5J3QA

Crystal structure of s. pombe dcp1:edc1 mrna decapping complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
DENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Dcp2-Dcp1 mRNA-decapping complex in the activated conformation.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase
molecule keywords mRNA-decapping enzyme subunit 1
total genus 35
structure length 125
sequence length 125
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5j3qA00
1WJMA 3ULBA 2H7EA 4WJ7A 1X1FA 1EF1A 1ISNA 1I2HA 2XQNM 2D9VA 1OY2A 5HE1A 1U27A 4A6KA 2GS0A 2L2IA 1IRSA 3HK0A 1X86A 2MDXA 4EKUA 4GPTB 1UPRA 2HE7A 2D11A 2D9ZA 2JP2A 1BTKA 3DXDA 1EAZA 4CHJA 2ELAA 4ZRJA 2D9WA 1FGYA 1UPQA 3QBVB 2Z0OA 1FHWA 2J0MA 5C79A 2RLOA 3TFMA 1DDWA 2W2XC 2ZPYA 4EJNA 4KHBB 2DKPA 1EVHA 3SUZA 3A8PA 2YT0A 2QKLA 5J3QA 1FGZA 1DYNA 4A5KA 3OANA 5C6RA 3M1IB 5J3YA 2EMTA 4EMOA 2DLWA 1SHCA 4GMXB 2N0YA 1NI2A 1DBHA 1Y19B 1K5GB 3PVWA 1OMWA 1FOEA 4H8SA 1GC6A 5JHHA 3P6AA 3ULCA 1Z87A 2RNRB 1X1GA 2D4QA 5L81A 2H7DA 3TCAA 1RJ2A 1M7RA 3TO1A 2LULA 1B55A 5JP4A 2NZ8B 4NSWA 4YL8A 1MPHA 2DTCA 2Z0QA 2P8VA 4HB0B 2GCJA 3O96A 3IVFA 4DX90 1J0WA 4TKNA 4CYEA 1SGHA 3D8FA 1FHOA 1MIZB 3WYFB 5GOWB 1FB8A 4MT7A 5HE3A 4DXAB 2VSZA 1WGUA 2DX1A 1TQZA 2EJ8A 2UZSA 2N23A 1PLSA 1PFJA 1M7EA 1V88A 1MKEA 1Y5OA 3PVLA 1MK9B 2CAYA 3V5WA 5KCVA 2FJLA 2LKOA 1W1DA 4A6FA 2DFKA 1UNPA 1FAOA 3BINA 3D8EA 1ZSQA 3QIJA 2YF0A 2K2JA 4HB4B 1X11A 1PMSA 5D3VA 3MDBC 1AQCA 2UVMA 2P0HA 3G9WA 1LW3A 4D0NB 4NY0A 2OTXA 1N3HA 2ROZB 2L1CA 2R0DA 4F7UP 3VOQA 1Q67A 2M38A 2Y8GA 2LOXA 1U5FA 5FI0A 4K81A 3ML4A 3DXEA 3PP2A 3A98B 3CXBB 4A6HA 1NTYA 2DYNA 2J59M 1WG7A 2M14A 3SNHA 4IAPA 5DHAB 1WGQA 4HAVB 4CHMA 2I1JA 1DROA 1GC7A 2DX5A 3D8DA 4TYZA 2AEHA 2RVBB 3F0WA 3ODXA 1U5GA 4HHVA 4C0AA 1V61A 1EGXA 2ELBA 1P6SA 5D3XA 4F7GA 3NSUA 3F5RA 5DH9B 2COAA 2HTHB 2LYDA 1P3RA 5D27A 4B6HA 4Y94A 2X18A 3UZTA 1WI1A 1U5DA 1GG3A 2D2QA 2KUPA 5FI1A 3TVVA 2VRWB 4P7IA 2I5CA 5KQ1A 1BWNA 4HAYB 1WVHA 3QWMA 5DI9B 2OQBA 1KZ7A 3LJUX 4KHAA 2MKRA 3DXCA 5HE0A 1RRPB 1ZM0A 1V5UA 3T06A 2I5FA 2DYQA 3PZDA 2ROVA 3GYOA 1NU2A 1XKEA 4GMVA 2P0DA 2R09A 5DIFB 1MK7B 4YONA 2D10A 4WVFB 2Z0PA 2ADZA 1XCGA 2V76A 3U8ZA 2YSZA 4Z2NA 1XX0A 4ZRIA 2CRFA 1TJ6A 3SO6A 1BTNA 5C16A 1ZVRA 2CY4A 3X23A 2EMSA 4HAWB 5JHGA 3PG7A 1LB1A 3ODWA 3P7ZA 2D9XA 5LOPB 4MK0A 2DN6A 1K5DB 1P5TA 1DDMA 2BCJA 5C5BB 3PEGA 3AJ4A 1W1GA 3ZDTA 4PNKA 2E2XA 2IFSA 2I1KA 3KSYA 1H4RA 2MFQA 1I7AA 5LONB 4IFSA 2P0FA 2KGXB 3FSSA 2YT1A 2COFA 3N7CA 1TXDA 4DBBA 3MPXA 4K17A 3KRWA 1V5PA 4K2OA 4F7HA 4L6EA 1UEFA 3ODOA 2RGNB 3AU5A 4HAXB 4HAZB 1W1HA 4ZRKA 1V5MA 4MY6A 2LOZA 1XR0B 1NTVA 1V89A 2YRYA 4HB2B 3FEHA 2YS3A 1WJ1A 2DHJA 5D3WA 1H10A 2YS1A 5KQ4A 2Y8FA 1J19A 2W2XD 3HW2B 2J0KA 3VIAA 1DDVA 3BJIA 1OQNA 2CY5A 4HAUB 2GCLA 5HE2A 4KVGB 4HB3B 4HDOA 2DHIA 2KCJA 2VKIA 3RCPA 1FHXA 1MAIA 2DA0A 1QC6A 2YVCA 2QKMA 1XD4A 2COCA 1KI1B 2Q13A 5C5BA 2PZ1A 2DHKA 1AWEA 