5J3QA

Crystal structure of s. pombe dcp1:edc1 mrna decapping complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
DENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
total genus 35
structure length 125
sequence length 125
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3qA00
2KCJA 2YT1A 1Y5OA 4HB0B 2D9YA 3PP2A 1KZ7A 2EMTA 1MIZB 1N3HA 3MDBC 1V5MA 1ZSQA 4A6FA 4CYEA 2YF0A 1MIXA 3ZVRA 4Y94A 2YVCA 2AEHA 3VIAA 3OANA 5DHFB 2ADZA 3QBVB 1KZGA 1U5DA 1U2BA 1NTVA 2LULA 1SGHA 1H10A 3HQCA 1W1HA 2COFA 5D3YA 5EFXA 2I5CA 2VKIA 1FAOA 2AL6A 3WYFB 1U5FA 4K2OA 3TW1A 3ZDTA 1U5GA 2H7EA 2ROZB 3RCPA 2GCJA 2DKPA 3PZDA 1U29A 1MAIA 1XCGA 1Q67A 2RGNB 4DXAB 4EKUA 1DDMA 3PEGA 4F7UP 3TVVA 3FEHA 2ZPYA 2G35A 2R0DA 4TKNA 2HTHB 1V5UA 3QWMA 1M7RA 4IFSA 4EMOA 2DX1A 4KVGB 5JP4A 2YS3A 2EJ8A 2D9WA 4DX8A 3SO6A 1Y19B 5HE2A 5J3QA 2MKRA 1WJ1A 3LJUX 2D9ZA 3V5WA 2W2XC 1DDVA 1W1DA 4KHOA 1WG7A 2UVMA 5KQ1A 4HDQA 3KRWA 2MFQA 3PSCA 1EF1A 2P0DA 2RNRB 2DA0A 4A6HA 5JHGA 5D3XA 3SNHA 3X23A 3BINA 5DHAB 4EJNA 2LOXA 2Z0QA 1ZC3B 4ZRJA 3TO1A 3DXEA 5GOWB 4IOYX 3FSSA 1XR0B 1J0WA 4BBKA 4HAUB 1XKEA 1TJ6A 1WGUA 4PQ0A 3F5RA 1V89A 5L81A 4YL8A 2YRYA 2X18A 3ULBA 2Q13A 2Y7BA 2FJLA 1AQCA 2I5FA 3ODWA 5JLJB 3KY9A 3AU4A 3PVLA 1UEFA 3ULCA 1FGYA 1X1FA 1WVHA 1U5EA 1DROA 4Z2MB 5JHHA 2UZSA 2KUPA 2N23A 3D8FA 1TXDA 2CODA 4NY0A 1FHOA 2DFKA 2ELBA 1BTKA 5CLQB 3F0WA 1PFJA 3VOQA 3DXCA 1FOEA 3U8ZA 2CRFA 1LW3A 2J0MA 1DDWA 1P3RA 4GZUA 4F7GA 3HK0A 2D2QA 2OQBA 1MPHA 3AU5A 1FB8A 2D4QA 1UNRA 2DHIA 2LG1A 1PLSA 1UNQA 1RRPB 3SUZA 1X11A 1Z87A 1QC6A 2GCLA 1K5DB 2CAYA 1EVHA 2J59M 1BTNA 1I7AA 1X1GA 1IRSA 4IAPA 5C5BA 2DLWA 1DYNA 5D3WA 3D8DA 2MWNB 1KI1B 2YT0A 2DN6A 1ISNA 4CHMA 1K5GB 1ZC4B 4HATB 1UPRA 3N7CA 4HAYB 4A6FB 4HDOA 2RSGA 1XODA 2YSZA 1OY2A 1OMWA 1W1GA 2H7DA 2ROVA 3DXDA 2HE7A 2Z0PA 1GC6A 4DBBA 2COCA 1DBHA 5C6RA 3GYPA 4L6EA 2M38A 4NSWA 1MK7B 1ZM0A 2R09A 2P0FA 3GYOA 2W2WA 1RJ2A 1OQNA 3P7ZA 1EAZA 3HW2B 2DHJA 1GG3A 2IYBA 5KQ4A 1PMSA 5LONB 2M14A 2UZRA 1LB1A 4TYZA 2VRWB 1AWEA 2DYNA 4HB2B 2DKQA 2LKOA 2VSZA 3KZ1A 4A6KA 4A5KA 2K2JA 2J0KA 1SHCA 4KHAA 1XD4A 4F7HA 3M1IB 2KGXB 3ODXA 3TCAA 3U7DA 2Y8FA 4GXBA 2K00A 1WGQA 1V88A 4K17A 2PZ1A 4WSFA 2OTXA 1GC7A 4KHBB 4PNKA 2P0HA 1WI1A 4HAXB 4GN1A 3A98B 3ML4A 1I2HA 5DI9B 5C16A 1NI2A 2MDXA 2E2XA 3KRXA 2CY5A 2D10A 4XWXA 4YONA 1UNPA 3P6AA 2J0JA 5HE0A 3AJ4A 3G9WA 4HB4B 5J3TA 2L2IA 2YS5A 4HAZB 2I1JA 3D8EA 4K2PA 2NZ8B 4ZRKA 3SYXA 3WA0A 1MK9B 1J19A 5HE1A 3A8QA 3CXBB 1X86A 2CY4A 1FGZA 2EMSA 2LYDA 3T06A 2RVBB 4HHVA 4MK0A 1V61A 2DYQA 2D11A 1TQZA 2XQNM 4K81A 5HE3A 1MKEA 1UPQA 2Y8GA 2L1CA 5J3YA 1FHWA 2QKMA 1EGXA 3FM8C 4B6HA 3O96A 2D9VA 4GMVA 3BJIA 2GS0A 2ELAA 4GMXB 5CLLB 1QQGA 5KCVA 2V76A 2YS1A 5D27A 1M7EA 3NSUA 2LOZA 1V5PA 3KSYA 1BWNA 2BCJA 2P8VA 2QKLA 4HAVB 1U27A 5C5BB 1E5WA 4CHJA 2K2UA 1NU2A 4HAWB 3QIJA 1BAKA 1WJMA 3CIKA 3TFMA 2NMBA 4Z2NA 5DIFB 4KAXB 4DX90 3IVFA 2D9XA 3SV1A 4C0AA 2DHKA 2RLOA 1P6SA 3ODOA 4HB3B 2Z0OA 5LOPB 1B55A 2N0YA 1XX0A 3A8PA 4ZRIA 3PVUA 2JP2A 4MY6A 2RUKB 4MT7A 1NTYA 2W2XD 3MPXA 5C79A 2I1KA 4P7IA 5FI1A 1FHXA 2GJYA 5DH9B 4WJ7A 2COAA 2EC1A 4GPTB 2DX5A 4WVFB 2IFSA 1ZVRA 2DTCA 3UZTA 3PVWA 3PG7A 5D3VA 4H8SA 1P5TA 1H4RA 4D0NB 5FI0A 1X05A
