5J43A

Cdia-ct from uropathogenic escherichia coli in complex with cysk
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
313
structure length
312
Chain Sequence
GKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVCRIGANMIWDAEKRGVLKPGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGMKGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGTGGTLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPANLDLKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILPSSGERYLSTALFAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase A
publication title Unraveling the essential role of CysK in CDI toxin activation.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Toxin
total genus 111
structure length 312
sequence length 313
chains with identical sequence E
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5j43A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5j43A02
1D6SA 1UBSB 5D86A 5IWCA 4Y6GB 5D84A 3CEPB 4D97A 2BHTA 1A5BB 2V03A 4D9IA 1A5SB 4D8UA 3R0XA 1TTPB 3IQGX 4D9NA 3V7NA 4D8TA 3HMKA 3FCAA 1V8ZA 5HBGA 5B53A 1J0BA 1K3UB 1KFCB 2DH5A 2CLEB 1K8XB 5IW8A 1J0CA 1QOQB 4LMBA 5DVZA 4PCUA 1RQXA 2TRSB 4HN4B 4L0DA 2Q3BA 1V7CA 4D9BA 2RHGB 2CLIB 1VB3A 1A5AB 3VBEA 5B36A 2C2BA 1PWHA 3VSDA 5T6MA 4D9KA 2Q3CA 5CGQB 1M54A 3VSAA 5DW3A 5EY5B 1J0EA 3ZEIA 5I6DA 5E0KB 2O2EA 3FGPA 3L6BA 5DW0A 1K7XB 3SS9X 1TZMA 3DWGA 4L28A 4ZU1X 2RH9B 2GN1A 4COOA 3X44A 4H27A 2TSYB 5DBHX 2TYSB 1X1QA 2GN0A 5BW6B 4D9GA 1PWEA 1BKSB 4OFXA 1VE1A 1WBJB 1WDWB 3L6RA 4D99A 3X43A 4AECA 3PC3A 3AEXA 1Z7WA 2EFYA 3PR2B 2Q3DA 4L3VA 1KFBB 1OASA 4IL5A 1KL7A 1UIMA 5J43A 1F2DA 5KINB 4QYSA 5I7RA 3DWIA 1KFJB 4AIRA 1UINA 2PQMA 1CW2B 5JISA 4HPJB 5DBEX 2CLMB 1K7FB 3T4PA 1C8VB 1TTQB 5I7WA 2DH6A 1CX9B 2J9ZB 1K7EB 1KFKB 2ISQA 3IAUA 5B3AA 2WSYB 1BEUB 5I7HA 4NU8X 3DKIA 3R0ZA 3AEYA 5JJCA 1E5XA 1C9DB 2GN2A 4F4FA 3PC2A 1K8ZB 1P5JA 2O2JA 4HPXB 4I1YA 1TZJA 4D96A 2EGUA 4KKXB 4D9EA 4JBNA 1QOPB 4WX2B 1WKVA 2RKBA 5B1HA 2CLLB 2D1FA 4NEGA 1TDJA 2J9YB 1Y7LA 4HO1X 1C29B 3TBHA 1KFEB 1TJPB 1JBQA 1K8YB 5B55A 5D87A 2CLFB 2ZSJA 1WTCA 1TZKA 2ECOA 3BM5A 5CVCA 1V71A 4HT3B 5C3UA 5I7OA 1Z7YA 4D9FA 5B1IA 5I7AA 2C2GA 3RR2A 5D85A 3IQHX 5KZMB 4D92A 3VC3A 2CLKB 1J0AA 2CLHB 1O58A 3L6CA 3SS7X 3PC4A 2J9XB 2CLOB 3SPXA 2JC3A 1VE5A 5J5VA 1FCJA 4D8WA 4L27A 1J0DA 4LI3X 1FUYB 4D9CA 5IXJA 1TZ2A 3IQIX 2ZPUA 4ZU6X 4XUGB 2BHSA 2ZR8A 3VSCA 4LMAA 4D9MA 1A50B 2ECQA 4OREX 1TYZA 4JBLA 4ZQCB
chains in the Genus database with same CATH superfamily
