5J3QA

Crystal structure of s. pombe dcp1:edc1 mrna decapping complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
b'DENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
total genus 35
structure length 125
sequence length 125
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3qA00
3WA0A 2EMSA 3N7CA 4GZUA 3KSYA 2ELBA 2VRWB 3PEGA 3ODOA 2RLOA 2K00A 2RGNB 1J19A 1AQCA 2UVMA 4HAWB 2X18A 1FAOA 5JHHA 2L1CA 5C16A 2YS1A 2P0DA 2D9YA 5D3YA 3V5WA 1W1DA 1QQGA 2NZ8B 1TJ6A 3ULCA 4KAXB 1P6SA 2YT1A 1K5DB 5DI9B 1OMWA 4XWXA 2IFSA 2M38A 1N3HA 1V88A 2W2WA 3F5RA 2P8VA 2J0JA 1UNPA 2DHIA 4B6HA 3PSCA 1H10A 4NSWA 1U29A 4HB3B 4NY0A 5DHFB 4EMOA 4TKNA 3FEHA 4DX90 2I5FA 1SGHA 2MKRA 1X05A 3PG7A 5HE3A 1GC7A 5DHAB 2Z0QA 2K2JA 2LOZA 3FM8C 2D2QA 4L6EA 3LJUX 4GMXB 2DX5A 3HQCA 2Y8FA 1TXDA 1XR0B 4KHBB 2L2IA 3SYXA 1ZVRA 1NU2A 1WG7A 5FI0A 5D3VA 1J0WA 2AEHA 1RRPB 2DA0A 3D8DA 2Y8GA 2FJLA 4H8SA 1V89A 2HE7A 2CODA 2ROZB 2RUKB 2EC1A 5JP4A 4DXAB 3D8FA 2PZ1A 5KCVA 3BJIA 2J59M 2ZPYA 1RJ2A 1MIZB 1FHOA 2QKLA 5J3TA 1ZC4B 2W2XC 1DYNA 2H7EA 1U5GA 1GG3A 1NTYA 2LOXA 2UZRA 1DROA 3ODWA 2YS3A 4HAUB 5D3WA 1BAKA 1NI2A 2MFQA 1X1GA 2DFKA 2DKQA 2N23A 5C79A 3HW2B 2D9ZA 4MK0A 2DLWA 1V5UA 4PQ0A 1DDWA 1U2BA 3VIAA 1MAIA 3DXEA 3PZDA 2EJ8A 2DHJA 2D9WA 4GMVA 2D9XA 1BTKA 1V5MA 2Z0OA 2NMBA 2LYDA 1OY2A 5EFXA 2RSGA 3PVLA 1UPQA 4A6FA 4ZRJA 4GPTB 5CLQB 1ISNA 3OANA 2COAA 1X11A 1ZSQA 3TVVA 1XD4A 4HAZB 4HB4B 3IVFA 4IOYX 2CY4A 3PP2A 2XQNM 1KZGA 4CHJA 4HDOA 2ROVA 1KZ7A 5KQ4A 2CY5A 5DIFB 3DXCA 1WI1A 5L81A 2IYBA 2Y7BA 4KHOA 1EF1A 4P7IA 3PVWA 4K81A 4F7HA 2DYQA 2VKIA 1PLSA 5C5BA 3GYOA 4HB0B 3A8PA 3G9WA 1LB1A 2RVBB 4F7GA 4HATB 3AJ4A 1MKEA 4BBKA 3A98B 2CAYA 4CYEA 1B55A 1MK7B 4HAXB 1EGXA 3CIKA 5HE1A 2LG1A 4WVFB 5FI1A 1KI1B 2K2UA 4PNKA 1UEFA 1UPRA 1EVHA 2GS0A 1WGQA 4DBBA 2W2XD 1K5GB 4MT7A 2AL6A 2V76A 1FHXA 3ODXA 2QKMA 1OQNA 3CXBB 5LONB 4GXBA 4HB2B 2MWNB 2N0YA 4IAPA 3TCAA 4IFSA 1V5PA 2D9VA 4K17A 5KQ1A 1FGYA 1U5EA 1WGUA 3FSSA 1SHCA 2Q13A 1XKEA 3HK0A 3KY9A 3SV1A 1WJ1A 1Y19B 3MPXA 2RNRB 5HE0A 1I7AA 2YS5A 3M1IB 2I1KA 3ULBA 3UZTA 2YF0A 2DHKA 5DH9B 2OTXA 2P0HA 3P7ZA 1PMSA 2YRYA 3X23A 2MDXA 2E2XA 4ZRKA 1U27A 1BTNA 4K2PA 1TQZA 1XCGA 1GC6A 1FGZA 4Y94A 1FOEA 3SUZA 4F7UP 3RCPA 2DN6A 2GCJA 4Z2MB 1ZC3B 1WJMA 2OQBA 5GOWB 4D0NB 2I5CA 4TYZA 1QC6A 1V61A 3SNHA 4HAYB 1Y5OA 4EJNA 5CLLB 2G35A 3SO6A 2KUPA 3AU4A 1M7RA 2LULA 3O96A 2UZSA 1W1GA 2ADZA 3QWMA 2YSZA 4Z2NA 1DBHA 4A6HA 1U5FA 2GCLA 4EKUA 1IRSA 3P6AA 5JLJB 3MDBC 3ZVRA 1MIXA 3F0WA 4K2OA 1E5WA 1X1FA 3VOQA 5LOPB 4HAVB 2VSZA 1EAZA 1W1HA 3KRWA 2DKPA 3ML4A 2YT0A 1P3RA 3D8EA 2Z0PA 2D11A 2EMTA 3QIJA 3DXDA 1PFJA 1FHWA 3TFMA 2YVCA 4KHAA 3A8QA 1Z87A 2JP2A 1MPHA 5J3QA 5JHGA 2J0MA 1XODA 4GN1A 2BCJA 2ELAA 2KGXB 1H4RA 2R0DA 1NTVA 4WSFA 2COCA 1ZM0A 2KCJA 1FB8A 4DX8A 3T06A 3ZDTA 1XX0A 5D27A 4YL8A 2DYNA 4C0AA 3U7DA 2DTCA 1BWNA 1WVHA 5D3XA 1P5TA 4A5KA 2H7DA 2P0FA 4A6KA 2CRFA 4ZRIA 1X86A 3U8ZA 4A6FB 2GJYA 1Q67A 2J0KA 2R09A 3BINA 3TO1A 4KVGB 4HHVA 1DDMA 1M7EA 3QBVB 2HTHB 3KZ1A 4YONA 1MK9B 5HE2A 3NSUA 3PVUA 2COFA 2DX1A 3GYPA 4CHMA 1UNRA 1AWEA 4HDQA 3AU5A 4MY6A 1I2HA 3WYFB 3TW1A 2D10A 2I1JA 2D4QA 1U5DA 1LW3A 5C5BB 5C6RA 4WJ7A 1UNQA 1DDVA 2LKOA 3KRXA 5J3YA 2M14A