3HQCA 3AU4A 5CLLB 5J3TA 1ZC4B 4K2PA 2IYBA 4BBKA 5JLJB 3CIKA 4DX8A 3KY9A 2J0JA 2W2WA 2RSGA 1QQGA 4GXBA 3KRXA 4A6FB 1X05A 4HDQA 4IOYX 5EFXA 4XWXA 1U2BA 1E5WA 4WSFA 1U5EA 1MIXA 4PQ0A 3FM8C 3ZVRA 1UNRA 3GYPA 3A8QA 2GJYA 5CLQB 3KZ1A 3SV1A 3PVUA 2K00A 3TW1A 2AL6A 5D3YA 2MWNB 3U7DA 1U29A 4KAXB 2G35A 3PSCA 3WA0A 2EC1A 1BAKA 1ZC3B 4GN1A 4GZUA 1KZGA 1UNQA 2UZRA 2NMBA 1XODA 2K2UA 4HATB 2D9YA 4KHOA 5DHFB 2LG1A 4Z2MB 2RUKB 2DKQA 2Y7BA 2CODA 3SYXA 2YS5A
chains in the Genus database with same CATH superfamily
1WJMA 3ULBA 2H7EA 4WJ7A 1X1FA 1EF1A 1ISNA 1I2HA 2XQNM 2D9VA 1OY2A 5HE1A 1U27A 4A6KA 2GS0A 2L2IA 1IRSA 3HK0A 1X86A 2MDXA 4EKUA 4GPTB 1UPRA 2HE7A 2D11A 2D9ZA 2JP2A 1BTKA 3DXDA 1EAZA 4CHJA 2ELAA 4OSNA 4ZRJA 2Z59A 2D9WA 1FGYA 1UPQA 3QBVB 2Z0OA 1FHWA 2J0MA 2YT2A 5C79A 2RLOA 3TFMA 1DDWA 2W2XC 2ZPYA 4EJNA 4KHBB 2DKPA 1EVHA 3SUZA 3A8PA 2YT0A 2QKLA 5J3QA 1FGZA 1DYNA 4A5KA 3OANA 5C6RA 3M1IB 5J3YA 2EMTA 4EMOA 2DLWA 1SHCA 4GNKB 4GMXB 2N0YA 1NI2A 1DBHA 1Y19B 1K5GB 3HIEA 3PVWA 1OMWA 1FOEA 4H8SA 1GC6A 5JHHA 3P6AA 3ULCA 1Z87A 2RNRB 1X1GA 2D4QA 5L81A 4QJ3B 2H7DA 3TCAA 1RJ2A 1M7RA 3TO1A 2LULA 1B55A 3U12A 5JP4A 2NZ8B 4NSWA 4YL8A 1MPHA 2DTCA 2Z0QA 2P8VA 4HB0B 2GCJA 3O96A 3IVFA 4DX90 4CSQA 1J0WA 4TKNA 4CYEA 1SGHA 3D8FA 1FHOA 1MIZB 3WYFB 5GOWB 1FB8A 4MT7A 5HE3A 4DXAB 2VSZA 1WGUA 2DX1A 1TQZA 3A58A 2EJ8A 2UZSA 2N23A 1PLSA 1PFJA 1M7EA 2K8EA 1V88A 1MKEA 1Y5OA 3PVLA 1MK9B 2CAYA 4QJ5B 2Z14A 3V5WA 5KCVA 2FJLA 2LKOA 1W1DA 4A6FA 2DFKA 1UNPA 1FAOA 3BINA 2K49A 3D8EA 1ZSQA 2YF0A 3QIJA 2K2JA 4HB4B 3NWFA 1X11A 1PMSA 5D3VA 3MDBC 1AQCA 2UVMA 2P0HA 3G9WA 1LW3A 4D0NB 2NBVA 4NY0A 2OTXA 1N3HA 2ROZB 2L1CA 2R0DA 4F7UP 3VOQA 1Q67A 2M38A 2Y8GA 2LOXA 1U5FA 5FI0A 4K81A 3ML4A 3DXEA 3PP2A 5I2MA 3NWAA 3A98B 3CXBB 4A6HA 1NTYA 2DYNA 2J59M 1WG7A 2M14A 3SNHA 4IAPA 5DHAB 1WGQA 4HAVB 4CHMA 2I1JA 4DIXA 1DROA 1GC7A 2DX5A 3D8DA 4TYZA 2AEHA 2RVBB 3F0WA 3ODXA 1U5GA 4HHVA 4C0AA 1V61A 1EGXA 2ELBA 1P6SA 5D3XA 4F7GA 3NSUA 3F5RA 5DH9B 2GUMA 2COAA 2HTHB 2LYDA 1P3RA 5D27A 4B6HA 4Y94A 2X18A 3UZTA 1WI1A 1U5DA 1GG3A 3DCXA 2D2QA 2KUPA 5FI1A 3TVVA 2VRWB 2KR0A 4P7IA 2I5CA 5KQ1A 1BWNA 4HAYB 1WVHA 3QWMA 5DI9B 2OQBA 1KZ7A 3LJUX 4KHAA 2MKRA 3DXCA 5HE0A 1RRPB 1ZM0A 1V5UA 3T06A 2I5FA 2DYQA 3PZDA 2ROVA 3GYOA 1NU2A 1XKEA 4GMVA 2P0DA 2R09A 5DIFB 1MK7B 4YONA 2D10A 4WVFB 2Z0PA 2ADZA 1XCGA 2V76A 3U8ZA 2YSZA 4Z2NA 1XX0A 4ZRIA 2CRFA 1TJ6A 3SO6A 1BTNA 5C16A 1ZVRA 2CY4A 4OT1A 2RRFA 3X23A 2EMSA 4HAWB 5JHGA 3PG7A 3NWDA 3P7ZA 1LB1A 3ODWA 2D9XA 5LOPB 4MK0A 4QJ4B 2DN6A 1K5DB 1P5TA 1DDMA 2BCJA 5C5BB 3PEGA 3AJ4A 1W1GA 1ZYIA 3ZDTA 4PNKA 2E2XA 2IFSA 2I1KA 3KSYA 1H4RA 2MFQA 1I7AA 5LONB 4IFSA 2P0FA 2KGXB 3FSSA 2FJUB 2YT1A 2COFA 3N7CA 2KUQA 1TXDA 4DBBA 3MPXA 4K17A 3KRWA 4L1RA 1V5PA 4K2OA 4GOUA 4F7HA 4L6EA 1UEFA 3ODOA 2RGNB 3AU5A 4HAXB 4HAZB 2KIEA 1W1HA 4ZRKA 1V5MA 4MY6A 2LOZA 1XR0B 1NTVA 1V89A 2YRYA 4HB2B 3FEHA 2YS3A 2Z4DA 1WJ1A 2DHJA 