2YMMA 4EUHA 4Q3KA 4DV3B 3OLXA 3D2AA 5HFAA 1ZI6A 4AJEA 1H8HD 2PCJA 2RIRA 3B6ZA 3U4QB 1GDTA 3FYUC 4ZO7A 1T5OA 3DUFA 3FRJA 4XX0B 4F85A 3MJSA 1C81A 1HFKA 2D5AA 4DZRA 3KZCA 3O8QA 2PIAA 4BFSA 1F8UA 2R7KA 1DJNA 1N6NA 3BE8A 1JQKA 4FYMA 3R7SA 1JDBC 4YP7A 1G18A 1HE8B 1NNLA 3DCNA 2RHGB 3KALA 4X97A 3RUCA 1A5AB 1NXWA 1T4CA 3F5DA 1B0UA 1CKEA 3NNDA 5I9TA 3VH1A 4OSOA 2Q6LA 4E03A 3SVLA 3VPCA 3JAWB 5EXTA 1PZMA 4ZEWA 3ESXA 5EZQA 3A06A 4TS1A 5IKOA 4P7GA 4Z8XA 1T5DX 2LKDA 5DFAA 3U16A 4CDGA 2VP4A 1F3LA 3NOXA 4DR3B 2WU4A 4UBJA 3AR4A 2ZDQA 4LHZA 4PPYA 5FL7A 3EVNA 3F1KA 3HVUA 2HWXA 1FK8A 1TADA 2AOTB 4DBLE 2APJA 2JAWA 1S96A 3KOYA 1WDMA 1BU8A 1C8LA 4LISA 1DEOA 2DSNA 2YWGA 3MJEA 5FUMA 1JXOA 4JSRA 1EVZA 1ENPA 2H29A 2O3UA 2CVOA 3OHMA 2ZE7A 2AG8A 2ZRAA 5HS6A 3VR2A 4RD2A 4FNAA 3OX3A 3SIWA 3DLPX 2ZJ0A 4BAUA 4WLEA 1X86B 3U7HB 3TW8B 1ZUWA 4U7HA 4XIJA 4BTLA 4FGZA 1OLXA 1WF6A 2A3NA 1BXKA 5FPYA 1GILA 3R6GA 1I2MA 2QMEA 2ZLBA 3I5UA 1EJ2A 3NXKA 4UHJA 1VPWA 5J58A 2P2SA 2ZBGA 2CHFA 4XGKA 3UUEA 4CMHA 4HVLA 3FNQA 1SBZA 2QIOA 1K08A 2WOJA 3ZXXA 4NZZA 1MV8A 4U7WA 3QA9A 5EMKA 3RVDA 1VLJA 3PGLA 3TMYA 2EHJA 3UQYS 4ASUD 5KYTA 3WYFA 3BL6A 1XMSA 2OYCA 1G4HA 3PVSA 1KOFA 4IEEA 3EGIA 1AS0A 3UMFA 2G6BA 3F7NA 2B99A 5LA6B 4JT4A 2DTEA 4Z3KA 4FI3F 4FT4A 2P27A 3AWIA 3GF4A 2Y2VA 3AR6A 4OQLA 5DNCA 4URUR 5CFZA 1E0AA 2RGXA 4P3PA 1LTHR 3ZN2A 1Q12A 4RVUA 1VL8A 2YTZA 4JBGA 4JJAA 4NHOA 3X2FA 2QJTA 2VA9A 3VNVA 2R3SA 4L9RA 4WZAB 4OLAA 3C6KA 3IB6A 3DH0A 1PFUA 1OYOA 3KUXA 5IM4A 4ID9A 2CLKB 4PRKA 4R7GA 2RGEA 4JJZA 2P9QA 2NZVG 1RM4A 4HTFB 4Z6KA 2J9XB 4I5FA 3HMQA 1CDEA 3LECA 3MW8A 3IEPA 2C5SA 1P31A 1WF3A 4JI6B 2GZAA 4JT2A 3QZUA 3E9ZA 5DO9A 5EXDA 1ISRA 1U9CA 3V4VB 3VSCA 1A9XB 3ELDA 5IJAA 2BGUA 4OKSA 4HFNA 1RCUA 1JDNA 1M2OA 4GPZA 3R6LA 3UAVA 2DPGA 2A9FA 2AZTA 4G0WA 3K1YA 4HGQA 3ODGA 2IIPA 3HPRA 4PZCA 5D1NA 1CLEA 3G0HA 2GYUA 1H3NA 3DL2A 3ON5A 1SPXA 3KYIB 3UKOA 5CA0A 2BHTA 1E0JA 4DCNA 1JV2B 3UXEA 3AUYA 1FE8A 1OH5A 2D0IA 4FMDB 3SFZA 3TN7A 3DAGA 1ZM4A 1Q14A 4CM9D 1EGHA 2QM0A 2VN8A 3MD0A 4CKBB 1N34B 4B4DA 4G6ZA 3TYXA 2CE2X 5IM5A 1MMFB 2QUKA 2FG5A 3RS2A 4EVQA 4KH1A 4I50F 1ZGZA 2FUNB 2JANA 3CS3A 5CLIA 4ZOEA 4CKWA 1ISMA 1GSOA 1DOHA 5L4LA 4DFDA 3JX9A 1X19A 4EQ6A 2J0SA 2F8MA 3FHCB 3K1TA 1U2DC 5CDGA 4KW7A 1WXHA 2WWXA 1HO3A 3FUUA 4R9RA 4B40A 1IU9A 2OZLA 3LZ6A 3HLTA 4EG6A 3CPJB 1NAIA 2C9BA 1FJGB 4CGZA 4PSAA 1JA1A 5DTMA 2FP4A 4RFSB 2QN6A 4LC9A 1XLWA 1JGTA 4FDTA 4IQ4A 4LQCA 2JEOA 3VO8A 5BV7A 4EA7A 5TQ0B 4V0OA 4BU0A 3KSMA 3KQOA 1LSOA 3GRCA 4X6YA 4FDUA 3S99A 1XK6A 2V9ZA 4EBFA 4CL2A 3DBHA 2C58A 1PJ8A 4Z4FA 1TLTA 4X1IB 5DN6A 2DWQA 4WFKA 1FX1A 2INGX 4DMUB 2VTVA 4ESEA 2XECA 4K0RA 4R8VA 5AJXA 3K4QA 3CVOA 4C7OB 2HPZA 4A36A 4AWAA 5AVTA 1PL0A 4AIRA 1E9RA 3VGJA 2CWWA 4RCYA 2Q6VA 3H9BA 4LUCA 1WV0A 4WESA 5DGXA 5TGDA 2ZROA 5T67A 