chains in the Genus database with same CATH superfamily
2Z4DA 2KCJA 2YT1A 1Y5OA 4HB0B 2D9YA 3PP2A 1KZ7A 2EMTA 1MIZB 1N3HA 3MDBC 3NW8A 1V5MA 1ZSQA 5I2SA 4A6FA 4CYEA 2YF0A 1MIXA 5I2MA 3ZVRA 4Y94A 2YVCA 2AEHA 3VIAA 3OANA 5DHFB 2ADZA 3QBVB 1KZGA 1U5DA 1U2BA 1NTVA 2LULA 1SGHA 1H10A 3HQCA 1W1HA 2COFA 2K49A 5D3YA 5EFXA 2I5CA 2VKIA 1T77A 1FAOA 2AL6A 3WYFB 1U5FA 4K2OA 3TW1A 3ZDTA 1U5GA 2H7EA 4GOUA 2ROZB 3RCPA 2GCJA 2DKPA 3PZDA 1U29A 1MAIA 1XCGA 1Q67A 2RGNB 4DXAB 4EKUA 1DDMA 3FVCA 3PEGA 4F7UP 3TVVA 3FEHA 2ZPYA 2G35A 2R0DA 4TKNA 2HTHB 2KUQA 1V5UA 3QWMA 1M7RA 4IFSA 4EMOA 2DX1A 4KVGB 5JP4A 2YS3A 2EJ8A 2D9WA 4DX8A 3SO6A 1Y19B 5HE2A 5J3QA 2MKRA 1WJ1A 3LJUX 2D9ZA 3V5WA 2W2XC 1DDVA 1W1DA 4KHOA 1WG7A 2UVMA 5KQ1A 4HDQA 3KRWA 4KHBA 2MFQA 3PSCA 1EF1A 2P0DA 2RNRB 2DA0A 2Z14A 4A6HA 5JHGA 5D3XA 3SNHA 3X23A 3BINA 5DHAB 4EJNA 2LOXA 2NBVA 2Z0QA 1ZYIA 1ZC3B 4ZRJA 3TO1A 3DXEA 5GOWB 4IOYX 3FSSA 1XR0B 1J0WA 3NWDA 4BBKA 1MI1A 4DIXA 4HAUB 4QJ4B 1XKEA 1TJ6A 1WGUA 4PQ0A 3U12A 3F5RA 1V89A 5L81A 4YL8A 2YRYA 2X18A 3ULBA 4D6WA 2Q13A 2Y7BA 2FJLA 1AQCA 2I5FA 3ODWA 5JLJB 4HSIA 3KY9A 4OT1A 3AU4A 3PVLA 1UEFA 3ULCA 1FGYA 1X1FA 1WVHA 1U5EA 1DROA 4Z2MB 5JHHA 2UZSA 3OHMB 2KUPA 2N23A 3D8FA 1TXDA 2CODA 4QJ5B 2GUMA 4NY0A 1FHOA 2DFKA 3DCXA 2ELBA 1BTKA 5CLQB 5M4YB 3F0WA 1PFJA 3VOQA 3DXCA 1FOEA 3U8ZA 2CRFA 1LW3A 2J0MA 1DDWA 1P3RA 4GZUA 4F7GA 3HK0A 4L1RA 2D2QA 2OQBA 1MPHA 3AU5A 1FB8A 2D4QA 1UNRA 2DHIA 2LG1A 1PLSA 1UNQA 1RRPB 3SUZA 1X11A 1Z87A 1QC6A 2GCLA 1K5DB 2CAYA 1EVHA 2J59M 1BTNA 1I7AA 1X1GA 1IRSA 3HIEA 4IAPA 5C5BA 2DLWA 1DYNA 5D3WA 3D8DA 2MWNB 1KI1B 2YT0A 2DN6A 1ISNA 4CHMA 1K5GB 1ZC4B 4HATB 1UPRA 3N7CA 4HAYB 4A6FB 2YT2A 4HDOA 2RSGA 1XODA 2YSZA 1OY2A 1OMWA 1W1GA 2H7DA 2ROVA 3DXDA 2HE7A 2Z0PA 1GC6A 5IRSA 4DBBA 2COCA 1DBHA 5C6RA 3GYPA 4L6EA 2M38A 3A58A 4NSWA 1MK7B 1ZM0A 2R09A 2P0FA 4QXAB 4CSQA 3GYOA 2W2WA 1RJ2A 1OQNA 3P7ZA 1EAZA 3HW2B 2DHJA 3NWAA 1GG3A 2IYBA 5KQ4A 1PMSA 5LONB 2M14A 2UZRA 1LB1A 4TYZA 2VRWB 1AWEA 2DYNA 4HB2B 2DKQA 2LKOA 2VSZA 3KZ1A 4A6KA 2Z59A 4A5KA 2K2JA 2J0KA 1SHCA 4KHAA 1XD4A 2KIEA 4F7HA 3M1IB 2KGXB 3B77A 3ODXA 3TCAA 3U7DA 2Y8FA 4GXBA 2K00A 1WGQA 1V88A 2RRFA 4K17A 2PZ1A 4WSFA 2OTXA 1GC7A 4KHBB 4PNKA 2P0HA 1WI1A 4HAXB 4GN1A 3A98B 3ML4A 1I2HA 2Z13A 4OSNA 5DI9B 5C16A 1NI2A 2MDXA 2E2XA 3KRXA 2CY5A 2D10A 4XWXA 4YONA 1UNPA 3P6AA 2J0JA 5HE0A 3AJ4A 3G9WA 4HB4B 5J3TA 2L2IA 2YS5A 4HAZB 2I1JA 3D8EA 4K2PA 2NZ8B 4ZRKA 3NWFA 3SYXA 3WA0A 2ZKMX 1MK9B 1J19A 5HE1A 3A8QA 3CXBB 1X86A 2CY4A 1FGZA 2EMSA 2LYDA 3T06A 2RVBB 4HHVA 4MK0A 1V61A 2DYQA 2D11A 1TQZA 2XQNM 4K81A 5HE3A 