1MI1A 5D3WA 1H10A 1T77A 3NW8A 2YS1A 5KQ4A 2Y8FA 1J19A 2W2XD 3HW2B 2J0KA 5M4YB 3VIAA 1DDVA 3BJIA 1OQNA 2CY5A 4HAUB 2GCLA 5HE2A 4KVGB 4HB3B 4HDOA 2DHIA 2KCJA 2VKIA 3RCPA 1FHXA 1MAIA 2DA0A 4HSIA 1QC6A 2YVCA 2QKMA 1XD4A 2COCA 1KI1B 2Q13A 5C5BA 2PZ1A 2DHKA 1AWEA 3HQCA 3AU4A 5CLLB 2KIGA 5J3TA 1ZC4B 4K2PA 2IYBA 4BBKA 5JLJB 3CIKA 4DX8A 5IRSA 2R2YA 3KY9A 2J0JA 2W2WA 2RSGA 1QQGA 4GXBA 3KRXA 4A6FB 1X05A 4D6WA 4HDQA 4IOYX 5EFXA 4XWXA 1U2BA 1E5WA 4WSFA 1U5EA 4KHBA 1MIXA 4PQ0A 3FM8C 5I2SA 3ZVRA 1UNRA 3B77A 3A8QA 2GJYA 3GYPA 5CLQB 3KZ1A 3SV1A 3PVUA 2K00A 3TW1A 2AL6A 5D3YA 2MWNB 3U7DA 1U29A 4KAXB 2G35A 3PSCA 2ZKMX 3WA0A 2EC1A 1BAKA 1ZC3B 4GN1A 4GZUA 1KZGA 1UNQA 2UZRA 3FVCA 2NMBA 2Z13A 1XODA 2K2UA 4HATB 2D9YA 4KHOA 3HSAA 5DHFB 2LG1A 4Z2MB 2RUKB 5LG4B 4QXAB 3OHMB 2DKQA 2Y7BA 2CODA 3SYXA 2YS5A
chains in the Genus database with same CATH topology
1WJMA 3ULBA 2H7EA 4WJ7A 1X1FA 1EF1A 1ISNA 1I2HA 2XQNM 2D9VA 1OY2A 5HE1A 1U27A 4A6KA 2GS0A 2L2IA 1IRSA 3HK0A 1X86A 2MDXA 4EKUA 4GPTB 1UPRA 2HE7A 2D11A 2D9ZA 2JP2A 1BTKA 3DXDA 1EAZA 4CHJA 2ELAA 4ZRJA 2D9WA 1FGYA 1UPQA 3QBVB 2Z0OA 1FHWA 2J0MA 5C79A 2RLOA 3TFMA 1DDWA 2W2XC 2ZPYA 4EJNA 4KHBB 2DKPA 1EVHA 3SUZA 3A8PA 2YT0A 2QKLA 5J3QA 1FGZA 1DYNA 4A5KA 3OANA 5C6RA 3M1IB 5J3YA 2EMTA 4EMOA 2DLWA 1SHCA 4GMXB 2N0YA 1NI2A 1DBHA 1Y19B 1K5GB 3PVWA 1OMWA 1FOEA 4H8SA 1GC6A 5JHHA 3P6AA 3ULCA 1Z87A 2RNRB 1X1GA 2D4QA 5L81A 2H7DA 3TCAA 1RJ2A 1M7RA 3TO1A 2LULA 1B55A 5JP4A 2NZ8B 4NSWA 4YL8A 1MPHA 2DTCA 2Z0QA 2P8VA 4HB0B 2GCJA 3O96A 3IVFA 4DX90 1J0WA 4TKNA 4CYEA 1SGHA 3D8FA 1FHOA 1MIZB 3WYFB 5GOWB 1FB8A 4MT7A 5HE3A 4DXAB 2VSZA 1WGUA 2DX1A 1TQZA 2EJ8A 2UZSA 2N23A 1PLSA 1PFJA 1M7EA 1V88A 1MKEA 1Y5OA 3PVLA 1MK9B 2CAYA 3V5WA 5KCVA 2FJLA 2LKOA 1W1DA 4A6FA 2DFKA 1UNPA 1FAOA 3BINA 3D8EA 1ZSQA 3QIJA 2YF0A 2K2JA 4HB4B 1X11A 1PMSA 5D3VA 3MDBC 1AQCA 2UVMA 2P0HA 3G9WA 1LW3A 4D0NB 4NY0A 2OTXA 1N3HA 2ROZB 2L1CA 2R0DA 4F7UP 3VOQA 1Q67A 2M38A 2Y8GA 2LOXA 1U5FA 5FI0A 4K81A 3ML4A 3DXEA 3PP2A 3A98B 3CXBB 4A6HA 1NTYA 2DYNA 2J59M 1WG7A 2M14A 3SNHA 4IAPA 5DHAB 1WGQA 4HAVB 4CHMA 2I1JA 1DROA 1GC7A 2DX5A 3D8DA 4TYZA 2AEHA 2RVBB 3F0WA 3ODXA 1U5GA 4HHVA 4C0AA 1V61A 1EGXA 2ELBA 1P6SA 5D3XA 4F7GA 3NSUA 3F5RA 5DH9B 2COAA 2HTHB 2LYDA 1P3RA 5D27A 4B6HA 4Y94A 2X18A 3UZTA 1WI1A 1U5DA 1GG3A 2D2QA 2KUPA 5FI1A 3TVVA 2VRWB 4P7IA 2I5CA 5KQ1A 1BWNA 4HAYB 1WVHA 3QWMA 5DI9B 2OQBA 1KZ7A 3LJUX 4KHAA 2MKRA 3DXCA 5HE0A 1RRPB 1ZM0A 1V5UA 3T06A 2I5FA 2DYQA 3PZDA 2ROVA 3GYOA 1NU2A 1XKEA 4GMVA 2P0DA 2R09A 5DIFB 1MK7B 4YONA 2D10A 4WVFB 2Z0PA 2ADZA 1XCGA 2V76A 3U8ZA 2YSZA 4Z2NA 1XX0A 4ZRIA 2CRFA 1TJ6A 3SO6A 1BTNA 5C16A 1ZVRA 2CY4A 3X23A 2EMSA 4HAWB 5JHGA 3PG7A 1LB1A 3ODWA 3P7ZA 2D9XA 5LOPB 4MK0A 2DN6A 1K5DB 1P5TA 1DDMA 2BCJA 5C5BB 3PEGA 3AJ4A 1W1GA 3ZDTA 4PNKA 2E2XA 2IFSA 2I1KA 3KSYA 1H4RA 2MFQA 1I7AA 5LONB 4IFSA 2P0FA 2KGXB 3FSSA 2YT1A 2COFA 3N7CA 1TXDA 4DBBA 3MPXA 4K17A 3KRWA 