4DNOA 1GR1A 2VXYA 4XRGA 2N47A 1EFAA 2YJ4A 1FXSA 1VGVA 4ETIA 5EHQA 5L40A 3L7CA 3AILA 2R44A 1P5RA 1YS9A 1T4MA 2ZRBA 1TKCA 4G56A 4I9HA 5C2JB 3GEHA 1ESEA 1MR3F 1U4SA 3N70A 5LIRA 2X14A 1PNQA 5BR8B 1CU1A 4GM4A 2FSVA 2IP2A 2XE7A 4LVUA 2CJWB 3CLVA 3MN1A 1AD2A 2C2WA 1XZLA 3N2KA 4MQMA 3PUWA 1UMDA 1W0KD 5DMXA 4BNTA 2ZW9A 4OL0A 3HEAA 3K6JA 3UWPA 5KQRA 1BVUA 2XBLA 2XBUA 4C0KA 1VSTA 4LFAB 1XQ1A 1Z28A 3HJBA 3AZQA 4H60A 4X9XA 1JAZA 4KBYA 1W2HA 3JZDA 3O84A 3E3OA 4OV6B 4A7PA 1ZN2A 2A94A 3WRVA 4QDZA 4LV6A 5TNXA 5IWAB 5I5EA 5EG5A 4PC7A 3S6JA 5DM60 5CD1A 3I2JA 4WPGA 1BZYA 2V98A 1XMOB 1NVKA 3P0FA 2X0RA 3SC2A 2WAYA 1GM5A 2PWBA 3E70C 4WK0B 4HDNA 1AKRA 4RY8A 4NARA 2NV0A 1RQNA 4DLKA 1POXA 1FIUA 4EHDA 3FGZA 2HHCA 2VHTA 4MR9A 4TX1A 4QZVA 2JIZD 2VJCA 2Z8XA 4UQOA 3K5HA 2L82A 2PD3A 1QV6A 2GXUA 1ZN7A 4XVCA 4DIUA 4KREA 1NMYA 4M22A 2UZAA 4G26A 2ZYRA 3WGYA 4B4OA 2GAOA 3HACA 1I13A 1IVNA 3ONNA 2FWNA 4HHEA 2WJJA 1K4KA 1QHFA 3DV0A 1WIWA 1G7SA 5K0NA 4NBNA 3VNSA 4RTQA 1Z17A 3QM1A 1ULTA 3IIIA 2IDMA 4Y1FA 1O0SA 1Z0JA 1GHTA 2JGMA 1OU0A 2QTHA 1H0KA 2VL7A 2ZRCA 2CVPA 3IESA 1V1MB 3GLHA 1SK9A 2PA3A 1T9BA 2QTWB 1NVGA 3O2JA 4RE5A 1ZK1A 2PZMA 1GRRA 3W4IA 1ZH8A 3RJTA 1ZO8A 4Q6WA 5BNWA 2MHCA 1GGJA 1M0EA 3FPFA 3ZKAA 5IPFA 1ZHHA 3IVXA 3NQ41 2VPPA 1ORIA 3O93A 4NENB 3EHEA 2HIAA 3KJIA 3IKJA 3SE0A 4ZI7F 3EW9A 3FSGA 4G0PA 3N9IA 3IVCA 2R7AA 1PJQA 3LCJA 5FWXA 2DMRA 3CTMA 3GT7A 3NBMA 5C51B 4QODA 2XMCA 3O8OB 2XXAB 5KQGA 4ZYZA 1ZPDA 1H66A 1SKBA 4UD6A 2JRLA 2ECKA 4JYPA 4XI9A 1M66A 4HZUA 4B0OA 2H0RA 4MQEB 5LDDC 4OHXA 4LJ6A 3EISA 4YQFA 1RBMA 5CNKA 1DIGA 2CFSA 1VLLA 4INOA 4AQ7A 3ETDA 3B2QA 1J8YF 4UHFA 3WBKA 5CHEA 1N0UA 1DUSA 1DMSA 4GR9A 4IQ8A 3SIPA 4A91A 4ZYXA 2ZT6A 2OV6A 2QM8A 5A6SB 1J6UA 2L18A 4B5LA 4U2FA 1Y5MA 4DDHA 1M72A 1YBHA 4RZ2A 4EA9A 2JFPA 5DI9A 5AW7A 2PQMA 4JXJA 2O2SA 1OU4A 3ZGZA 1PWZA 1H2XA 2AYZA 3LK6A 3ZGNA 7ADHA 3B6IA 5GJVC 2F1HA 2GN8A 1N7IA 2C8VA 3UJ3X 1Z5UA 4NPAA 2DT8A 3AY3A 3NUQA 3T1OA 4GYKA 2WUGA 3M2TA 3OKAA 1R12A 1VCIA 4LHXA 4Z9XA 4KZPA 2GLUA 3AINA 3SF0A 3LX4A 3LNTA 3AKZA 1KY2A 3DA8A 1Z4IA 1UODA 1JEOA 4C21A 2ZTLA 2Q4EA 1KARA 2MSDB 2QS9A 2IZOA 5C18A 5JH7F 2R4TA 5CDHA 1HYBA 4PZDA 3RHFA 4RAQA 4YMTA 3HWRA 1B42A 2MINB 1YL7A 2XITA 4ZHQA 3VKGA 2GARA 1YASA 1WPGA 3A7EA 3VR4A 2BSXA 4KQXA 1O97D 3JYPA 4FBLA 4WNIA 2HU5A 5TY0A 3IMCA 3GEPA 1B1AA 4BE4A 3ROEA 3JR3A 4X1YA 3RYHA 1CUUA 1W36B 1C1XA 2PX0A 1YQGA 4WCVA 1L5WA 1X9IA 2Z6VA 1PV2A 4FYKA 1GVNB 3V8QA 2ZJ5A 4ANFA 2P77A 2X0IA 1YGYA 3OLQA 4RF3A 5M34A 5IP5A 1E77A 3PUYA 1LPNA 2FZ5A 1M74A 3IH5A 5HIKA 2ZSBA 1SU4A 1DWUA 3G2IA 2YJ6A 1W76A 3V1NA 2FZ4A 3OZCA 5FV4A 5ADWA 2PT7A 2D3WA 4BB5A 1TRKA 4H7FA 4LRTB 4LXYA 