chains in the Genus database with same CATH superfamily
3WA0A 2EMSA 3N7CA 4GZUA 3KSYA 2ELBA 2VRWB 3PEGA 3ODOA 2RLOA 2K00A 2RGNB 1J19A 1AQCA 1MI1A 2UVMA 4HAWB 2X18A 1FAOA 5JHHA 2L1CA 5C16A 2YS1A 5I2MA 2P0DA 2D9YA 5D3YA 3V5WA 1W1DA 1QQGA 4QXAB 2NZ8B 1TJ6A 3ULCA 4KAXB 1P6SA 2YT1A 1K5DB 5DI9B 1OMWA 4D6WA 4GOUA 4XWXA 2IFSA 2M38A 1N3HA 1V88A 2W2WA 3F5RA 2P8VA 2J0JA 2KIEA 4CSQA 1UNPA 2DHIA 4B6HA 3PSCA 1H10A 4NSWA 1U29A 4HB3B 4NY0A 5DHFB 4EMOA 4TKNA 3FEHA 4DX90 2I5FA 1SGHA 4OSNA 2MKRA 1X05A 3PG7A 5HE3A 1GC7A 5DHAB 2Z0QA 1T77A 2K2JA 2LOZA 3FM8C 2D2QA 4L6EA 3LJUX 4GMXB 2DX5A 3HQCA 2Y8FA 1TXDA 1XR0B 4KHBB 2L2IA 4QJ4B 3SYXA 1ZVRA 1NU2A 1WG7A 5FI0A 5D3VA 1J0WA 2AEHA 1RRPB 2DA0A 3D8DA 2Y8GA 2FJLA 2RRFA 4H8SA 1V89A 2HE7A 2CODA 2ROZB 2RUKB 2EC1A 3NWDA 5JP4A 4DXAB 3D8FA 2PZ1A 5KCVA 3BJIA 2J59M 2ZPYA 1RJ2A 3NW8A 1MIZB 5IRSA 1FHOA 2QKLA 5J3TA 1ZC4B 2W2XC 1DYNA 2H7EA 1U5GA 1GG3A 2FJUB 1NTYA 2LOXA 2UZRA 1DROA 3ODWA 2YS3A 4HAUB 5D3WA 1BAKA 1NI2A 2MFQA 1X1GA 2DFKA 2DKQA 2N23A 5C79A 3HW2B 2D9ZA 4MK0A 2DLWA 1V5UA 4PQ0A 3B77A 1DDWA 1U2BA 3VIAA 1MAIA 3DXEA 3PZDA 2K8EA 2EJ8A 2DHJA 2GUMA 2D9WA 3HSAA 4GMVA 2D9XA 1BTKA 1V5MA 2Z0OA 2NMBA 2LYDA 1OY2A 5EFXA 2RSGA 3PVLA 1UPQA 4A6FA 4ZRJA 4GPTB 5CLQB 1ISNA 3OANA 2COAA 1X11A 1ZSQA 3TVVA 1XD4A 4HAZB 4HB4B 3IVFA 4IOYX 2CY4A 3PP2A 2XQNM 1KZGA 2Z59A 4CHJA 5LG4B 4HDOA 2ROVA 1KZ7A 5KQ4A 2CY5A 5DIFB 3DXCA 1WI1A 5L81A 2IYBA 2Y7BA 4KHOA 1EF1A 4P7IA 3PVWA 4K81A 4F7HA 2DYQA 2VKIA 3FVCA 1PLSA 5C5BA 3GYOA 4HB0B 3A8PA 3G9WA 1LB1A 2RVBB 4F7GA 4DIXA 4HATB 3A58A 3AJ4A 1MKEA 4BBKA 3A98B 3NWAA 2CAYA 4CYEA 1B55A 1MK7B 4HAXB 1EGXA 3CIKA 5HE1A 2LG1A 4WVFB 5FI1A 1KI1B 2K2UA 4PNKA 1UEFA 1UPRA 1EVHA 2GS0A 1WGQA 4DBBA 2W2XD 1K5GB 4MT7A 2AL6A 2V76A 2Z4DA 1FHXA 3ODXA 2QKMA 1OQNA 3CXBB 5LONB 4GXBA 2YT2A 4HB2B 2MWNB 2N0YA 2K49A 4IAPA 3TCAA 4IFSA 1V5PA 2D9VA 4K17A 5KQ1A 1FGYA 1U5EA 1WGUA 3FSSA 1SHCA 2Q13A 1XKEA 3HK0A 3KY9A 5M4YB 3SV1A 1WJ1A 1Y19B 3MPXA 2RNRB 3NWFA 5HE0A 1I7AA 2YS5A 3M1IB 2I1KA 3ULBA 3UZTA 2YF0A 2DHKA 5DH9B 2OTXA 2P0HA 3P7ZA 1PMSA 2YRYA 3X23A 2MDXA 2E2XA 4ZRKA 3OHMB 4KHBA 1U27A 1BTNA 4K2PA 1TQZA 1XCGA 1GC6A 1FGZA 4Y94A 1FOEA 3SUZA 4F7UP 3RCPA 2DN6A 2GCJA 4Z2MB 1ZC3B 1WJMA 2OQBA 5GOWB 4D0NB 2I5CA 4TYZA 1QC6A 1V61A 3SNHA 4HAYB 1Y5OA 4EJNA 5CLLB 2G35A 3SO6A 2KUPA 3AU4A 4OT1A 1M7RA 2LULA 1ZYIA 3O96A 2UZSA 1W1GA 2ADZA 3QWMA 2KUQA 2YSZA 4Z2NA 4QJ3B 1DBHA 4A6HA 1U5FA 2GCLA 4EKUA 1IRSA 3P6AA 5JLJB 4HSIA 3MDBC 3ZVRA 1MIXA 3F0WA 4K2OA 1E5WA 1X1FA 3VOQA 5LOPB 4HAVB 2VSZA 1EAZA 1W1HA 4L1RA 3KRWA 2DKPA 3ML4A 2YT0A 1P3RA 2KIGA 3D8EA 