1MKEA 1UPQA 2Y8GA 2KR0A 2L1CA 5J3YA 1FHWA 2QKMA 1EGXA 3FM8C 4B6HA 3O96A 2D9VA 4GMVA 3BJIA 2GS0A 2ELAA 2R2YA 4GMXB 5CLLB 1QQGA 5KCVA 2V76A 2YS1A 5D27A 1M7EA 3NSUA 2LOZA 1V5PA 3KSYA 1BWNA 3HSAA 2BCJA 2P8VA 2QKLA 4HAVB 1U27A 4QJ3B 5C5BB 1E5WA 4CHJA 2K2UA 1NU2A 4HAWB 3QIJA 2FJUB 1BAKA 1WJMA 3CIKA 3TFMA 2NMBA 4Z2NA 5DIFB 4KAXB 4DX90 2K8EA 3IVFA 2D9XA 3SV1A 4C0AA 2DHKA 2RLOA 1P6SA 3ODOA 4HB3B 2Z0OA 5LOPB 4GNKB 1B55A 2N0YA 1XX0A 3A8PA 2KIGA 4ZRIA 3PVUA 2JP2A 4MY6A 2RUKB 4MT7A 1NTYA 2W2XD 3MPXA 5C79A 2I1KA 4P7IA 5FI1A 1FHXA 2GJYA 5DH9B 4WJ7A 2COAA 5LG4B 2EC1A 4GPTB 2DX5A 4WVFB 2IFSA 1ZVRA 2DTCA 3UZTA 3PVWA 3PG7A 5D3VA 4H8SA 1P5TA 1H4RA 4D0NB 5FI0A 1X05A
chains in the Genus database with same CATH topology
2KCJA 2YT1A 1Y5OA 4HB0B 2D9YA 3PP2A 1KZ7A 2EMTA 1MIZB 1N3HA 3MDBC 1V5MA 1ZSQA 4A6FA 4CYEA 2YF0A 1MIXA 3ZVRA 4Y94A 2YVCA 2AEHA 3VIAA 3OANA 5DHFB 2ADZA 3QBVB 1KZGA 1U5DA 1U2BA 1NTVA 2LULA 1SGHA 1H10A 3HQCA 1W1HA 2COFA 5D3YA 5EFXA 2I5CA 2VKIA 1FAOA 2AL6A 3WYFB 1U5FA 4K2OA 3TW1A 3ZDTA 1U5GA 2H7EA 2ROZB 3RCPA 2GCJA 2DKPA 3PZDA 1U29A 1MAIA 1XCGA 1Q67A 2RGNB 4DXAB 4EKUA 1DDMA 3PEGA 4F7UP 3TVVA 3FEHA 2ZPYA 2G35A 2R0DA 4TKNA 2HTHB 1V5UA 3QWMA 1M7RA 4IFSA 4EMOA 2DX1A 4KVGB 5JP4A 2YS3A 2EJ8A 2D9WA 4DX8A 3SO6A 1Y19B 5HE2A 5J3QA 2MKRA 1WJ1A 3LJUX 2D9ZA 3V5WA 2W2XC 1DDVA 1W1DA 4KHOA 1WG7A 2UVMA 5KQ1A 4HDQA 3KRWA 2MFQA 3PSCA 1EF1A 2P0DA 2RNRB 2DA0A 4A6HA 5JHGA 5D3XA 3SNHA 3X23A 3BINA 5DHAB 4EJNA 2LOXA 2Z0QA 1ZC3B 4ZRJA 3TO1A 3DXEA 5GOWB 4IOYX 3FSSA 1XR0B 1J0WA 4BBKA 4HAUB 1XKEA 1TJ6A 1WGUA 4PQ0A 3F5RA 1V89A 5L81A 4YL8A 2YRYA 2X18A 3ULBA 2Q13A 2Y7BA 2FJLA 1AQCA 2I5FA 3ODWA 5JLJB 3KY9A 3AU4A 3PVLA 1UEFA 3ULCA 1FGYA 1X1FA 1WVHA 1U5EA 1DROA 4Z2MB 5JHHA 2UZSA 2KUPA 2N23A 3D8FA 1TXDA 2CODA 4NY0A 1FHOA 2DFKA 2ELBA 1BTKA 5CLQB 3F0WA 1PFJA 3VOQA 3DXCA 1FOEA 3U8ZA 2CRFA 1LW3A 2J0MA 1DDWA 1P3RA 4GZUA 4F7GA 3HK0A 2D2QA 2OQBA 1MPHA 3AU5A 1FB8A 2D4QA 1UNRA 2DHIA 2LG1A 1PLSA 1UNQA 1RRPB 3SUZA 1X11A 1Z87A 1QC6A 2GCLA 1K5DB 2CAYA 1EVHA 2J59M 1BTNA 1I7AA 1X1GA 1IRSA 4IAPA 5C5BA 2DLWA 1DYNA 5D3WA 3D8DA 2MWNB 1KI1B 2YT0A 2DN6A 1ISNA 4CHMA 1K5GB 1ZC4B 4HATB 1UPRA 3N7CA 4HAYB 4A6FB 4HDOA 2RSGA 1XODA 2YSZA 1OY2A 1OMWA 1W1GA 2H7DA 2ROVA 3DXDA 2HE7A 2Z0PA 1GC6A 4DBBA 2COCA 1DBHA 5C6RA 3GYPA 4L6EA 2M38A 4NSWA 1MK7B 1ZM0A 2R09A 2P0FA 3GYOA 2W2WA 1RJ2A 1OQNA 3P7ZA 1EAZA 3HW2B 2DHJA 1GG3A 2IYBA 5KQ4A 1PMSA 5LONB 2M14A 2UZRA 1LB1A 4TYZA 2VRWB 1AWEA 2DYNA 4HB2B 2DKQA 2LKOA 2VSZA 3KZ1A 4A6KA 4A5KA 2K2JA 2J0KA 1SHCA 4KHAA 1XD4A 4F7HA 3M1IB 2KGXB 3ODXA 3TCAA 3U7DA 2Y8FA 4GXBA 2K00A 1WGQA 1V88A 4K17A 2PZ1A 4WSFA 2OTXA 1GC7A 4KHBB 4PNKA 2P0HA 1WI1A 4HAXB 4GN1A 3A98B 3ML4A 1I2HA 5DI9B 5C16A 1NI2A 2MDXA 2E2XA 3KRXA 2CY5A 2D10A 4XWXA 4YONA 1UNPA 3P6AA 2J0JA 5HE0A 3AJ4A 3G9WA 4HB4B 5J3TA 2L2IA 2YS5A 4HAZB 2I1JA 3D8EA 4K2PA 2NZ8B 4ZRKA 3SYXA 3WA0A 1MK9B 1J19A 5HE1A 