1V5PA 4K2OA 4F7HA 4L6EA 1UEFA 3ODOA 2RGNB 3AU5A 4HAXB 4HAZB 1W1HA 4ZRKA 1V5MA 4MY6A 2LOZA 1XR0B 1NTVA 1V89A 2YRYA 4HB2B 3FEHA 2YS3A 1WJ1A 2DHJA 5D3WA 1H10A 2YS1A 5KQ4A 2Y8FA 1J19A 2W2XD 3HW2B 2J0KA 3VIAA 1DDVA 3BJIA 1OQNA 2CY5A 4HAUB 2GCLA 5HE2A 4KVGB 4HB3B 4HDOA 2DHIA 2KCJA 2VKIA 3RCPA 1FHXA 1MAIA 2DA0A 1QC6A 2YVCA 2QKMA 1XD4A 2COCA 1KI1B 2Q13A 5C5BA 2PZ1A 2DHKA 1AWEA 3HQCA 3AU4A 5CLLB 5J3TA 1ZC4B 4K2PA 2IYBA 4BBKA 5JLJB 3CIKA 4DX8A 3KY9A 2J0JA 2W2WA 2RSGA 1QQGA 4GXBA 3KRXA 4A6FB 1X05A 4HDQA 4IOYX 5EFXA 4XWXA 1U2BA 1E5WA 4WSFA 1U5EA 1MIXA 4PQ0A 3FM8C 3ZVRA 1UNRA 3GYPA 3A8QA 2GJYA 5CLQB 3KZ1A 3SV1A 3PVUA 2K00A 3TW1A 2AL6A 5D3YA 2MWNB 3U7DA 1U29A 4KAXB 2G35A 3PSCA 3WA0A 2EC1A 1BAKA 1ZC3B 4GN1A 4GZUA 1KZGA 1UNQA 2UZRA 2NMBA 1XODA 2K2UA 4HATB 2D9YA 4KHOA 5DHFB 2LG1A 4Z2MB 2RUKB 2DKQA 2Y7BA 2CODA 3SYXA 2YS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJM A;  3ULB A;  2H7E A;  4WJ7 A;  1X1F A;  1EF1 A;  1ISN A;  1I2H A;  2XQN M;  2D9V A;  1OY2 A;  5HE1 A;  1U27 A;  4A6K A;  2GS0 A;  2L2I A;  1IRS A;  3HK0 A;  1X86 A;  2MDX A;  4EKU A;  4GPT B;  1UPR A;  2HE7 A;  2D11 A;  2D9Z A;  2JP2 A;  1BTK A;  3DXD A;  1EAZ A;  4CHJ A;  2ELA A;  4ZRJ A;  2D9W A;  1FGY A;  1UPQ A;  3QBV B;  2Z0O A;  1FHW A;  2J0M A;  5C79 A;  2RLO A;  3TFM A;  1DDW A;  2W2X C;  2ZPY A;  4EJN A;  4KHB B;  2DKP A;  1EVH A;  3SUZ A;  3A8P A;  2YT0 A;  2QKL A;  5J3Q A;  1FGZ A;  1DYN A;  4A5K A;  3OAN A;  5C6R A;  3M1I B;  5J3Y A;  2EMT A;  4EMO A;  2DLW A;  1SHC A;  4GMX B;  2N0Y A;  1NI2 A;  1DBH A;  1Y19 B;  1K5G B;  3PVW A;  1OMW A;  1FOE A;  4H8S A;  1GC6 A;  5JHH A;  3P6A A;  3ULC A;  1Z87 A;  2RNR B;  1X1G A;  2D4Q A;  5L81 A;  2H7D A;  3TCA A;  1RJ2 A;  1M7R A;  3TO1 A;  2LUL A;  1B55 A;  5JP4 A;  2NZ8 B;  4NSW A;  4YL8 A;  1MPH A;  2DTC A;  2Z0Q A;  2P8V A;  4HB0 B;  2GCJ A;  3O96 A;  3IVF A;  4DX9 0;  1J0W A;  4TKN A;  4CYE A;  1SGH A;  3D8F A;  1FHO A;  1MIZ B;  3WYF B;  5GOW B;  1FB8 A;  4MT7 A;  5HE3 A;  4DXA B;  2VSZ A;  1WGU A;  2DX1 A;  1TQZ A;  2EJ8 A;  2UZS A;  2N23 A;  1PLS A;  1PFJ A;  1M7E A;  1V88 A;  1MKE A;  1Y5O A;  3PVL A;  1MK9 B;  2CAY A;  3V5W A;  5KCV A;  2FJL A;  2LKO A;  1W1D A;  4A6F A;  2DFK A;  1UNP A;  1FAO A;  3BIN A;  3D8E A;  1ZSQ A;  3QIJ A;  2YF0 A;  2K2J A;  4HB4 B;  1X11 A;  1PMS A;  5D3V A;  3MDB C;  1AQC A;  2UVM A;  2P0H A;  3G9W A;  1LW3 A;  4D0N B;  4NY0 A;  2OTX A;  1N3H A;  2ROZ B;  2L1C A;  2R0D A;  4F7U P;  3VOQ A;  1Q67 A;  2M38 A;  2Y8G A;  2LOX A;  1U5F A;  5FI0 A;  4K81 A;  3ML4 A;  3DXE A;  3PP2 A;  3A98 B;  3CXB B;  4A6H A;  1NTY A;  2DYN A;  2J59 M;  1WG7 A;  2M14 A;  3SNH A;  4IAP A;  5DHA B;  1WGQ A;  4HAV B;  4CHM A;  2I1J A;  1DRO A;  1GC7 A;  2DX5 A;  3D8D A;  4TYZ A;  2AEH A;  2RVB B;  3F0W A;  3ODX A;  1U5G A;  4HHV A;  4C0A A;  1V61 A;  1EGX A;  2ELB A;  1P6S A;  5D3X A;  4F7G A;  3NSU A;  3F5R