2Z0PA 2D11A 2EMTA 3QIJA 3DXDA 3U12A 1PFJA 1FHWA 3TFMA 2YVCA 4KHAA 5I2SA 3A8QA 1Z87A 2JP2A 1MPHA 5J3QA 5JHGA 2J0MA 1XODA 2Z14A 4GN1A 2BCJA 2ELAA 2KGXB 1H4RA 2R0DA 1NTVA 4WSFA 2COCA 1ZM0A 2KCJA 2Z13A 1FB8A 4DX8A 3T06A 3ZDTA 1XX0A 5D27A 4YL8A 2DYNA 4C0AA 3U7DA 2DTCA 1BWNA 1WVHA 5D3XA 1P5TA 4A5KA 2H7DA 2P0FA 4A6KA 2CRFA 4ZRIA 1X86A 3U8ZA 4A6FB 2GJYA 1Q67A 2J0KA 2R09A 3BINA 3TO1A 4KVGB 4HHVA 1DDMA 1M7EA 3QBVB 2HTHB 3KZ1A 2ZKMX 4YONA 1MK9B 3HIEA 5HE2A 3DCXA 3NSUA 3PVUA 4GNKB 2COFA 2DX1A 3GYPA 4CHMA 1UNRA 2R2YA 1AWEA 4HDQA 3AU5A 4MY6A 1I2HA 3WYFB 3TW1A 4QJ5B 2D10A 2I1JA 2D4QA 1U5DA 1LW3A 5C5BB 5C6RA 4WJ7A 1UNQA 2KR0A 1DDVA 2NBVA 2LKOA 3KRXA 5J3YA 2M14A
chains in the Genus database with same CATH topology
3WA0A 2EMSA 3N7CA 4GZUA 3KSYA 2ELBA 2VRWB 3PEGA 3ODOA 2RLOA 2K00A 2RGNB 1J19A 1AQCA 2UVMA 4HAWB 2X18A 1FAOA 5JHHA 2L1CA 5C16A 2YS1A 2P0DA 2D9YA 5D3YA 3V5WA 1W1DA 1QQGA 2NZ8B 1TJ6A 3ULCA 4KAXB 1P6SA 2YT1A 1K5DB 5DI9B 1OMWA 4XWXA 2IFSA 2M38A 1N3HA 1V88A 2W2WA 3F5RA 2P8VA 2J0JA 1UNPA 2DHIA 4B6HA 3PSCA 1H10A 4NSWA 1U29A 4HB3B 4NY0A 5DHFB 4EMOA 4TKNA 3FEHA 4DX90 2I5FA 1SGHA 2MKRA 1X05A 3PG7A 5HE3A 1GC7A 5DHAB 2Z0QA 2K2JA 2LOZA 3FM8C 2D2QA 4L6EA 3LJUX 4GMXB 2DX5A 3HQCA 2Y8FA 1TXDA 1XR0B 4KHBB 2L2IA 3SYXA 1ZVRA 1NU2A 1WG7A 5FI0A 5D3VA 1J0WA 2AEHA 1RRPB 2DA0A 3D8DA 2Y8GA 2FJLA 4H8SA 1V89A 2HE7A 2CODA 2ROZB 2RUKB 2EC1A 5JP4A 4DXAB 3D8FA 2PZ1A 5KCVA 3BJIA 2J59M 2ZPYA 1RJ2A 1MIZB 1FHOA 2QKLA 5J3TA 1ZC4B 2W2XC 1DYNA 2H7EA 1U5GA 1GG3A 1NTYA 2LOXA 2UZRA 1DROA 3ODWA 2YS3A 4HAUB 5D3WA 1BAKA 1NI2A 2MFQA 1X1GA 2DFKA 2DKQA 2N23A 5C79A 3HW2B 2D9ZA 4MK0A 2DLWA 1V5UA 4PQ0A 1DDWA 1U2BA 3VIAA 1MAIA 3DXEA 3PZDA 2EJ8A 2DHJA 2D9WA 4GMVA 2D9XA 1BTKA 1V5MA 2Z0OA 2NMBA 2LYDA 1OY2A 5EFXA 2RSGA 3PVLA 1UPQA 4A6FA 4ZRJA 4GPTB 5CLQB 1ISNA 3OANA 2COAA 1X11A 1ZSQA 3TVVA 1XD4A 4HAZB 4HB4B 3IVFA 4IOYX 2CY4A 3PP2A 2XQNM 1KZGA 4CHJA 4HDOA 2ROVA 1KZ7A 5KQ4A 2CY5A 5DIFB 3DXCA 1WI1A 5L81A 2IYBA 2Y7BA 4KHOA 1EF1A 4P7IA 3PVWA 4K81A 4F7HA 2DYQA 2VKIA 1PLSA 5C5BA 3GYOA 4HB0B 3A8PA 3G9WA 1LB1A 2RVBB 4F7GA 4HATB 3AJ4A 1MKEA 4BBKA 3A98B 2CAYA 4CYEA 1B55A 1MK7B 4HAXB 1EGXA 3CIKA 5HE1A 2LG1A 4WVFB 5FI1A 1KI1B 2K2UA 4PNKA 1UEFA 1UPRA 1EVHA 2GS0A 1WGQA 4DBBA 2W2XD 1K5GB 4MT7A 2AL6A 2V76A 1FHXA 3ODXA 2QKMA 1OQNA 3CXBB 5LONB 4GXBA 4HB2B 2MWNB 2N0YA 4IAPA 3TCAA 4IFSA 1V5PA 2D9VA 4K17A 5KQ1A 1FGYA 1U5EA 1WGUA 3FSSA 1SHCA 2Q13A 1XKEA 3HK0A 3KY9A 3SV1A 1WJ1A 1Y19B 3MPXA 2RNRB 5HE0A 1I7AA 2YS5A 3M1IB 2I1KA 3ULBA 3UZTA 2YF0A 2DHKA 5DH9B 2OTXA 2P0HA 3P7ZA 1PMSA 2YRYA 3X23A 2MDXA 2E2XA 4ZRKA 1U27A 1BTNA 4K2PA 1TQZA 1XCGA 1GC6A 1FGZA 4Y94A 1FOEA 3SUZA 4F7UP 3RCPA 2DN6A 2GCJA 4Z2MB 1ZC3B 1WJMA 2OQBA 5GOWB 4D0NB 2I5CA 4TYZA 1QC6A 1V61A 3SNHA 4HAYB 1Y5OA 4EJNA 5CLLB 2G35A 3SO6A 2KUPA 3AU4A 1M7RA 2LULA 3O96A 2UZSA 1W1GA 2ADZA 3QWMA 2YSZA 4Z2NA 1DBHA 4A6HA 1U5FA 2GCLA 4EKUA 1IRSA 