3A8QA 3CXBB 1X86A 2CY4A 1FGZA 2EMSA 2LYDA 3T06A 2RVBB 4HHVA 4MK0A 1V61A 2DYQA 2D11A 1TQZA 2XQNM 4K81A 5HE3A 1MKEA 1UPQA 2Y8GA 2L1CA 5J3YA 1FHWA 2QKMA 1EGXA 3FM8C 4B6HA 3O96A 2D9VA 4GMVA 3BJIA 2GS0A 2ELAA 4GMXB 5CLLB 1QQGA 5KCVA 2V76A 2YS1A 5D27A 1M7EA 3NSUA 2LOZA 1V5PA 3KSYA 1BWNA 2BCJA 2P8VA 2QKLA 4HAVB 1U27A 5C5BB 1E5WA 4CHJA 2K2UA 1NU2A 4HAWB 3QIJA 1BAKA 1WJMA 3CIKA 3TFMA 2NMBA 4Z2NA 5DIFB 4KAXB 4DX90 3IVFA 2D9XA 3SV1A 4C0AA 2DHKA 2RLOA 1P6SA 3ODOA 4HB3B 2Z0OA 5LOPB 1B55A 2N0YA 1XX0A 3A8PA 4ZRIA 3PVUA 2JP2A 4MY6A 2RUKB 4MT7A 1NTYA 2W2XD 3MPXA 5C79A 2I1KA 4P7IA 5FI1A 1FHXA 2GJYA 5DH9B 4WJ7A 2COAA 2EC1A 4GPTB 2DX5A 4WVFB 2IFSA 1ZVRA 2DTCA 3UZTA 3PVWA 3PG7A 5D3VA 4H8SA 1P5TA 1H4RA 4D0NB 5FI0A 1X05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCJ A;  2YT1 A;  1Y5O A;  4HB0 B;  2D9Y A;  3PP2 A;  1KZ7 A;  2EMT A;  1MIZ B;  1N3H A;  3MDB C;  1V5M A;  1ZSQ A;  4A6F A;  4CYE A;  2YF0 A;  1MIX A;  3ZVR A;  4Y94 A;  2YVC A;  2AEH A;  3VIA A;  3OAN A;  5DHF B;  2ADZ A;  3QBV B;  1KZG A;  1U5D A;  1U2B A;  1NTV A;  2LUL A;  1SGH A;  1H10 A;  3HQC A;  1W1H A;  2COF A;  5D3Y A;  5EFX A;  2I5C A;  2VKI A;  1FAO A;  2AL6 A;  3WYF B;  1U5F A;  4K2O A;  3TW1 A;  3ZDT A;  1U5G A;  2H7E A;  2ROZ B;  3RCP A;  2GCJ A;  2DKP A;  3PZD A;  1U29 A;  1MAI A;  1XCG A;  1Q67 A;  2RGN B;  4DXA B;  4EKU A;  1DDM A;  3PEG A;  4F7U P;  3TVV A;  3FEH A;  2ZPY A;  2G35 A;  2R0D A;  4TKN A;  2HTH B;  1V5U A;  3QWM A;  1M7R A;  4IFS A;  4EMO A;  2DX1 A;  4KVG B;  5JP4 A;  2YS3 A;  2EJ8 A;  2D9W A;  4DX8 A;  3SO6 A;  1Y19 B;  5HE2 A;  5J3Q A;  2MKR A;  1WJ1 A;  3LJU X;  2D9Z A;  3V5W A;  2W2X C;  1DDV A;  1W1D A;  4KHO A;  1WG7 A;  2UVM A;  5KQ1 A;  4HDQ A;  3KRW A;  2MFQ A;  3PSC A;  1EF1 A;  2P0D A;  2RNR B;  2DA0 A;  4A6H A;  5JHG A;  5D3X A;  3SNH A;  3X23 A;  3BIN A;  5DHA B;  4EJN A;  2LOX A;  2Z0Q A;  1ZC3 B;  4ZRJ A;  3TO1 A;  3DXE A;  5GOW B;  4IOY X;  3FSS A;  1XR0 B;  1J0W A;  4BBK A;  4HAU B;  1XKE A;  1TJ6 A;  1WGU A;  4PQ0 A;  3F5R A;  1V89 A;  5L81 A;  4YL8 A;  2YRY A;  2X18 A;  3ULB A;  2Q13 A;  2Y7B A;  2FJL A;  1AQC A;  2I5F A;  3ODW A;  5JLJ B;  3KY9 A;  3AU4 A;  3PVL A;  1UEF A;  3ULC A;  1FGY A;  1X1F A;  1WVH A;  1U5E A;  1DRO A;  4Z2M B;  5JHH A;  2UZS A;  2KUP A;  2N23 A;  3D8F A;  1TXD A;  2COD A;  4NY0 A;  1FHO A;  2DFK A;  2ELB A;  1BTK A;  5CLQ B;  3F0W A;  1PFJ A;  3VOQ A;  3DXC A;  1FOE A;  3U8Z A;  2CRF A;  1LW3 A;  2J0M A;  1DDW A;  1P3R A;  4GZU A;  4F7G A;  3HK0 A;  2D2Q A;  2OQB A;  1MPH A;  3AU5 A;  1FB8 A;  2D4Q A;  1UNR A;  2DHI A;  2LG1 A;  1PLS A;  1UNQ A;  1RRP B;  3SUZ A;  1X11 A;  1Z87 A;  1QC6 A;  2GCL A;  1K5D B;  2CAY A;  1EVH A;  2J59 M;  1BTN A;  1I7A A;  1X1G A;  1IRS A;  4IAP A;  5C5B A;  2DLW A;  1DYN A;  5D3W A;  3D8D A;  2MWN B;  1KI1 B;  2YT0 A;  2DN6 A;  1ISN A;  4CHM A;  1K5G B;  