A;  5DH9 B;  2COA A;  2HTH B;  2LYD A;  1P3R A;  5D27 A;  4B6H A;  4Y94 A;  2X18 A;  3UZT A;  1WI1 A;  1U5D A;  1GG3 A;  2D2Q A;  2KUP A;  5FI1 A;  3TVV A;  2VRW B;  4P7I A;  2I5C A;  5KQ1 A;  1BWN A;  4HAY B;  1WVH A;  3QWM A;  5DI9 B;  2OQB A;  1KZ7 A;  3LJU X;  4KHA A;  2MKR A;  3DXC A;  5HE0 A;  1RRP B;  1ZM0 A;  1V5U A;  3T06 A;  2I5F A;  2DYQ A;  3PZD A;  2ROV A;  3GYO A;  1NU2 A;  1XKE A;  4GMV A;  2P0D A;  2R09 A;  5DIF B;  1MK7 B;  4YON A;  2D10 A;  4WVF B;  2Z0P A;  2ADZ A;  1XCG A;  2V76 A;  3U8Z A;  2YSZ A;  4Z2N A;  1XX0 A;  4ZRI A;  2CRF A;  1TJ6 A;  3SO6 A;  1BTN A;  5C16 A;  1ZVR A;  2CY4 A;  3X23 A;  2EMS A;  4HAW B;  5JHG A;  3PG7 A;  1LB1 A;  3ODW A;  3P7Z A;  2D9X A;  5LOP B;  4MK0 A;  2DN6 A;  1K5D B;  1P5T A;  1DDM A;  2BCJ A;  5C5B B;  3PEG A;  3AJ4 A;  1W1G A;  3ZDT A;  4PNK A;  2E2X A;  2IFS A;  2I1K A;  3KSY A;  1H4R A;  2MFQ A;  1I7A A;  5LON B;  4IFS A;  2P0F A;  2KGX B;  3FSS A;  2YT1 A;  2COF A;  3N7C A;  1TXD A;  4DBB A;  3MPX A;  4K17 A;  3KRW A;  1V5P A;  4K2O A;  4F7H A;  4L6E A;  1UEF A;  3ODO A;  2RGN B;  3AU5 A;  4HAX B;  4HAZ B;  1W1H A;  4ZRK A;  1V5M A;  4MY6 A;  2LOZ A;  1XR0 B;  1NTV A;  1V89 A;  2YRY A;  4HB2 B;  3FEH A;  2YS3 A;  1WJ1 A;  2DHJ A;  5D3W A;  1H10 A;  2YS1 A;  5KQ4 A;  2Y8F A;  1J19 A;  2W2X D;  3HW2 B;  2J0K A;  3VIA A;  1DDV A;  3BJI A;  1OQN A;  2CY5 A;  4HAU B;  2GCL A;  5HE2 A;  4KVG B;  4HB3 B;  4HDO A;  2DHI A;  2KCJ A;  2VKI A;  3RCP A;  1FHX A;  1MAI A;  2DA0 A;  1QC6 A;  2YVC A;  2QKM A;  1XD4 A;  2COC A;  1KI1 B;  2Q13 A;  5C5B A;  2PZ1 A;  2DHK A;  1AWE A;  3HQC A;  3AU4 A;  5CLL B;  5J3T A;  1ZC4 B;  4K2P A;  2IYB A;  4BBK A;  5JLJ B;  3CIK A;  4DX8 A;  3KY9 A;  2J0J A;  2W2W A;  2RSG A;  1QQG A;  4GXB A;  3KRX A;  4A6F B;  1X05 A;  4HDQ A;  4IOY X;  5EFX A;  4XWX A;  1U2B A;  1E5W A;  4WSF A;  1U5E A;  1MIX A;  4PQ0 A;  3FM8 C;  3ZVR A;  1UNR A;  3GYP A;  3A8Q A;  2GJY A;  5CLQ B;  3KZ1 A;  3SV1 A;  3PVU A;  2K00 A;  3TW1 A;  2AL6 A;  5D3Y A;  2MWN B;  3U7D A;  1U29 A;  4KAX B;  2G35 A;  3PSC A;  3WA0 A;  2EC1 A;  1BAK A;  1ZC3 B;  4GN1 A;  4GZU A;  1KZG A;  1UNQ A;  2UZR A;  2NMB A;  1XOD A;  2K2U A;  4HAT B;  2D9Y A;  4KHO A;  5DHF B;  2LG1 A;  4Z2M B;  2RUK B;  2DKQ A;  2Y7B A;  2COD A;  3SYX A;  2YS5 A; 
#chains in the Genus database with same CATH topology
 1WJM A;  3ULB A;  2H7E A;  4WJ7 A;  1X1F A;  1EF1 A;  1ISN A;  1I2H A;  2XQN M;  2D9V A;  1OY2 A;  5HE1 A;  1U27 A;  4A6K A;  2GS0 A;  2L2I A;  1IRS A;  3HK0 A;  1X86 A;  2MDX A;  4EKU A;  4GPT B;  1UPR A;  2HE7 A;  2D11 A;  2D9Z A;  2JP2 A;  1BTK A;  3DXD A;  1EAZ A;  4CHJ A;  2ELA A;  4OSN A;  4ZRJ A;  2Z59 A;  2D9W A;  1FGY A;  1UPQ A;  3QBV B;  2Z0O A;  1FHW A;  2J0M A;  2YT2 A;  5C79 A;  2RLO A;  3TFM A;  1DDW A;  2W2X C;  2ZPY A;  4EJN A;  4KHB B;  2DKP A;  1EVH A;  3SUZ A;  3A8P A;  2YT0 