1M9NA 1PTJA 3T5BA 1ZSYA 3DZBA 5L7WA 3DPUA 5T8KC 1KK0A 3J80A 2XE8A 4K3UA 4E1BA 1YR2A 1YC5A 2J0EA 3T34A 1EK2A 1SZDA 3BB1A 1MOSA 4B46A 4EY6A 5KTMA 5CEFA 1WZIA 3O73A 2AJDA 1NQVA 1YMQA 2BMDA 4PGMA 3PJGA 1DBQA 1SIUA 3PXBA 5AI6A 3BMOA 3SDSA 1DBIA 1T2CA 3PQ4A 3NRCA 2X0FA 5K20A 5TB5A 2HAEA 3GAZA 1GAWA 2XUAA 1TU4A 4BECA 3BTVA 2QRPA 4ZYVA 6REQA 1IL0A 3HEBA 3D6AA 3LBAA 4RCVA 1X77A 1Z82A 2BZGA 4E3WA 4B81A 1R50A 2FHSA 2XWJI 2ZULA 3GA5A 3LLSA 2O2ZA 2PZGA 1LH0A 5F1KA 3RWBA 3ZR4B 4BVFA 4DOMA 5KS2A 4UARA 1RI1A 3BILA 2G0TA 4XFKA 5IJXA 2VYND 5JCJA 4DG8A 4DKJA 3VBEA 2UV8A 3AVYA 4XLZA 3Q40A 4WOJA 3AI2A 5JEDA 3K8YA 5GMOA 1G3UA 1TL7C 4OMCA 3UMGA 2OM6A 2P0AA 2ST1A 4KRFA 4V24A 3ZY3A 5FWAA 3JQ9C 2JLWA 2GFIA 1NX6A 1XJWA 2Q45A 3H9EO 1RPZA 4WY8A 2UYHA 1OFVA 3C87A 1YHZA 4KE6A 4EW2A 2IY9A 2EFCB 1F2TA 1M0SA 1QHHB 4FHCA 5MFZA 4IHQA 4OA8A 2YYSA 1L7XA 3OAAA 4PAGA 5ENDA 1ZIYA 4DILA 3AM1A 3T95A 3EVTA 1IY0A 1L4BA 3EIHA 2CDNA 1NZDA 5CG1A 2XXJA 5KB3A 3K1AB 3AEXA 3BSSA 2ZDGA 3R0IA 4RVHA 4ODIA 3OC0A 2F17A 1TAQA 3HCWA 1Q21A 4O2AA 5BSGA 5HHTA 4BXOA 3IVRA 4ZEMA 2QRQA 5HDBB 4EG5A 5JISA 1UAGA 1HY3A 1VMEA 2ZWAA 1ZITA 1JSRA 3L6EA 3EODA 3LHSA 1Q57A 4QFDA 5CTJA 1H93A 3ANTA 5TMEA 2PRSA 2X2FA 4CTMA 4ZMBA 4I4TA 2GHTA 1OH6A 5DHRA 2PH1A 1GTJ1 1QP8A 1MDBA 4NH0A 4Y2QA 2J3QA 3OMWA 3REQA 1T6ZA 1D2NA 1RE1A 4O1HA 3TL6A 2JLAA 3RUDA 3MYRA 3ECAA 3TM5A 2OFFA 4LZJA 1BE0A 1CB7A 2NYAA 4BNDA 4V1CB 4Z9FA 1CF4A 2EKDA 3CYFA 5E7JA 4BKMA 4G23A 2V74B 3M3DA 3IIEA 4K05A 4LY9A 1U2TA 3DYVA 2V7BA 2PIDA 3LT2A 4GPTA 1VZ3A 1T35A 3KJFA 5TVGA 1GUZA 4ARUA 1ADYA 4DS3A 1Q7CA 5CLFA 1SCDA 1Z18A 2GCEA 3W6ZA 4N65A 1DTWA 1GL3A 3D6HA 3T3IA 2DERA 3O4GA 1VL2A 4QYWA 7YASA 3GBPA 3D8HA 1PS0A 1D1SA 4R8RA 1MO3A 2H1OA 1E3SA 1XB2A 4UPEA 4OGGA 3G9XA 3OFKA 1R5JA 1PHRA 3O83A 3ABOB 1ANKA 5BR7A 4OA5A 4N82A 3DJFA 4XUEA 2ZWVA 3WGJA 3IQHX 2GYWA 4B75A 1OTHA 3TQOA 5AKLA 3IP7A 1KMQA 1ZGJA 1NNEA 4P9NA 2ZEJA 3ESQA 3FOZA 4HS9A 4AQYB 3UMRA 2J30A 3DYBA 2W58A 1NSTA 2ZGVA 3BKWA 3LYUA 3ITKA 3MTBA 3WNVA 3U6KA 5A06A 1OKKD 5CYOA 1GPMA 3QP9A 2R5NA 4TMYA 3A25A 2JHPA 4MB2A 1Q1NA 1SG6A 1VA5A 3C4QA 3ICPA 2VRBA 4HDAA 4LZAA 4JLKA 2IXDA 4TZ0A 1FF9A 4CHTA 3MT7A 1VDMA 1E89A 2GEJA 4QTYA 4IDFA 3LUJA 4J4TA 5F7JA 2IC5A 3RYFA 2I2FA 2I4OA 5AJHA 4ZOLB 3OFNA 5JFOA 2LXNA 2WLTA 3IEXA 3P0RA 1I51A 2RC5A 1O4WA 1W1IA 3P9QA 1AKUA 3TXXA 2BM8A 3B9BA 5LZ4A 1SC9A 2J7PD 3KVNA 4MAFA 4OAOA 3C1TA 4RTKA 4UTPA 3VZCA 2WZQA 2OHVA 4RVOA 4TLLB 4E3ZA 2JGKA 1ONBA 4YAUA 2C82A 3KE9A 1CV2A 1Y3AA 1FP4B 1W44A 4FILA 3C6MA 1MFPA 1W30A 1HFWA 3PKZA 2ZZNA 1EVLA 1UFOA 2PO7A 4JOQA 4C7KA 4WDQA 3KZVA 3WNDA 1JAIA 4F93B 3Q7QA 1KI6A 5THQA 1IOZA 1N0IA 1XPJA 1P5HA 3FJYA 