3P6AA 5JLJB 3MDBC 3ZVRA 1MIXA 3F0WA 4K2OA 1E5WA 1X1FA 3VOQA 5LOPB 4HAVB 2VSZA 1EAZA 1W1HA 3KRWA 2DKPA 3ML4A 2YT0A 1P3RA 3D8EA 2Z0PA 2D11A 2EMTA 3QIJA 3DXDA 1PFJA 1FHWA 3TFMA 2YVCA 4KHAA 3A8QA 1Z87A 2JP2A 1MPHA 5J3QA 5JHGA 2J0MA 1XODA 4GN1A 2BCJA 2ELAA 2KGXB 1H4RA 2R0DA 1NTVA 4WSFA 2COCA 1ZM0A 2KCJA 1FB8A 4DX8A 3T06A 3ZDTA 1XX0A 5D27A 4YL8A 2DYNA 4C0AA 3U7DA 2DTCA 1BWNA 1WVHA 5D3XA 1P5TA 4A5KA 2H7DA 2P0FA 4A6KA 2CRFA 4ZRIA 1X86A 3U8ZA 4A6FB 2GJYA 1Q67A 2J0KA 2R09A 3BINA 3TO1A 4KVGB 4HHVA 1DDMA 1M7EA 3QBVB 2HTHB 3KZ1A 4YONA 1MK9B 5HE2A 3NSUA 3PVUA 2COFA 2DX1A 3GYPA 4CHMA 1UNRA 1AWEA 4HDQA 3AU5A 4MY6A 1I2HA 3WYFB 3TW1A 2D10A 2I1JA 2D4QA 1U5DA 1LW3A 5C5BB 5C6RA 4WJ7A 1UNQA 1DDVA 2LKOA 3KRXA 5J3YA 2M14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA0 A;  2EMS A;  3N7C A;  4GZU A;  3KSY A;  2ELB A;  2VRW B;  3PEG A;  3ODO A;  2RLO A;  2K00 A;  2RGN B;  1J19 A;  1AQC A;  2UVM A;  4HAW B;  2X18 A;  1FAO A;  5JHH A;  2L1C A;  5C16 A;  2YS1 A;  2P0D A;  2D9Y A;  5D3Y A;  3V5W A;  1W1D A;  1QQG A;  2NZ8 B;  1TJ6 A;  3ULC A;  4KAX B;  1P6S A;  2YT1 A;  1K5D B;  5DI9 B;  1OMW A;  4XWX A;  2IFS A;  2M38 A;  1N3H A;  1V88 A;  2W2W A;  3F5R A;  2P8V A;  2J0J A;  1UNP A;  2DHI A;  4B6H A;  3PSC A;  1H10 A;  4NSW A;  1U29 A;  4HB3 B;  4NY0 A;  5DHF B;  4EMO A;  4TKN A;  3FEH A;  4DX9 0;  2I5F A;  1SGH A;  2MKR A;  1X05 A;  3PG7 A;  5HE3 A;  1GC7 A;  5DHA B;  2Z0Q A;  2K2J A;  2LOZ A;  3FM8 C;  2D2Q A;  4L6E A;  3LJU X;  4GMX B;  2DX5 A;  3HQC A;  2Y8F A;  1TXD A;  1XR0 B;  4KHB B;  2L2I A;  3SYX A;  1ZVR A;  1NU2 A;  1WG7 A;  5FI0 A;  5D3V A;  1J0W A;  2AEH A;  1RRP B;  2DA0 A;  3D8D A;  2Y8G A;  2FJL A;  4H8S A;  1V89 A;  2HE7 A;  2COD A;  2ROZ B;  2RUK B;  2EC1 A;  5JP4 A;  4DXA B;  3D8F A;  2PZ1 A;  5KCV A;  3BJI A;  2J59 M;  2ZPY A;  1RJ2 A;  1MIZ B;  1FHO A;  2QKL A;  5J3T A;  1ZC4 B;  2W2X C;  1DYN A;  2H7E A;  1U5G A;  1GG3 A;  1NTY A;  2LOX A;  2UZR A;  1DRO A;  3ODW A;  2YS3 A;  4HAU B;  5D3W A;  1BAK A;  1NI2 A;  2MFQ A;  1X1G A;  2DFK A;  2DKQ A;  2N23 A;  5C79 A;  3HW2 B;  2D9Z A;  4MK0 A;  2DLW A;  1V5U A;  4PQ0 A;  1DDW A;  1U2B A;  3VIA A;  1MAI A;  3DXE A;  3PZD A;  2EJ8 A;  2DHJ A;  2D9W A;  4GMV A;  2D9X A;  1BTK A;  1V5M A;  2Z0O A;  2NMB A;  2LYD A;  1OY2 A;  5EFX A;  2RSG A;  3PVL A;  1UPQ A;  4A6F A;  4ZRJ A;  4GPT B;  5CLQ B;  1ISN A;  3OAN A;  2COA A;  1X11 A;  1ZSQ A;  3TVV A;  1XD4 A;  4HAZ B;  4HB4 B;  3IVF A;  4IOY X;  2CY4 A;  3PP2 A;  2XQN M;  1KZG A;  4CHJ A;  4HDO A;  2ROV A;  1KZ7 A;  5KQ4 A;  2CY5 A;  5DIF B;  3DXC A;  1WI1 A;  5L81 A;  2IYB A;  2Y7B A;  4KHO A;  1EF1 A;  4P7I A;  3PVW A;  4K81 A;  4F7H A;  2DYQ A;  2VKI A;  1PLS A;  5C5B A;  3GYO A;  4HB0 B;  3A8P A;  3G9W A;  1LB1 A;  2RVB B;  4F7G A;  4HAT B;  3AJ4 A;  1MKE A;  4BBK A;  3A98 B;  2CAY A;  4CYE A;  1B55 A;  1MK7 