A;  2QKL A;  5J3Q A;  1FGZ A;  1DYN A;  4A5K A;  3OAN A;  5C6R A;  3M1I B;  5J3Y A;  2EMT A;  4EMO A;  2DLW A;  1SHC A;  4GNK B;  4GMX B;  2N0Y A;  1NI2 A;  1DBH A;  1Y19 B;  1K5G B;  3HIE A;  3PVW A;  1OMW A;  1FOE A;  4H8S A;  1GC6 A;  5JHH A;  3P6A A;  3ULC A;  1Z87 A;  2RNR B;  1X1G A;  2D4Q A;  5L81 A;  4QJ3 B;  2H7D A;  3TCA A;  1RJ2 A;  1M7R A;  3TO1 A;  2LUL A;  1B55 A;  3U12 A;  5JP4 A;  2NZ8 B;  4NSW A;  4YL8 A;  1MPH A;  2DTC A;  2Z0Q A;  2P8V A;  4HB0 B;  2GCJ A;  3O96 A;  3IVF A;  4DX9 0;  4CSQ A;  1J0W A;  4TKN A;  4CYE A;  1SGH A;  3D8F A;  1FHO A;  1MIZ B;  3WYF B;  5GOW B;  1FB8 A;  4MT7 A;  5HE3 A;  4DXA B;  2VSZ A;  1WGU A;  2DX1 A;  1TQZ A;  3A58 A;  2EJ8 A;  2UZS A;  2N23 A;  1PLS A;  1PFJ A;  1M7E A;  2K8E A;  1V88 A;  1MKE A;  1Y5O A;  3PVL A;  1MK9 B;  2CAY A;  4QJ5 B;  2Z14 A;  3V5W A;  5KCV A;  2FJL A;  2LKO A;  1W1D A;  4A6F A;  2DFK A;  1UNP A;  1FAO A;  3BIN A;  2K49 A;  3D8E A;  1ZSQ A;  2YF0 A;  3QIJ A;  2K2J A;  4HB4 B;  3NWF A;  1X11 A;  1PMS A;  5D3V A;  3MDB C;  1AQC A;  2UVM A;  2P0H A;  3G9W A;  1LW3 A;  4D0N B;  2NBV A;  4NY0 A;  2OTX A;  1N3H A;  2ROZ B;  2L1C A;  2R0D A;  4F7U P;  3VOQ A;  1Q67 A;  2M38 A;  2Y8G A;  2LOX A;  1U5F A;  5FI0 A;  4K81 A;  3ML4 A;  3DXE A;  3PP2 A;  5I2M A;  3NWA A;  3A98 B;  3CXB B;  4A6H A;  1NTY A;  2DYN A;  2J59 M;  1WG7 A;  2M14 A;  3SNH A;  4IAP A;  5DHA B;  1WGQ A;  4HAV B;  4CHM A;  2I1J A;  4DIX A;  1DRO A;  1GC7 A;  2DX5 A;  3D8D A;  4TYZ A;  2AEH A;  2RVB B;  3F0W A;  3ODX A;  1U5G A;  4HHV A;  4C0A A;  1V61 A;  1EGX A;  2ELB A;  1P6S A;  5D3X A;  4F7G A;  3NSU A;  3F5R A;  5DH9 B;  2GUM A;  2COA A;  2HTH B;  2LYD A;  1P3R A;  5D27 A;  4B6H A;  4Y94 A;  2X18 A;  3UZT A;  1WI1 A;  1U5D A;  1GG3 A;  3DCX A;  2D2Q A;  2KUP A;  5FI1 A;  3TVV A;  2VRW B;  2KR0 A;  4P7I A;  2I5C A;  5KQ1 A;  1BWN A;  4HAY B;  1WVH A;  3QWM A;  5DI9 B;  2OQB A;  1KZ7 A;  3LJU X;  4KHA A;  2MKR A;  3DXC A;  5HE0 A;  1RRP B;  1ZM0 A;  1V5U A;  3T06 A;  2I5F A;  2DYQ A;  3PZD A;  2ROV A;  3GYO A;  1NU2 A;  1XKE A;  4GMV A;  2P0D A;  2R09 A;  5DIF B;  1MK7 B;  4YON A;  2D10 A;  4WVF B;  2Z0P A;  2ADZ A;  1XCG A;  2V76 A;  3U8Z A;  2YSZ A;  4Z2N A;  1XX0 A;  4ZRI A;  2CRF A;  1TJ6 A;  3SO6 A;  1BTN A;  5C16 A;  1ZVR A;  2CY4 A;  4OT1 A;  2RRF A;  3X23 A;  2EMS A;  4HAW B;  5JHG A;  3PG7 A;  3NWD A;  3P7Z A;  1LB1 A;  3ODW A;  2D9X A;  5LOP B;  4MK0 A;  4QJ4 B;  2DN6 A;  1K5D B;  1P5T A;  1DDM A;  2BCJ A;  5C5B B;  3PEG A;  3AJ4 A;  1W1G A;  1ZYI A;  3ZDT A;  4PNK A;  2E2X A;  2IFS A;  2I1K A;  3KSY A;  1H4R A;  2MFQ A;  1I7A A;  5LON B;  4IFS A;  2P0F A;  2KGX B;  3FSS A;  2FJU B;  2YT1 A;  2COF A;  3N7C A;  2KUQ A;  1TXD A;  4DBB A;  3MPX A;  4K17 A;  3KRW A;  4L1R A;  1V5P A;  4K2O A;  4GOU A;  4F7H A;  4L6E A;  1UEF A;  3ODO A;  2RGN B;  3AU5 A;  4HAX B;  4HAZ B;  2KIE A;  