1ZC4 B;  4HAT B;  1UPR A;  3N7C A;  4HAY B;  4A6F B;  4HDO A;  2RSG A;  1XOD A;  2YSZ A;  1OY2 A;  1OMW A;  1W1G A;  2H7D A;  2ROV A;  3DXD A;  2HE7 A;  2Z0P A;  1GC6 A;  4DBB A;  2COC A;  1DBH A;  5C6R A;  3GYP A;  4L6E A;  2M38 A;  4NSW A;  1MK7 B;  1ZM0 A;  2R09 A;  2P0F A;  3GYO A;  2W2W A;  1RJ2 A;  1OQN A;  3P7Z A;  1EAZ A;  3HW2 B;  2DHJ A;  1GG3 A;  2IYB A;  5KQ4 A;  1PMS A;  5LON B;  2M14 A;  2UZR A;  1LB1 A;  4TYZ A;  2VRW B;  1AWE A;  2DYN A;  4HB2 B;  2DKQ A;  2LKO A;  2VSZ A;  3KZ1 A;  4A6K A;  4A5K A;  2K2J A;  2J0K A;  1SHC A;  4KHA A;  1XD4 A;  4F7H A;  3M1I B;  2KGX B;  3ODX A;  3TCA A;  3U7D A;  2Y8F A;  4GXB A;  2K00 A;  1WGQ A;  1V88 A;  4K17 A;  2PZ1 A;  4WSF A;  2OTX A;  1GC7 A;  4KHB B;  4PNK A;  2P0H A;  1WI1 A;  4HAX B;  4GN1 A;  3A98 B;  3ML4 A;  1I2H A;  5DI9 B;  5C16 A;  1NI2 A;  2MDX A;  2E2X A;  3KRX A;  2CY5 A;  2D10 A;  4XWX A;  4YON A;  1UNP A;  3P6A A;  2J0J A;  5HE0 A;  3AJ4 A;  3G9W A;  4HB4 B;  5J3T A;  2L2I A;  2YS5 A;  4HAZ B;  2I1J A;  3D8E A;  4K2P A;  2NZ8 B;  4ZRK A;  3SYX A;  3WA0 A;  1MK9 B;  1J19 A;  5HE1 A;  3A8Q A;  3CXB B;  1X86 A;  2CY4 A;  1FGZ A;  2EMS A;  2LYD A;  3T06 A;  2RVB B;  4HHV A;  4MK0 A;  1V61 A;  2DYQ A;  2D11 A;  1TQZ A;  2XQN M;  4K81 A;  5HE3 A;  1MKE A;  1UPQ A;  2Y8G A;  2L1C A;  5J3Y A;  1FHW A;  2QKM A;  1EGX A;  3FM8 C;  4B6H A;  3O96 A;  2D9V A;  4GMV A;  3BJI A;  2GS0 A;  2ELA A;  4GMX B;  5CLL B;  1QQG A;  5KCV A;  2V76 A;  2YS1 A;  5D27 A;  1M7E A;  3NSU A;  2LOZ A;  1V5P A;  3KSY A;  1BWN A;  2BCJ A;  2P8V A;  2QKL A;  4HAV B;  1U27 A;  5C5B B;  1E5W A;  4CHJ A;  2K2U A;  1NU2 A;  4HAW B;  3QIJ A;  1BAK A;  1WJM A;  3CIK A;  3TFM A;  2NMB A;  4Z2N A;  5DIF B;  4KAX B;  4DX9 0;  3IVF A;  2D9X A;  3SV1 A;  4C0A A;  2DHK A;  2RLO A;  1P6S A;  3ODO A;  4HB3 B;  2Z0O A;  5LOP B;  1B55 A;  2N0Y A;  1XX0 A;  3A8P A;  4ZRI A;  3PVU A;  2JP2 A;  4MY6 A;  2RUK B;  4MT7 A;  1NTY A;  2W2X D;  3MPX A;  5C79 A;  2I1K A;  4P7I A;  5FI1 A;  1FHX A;  2GJY A;  5DH9 B;  4WJ7 A;  2COA A;  2EC1 A;  4GPT B;  2DX5 A;  4WVF B;  2IFS A;  1ZVR A;  2DTC A;  3UZT A;  3PVW A;  3PG7 A;  5D3V A;  4H8S A;  1P5T A;  1H4R A;  4D0N B;  5FI0 A;  1X05 A; 
#chains in the Genus database with same CATH topology
 2Z4D A;  2KCJ A;  2YT1 A;  1Y5O A;  4HB0 B;  2D9Y A;  3PP2 A;  1KZ7 A;  2EMT A;  1MIZ B;  1N3H A;  3MDB C;  3NW8 A;  1V5M A;  1ZSQ A;  5I2S A;  4A6F A;  4CYE A;  2YF0 A;  1MIX A;  5I2M A;  3ZVR A;  4Y94 A;  2YVC A;  2AEH A;  3VIA A;  3OAN A;  5DHF B;  2ADZ A;  3QBV B;  1KZG A;  1U5D A;  1U2B A;  1NTV A;  2LUL A;  1SGH A;  1H10 A;  3HQC A;  1W1H A;  2COF A;  2K49 A;  5D3Y A;  5EFX A;  2I5C A;  2VKI A;  1T77 A;  1FAO A;  2AL6 A;  3WYF B;  1U5F A;  4K2O A;  3TW1 A;  3ZDT A;  1U5G A;  2H7E A;  4GOU A;  2ROZ B;  3RCP A;  2GCJ A;  2DKP A;  3PZD A;  1U29 A;  1MAI