B;  4HAX B;  1EGX A;  3CIK A;  5HE1 A;  2LG1 A;  4WVF B;  5FI1 A;  1KI1 B;  2K2U A;  4PNK A;  1UEF A;  1UPR A;  1EVH A;  2GS0 A;  1WGQ A;  4DBB A;  2W2X D;  1K5G B;  4MT7 A;  2AL6 A;  2V76 A;  1FHX A;  3ODX A;  2QKM A;  1OQN A;  3CXB B;  5LON B;  4GXB A;  4HB2 B;  2MWN B;  2N0Y A;  4IAP A;  3TCA A;  4IFS A;  1V5P A;  2D9V A;  4K17 A;  5KQ1 A;  1FGY A;  1U5E A;  1WGU A;  3FSS A;  1SHC A;  2Q13 A;  1XKE A;  3HK0 A;  3KY9 A;  3SV1 A;  1WJ1 A;  1Y19 B;  3MPX A;  2RNR B;  5HE0 A;  1I7A A;  2YS5 A;  3M1I B;  2I1K A;  3ULB A;  3UZT A;  2YF0 A;  2DHK A;  5DH9 B;  2OTX A;  2P0H A;  3P7Z A;  1PMS A;  2YRY A;  3X23 A;  2MDX A;  2E2X A;  4ZRK A;  1U27 A;  1BTN A;  4K2P A;  1TQZ A;  1XCG A;  1GC6 A;  1FGZ A;  4Y94 A;  1FOE A;  3SUZ A;  4F7U P;  3RCP A;  2DN6 A;  2GCJ A;  4Z2M B;  1ZC3 B;  1WJM A;  2OQB A;  5GOW B;  4D0N B;  2I5C A;  4TYZ A;  1QC6 A;  1V61 A;  3SNH A;  4HAY B;  1Y5O A;  4EJN A;  5CLL B;  2G35 A;  3SO6 A;  2KUP A;  3AU4 A;  1M7R A;  2LUL A;  3O96 A;  2UZS A;  1W1G A;  2ADZ A;  3QWM A;  2YSZ A;  4Z2N A;  1DBH A;  4A6H A;  1U5F A;  2GCL A;  4EKU A;  1IRS A;  3P6A A;  5JLJ B;  3MDB C;  3ZVR A;  1MIX A;  3F0W A;  4K2O A;  1E5W A;  1X1F A;  3VOQ A;  5LOP B;  4HAV B;  2VSZ A;  1EAZ A;  1W1H A;  3KRW A;  2DKP A;  3ML4 A;  2YT0 A;  1P3R A;  3D8E A;  2Z0P A;  2D11 A;  2EMT A;  3QIJ A;  3DXD A;  1PFJ A;  1FHW A;  3TFM A;  2YVC A;  4KHA A;  3A8Q A;  1Z87 A;  2JP2 A;  1MPH A;  5J3Q A;  5JHG A;  2J0M A;  1XOD A;  4GN1 A;  2BCJ A;  2ELA A;  2KGX B;  1H4R A;  2R0D A;  1NTV A;  4WSF A;  2COC A;  1ZM0 A;  2KCJ A;  1FB8 A;  4DX8 A;  3T06 A;  3ZDT A;  1XX0 A;  5D27 A;  4YL8 A;  2DYN A;  4C0A A;  3U7D A;  2DTC A;  1BWN A;  1WVH A;  5D3X A;  1P5T A;  4A5K A;  2H7D A;  2P0F A;  4A6K A;  2CRF A;  4ZRI A;  1X86 A;  3U8Z A;  4A6F B;  2GJY A;  1Q67 A;  2J0K A;  2R09 A;  3BIN A;  3TO1 A;  4KVG B;  4HHV A;  1DDM A;  1M7E A;  3QBV B;  2HTH B;  3KZ1 A;  4YON A;  1MK9 B;  5HE2 A;  3NSU A;  3PVU A;  2COF A;  2DX1 A;  3GYP A;  4CHM A;  1UNR A;  1AWE A;  4HDQ A;  3AU5 A;  4MY6 A;  1I2H A;  3WYF B;  3TW1 A;  2D10 A;  2I1J A;  2D4Q A;  1U5D A;  1LW3 A;  5C5B B;  5C6R A;  4WJ7 A;  1UNQ A;  1DDV A;  2LKO A;  3KRX A;  5J3Y A;  2M14 A; 
#chains in the Genus database with same CATH topology
 3WA0 A;  2EMS A;  3N7C A;  4GZU A;  3KSY A;  2ELB A;  2VRW B;  3PEG A;  3ODO A;  2RLO A;  2K00 A;  2RGN B;  1J19 A;  1AQC A;  1MI1 A;  2UVM A;  4HAW B;  2X18 A;  1FAO A;  5JHH A;  2L1C A;  5C16 A;  2YS1 A;  5I2M A;  2P0D A;  2D9Y A;  5D3Y A;  3V5W A;  1W1D A;  1QQG A;  4QXA B;  2NZ8 B;  1TJ6 A;  3ULC A;  4KAX B;  1P6S A;  2YT1 A;  1K5D B;  5DI9 B;  1OMW A;  4D6W A;  4GOU A;  4XWX A;  2IFS A;  2M38 A;  1N3H A;  1V88 A;  2W2W A;  3F5R A;  2P8V A;  2J0J A;  2KIE A;  4CSQ A;  1UNP A;  2DHI A;  4B6H A;  3PSC A;  1H10 A;  4NSW A;  1U29 A;  4HB3 B;  4NY0 A;  5DHF