1W1H A;  4ZRK A;  1V5M A;  4MY6 A;  2LOZ A;  1XR0 B;  1NTV A;  1V89 A;  2YRY A;  4HB2 B;  3FEH A;  2YS3 A;  2Z4D A;  1WJ1 A;  2DHJ A;  1MI1 A;  5D3W A;  1H10 A;  1T77 A;  3NW8 A;  2YS1 A;  5KQ4 A;  2Y8F A;  1J19 A;  2W2X D;  3HW2 B;  2J0K A;  5M4Y B;  3VIA A;  1DDV A;  3BJI A;  1OQN A;  2CY5 A;  4HAU B;  2GCL A;  5HE2 A;  4KVG B;  4HB3 B;  4HDO A;  2DHI A;  2KCJ A;  2VKI A;  3RCP A;  1FHX A;  1MAI A;  2DA0 A;  4HSI A;  1QC6 A;  2YVC A;  2QKM A;  1XD4 A;  2COC A;  1KI1 B;  2Q13 A;  5C5B A;  2PZ1 A;  2DHK A;  1AWE A;  3HQC A;  3AU4 A;  5CLL B;  2KIG A;  5J3T A;  1ZC4 B;  4K2P A;  2IYB A;  4BBK A;  5JLJ B;  3CIK A;  4DX8 A;  5IRS A;  2R2Y A;  3KY9 A;  2J0J A;  2W2W A;  2RSG A;  1QQG A;  4GXB A;  3KRX A;  4A6F B;  1X05 A;  4D6W A;  4HDQ A;  4IOY X;  5EFX A;  4XWX A;  1U2B A;  1E5W A;  4WSF A;  1U5E A;  4KHB A;  1MIX A;  4PQ0 A;  3FM8 C;  5I2S A;  3ZVR A;  1UNR A;  3B77 A;  3A8Q A;  2GJY A;  3GYP A;  5CLQ B;  3KZ1 A;  3SV1 A;  3PVU A;  2K00 A;  3TW1 A;  2AL6 A;  5D3Y A;  2MWN B;  3U7D A;  1U29 A;  4KAX B;  2G35 A;  3PSC A;  2ZKM X;  3WA0 A;  2EC1 A;  1BAK A;  1ZC3 B;  4GN1 A;  4GZU A;  1KZG A;  1UNQ A;  2UZR A;  3FVC A;  2NMB A;  2Z13 A;  1XOD A;  2K2U A;  4HAT B;  2D9Y A;  4KHO A;  3HSA A;  5DHF B;  2LG1 A;  4Z2M B;  2RUK B;  5LG4 B;  4QXA B;  3OHM B;  2DKQ A;  2Y7B A;  2COD A;  3SYX A;  2YS5 A; 
#chains in the Genus database with same CATH homology
 1WJM A;  3ULB A;  2H7E A;  4WJ7 A;  1X1F A;  1EF1 A;  1ISN A;  1I2H A;  2XQN M;  2D9V A;  1OY2 A;  5HE1 A;  1U27 A;  4A6K A;  2GS0 A;  2L2I A;  1IRS A;  3HK0 A;  1X86 A;  2MDX A;  4EKU A;  4GPT B;  1UPR A;  2HE7 A;  2D11 A;  2D9Z A;  2JP2 A;  1BTK A;  3DXD A;  1EAZ A;  4CHJ A;  2ELA A;  4ZRJ A;  2D9W A;  1FGY A;  1UPQ A;  3QBV B;  2Z0O A;  1FHW A;  2J0M A;  5C79 A;  2RLO A;  3TFM A;  1DDW A;  2W2X C;  2ZPY A;  4EJN A;  4KHB B;  2DKP A;  1EVH A;  3SUZ A;  3A8P A;  2YT0 A;  2QKL A;  5J3Q A;  1FGZ A;  1DYN A;  4A5K A;  3OAN A;  5C6R A;  3M1I B;  5J3Y A;  2EMT A;  4EMO A;  2DLW A;  1SHC A;  4GMX B;  2N0Y A;  1NI2 A;  1DBH A;  1Y19 B;  1K5G B;  3PVW A;  1OMW A;  1FOE A;  4H8S A;  1GC6 A;  5JHH A;  3P6A A;  3ULC A;  1Z87 A;  2RNR B;  1X1G A;  2D4Q A;  5L81 A;  2H7D A;  3TCA A;  1RJ2 A;  1M7R A;  3TO1 A;  2LUL A;  1B55 A;  5JP4 A;  2NZ8 B;  4NSW A;  4YL8 A;  1MPH A;  2DTC A;  2Z0Q A;  2P8V A;  4HB0 B;  2GCJ A;  3O96 A;  3IVF A;  4DX9 0;  1J0W A;  4TKN A;  4CYE A;  1SGH A;  3D8F A;  1FHO A;  1MIZ B;  3WYF B;  5GOW B;  1FB8 A;  4MT7 A;  5HE3 A;  4DXA B;  2VSZ A;  1WGU A;  2DX1 A;  1TQZ A;  2EJ8 A;  2UZS A;  2N23 A;  1PLS A;  1PFJ A;  1M7E A;  1V88 A;  1MKE A;  1Y5O A;  3PVL A;  1MK9 B;  2CAY A;  3V5W A;  5KCV A;  2FJL A;  2LKO A;  1W1D A;  4A6F A;  2DFK A;  1UNP A;  1FAO A;  3BIN A;  3D8E A;  1ZSQ A;  3QIJ A;  2YF0 A;  2K2J A;  4HB4 B;  1X11 A;  1PMS A;  5D3V A;  3MDB C;  1AQC A;  2UVM A;  