A;  1XCG A;  1Q67 A;  2RGN B;  4DXA B;  4EKU A;  1DDM A;  3FVC A;  3PEG A;  4F7U P;  3TVV A;  3FEH A;  2ZPY A;  2G35 A;  2R0D A;  4TKN A;  2HTH B;  2KUQ A;  1V5U A;  3QWM A;  1M7R A;  4IFS A;  4EMO A;  2DX1 A;  4KVG B;  5JP4 A;  2YS3 A;  2EJ8 A;  2D9W A;  4DX8 A;  3SO6 A;  1Y19 B;  5HE2 A;  5J3Q A;  2MKR A;  1WJ1 A;  3LJU X;  2D9Z A;  3V5W A;  2W2X C;  1DDV A;  1W1D A;  4KHO A;  1WG7 A;  2UVM A;  5KQ1 A;  4HDQ A;  3KRW A;  4KHB A;  2MFQ A;  3PSC A;  1EF1 A;  2P0D A;  2RNR B;  2DA0 A;  2Z14 A;  4A6H A;  5JHG A;  5D3X A;  3SNH A;  3X23 A;  3BIN A;  5DHA B;  4EJN A;  2LOX A;  2NBV A;  2Z0Q A;  1ZYI A;  1ZC3 B;  4ZRJ A;  3TO1 A;  3DXE A;  5GOW B;  4IOY X;  3FSS A;  1XR0 B;  1J0W A;  3NWD A;  4BBK A;  1MI1 A;  4DIX A;  4HAU B;  4QJ4 B;  1XKE A;  1TJ6 A;  1WGU A;  4PQ0 A;  3U12 A;  3F5R A;  1V89 A;  5L81 A;  4YL8 A;  2YRY A;  2X18 A;  3ULB A;  4D6W A;  2Q13 A;  2Y7B A;  2FJL A;  1AQC A;  2I5F A;  3ODW A;  5JLJ B;  4HSI A;  3KY9 A;  4OT1 A;  3AU4 A;  3PVL A;  1UEF A;  3ULC A;  1FGY A;  1X1F A;  1WVH A;  1U5E A;  1DRO A;  4Z2M B;  5JHH A;  2UZS A;  3OHM B;  2KUP A;  2N23 A;  3D8F A;  1TXD A;  2COD A;  4QJ5 B;  2GUM A;  4NY0 A;  1FHO A;  2DFK A;  3DCX A;  2ELB A;  1BTK A;  5CLQ B;  5M4Y B;  3F0W A;  1PFJ A;  3VOQ A;  3DXC A;  1FOE A;  3U8Z A;  2CRF A;  1LW3 A;  2J0M A;  1DDW A;  1P3R A;  4GZU A;  4F7G A;  3HK0 A;  4L1R A;  2D2Q A;  2OQB A;  1MPH A;  3AU5 A;  1FB8 A;  2D4Q A;  1UNR A;  2DHI A;  2LG1 A;  1PLS A;  1UNQ A;  1RRP B;  3SUZ A;  1X11 A;  1Z87 A;  1QC6 A;  2GCL A;  1K5D B;  2CAY A;  1EVH A;  2J59 M;  1BTN A;  1I7A A;  1X1G A;  1IRS A;  3HIE A;  4IAP A;  5C5B A;  2DLW A;  1DYN A;  5D3W A;  3D8D A;  2MWN B;  1KI1 B;  2YT0 A;  2DN6 A;  1ISN A;  4CHM A;  1K5G B;  1ZC4 B;  4HAT B;  1UPR A;  3N7C A;  4HAY B;  4A6F B;  2YT2 A;  4HDO A;  2RSG A;  1XOD A;  2YSZ A;  1OY2 A;  1OMW A;  1W1G A;  2H7D A;  2ROV A;  3DXD A;  2HE7 A;  2Z0P A;  1GC6 A;  5IRS A;  4DBB A;  2COC A;  1DBH A;  5C6R A;  3GYP A;  4L6E A;  2M38 A;  3A58 A;  4NSW A;  1MK7 B;  1ZM0 A;  2R09 A;  2P0F A;  4QXA B;  4CSQ A;  3GYO A;  2W2W A;  1RJ2 A;  1OQN A;  3P7Z A;  1EAZ A;  3HW2 B;  2DHJ A;  3NWA A;  1GG3 A;  2IYB A;  5KQ4 A;  1PMS A;  5LON B;  2M14 A;  2UZR A;  1LB1 A;  4TYZ A;  2VRW B;  1AWE A;  2DYN A;  4HB2 B;  2DKQ A;  2LKO A;  2VSZ A;  3KZ1 A;  4A6K A;  2Z59 A;  4A5K A;  2K2J A;  2J0K A;  1SHC A;  4KHA A;  1XD4 A;  2KIE A;  4F7H A;  3M1I B;  2KGX B;  3B77 A;  3ODX A;  3TCA A;  3U7D A;  2Y8F A;  4GXB A;  2K00 A;  1WGQ A;  1V88 A;  2RRF A;  4K17 A;  2PZ1 A;  4WSF A;  2OTX A;  1GC7 A;  4KHB B;  4PNK A;  2P0H A;  1WI1 A;  4HAX B;  4GN1 A;  3A98 B;  3ML4 A;  1I2H A;  2Z13 A;  4OSN A;  5DI9 B;  5C16 A;  1NI2 A;  2MDX A;  2E2X A;  3KRX A;  2CY5 A;  2D10 A;  4XWX A;  4YON A;  1UNP A;  3P6A A;  2J0J A;  5HE0 A;  3AJ4 A;  3G9W A;  4HB4 B;  5J3T A;  2L2I