B;  4EMO A;  4TKN A;  3FEH A;  4DX9 0;  2I5F A;  1SGH A;  4OSN A;  2MKR A;  1X05 A;  3PG7 A;  5HE3 A;  1GC7 A;  5DHA B;  2Z0Q A;  1T77 A;  2K2J A;  2LOZ A;  3FM8 C;  2D2Q A;  4L6E A;  3LJU X;  4GMX B;  2DX5 A;  3HQC A;  2Y8F A;  1TXD A;  1XR0 B;  4KHB B;  2L2I A;  4QJ4 B;  3SYX A;  1ZVR A;  1NU2 A;  1WG7 A;  5FI0 A;  5D3V A;  1J0W A;  2AEH A;  1RRP B;  2DA0 A;  3D8D A;  2Y8G A;  2FJL A;  2RRF A;  4H8S A;  1V89 A;  2HE7 A;  2COD A;  2ROZ B;  2RUK B;  2EC1 A;  3NWD A;  5JP4 A;  4DXA B;  3D8F A;  2PZ1 A;  5KCV A;  3BJI A;  2J59 M;  2ZPY A;  1RJ2 A;  3NW8 A;  1MIZ B;  5IRS A;  1FHO A;  2QKL A;  5J3T A;  1ZC4 B;  2W2X C;  1DYN A;  2H7E A;  1U5G A;  1GG3 A;  2FJU B;  1NTY A;  2LOX A;  2UZR A;  1DRO A;  3ODW A;  2YS3 A;  4HAU B;  5D3W A;  1BAK A;  1NI2 A;  2MFQ A;  1X1G A;  2DFK A;  2DKQ A;  2N23 A;  5C79 A;  3HW2 B;  2D9Z A;  4MK0 A;  2DLW A;  1V5U A;  4PQ0 A;  3B77 A;  1DDW A;  1U2B A;  3VIA A;  1MAI A;  3DXE A;  3PZD A;  2K8E A;  2EJ8 A;  2DHJ A;  2GUM A;  2D9W A;  3HSA A;  4GMV A;  2D9X A;  1BTK A;  1V5M A;  2Z0O A;  2NMB A;  2LYD A;  1OY2 A;  5EFX A;  2RSG A;  3PVL A;  1UPQ A;  4A6F A;  4ZRJ A;  4GPT B;  5CLQ B;  1ISN A;  3OAN A;  2COA A;  1X11 A;  1ZSQ A;  3TVV A;  1XD4 A;  4HAZ B;  4HB4 B;  3IVF A;  4IOY X;  2CY4 A;  3PP2 A;  2XQN M;  1KZG A;  2Z59 A;  4CHJ A;  5LG4 B;  4HDO A;  2ROV A;  1KZ7 A;  5KQ4 A;  2CY5 A;  5DIF B;  3DXC A;  1WI1 A;  5L81 A;  2IYB A;  2Y7B A;  4KHO A;  1EF1 A;  4P7I A;  3PVW A;  4K81 A;  4F7H A;  2DYQ A;  2VKI A;  3FVC A;  1PLS A;  5C5B A;  3GYO A;  4HB0 B;  3A8P A;  3G9W A;  1LB1 A;  2RVB B;  4F7G A;  4DIX A;  4HAT B;  3A58 A;  3AJ4 A;  1MKE A;  4BBK A;  3A98 B;  3NWA A;  2CAY A;  4CYE A;  1B55 A;  1MK7 B;  4HAX B;  1EGX A;  3CIK A;  5HE1 A;  2LG1 A;  4WVF B;  5FI1 A;  1KI1 B;  2K2U A;  4PNK A;  1UEF A;  1UPR A;  1EVH A;  2GS0 A;  1WGQ A;  4DBB A;  2W2X D;  1K5G B;  4MT7 A;  2AL6 A;  2V76 A;  2Z4D A;  1FHX A;  3ODX A;  2QKM A;  1OQN A;  3CXB B;  5LON B;  4GXB A;  2YT2 A;  4HB2 B;  2MWN B;  2N0Y A;  2K49 A;  4IAP A;  3TCA A;  4IFS A;  1V5P A;  2D9V A;  4K17 A;  5KQ1 A;  1FGY A;  1U5E A;  1WGU A;  3FSS A;  1SHC A;  2Q13 A;  1XKE A;  3HK0 A;  3KY9 A;  5M4Y B;  3SV1 A;  1WJ1 A;  1Y19 B;  3MPX A;  2RNR B;  3NWF A;  5HE0 A;  1I7A A;  2YS5 A;  3M1I B;  2I1K A;  3ULB A;  3UZT A;  2YF0 A;  2DHK A;  5DH9 B;  2OTX A;  2P0H A;  3P7Z A;  1PMS A;  2YRY A;  3X23 A;  2MDX A;  2E2X A;  4ZRK A;  3OHM B;  4KHB A;  1U27 A;  1BTN A;  4K2P A;  1TQZ A;  1XCG A;  1GC6 A;  1FGZ A;  4Y94 A;  1FOE A;  3SUZ A;  4F7U P;  3RCP A;  2DN6 A;  2GCJ A;  4Z2M B;  1ZC3 B;  1WJM A;  2OQB A;  5GOW B;  4D0N B;  2I5C A;  4TYZ A;  1QC6 A;  1V61 A;  3SNH A;  4HAY B;  1Y5O A;  4EJN A;  5CLL B;  2G35 A;  3SO6 A;  2KUP A;  3AU4 A;  4OT1 A;  1M7R A;  2LUL A;  1ZYI A;  3O96 A;  2UZS A;  1W1G A;  2ADZ A;  3QWM A;  2KUQ A;  2YSZ A;  4Z2N A;  4QJ3 B;  1DBH A;  4A6H A;  1U5F A;  2GCL A;  4EKU A;  1IRS A;  3P6A A;  5JLJ B;  4HSI A;  3MDB C;  3ZVR A;  1MIX A;  3F0W A;  4K2O A;  1E5W A;  1X1F A;  3VOQ A;  5LOP B;  4HAV B;  2VSZ A;  1EAZ A;  1W1H A;  4L1R A;  3KRW A;  2DKP A;  3ML4 A;  2YT0 A;  1P3R A;  2KIG A;  3D8E A;  2Z0P A;  2D11 A;  2EMT A;  3QIJ A;  3DXD A;  3U12 A;  1PFJ A;  1FHW A;  3TFM A;  2YVC A;  4KHA A;  5I2S A;  3A8Q A;  1Z87 A;  2JP2 A;  1MPH A;  5J3Q A;  5JHG A;  2J0M A;  1XOD A;  2Z14 A;  4GN1 A;  2BCJ A;  2ELA A;  2KGX B;  1H4R A;  2R0D A;  1NTV A;  4WSF A;  2COC A;  1ZM0 A;  2KCJ A;  2Z13 A;  1FB8 A;  4DX8 A;  3T06 A;  3ZDT A;  1XX0 A;  5D27 A;  4YL8 A;  2DYN A;  4C0A A;  3U7D A;  2DTC A;  1BWN A;  1WVH A;  5D3X A;  1P5T A;  4A5K A;  2H7D A;  2P0F A;  4A6K A;  2CRF A;  4ZRI A;  1X86 A;  3U8Z A;  4A6F B;  2GJY A;  1Q67 A;  2J0K A;  2R09 A;  3BIN A;  3TO1 A;  4KVG B;  4HHV A;  1DDM A;  1M7E A;  3QBV B;  2HTH B;  3KZ1 A;  2ZKM X;  4YON A;  1MK9 B;  3HIE A;  5HE2 A;  3DCX A;  3NSU A;  3PVU A;  4GNK B;  2COF A;  2DX1 A;  3GYP A;  4CHM A;  1UNR A;  2R2Y A;  1AWE A;  4HDQ A;  3AU5 A;  4MY6 A;  1I2H A;  3WYF B;  3TW1 A;  4QJ5 B;  2D10 A;  2I1J A;  2D4Q A;  1U5D A;  1LW3 A;  5C5B B;  5C6R A;  4WJ7 A;  1UNQ A;  2KR0 A;  1DDV A;  2NBV A;  2LKO A;  3KRX A;  5J3Y A;  2M14 A; 
#chains in the Genus database with same CATH homology
 3WA0 A;  2EMS A;  3N7C A;  4GZU A;  3KSY A;  2ELB A;  2VRW B;  3PEG A;  3ODO A;  2RLO A;  2K00 A;  2RGN B;  1J19 A;  1AQC A;  2UVM A;  4HAW B;  2X18 A;  1FAO A;  5JHH A;  2L1C A;  5C16 A;  2YS1 A;  2P0D A;  2D9Y A;  5D3Y A;  3V5W A;  1W1D A;  1QQG A;  2NZ8 B;  1TJ6 A;  3ULC A;  4KAX B;  1P6S A;  2YT1 A;  1K5D B;  5DI9 B;  1OMW A;  4XWX A;  2IFS A;  2M38 A;  1N3H A;  1V88 A;  2W2W A;  3F5R A;  2P8V A;  2J0J A;  1UNP A;  2DHI A;  4B6H A;  3PSC A;  1H10 A;  4NSW A;  1U29 A;  4HB3 B;  4NY0 A;  5DHF B;  4EMO A;  4TKN A;  3FEH A;  4DX9 0;  2I5F A;  1SGH A;  2MKR A;  1X05 A;  3PG7 A;  5HE3 A;  1GC7 A;  5DHA B;  2Z0Q A;  2K2J A;  2LOZ A;  3FM8 C;  2D2Q A;  4L6E A;  3LJU X;  4GMX B;  2DX5 A;  3HQC A;  2Y8F A;  1TXD A;  1XR0 B;  4KHB B;  2L2I A;  3SYX A;  1ZVR A;  1NU2 A;  1WG7 A;  5FI0 A;  5D3V A;  1J0W A;  2AEH A;  1RRP B;  2DA0 A;  3D8D A;  2Y8G A;  2FJL A;  4H8S A;  1V89 A;  2HE7 A;  2COD A;  2ROZ B;  2RUK B;  2EC1 A;  5JP4 A;  4DXA B;  3D8F A;  2PZ1 A;  5KCV A;  3BJI A;  2J59 M;  2ZPY A;  1RJ2 A;  1MIZ B;  1FHO A;  2QKL A;  5J3T A;  1ZC4 B;  2W2X C;  1DYN A;  2H7E A;  1U5G A;  1GG3 A;  1NTY A;  2LOX A;  2UZR A;  1DRO A;  3ODW A;  2YS3 A;  4HAU B;  5D3W A;  1BAK A;  1NI2 A;  2MFQ A;  1X1G A;  2DFK A;  2DKQ A;  2N23 A;  5C79 A;  3HW2 B;  2D9Z A;  4MK0 A;  2DLW A;  1V5U A;  4PQ0 A;  1DDW A;  1U2B A;  3VIA A;  1MAI A;  3DXE A;  3PZD A;  2EJ8 A;  2DHJ A;  2D9W A;  4GMV A;  2D9X A;  1BTK A;  1V5M A;  2Z0O A;  2NMB