3SS9X 1XWIA 4COOA 4WA7A 2PD6A 4B47A 3AF3A 3FMOB 5TT1A 1Y8QA 4KAAA 5F1OA 3VKFA 1QGAA 1MAHA 4S1NA 3VHQA 1E3WB 3OY7A 4MH0R 1P9NA 5GP1A 3O21A 3GVCA 3M6LA 2R2AA 4WE3A 2NU7A 3B13B 2B2XA 2PX6A 3A2LA 4ZQEA 3HGTA 1T8TA 4D56A 4UE3S 2Q27A 5EIBD 2OV4A 3UICA 4CCWA 2PS9A 2HSZA 2IH5A 4Q9HA 1EX9A 1Y9JA 2J4FA 3DFFA 5J23A 2HQRA 2X7JA 4QT0A 5DK4A 2H52A 3KQLA 2JFNA 1ZM3A 1CX9B 3U4IA 3FTCA 3QVOA 4OY3A 4RHFA 4IR7A 4G1VA 4NU8X 1NM5A 1GXSA 1ATZA 3DTVA 3PXXA 3AFNA 3SXUA 4JJEA 4XFJA 2ACEA 4PGGA 1XZAA 1DX4A 1WV1A 3DHNA 2KBFA 2BF7A 5COQA 3VTZA 3WFIA 3T3NA 3I58A 3B48A 3D5EA 1AHHA 1QOPB 1FP1D 1OGJA 5IT0A 1FVOA 4DMLA 3FM9A 1UKYA 4O0MA 2C0CA 1C9MA 4BGIA 1NA5A 3AJRA 3C2QA 3LZCA 2IFTA 4H3KB 5I3CA 1RYFA 3PHBE 5A4KA 2H2GA 4RSRA 1S3SA 3JQCA 3NAZA 5JQGB 2UZ1B 4IRUB 2RSLA 4MWZA 2CEKA 4CM4B 4YCLA 3FMFA 4PO3X 3C7CB 1MTZA 2J6CA 2PYZA 1G5IA 4G97A 5IS2A 3EPJA 3VNQA 3IDFA 4DV4B 1UBCA 1JYFA 3DKRA 1HQCA 4W7IA 3DEHA 5B1IA 3WWPA 4UBMA 4PYNA 2BELA 3OPYB 3H4VA 5G53C 3WL6A 3STUA 4A6XA 3BJEA 5LVAA 2W2KB 3CB4A 2ZBUA 2B6HA 2G09A 1DIBA 1JQJC 2W11A 5F3WB 4JJKA 4PFKA 4LRUA 2ZB3A 3RNOA 4E2WA 3NPMA 5LQSA 2XB8A 1COZA 4P32A 3L0PA 4PLPA 4TWIA 1D6JA 4RL4A 4R2KA 4Z7JA 1E1RA 3ZDYB 1TI7A 2BFBA 3R3VA 4ZDWA 4QL3A 3U7JA 3ZS9A 1VE9A 2I3BA 2YBDA 3EUFA 1P6XA 4OGFA 1G41A 1NXTA 3SHFA 1DB3A 3RK4A 4A2CA 5B2EA 4NCKA 3UPTA 3D5QA 1ODIA 5LJIA 2H07A 3IB3A 1PVVA 3ZZUA 3RF6A 1DEXA 1YCDA 1H4VB 1SZJG 3UAYA 5JSZA 3ER8A 3TIFA 2FPIA 4KXLA 4S35A 5BUQA 1NW3A 3GGOA 2PEZA 3DOHA 5C7OO 1MUUA 3JARB 3OY2A 3OJ0A 8OHMA 4RQBA 2VH2A 4D43A 3H8JA 3DSRA 3GLTA 2AG0A 1YUBA 2XE4A 1RCFA 2YC2C 2IP1A 3O3CA 4MUGA 4TMKA 5IVIA 4CM8B 2FHPA 2D74A 1OZHA 2PBLA 3LQRA 3Q3CA 1MH1A 2DTDA 4DNXA 3PC8C 2RD2A 1KJJA 3QI2A 2MTBA 3KB2A 3LL7A 1ZKDA 5J2UA 3K70B 4GRDA 5FNZA 2Y2UA 3HV2A 4IO0A 2ZIGA 4L51A 1ODSA 4R1NA 1L5HA 5KREA 3T5AA 3I2HA 1W6RA 1PQ4A 4LSGA 5E7MA 5DW3A 1GV0A 1G5HA 1HG0A 3QWHA 5DRYA 1WZCA 1A8PA 6ADHA 1XNHA 1RYBA 3D4BA 3ZU2A 1K7XB 1XRRA 3BIJA 1Z36A 3CKKA 1TAUA 1PZNA 4XD2A 1RAHA 5M3BA 4UVHA 1DQNA 1P39A 5IJ0A 4NJOA 5TXGA 2D6FA 3GLIA 1P18A 1BNCA 1B26A 2HLDA 3LO8A 1ZHFA 4HQLA 2GF0A 2BMJA 4IIFA 5IJ9A 4CDMA 2FAXA 3K9NA 3PFFA 3PC3A 1G0NA 4JLAA 2CZGA 4WASA 4P34A 2JHFA 1K92A 3KR2A 2ZU6A 1MC1A 2OCGA 3I5MA 1Z0AA 1MABA 4RD0A 4DJJA 1U0GA 4GPIB 1H1DA 4TRRA 1PGPA 1U6KA 4QUJA 2YFYA 4LCJA 1YA8A 2F1KA 4FI3C 4EJSB 2RHMA 3PPYA 1VYUA 5FEMA 3T8YA 4ZJPA 1Q3HA 4OI1A 2QTMA 3HRKA 5LD2B 1BCSB 3PCXA 1MTOA 4BDTA 4P7KA 2FFRA 2VP6A 1PJTA 2I55A 3H3FA 4ZAWA 5KKAA 4X7RA 3WO0A 2WJ6A 3KSAC 3CSUA 4K0KB 3LYLA 4DCGA 1O5IA 5THXA 5HZMA 4YY3B 2UZ4A 4QPCA 1ZJWA 4CRWB 2I1WA 2CBXA 1XQWA 2AFHA 2RCNA 1P2VA 4CM1A 4ENPA 1XTTA 1W2WB 2WJWA 1KZ6A 1M8GA 