A;  2YS5 A;  4HAZ B;  2I1J A;  3D8E A;  4K2P A;  2NZ8 B;  4ZRK A;  3NWF A;  3SYX A;  3WA0 A;  2ZKM X;  1MK9 B;  1J19 A;  5HE1 A;  3A8Q A;  3CXB B;  1X86 A;  2CY4 A;  1FGZ A;  2EMS A;  2LYD A;  3T06 A;  2RVB B;  4HHV A;  4MK0 A;  1V61 A;  2DYQ A;  2D11 A;  1TQZ A;  2XQN M;  4K81 A;  5HE3 A;  1MKE A;  1UPQ A;  2Y8G A;  2KR0 A;  2L1C A;  5J3Y A;  1FHW A;  2QKM A;  1EGX A;  3FM8 C;  4B6H A;  3O96 A;  2D9V A;  4GMV A;  3BJI A;  2GS0 A;  2ELA A;  2R2Y A;  4GMX B;  5CLL B;  1QQG A;  5KCV A;  2V76 A;  2YS1 A;  5D27 A;  1M7E A;  3NSU A;  2LOZ A;  1V5P A;  3KSY A;  1BWN A;  3HSA A;  2BCJ A;  2P8V A;  2QKL A;  4HAV B;  1U27 A;  4QJ3 B;  5C5B B;  1E5W A;  4CHJ A;  2K2U A;  1NU2 A;  4HAW B;  3QIJ A;  2FJU B;  1BAK A;  1WJM A;  3CIK A;  3TFM A;  2NMB A;  4Z2N A;  5DIF B;  4KAX B;  4DX9 0;  2K8E A;  3IVF A;  2D9X A;  3SV1 A;  4C0A A;  2DHK A;  2RLO A;  1P6S A;  3ODO A;  4HB3 B;  2Z0O A;  5LOP B;  4GNK B;  1B55 A;  2N0Y A;  1XX0 A;  3A8P A;  2KIG A;  4ZRI A;  3PVU A;  2JP2 A;  4MY6 A;  2RUK B;  4MT7 A;  1NTY A;  2W2X D;  3MPX A;  5C79 A;  2I1K A;  4P7I A;  5FI1 A;  1FHX A;  2GJY A;  5DH9 B;  4WJ7 A;  2COA A;  5LG4 B;  2EC1 A;  4GPT B;  2DX5 A;  4WVF B;  2IFS A;  1ZVR A;  2DTC A;  3UZT A;  3PVW A;  3PG7 A;  5D3V A;  4H8S A;  1P5T A;  1H4R A;  4D0N B;  5FI0 A;  1X05 A; 
#chains in the Genus database with same CATH homology
 2KCJ A;  2YT1 A;  1Y5O A;  4HB0 B;  2D9Y A;  3PP2 A;  1KZ7 A;  2EMT A;  1MIZ B;  1N3H A;  3MDB C;  1V5M A;  1ZSQ A;  4A6F A;  4CYE A;  2YF0 A;  1MIX A;  3ZVR A;  4Y94 A;  2YVC A;  2AEH A;  3VIA A;  3OAN A;  5DHF B;  2ADZ A;  3QBV B;  1KZG A;  1U5D A;  1U2B A;  1NTV A;  2LUL A;  1SGH A;  1H10 A;  3HQC A;  1W1H A;  2COF A;  5D3Y A;  5EFX A;  2I5C A;  2VKI A;  1FAO A;  2AL6 A;  3WYF B;  1U5F A;  4K2O A;  3TW1 A;  3ZDT A;  1U5G A;  2H7E A;  2ROZ B;  3RCP A;  2GCJ A;  2DKP A;  3PZD A;  1U29 A;  1MAI A;  1XCG A;  1Q67 A;  2RGN B;  4DXA B;  4EKU A;  1DDM A;  3PEG A;  4F7U P;  3TVV A;  3FEH A;  2ZPY A;  2G35 A;  2R0D A;  4TKN A;  2HTH B;  1V5U A;  3QWM A;  1M7R A;  4IFS A;  4EMO A;  2DX1 A;  4KVG B;  5JP4 A;  2YS3 A;  2EJ8 A;  2D9W A;  4DX8 A;  3SO6 A;  1Y19 B;  5HE2 A;  5J3Q A;  2MKR A;  1WJ1 A;  3LJU X;  2D9Z A;  3V5W A;  2W2X C;  1DDV A;  1W1D A;  4KHO A;  1WG7 A;  2UVM A;  5KQ1 A;  4HDQ A;  3KRW A;  2MFQ A;  3PSC A;  1EF1 A;  2P0D A;  2RNR B;  2DA0 A;  4A6H A;  5JHG A;  5D3X A;  3SNH A;  3X23 A;  3BIN A;  5DHA B;  4EJN A;  2LOX A;  2Z0Q A;  1ZC3 B;  4ZRJ A;  3TO1 A;  3DXE A;  5GOW B;  4IOY X;  3FSS A;  1XR0 B;  1J0W A;  4BBK A;  4HAU B;  1XKE A;  1TJ6 A;  1WGU A;  4PQ0 A;  3F5R A;  1V89 A;  5L81 A;  4YL8 A;  2YRY A;  2X18 A;  3ULB A;  2Q13 A;  2Y7B A;  2FJL A;  1AQC A;  2I5F A;  3ODW A;  5JLJ B;  3KY9 A;  3AU4 A;  3PVL A;  1UEF A;  3ULC A;  1FGY A;  1X1F A;  1WVH A;  1U5E A;  1DRO A;  4Z2M B;  5JHH A;  2UZS