2P0H A;  3G9W A;  1LW3 A;  4D0N B;  4NY0 A;  2OTX A;  1N3H A;  2ROZ B;  2L1C A;  2R0D A;  4F7U P;  3VOQ A;  1Q67 A;  2M38 A;  2Y8G A;  2LOX A;  1U5F A;  5FI0 A;  4K81 A;  3ML4 A;  3DXE A;  3PP2 A;  3A98 B;  3CXB B;  4A6H A;  1NTY A;  2DYN A;  2J59 M;  1WG7 A;  2M14 A;  3SNH A;  4IAP A;  5DHA B;  1WGQ A;  4HAV B;  4CHM A;  2I1J A;  1DRO A;  1GC7 A;  2DX5 A;  3D8D A;  4TYZ A;  2AEH A;  2RVB B;  3F0W A;  3ODX A;  1U5G A;  4HHV A;  4C0A A;  1V61 A;  1EGX A;  2ELB A;  1P6S A;  5D3X A;  4F7G A;  3NSU A;  3F5R A;  5DH9 B;  2COA A;  2HTH B;  2LYD A;  1P3R A;  5D27 A;  4B6H A;  4Y94 A;  2X18 A;  3UZT A;  1WI1 A;  1U5D A;  1GG3 A;  2D2Q A;  2KUP A;  5FI1 A;  3TVV A;  2VRW B;  4P7I A;  2I5C A;  5KQ1 A;  1BWN A;  4HAY B;  1WVH A;  3QWM A;  5DI9 B;  2OQB A;  1KZ7 A;  3LJU X;  4KHA A;  2MKR A;  3DXC A;  5HE0 A;  1RRP B;  1ZM0 A;  1V5U A;  3T06 A;  2I5F A;  2DYQ A;  3PZD A;  2ROV A;  3GYO A;  1NU2 A;  1XKE A;  4GMV A;  2P0D A;  2R09 A;  5DIF B;  1MK7 B;  4YON A;  2D10 A;  4WVF B;  2Z0P A;  2ADZ A;  1XCG A;  2V76 A;  3U8Z A;  2YSZ A;  4Z2N A;  1XX0 A;  4ZRI A;  2CRF A;  1TJ6 A;  3SO6 A;  1BTN A;  5C16 A;  1ZVR A;  2CY4 A;  3X23 A;  2EMS A;  4HAW B;  5JHG A;  3PG7 A;  1LB1 A;  3ODW A;  3P7Z A;  2D9X A;  5LOP B;  4MK0 A;  2DN6 A;  1K5D B;  1P5T A;  1DDM A;  2BCJ A;  5C5B B;  3PEG A;  3AJ4 A;  1W1G A;  3ZDT A;  4PNK A;  2E2X A;  2IFS A;  2I1K A;  3KSY A;  1H4R A;  2MFQ A;  1I7A A;  5LON B;  4IFS A;  2P0F A;  2KGX B;  3FSS A;  2YT1 A;  2COF A;  3N7C A;  1TXD A;  4DBB A;  3MPX A;  4K17 A;  3KRW A;  1V5P A;  4K2O A;  4F7H A;  4L6E A;  1UEF A;  3ODO A;  2RGN B;  3AU5 A;  4HAX B;  4HAZ B;  1W1H A;  4ZRK A;  1V5M A;  4MY6 A;  2LOZ A;  1XR0 B;  1NTV A;  1V89 A;  2YRY A;  4HB2 B;  3FEH A;  2YS3 A;  1WJ1 A;  2DHJ A;  5D3W A;  1H10 A;  2YS1 A;  5KQ4 A;  2Y8F A;  1J19 A;  2W2X D;  3HW2 B;  2J0K A;  3VIA A;  1DDV A;  3BJI A;  1OQN A;  2CY5 A;  4HAU B;  2GCL A;  5HE2 A;  4KVG B;  4HB3 B;  4HDO A;  2DHI A;  2KCJ A;  2VKI A;  3RCP A;  1FHX A;  1MAI A;  2DA0 A;  1QC6 A;  2YVC A;  2QKM A;  1XD4 A;  2COC A;  1KI1 B;  2Q13 A;  5C5B A;  2PZ1 A;  2DHK A;  1AWE A;  3HQC A;  3AU4 A;  5CLL B;  5J3T A;  1ZC4 B;  4K2P A;  2IYB A;  4BBK A;  5JLJ B;  3CIK A;  4DX8 A;  3KY9 A;  2J0J A;  2W2W A;  2RSG A;  1QQG A;  4GXB A;  3KRX A;  4A6F B;  1X05 A;  4HDQ A;  4IOY X;  5EFX A;  4XWX A;  1U2B A;  1E5W A;  4WSF A;  1U5E A;  1MIX A;  4PQ0 A;  3FM8 C;  3ZVR A;  1UNR A;  3GYP A;  3A8Q A;  2GJY A;  5CLQ B;  3KZ1 A;  3SV1 A;  3PVU A;  2K00 A;  3TW1 A;  2AL6 A;  5D3Y A;  2MWN B;  3U7D A;  1U29 A;  4KAX B;  2G35 A;  3PSC A;  3WA0 A;  2EC1 A;  1BAK A;  1ZC3 B;  4GN1 A;  4GZU A;  1KZG A;  1UNQ A;  2UZR A;  2NMB A;  1XOD A;  2K2U A;  4HAT B;  2D9Y A;  4KHO A;  5DHF B;  2LG1 A;  4Z2M B;  2RUK B;  2DKQ A;  2Y7B A;  2COD A;  3SYX A;  2YS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...