2RHTA 4M8LA 1X9GA 1QZTA 2CJPA 2GN9A 1HTWA 1ZGCA 4KAFA 4OUDA 4EB3A 4G0MA 5JAHA 4NJEB 2ZAIA 4ROSA 1UZNA 3K0CC 4H2DA 1ZFNA 4WEQA 2DLCX 3R7WA 3WK9A 1OH8A 1CCWA 2NOAA 3F5MA 4H77A 3UIEA 4LJLA 4A26A 1CETA 4ARZA 1Y1LA 1NQOA 2RG7A 3D1VA 5K8IA 5IAJA 1TVKA 4IG4A 4OF4A 1GFIA 2O8FA 4XDZA 3ROXA 1H8HA 2NN3C 4UFPA 4G9BA 2PUWA 3O7WA 4EX7A 1ACLA 4BVBA 3SYNA 5BUSA 2V9CA 1AKNA 3AEKA 3D02A 1D0SA 2IXAA 4KNWA 2V45A 1E2HA 5ECWA 5DWVA 2HA4A 3ZHRA 1EG2A 4R4JA 4YRLA 3AG6A 1WLSA 3AR7A 4JGBA 4ZVPA 1XP5A 2ACKA 2JVJA 1FFDA 1KAMA 2RDMA 1RQPA 4XB1A 4ZEOA 1P4JA 2IZ6A 4UFOA 1ODLA 4XCVA 3VPHA 1ZMRA 4QRHA 2IH2A 2O2IA 2OAP1 4LGVA 5K3DA 5A3SA 1DBVO 4XSHA 5LQRA 2CHGA 2P3QA 3B1ZA 1OI4A 2BKEA 1H2RS 1MRNA 2I4IA 4U3JA 2D3TA 1RT9A 4CKEA 4ARSA 4WWHA 1R0KA 1E3JA 3EMKA 2DOKA 3EVDA 3L1UA 1N3YA 5F1YA 5T4FA 4E2XA 1OI7A 4IH9A 2DETA 3HJFA 3R8FA 3CZ5A 4J9VA 4TSRA 5MGNA 2VJMA 4BVGA 1AGYA 2OBLA 1SCKA 5LZ5A 4MUYA 3JWEA 1GZSA 4H0FA 4YQZA 4N6GA 2YN2A 2CKMA 3F7OA 2A30A 3RFFA 4D9KA 4O4LF 1LPBB 1XRMA 2YY6A 1XMXA 3C3BA 4GI7A 4PHTA 4D4GA 2GZHA 2FWMX 1U5CA 1U94A 3HJNA 2H4JA 3MUEA 1ZVKA 1E2EA 3OHSX 3PGXA 4YJFA 4HC4A 5DGHA 4DIKA 4CIVA 4XYLA 4N41A 3A27A 1PUIA 2JLQA 3ZZ1A 2BC9A 4D41A 3IA2A 4Q1DA 3ZPXA 1SRQA 1YE3A 5J5CA 1GPAA 3O4IA 3ZTYA 5L4SA 2Y1DA 4MVJF 3M49A 3CLTC 4F3TA 4J16A 4QYMA 1K6IA 4XCQA 4BO6A 1AQUA 2X77A 5JZBA 5DGDA 2YV4A 2NUPB 1G9XA 4HI0E 1XWWA 4J7UA 2AX4A 2JLBA 5DCYA 1LNZA 4HSEA 4IIJF 2BE7A 4N3GA 1FQWA 1UP4A 4I1SA 2BKAA 1DO8A 3I62A 3GFGA 1K63A 3GFTA 1MB3A 2O23A 4IV5A 3UXHA 4DB2A 2VJBA 2W6QA 1P2TA 4YT5A 4MO9A 4UTZA 4K9NA 1G8YA 1QQ5A 3HCRA 2VQFB 3O9ZA 4ZI7B 1JQBA 4P53A 3O95A 1EEXB 1VMDA 1JLLB 2PZBA 1FSGA 2V9PA 1NPYA 2WT4A 1UBOS 2BEVA 1VJ1A 2YR0A 1C3EA 3P9PA 3HR4A 4FS8A 1H94A 1Y9AA 4ZANA 3RRYA 4JI4B 3C74A 3MEQA 3U6BA 1Y1QA 2YFQA 4JVSB 3AVWA 1F20A 2I54A 2P9ZA 2Y92A 3OE1A 1JLRA 4RIIA 5JNSA 2G67A 3LD9A 4M76B 1JKJA 1NKVA 4QECA 3SS8A 5B4VA 1U2ZA 2NNLD 4L8VA 3B8EA 4AROA 3N5CA 2R8RA 4ZO9A 1Z29A 2ZR9A 4A2WA 3UBMA 2NZ8A 1I4OA 1E9SA 4JNKA 5IAOA 5J4LA 4US0R 1AS3A 2QZ4A 1RYZA 4NIMA 2ILTA 1G6HA 2C3MA 2FPKA 3W8EA 3OE5A 1C0PA 4FSDA 5KSWB 4D80A 4X84A 2PSJA 1WD5A 3MLEA 3NWEA 3ZY5A 3IBGA 4YDQA 3E18A 2JJ1A 2G5CA 4FE4A 4O0LA 1NXXA 4RZ3A 1QOZA 4HQKA 3B78A 2MSKA 4WL0A 5J1TB 4CM9A 4NNJA 3M5DA 1JWBB 2UYCA 2LRHA 3DOIA 4MGHA 4AP6A 3ZX4A 2HF8A 3WB9A 3G5UA 3PNKA 2RHWA 4BQOA 4IKPA 5EWLB 2O7QA 2I6TA 4WERA 2X41A 2IHYA 4S1PA 1M76A 5LQCA 1UT5A 2QVBA 1RZVA 4WW0A 3EQZA 3GRPA 4R1QA 2VT3A 1VCNA 3AL0C 3OU7A 5FOUA 1D6SA 4FYYA 4MV0A 5TDHA 1A2OA 4QQ8A 3BGOS 2FFJA 3A36A 3MJTA 4H3HB 4RZHA 5D5HA 4MK4A 1E96A 3E5HA 3EFOA 4RFVA 3PNVA 2GEKA 1DTEA 2VHUA 1TTPB 1IZZA 2K7ZA 4II3A 4JVNA 1TM7E 4Z4GA 