A;  2KUP A;  2N23 A;  3D8F A;  1TXD A;  2COD A;  4NY0 A;  1FHO A;  2DFK A;  2ELB A;  1BTK A;  5CLQ B;  3F0W A;  1PFJ A;  3VOQ A;  3DXC A;  1FOE A;  3U8Z A;  2CRF A;  1LW3 A;  2J0M A;  1DDW A;  1P3R A;  4GZU A;  4F7G A;  3HK0 A;  2D2Q A;  2OQB A;  1MPH A;  3AU5 A;  1FB8 A;  2D4Q A;  1UNR A;  2DHI A;  2LG1 A;  1PLS A;  1UNQ A;  1RRP B;  3SUZ A;  1X11 A;  1Z87 A;  1QC6 A;  2GCL A;  1K5D B;  2CAY A;  1EVH A;  2J59 M;  1BTN A;  1I7A A;  1X1G A;  1IRS A;  4IAP A;  5C5B A;  2DLW A;  1DYN A;  5D3W A;  3D8D A;  2MWN B;  1KI1 B;  2YT0 A;  2DN6 A;  1ISN A;  4CHM A;  1K5G B;  1ZC4 B;  4HAT B;  1UPR A;  3N7C A;  4HAY B;  4A6F B;  4HDO A;  2RSG A;  1XOD A;  2YSZ A;  1OY2 A;  1OMW A;  1W1G A;  2H7D A;  2ROV A;  3DXD A;  2HE7 A;  2Z0P A;  1GC6 A;  4DBB A;  2COC A;  1DBH A;  5C6R A;  3GYP A;  4L6E A;  2M38 A;  4NSW A;  1MK7 B;  1ZM0 A;  2R09 A;  2P0F A;  3GYO A;  2W2W A;  1RJ2 A;  1OQN A;  3P7Z A;  1EAZ A;  3HW2 B;  2DHJ A;  1GG3 A;  2IYB A;  5KQ4 A;  1PMS A;  5LON B;  2M14 A;  2UZR A;  1LB1 A;  4TYZ A;  2VRW B;  1AWE A;  2DYN A;  4HB2 B;  2DKQ A;  2LKO A;  2VSZ A;  3KZ1 A;  4A6K A;  4A5K A;  2K2J A;  2J0K A;  1SHC A;  4KHA A;  1XD4 A;  4F7H A;  3M1I B;  2KGX B;  3ODX A;  3TCA A;  3U7D A;  2Y8F A;  4GXB A;  2K00 A;  1WGQ A;  1V88 A;  4K17 A;  2PZ1 A;  4WSF A;  2OTX A;  1GC7 A;  4KHB B;  4PNK A;  2P0H A;  1WI1 A;  4HAX B;  4GN1 A;  3A98 B;  3ML4 A;  1I2H A;  5DI9 B;  5C16 A;  1NI2 A;  2MDX A;  2E2X A;  3KRX A;  2CY5 A;  2D10 A;  4XWX A;  4YON A;  1UNP A;  3P6A A;  2J0J A;  5HE0 A;  3AJ4 A;  3G9W A;  4HB4 B;  5J3T A;  2L2I A;  2YS5 A;  4HAZ B;  2I1J A;  3D8E A;  4K2P A;  2NZ8 B;  4ZRK A;  3SYX A;  3WA0 A;  1MK9 B;  1J19 A;  5HE1 A;  3A8Q A;  3CXB B;  1X86 A;  2CY4 A;  1FGZ A;  2EMS A;  2LYD A;  3T06 A;  2RVB B;  4HHV A;  4MK0 A;  1V61 A;  2DYQ A;  2D11 A;  1TQZ A;  2XQN M;  4K81 A;  5HE3 A;  1MKE A;  1UPQ A;  2Y8G A;  2L1C A;  5J3Y A;  1FHW A;  2QKM A;  1EGX A;  3FM8 C;  4B6H A;  3O96 A;  2D9V A;  4GMV A;  3BJI A;  2GS0 A;  2ELA A;  4GMX B;  5CLL B;  1QQG A;  5KCV A;  2V76 A;  2YS1 A;  5D27 A;  1M7E A;  3NSU A;  2LOZ A;  1V5P A;  3KSY A;  1BWN A;  2BCJ A;  2P8V A;  2QKL A;  4HAV B;  1U27 A;  5C5B B;  1E5W A;  4CHJ A;  2K2U A;  1NU2 A;  4HAW B;  3QIJ A;  1BAK A;  1WJM A;  3CIK A;  3TFM A;  2NMB A;  4Z2N A;  5DIF B;  4KAX B;  4DX9 0;  3IVF A;  2D9X A;  3SV1 A;  4C0A A;  2DHK A;  2RLO A;  1P6S A;  3ODO A;  4HB3 B;  2Z0O A;  5LOP B;  1B55 A;  2N0Y A;  1XX0 A;  3A8P A;  4ZRI A;  3PVU A;  2JP2 A;  4MY6 A;  2RUK B;  4MT7 A;  1NTY A;  2W2X D;  3MPX A;  5C79 A;  2I1K A;  4P7I A;  5FI1 A;  1FHX A;  2GJY A;  5DH9 B;  4WJ7 A;  2COA A;  2EC1 A;  4GPT B;  2DX5 A;  4WVF B;  2IFS A;  1ZVR A;  2DTC A;  3UZT A;  3PVW A;  3PG7 A;  5D3V A;  4H8S A;  1P5T A;  1H4R A;  4D0N B;  5FI0 A;  1X05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...