2XGQA 4J2BA 1VRQC 2PFUA 1RHJB 1FT8A 1TMJA 3O5TB 5C15A 2ZBCA 3BO2A 4DV6J 5IWAJ 1F5BA 2OSQA 4FM1A 3MMBB 3M2UB 3S7RA 5M1FA 5IFMA 3D7EO 3HF5A 4ECTA 3IFRA 4K0KJ 1BUXA 1N33K 1ZAVA 2B8PA 2VKZG 4ZVFA 3AVMA 3H1QA 5BRHA 3SBGA 2FUG9 4J9LA 3U3GA 4C8LA 3TABA 4LF9K 3NF7A 2ZJPQ 2HBLA 2G8IA 1U2CA 4OV1A 4YB5A 2QA4G 1RT6B 1FJGJ 3SMPA 4RNNA 2CNNB 4OMFG 3T9NA 3UDEA 4DV4F 5JS1A 4JKHA 3FBBA 3ZNUA 1CVJA 2X3DA 1EETA 2WC9A 3EZ5A 3OYMA 1LW2A 4NLUA 3IBCB 2HB5A 1UVNA 4V19J 1LWFA 2FTRA 2OEMA 1KHWA 4ED3A 3CC4N 3SQGB 1UA1A 3DXBA 2QGFB 1W97L 1NDLA 5IT4A 3A5LC 3CWJA 1GH8A 4C8MA 1S9FA 4P72A 1WG1A 4BVOA 2QKBA 1CULB 3FCVA 5IT0A 2QYGA 4IG3B 1RKIA 1VSDA 4G9ZA 3ZT1A 2JJ4D 4PXEA 3R3TA 1RTHB 3G82B 3C6HA 2YWEA 2HVHA 3VEVA 4ED5A 1MLAA 4DV0K 1W26A 5ITHA 1VI7A 5GMEA 3F2KA 4QR2A 1VDHA 4ZPAA 2W42A 1LW0A 4QYZK 1M5OC 3V1QA 2W4DA 3QICA 5ETRA 3UN3A 2L3MA 3C6UB 3MN5A 3BUZB 3PUFA 4CJLA 3HXMA 3IXQA 3E2EA 1K47A 2WVCA 3R5DA 4M5GA 2KO1A 2HHSA 1CC8A 5D4OA 3G9CA 4FVCA 4YB1P 3J7A1 2B5JA 3CJ1A 3MAAA 2HHWA 1HWLA 3KJVB 1SV5B 3CCUN 4WK3A 2CJBA 3AO5A 4TY9A 3QBXA 3NNHA 3B82A 1OH7A 3PHEA 3VAKA 1Z2ZA 3G6VA 3VGKA 3DXKB 4L72B 5L1JA 3NH1A 3I5CA 3NRBA 5IC6B 4FLUA 3DLKB 1ZM2A 1RK8A 3O6QA 3OHRA 3K0SA 1N56A 1IUJA 1GLJO 4JRPA 4HCCA 5F8NA 1HWIA 1TZ0A 3HPGA 5BYRA 4F50A 3HM8A 5EX0A 1BQNB 1NSKL 1DTQB 4DSIA 1HQEA 1WSJA 3LP3A 1HI8A 4K5SA 4OZJA 4MMOA 3E1YA 4JV5J 1FWKA 3MM9A 3TTCA 1TAQA 3QJJA 2NYHA 4NXNK 4A8FA 4OX9F 4C8KA 4DR5J 3L0QA 1M5VC 1O13A 1XR5A 3W2VA 1WD6A 3ILOA 5AQRA 2IIRA 2JHEA 1Q95G 3CJ3A 5EN1A 4PG6A 5KPZA 2AJ2A 4UY8T 1X0PA 2YWGA 3D1HA 4URGA 4CM2A 1VLOA 3R5BA 1XJWB 5B0AA 2UVVA 2XRIA 2Q43A 1JXBA 4FK2A 3O4QA 2IRYA 3BBCA 2YWWA 3CJAA 3OTDA 3CC7S 3PW5A 4G65A 1WNEA 1P1TA 3MPDA 2BUNA 3OTBA 