A;  2LYD A;  1OY2 A;  5EFX A;  2RSG A;  3PVL A;  1UPQ A;  4A6F A;  4ZRJ A;  4GPT B;  5CLQ B;  1ISN A;  3OAN A;  2COA A;  1X11 A;  1ZSQ A;  3TVV A;  1XD4 A;  4HAZ B;  4HB4 B;  3IVF A;  4IOY X;  2CY4 A;  3PP2 A;  2XQN M;  1KZG A;  4CHJ A;  4HDO A;  2ROV A;  1KZ7 A;  5KQ4 A;  2CY5 A;  5DIF B;  3DXC A;  1WI1 A;  5L81 A;  2IYB A;  2Y7B A;  4KHO A;  1EF1 A;  4P7I A;  3PVW A;  4K81 A;  4F7H A;  2DYQ A;  2VKI A;  1PLS A;  5C5B A;  3GYO A;  4HB0 B;  3A8P A;  3G9W A;  1LB1 A;  2RVB B;  4F7G A;  4HAT B;  3AJ4 A;  1MKE A;  4BBK A;  3A98 B;  2CAY A;  4CYE A;  1B55 A;  1MK7 B;  4HAX B;  1EGX A;  3CIK A;  5HE1 A;  2LG1 A;  4WVF B;  5FI1 A;  1KI1 B;  2K2U A;  4PNK A;  1UEF A;  1UPR A;  1EVH A;  2GS0 A;  1WGQ A;  4DBB A;  2W2X D;  1K5G B;  4MT7 A;  2AL6 A;  2V76 A;  1FHX A;  3ODX A;  2QKM A;  1OQN A;  3CXB B;  5LON B;  4GXB A;  4HB2 B;  2MWN B;  2N0Y A;  4IAP A;  3TCA A;  4IFS A;  1V5P A;  2D9V A;  4K17 A;  5KQ1 A;  1FGY A;  1U5E A;  1WGU A;  3FSS A;  1SHC A;  2Q13 A;  1XKE A;  3HK0 A;  3KY9 A;  3SV1 A;  1WJ1 A;  1Y19 B;  3MPX A;  2RNR B;  5HE0 A;  1I7A A;  2YS5 A;  3M1I B;  2I1K A;  3ULB A;  3UZT A;  2YF0 A;  2DHK A;  5DH9 B;  2OTX A;  2P0H A;  3P7Z A;  1PMS A;  2YRY A;  3X23 A;  2MDX A;  2E2X A;  4ZRK A;  1U27 A;  1BTN A;  4K2P A;  1TQZ A;  1XCG A;  1GC6 A;  1FGZ A;  4Y94 A;  1FOE A;  3SUZ A;  4F7U P;  3RCP A;  2DN6 A;  2GCJ A;  4Z2M B;  1ZC3 B;  1WJM A;  2OQB A;  5GOW B;  4D0N B;  2I5C A;  4TYZ A;  1QC6 A;  1V61 A;  3SNH A;  4HAY B;  1Y5O A;  4EJN A;  5CLL B;  2G35 A;  3SO6 A;  2KUP A;  3AU4 A;  1M7R A;  2LUL A;  3O96 A;  2UZS A;  1W1G A;  2ADZ A;  3QWM A;  2YSZ A;  4Z2N A;  1DBH A;  4A6H A;  1U5F A;  2GCL A;  4EKU A;  1IRS A;  3P6A A;  5JLJ B;  3MDB C;  3ZVR A;  1MIX A;  3F0W A;  4K2O A;  1E5W A;  1X1F A;  3VOQ A;  5LOP B;  4HAV B;  2VSZ A;  1EAZ A;  1W1H A;  3KRW A;  2DKP A;  3ML4 A;  2YT0 A;  1P3R A;  3D8E A;  2Z0P A;  2D11 A;  2EMT A;  3QIJ A;  3DXD A;  1PFJ A;  1FHW A;  3TFM A;  2YVC A;  4KHA A;  3A8Q A;  1Z87 A;  2JP2 A;  1MPH A;  5J3Q A;  5JHG A;  2J0M A;  1XOD A;  4GN1 A;  2BCJ A;  2ELA A;  2KGX B;  1H4R A;  2R0D A;  1NTV A;  4WSF A;  2COC A;  1ZM0 A;  2KCJ A;  1FB8 A;  4DX8 A;  3T06 A;  3ZDT A;  1XX0 A;  5D27 A;  4YL8 A;  2DYN A;  4C0A A;  3U7D A;  2DTC A;  1BWN A;  1WVH A;  5D3X A;  1P5T A;  4A5K A;  2H7D A;  2P0F A;  4A6K A;  2CRF A;  4ZRI A;  1X86 A;  3U8Z A;  4A6F B;  2GJY A;  1Q67 A;  2J0K A;  2R09 A;  3BIN A;  3TO1 A;  4KVG B;  4HHV A;  1DDM A;  1M7E A;  3QBV B;  2HTH B;  3KZ1 A;  4YON A;  1MK9 B;  5HE2 A;  3NSU A;  3PVU A;  2COF A;  2DX1 A;  3GYP A;  4CHM A;  1UNR A;  1AWE A;  4HDQ A;  3AU5 A;  4MY6 A;  1I2H A;  3WYF B;  3TW1 A;  2D10 A;  2I1J A;  2D4Q A;  1U5D A;  1LW3 A;  5C5B B;  5C6R A;  4WJ7 A;  1UNQ A;  1DDV A;  2LKO A;  3KRX A;  5J3Y A;  2M14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...