2QVLA 1XA0A 1QK3A 1ZJJA 5I7UA 3DO8A 1Q2UA 2Q9BA 1F2UB 1L7MA 4GKBA 4U0JA 5SICE 2Q2OA 3G9UA 3QVGA 1L8QA 4X90A 2C3OA 3VU9B 3RVPA 1PNTA 3A6GA 3M6AA 1MA0A 2GNAA 1CLUA 4WIAA 2Z56A 5GM1A 1N4AA 4A3SA 4QUAA 3RF7A 5B7NA 5C4MA 4DA7A 1QIEA 3HK2A 3BJRA 1AM4D 2G76A 1XLUA 5BR1A 1IJEA 2EU8A 3FKJA 4MKHA 3GC6A 1YDEA 4GEGA 3OSZA 4DYVA 1U31A 3O4HA 1W7AA 1IH8A 4Y2TA 1I3CA 1TD9A 1CQPA 2FRDA 4HDSB 4CV0A 3ABIA 3MTIA 2OCLA 1Q7BA 1V8PA 2QRJA 2EP7A 3FCUB 3BFKA 1OX5A 3GCZA 4FCVA 2C98A 5EZ5A 3ZU3A 1G291 4CU2A 4DADA 1UOOA 4EKYA 3KEGA 5C1OA 3MMXA 4HS4A 1RWQA 4ONEA 3QG5A 4AJPA 4QO7A 3ILVA 3OQJA 4TUYB 3ASZA 4DABA 2Q3HA 1V35A 2JDID 3L6UA 1SZCA 3B5EA 3BIXA 5ITZA 1ZOSA 2DWPA 2TMGA 4KDRA 5JCZA 3IP8A 2VF4X 4RZIA 2DPYA 3JY6A 1E3IA 4K6HA 1D3AA 1WMDA 4IVQA 4CM3A 5KU7A 3TIXB 1Q0SA 3LYAA 2GD6A 5FOSA 3SR4A 1MJ5A 1MPXA 2FW0A 4GD3Q 5AUPB 2RG1A 5AP9A 4ZQHA 4Q4DA 3B1KA 1KSHA 2L69A 4MUXA 1PE0A 1XN1A 3FDZA 4PYIA 4RSHA 4BFTA 5FLXA 5EL0A 1VJTA 4Y9SA 1CRPA 1Y9DA 1EKXA 2BMFA 4BKQA 1Z73A 3KFXA 3TWOA 4D3SA 5JVDF 1JHUA 4CQMD 1Z47A 3O9VA 1OCEA 3INRA 5EOVA 3TFOA 1HZZA 1QLHA 5CCDA 3TBHA 2R4QA 3TTVA 4GBJA 3SF8B 4LOJA 3FNRA 1TJ5A 3R24A 2NO6A 1YRWA 4FE7A 4LSZA 4N5IX 1J2RA 1YRAA 4S1TA 4X45A 1E2GA 3WMWA 1UANA 2X15A 2VUSA 4WBXC 3WK4A 4EVRA 2FUCA 4HAZA 4DWWA 1SR8A 1TMYA 4P31A 3HBAA 4GPAA 3W5VA 1HDXA 2XODA 3RYTC 3NHWA 4XQ0A 1H4QA 3E9MA 4YASA 2VIIA 1PKEA 1YQXA 4MV4A 1DFHA 1BDMA 2GBLA 2VH5R 4ABYA 5HDQA 1UH5A 3N6RA 4J1TA 3ANMA 1NJ5A 4MUMA 2OV1A 3I0MA 5IXJA 1YBAA 3FAZA 2XUQA 3VTFA 2PUAA 3ETNA 2GM4A 1SVOA 1D6NA 2HRQA 2VEDA 1UT8A 3D0QA 2VYVD 4GLLA 4TRNA 5ECGC 3ZHUA 5JWOA 3H1PA 1M7BA 1LTKA 4WBSA 4PANA 3GB9A 4YCBA 3TAUA 2EQAA 2Q1UA 4TS3A 1BVHA 2IE8A 3KS9A 1KYWA 2BGIA 1P5ZB 2P6UA 3O2QB 1XYYA 4MCHA 4GHWA 4NQZA 4O3FA 4QULA 2JA2A 1NXSA 3CZQA 5JI2E 3ONVA 4JI3B 3ZYZA 5CB4B 1S2GA 1Y9ZA 3NXSA 5ALFA 3ZWWA 2HCJB 1CJUC 1B4DA 2HFJA 3ENKA 4FBMA 5ERYA 1FC0A 1XMPA 2V7QD 4OHUA 4UCFA 3NOOA 4REOA 2Q21A 4BGVA 2JGLA 2X5KO 1R5OA 3PS9A 4TTAA 1P72A 2A9KA 3L92A 3F0TA 5IUKC 4B73A 5KOJA 3HCPA 2OCYC 5DYWA 1XD8A 2XWBF 3AOGA 3G6KA 2ROQA 3TR6A 2V7TA 1X38A 3WI7A 4KQHA 4FWBA 2WQ6A 2BFFB 1XCJA 1XQ9A 2F90A 5FB3A 3DCJA 3B7WA 4XLTA 4L0CA 4OLFA 4D4HA 3W8RA 5JSQA 4GKJB 3EWSA 3MMNA 3TJRA 4DANA 4C7XA 4LFCB 5C1DA 1LPMA 4ES6A 3MS7A 2YWDA 1WB6A 4L4YA 4GL2A 1JDBB 3GMDA 1MU0A 3IDZA 3SQMA 3BULA 4C5AA 1TPYA 4CF4A 3C1OA 4D3DA 1XD2B 2I03A 2YUIA 4WN9A 3L0ZA 4RXMA 5COAA 4WAUA 1E5LA 2I4LA 2WV7A 2YDYA 5B2FA 3HCOA 2I29A 1BD4A 2AS0A 2R6HA 1BS9A 3B2EA 3CE6A 2EYQA 2J9RA 2IYFA 4KMOA 4OQZA 4HLNA 5IXSA 2X3UA 3BUSA 4DNPA 4CTNA 3FWYA 4J1NA 3UMVA 4YT2A 2PMWB 2W4IA 4K28A 2WFLB 4IRMA 1JMKC 4CWAA 3L0DA 3MOSA 4FS3A 3E35A 