3MWTA 5JJBA 1MMDA 1F5CA 5EHHA 2XMJA 1O51A 2OEJA 3QIPB 3C14B 1IKWA 2H1YA 2GW8A 3KLIA 1I94J 4FM2A 4MK7A 4DUZK 1XMOJ 3M5RA 2GHVC 3BSCA 1LW0B 5DQGA 1ESVA 4U7UD 5M2PA 2E5HA 2BW7A 2EK6A 1C6VA 2OMLA 1YJNS 4KHPF 1GQEA 3Q7CA 1PILA 1GX6A 2D1KA 4WF9Q 1R0BG 2C3OA 2DFFA 4KSEB 3KJFB 1MW7A 3M2VA 1T7PA 3V1OA 4EEYA 2KI2A 2FGCA 1NSPA 3HHKA 1VRUB 1Z25A 1Q86T 2OJ3A 1NK8A 2K8GA 1EQ0A 4F4ZA 3M3ZA 4J9QA 3BO3A 4GVBA 3CJ5A 3L3VA 4H5RA 4HT5A 4BC2A 2P6TA 3J8AA 5KRTA 4DS5A 4CHPA 2B4PA 3BGRA 4JI3J 3N28A 4JI4F 2CPIA 2CPFA 3D6RA 1VISA 1RWMB 1M1HA 1N0UA 2HHVA 2ASLA 4B3SK 3D5MA 4ZOSA 5E33A 1VQ7N 1YDLA 2R7SA 4WYLA 3HDSA 3KOAA 3K58A 1M5PC 3RYLA 1NHVA 4IFVA 3KDNA 4KH1B 2HQGA 3H7HB 2DHGA 3MM9B 4M5HA 4C98A 3OL6A 3JB9k 4TKTA 4ANEA 2HHTA 1T03A 3A5NC 4LF4K 5ETPA 2HNZA 5K14B 3NG8A 4DHVA 2K3KA 5BXIA 2QMWA 1H2VZ 4PYDA 3MUTP 3KFWX 3SSRA 2G8FA 5JLFA 5EOYA 3D66A 1PG5B 1HQ2A 3LGHA 2KJVA 1T6DA 3S01A 5B0CA 3AV9A 1QTNB 5IS2A 5JVGL 3HD2A 1VFJA 3GFZA 5HRPA 1M0SA 4OPAA 4OPKA 3FZMA 4LH5A 2KXNB 5KFNA 2E2QA 3O5BA 5KOWA 3N5FA 2E1RA 1U6FA 1JWWA 1RDAA 1JJ2M 1QUPA 3DOMA 4QIFA 2O8EB 5IQQA 4YDUC 4ISFA 2W9AA 1RWPB 2AD9A 3O1LA 4DR1K 1JLCB 3EX7B 4ATNA 2KT2A 3MECB 3LOUA 3N6MA 3HHLD 3ENWA 4QPTA 3RMAA 4DN9A 4IDKA 2NRVA 3KK2B 3SQOP 5KRSA 1MDUB 2MQLA 4LBIA 2FB0A 1YJWN 4FZZA 1HYVA 4PZVA 3EO3A 3H2LA 3CG7A 1UMJA 1R3NA 4XTTA 3JAMU 1KVCA 4X65F 2O1PA 4DR2J 3RU0A 4JI7K 4OO1J 3V1RA 1AFIA 4ED0A 5ADXH 2J8SA 2Q66A 1U48A 1WKJA 4BRNA 2HWTA 2V51B 3PHTA 3WEEA 2QK9A 5K8PA 4Y0FA 1Y10A 2V2ZA 3IAS9 2DPJA 2OCEA 4JI5K 2L9NA 4IR9A 3NBPA 3PW7A 4B8CA 4CHZA 4PPZA 1JLFA 4YP3A 4GVBB 1SC4B 2OP5A 1VQON 3OVBA 1RT7B 3EMTA 4GO7X 1MWQA 2NRXA 5BREA 3A0IX 2HEKA 4RPFA 2K2PA 1WC0A 2QE5A 4ECXA 3CYMA 1VQ9S 3AOBA 4XPEA 1O6XA 3C7NA 3ZZZA 4IKFA 2IM0A 4IUFA 1M5HA 2W4PA 3R9LA 2ZZNA 2H51B 4ILJA 1UCNA 4YN3B 4JK9A 1IQZA 2VFVA 1R59O 4CYUB 2GX9A 1U1OA 2W4CA 4EZ9A 1BU6O 2O8DA 1Y0HA 5KT3A 4IFVB 2J7WA 2VUGA 1QAIA 2ASOA 1JXVA 5FD1A 2CZ4A 5M1OA 3ZEUB 5GAEI 1YJWS 2HFUA 4FWMA 3MR7A 4NA3A 3QZ7A 4DCOB 4A46A 4O0IA 3TJ9A 4OHYA 1XHZA 1QZ5A 5FROA 5RUBA 5F8HA 3C46A 4JB8B 2G0CA 5KI6A 4NLSA 5HRRA 3VF0B 3ZETA 3CJ2A 1NGGA 1RAOA 3BQ1A 3DLEB 2UXCK 3RB4A 3AVKA 2DFHA 5SZTA 4KB1A 1FD8A 5DG9A 1NRKA 1HYSB 5FPNA 1NJWA 3AB2B 9ATCB 2V8HA 2IBOA 4DB3A 4C0HA 1U24A 3C19A 2CPZA 1UWAA 1TVRA 3C6TB 1U0HA 2M4MA 1ZBHA 2EG1A 1BWEA 3DOMB 2P9LA 3OYLA 1C1AA 3KLFA 1RT1A 2VASA 4C11A 1VQOS 5AFUA 3KK3B 5I3QA 1TKDA 4DSKA 1R0CB 3LM2A 2FBXA 1YZ6A 1NKCA 3D2FA 1X9JA 2MQOA 1BL3A 1TUVA 3L2VA 1EWRA 3OBYA 4ID1A 2IC3B 4OYBA 4AM6A 1HW8A 4DU3A 3M8PA 2XHWA 3TVYA 4HH0A 2XQCA 1MMLA 2XC9A 2AYBA 3ENHA 4R79A 3NDKA 2V50A 4DV7F 3VR1A 1PGZA 5A8WA 2VD3A 3ZNJ1 3D1OA 1SZ2A 2JL9A 2A10A 3OFEA 4O55A 3E51A 3TR5A 3HM9A 1PAEX 1LWEA 2ACMA 4NL5A 1DAXA 4QOTA 2M7SA 4LFCK 4E7IA 3RJMB 2VB6A 4O8KA 1LCUA 2XMUA 2QA1A 4DL4A 3KWIA 1U1MA 4FJGA 1UVJA 1RDWX 4Y1DA 3IG1B 4CEBA 5AJ3K 4JK7A 2QM1A 3I32A 1TL3B 4WFXA 2W9BA 2AW0A 5T7BA 2WTFA 3AJ2A 4O3SA 1KTVA 1FDNA 1Q81T 2HVZA 3G86A 1W2BM 1QQMA 2DITA 1NGDA 4NYPA 4KH6A 3L9ZA 3AT1B 3P5TL 5JS2A 3HI0A 3CO0P 3C7NB 2NREA 2D0BA 2FJVA 4DV5F 3WQTA 5GADU 1CSJA 4A2AA 3KG0A 2AWZA 1BI4B 4ENOA 2JEJA 4RW6B 4FJMA 5I9EB 2VWJA 2ZOGA 4YDDB 5DQHA 2HAIA 2KVIA 3D7SB 1KFSA 4PKIA 1DQ9A 1YTYA 4NZ6A 3N4WA 2YHYA 2QZ8A 1K1SA 5ETQA 1LK5A 3GIIA 3DLHA 1TUUA 2KVQE 4B3TF 3NS6A 1CLFA 4QR0A 2BBEA 3UPFA 2KDOA 4IH7A 4ZS6A 1F9HA 4M5JA 1YUWA 2HZCA 3PY8A 2R2UA 2NXJA 5CYQB 3WQUA 2P9PB 3QSYB 5LM7E 3PACA 1NK0A 2BV3A