1JPJA 3LT0A 3E23A 4I55A 2OSBA 1M33A 4F96A 5JXJA 1ZH2A 2WTEA 4JENA 1EJ0A 1CW2B 3HRIA 5REQA 4MP3A 3U3JA 4F5WA 2V7EA 3OCJA 4AIIA 5MGBA 3BMXA 3L7MA 2WHPA 4MHSA 1F0KA 1UFVA 1AQLA 5CNJA 1R2QA 3FCYA 4WXHA 1RHKA 3AB3A 2OR3A 1KY5A 1ZMBA 3EXIA 3NBAA 4EG7A 2IIVA 4RQUA 3QXJA 2BGMA 2P3OA 4Y6SA 1T0UA 2E18A 3CX6A 5E9AA 3UTDA 3ZQKA 1N2HA 4FMCF 2CFRA 5CH3A 1P0FA 4QD3A 3WMRA 3UCEA 3VJLA 5AYVA 4GKVA 4CM7A 2QX9A 3FFWA 5EERA 1ZX1A 4W8OA 5SY9A 1N5KA 1WRBA 2R6FA 3JYOA 4LEIA 3ZCQA 1YE8A 4UHKA 1VE7A 2VDRB 3BMCB 1XTKA 2RAPA 1JKFA 3TBKA 3GZNA 5LXTA 4XJVA 1WU8A 1GGHA 3Q1LA 1U0OC 2LP4Y 1PFQA 3JALA 3N7UA 1HORA 5FOWA 1S9DA 2QXTA 4R1PA 5JBQA 1GKIA 3QRWA 4Q9DA 1A8IA 3ZVRA 4R98A 3H0EA 2HF7A 1KKLA 4LG1A 2NVOA 5IZCA 1KR2A 4AD8A 1LDMA 3H4MA 1RIIA 4EFMA 3Q15C 1IQRA 1G6Q1 4MW7A 3R76A 1E4OA 3AHJA 1W5EA 4C0QC 1CG6A 4Q03A 3CUEF 4DHWA 2Q5OA 1KDZA 2JIQA 4AKTA 2ZQZA 5I9SA 1AKEA 2VNJA 1Q3KA 1EFTA 1RYMA 3PEYA 4UU1A 2G8LA 4P84A 1RAFA 4P58A 4Z99A 1I7SB 2Q1YA 4HDKA 1DLJA 3H2IA 3NFYA 4DCTA 3P71T 3GIWA 2WAOA 4CETA 1RVDA 2JPDA 1GT91 2QAGB 5SZIA 3DB2A 5LUBA 2GXQA 5ESWA 1KK2A 3GN2A 1AG9A 1B6SA 1PZEA 3AQIA 4BO5A 1AU9A 4EMBA 1CHDA 3DE4X 2CV2A 2ZZMA 2PDAA 1Q17A 1K97A 1C14A 1CY8A 3C7KA 1M1UA 1UDXA 5JDCA 4N76A 1J0BA 1E2NA 4ZVNA 1X7YA 2DH5A 4CDRA 4BWYA 1J2EA 3GZ4A 4EA8A 4RVCA 1X8LA 5B3JC 3AZOA 3S2FA 1MQAA 3WS7A 2C4TA 1CY6A 1KS2A 2GTIA 2KPOA 3BK7A 1TUBA 4MPTA 2NYRA 4QUKA 5G3YA 5ALXA 1JVNA 1O8CA 4RHCA 5LFAA 2OHOA 4JUBA 5ALOA 4DG5A 4YJ2A 5CGQB 2B4YA 4TVSA 1MB4A 2M2IA 1BKYA 1TKAA 1UDRA 2IEDA 2PLAA 3WNZA 4AXBA 5HUHA 3GDOA 4M54A 5KWJA 5BNTA 3H1EA 3KR1A 2VDVE 2VJPA 2CNBA 2XQFA 1WUYA 2YZGA 4WGFA 4XZ3A 5H0IA 5DBHX 3ZLBA 2NWQA 2OOKA 1L7QA 3DCYA 5HIMA 1T36A 3JWPA 3QEAZ 1WETA 1XWFA 3ASUA 1WBJB 2WJ4A 2M6LA 4MKGA 3CH4B 1V26A 4LJYA 2WM9B 1LV8A 5DBGA 1CUVA 2ADFA 3S81A 4JI0B 4ZD6A 4JR2A 6GPBA 4BMPB 4KMRA 5FORA 2MMCA 4G4GA 1V48A 1NUUA 5KTNA 1S2DA 1Z5GA 3NG1A 2WU1A 3NJ8A 3ZUPA 4MS4B 1ZJ4A 2FR8A 2XH8A 2BIFA 1HK7A 2PGLA 3VDNB 3ABQB 3ZVKA 1JRLA 2QZPA 1H2ZA 1WU7A 1Y3FE 3UFXA 3EZLA 2WSYB 4X94A 1NVVR 5FDFA 3C3CA 3OQPA 4N8DA 1ZGHA 4GWLA 5L9AA 1JKIA 1QO0D 2II6A 1YZNA 2BOVA 3TTSA 1ZAYA 1RXCA 3T7KA 1IXSB 3OJFA 2B5WA 2CVQA 4RK7A 4Q1EA 4C3OB 2HA6A 3HKEB 4QFCA 3LDHA 2WHQA 3SZUA 3GLRA 1PS9A 4IDHA 4DQVA 3HSSA 4KR7A 3I8SA 3NKVA 4QBIA 1S2OA 2WP0A 4IJKA 2VJKA 4NABA 3IULA 1GQFA 5K51A 2FMXA 3L0YA 1PGNA 5BOVA 1UJMA 4FKZA 2P35A 3PQ5A 1Z6QA 4HWPA 4MI3A 1YMVA 3IT1A 5JPIA 5BSHA 3NWOA 2IX3A 2FLWA 1JMVA 2TMYA 3JQBC 3G8YA 3LXUX 3IURA 2JI8A 2HZBA 1N1DA 2VPQA 1E4EA 5DHAA 3O38A 2QVCA 2IXBA 3V4PB 3D6TB 5EGSA 2W0MA 3SN6A 1QH0A 3G7UA 1MF7A 2J9GA 4Q1BA 1D4FA 3R8CA 2RI1A 4LQDA 4LBWA 2ZYUX 2W2TA 5EPOA 3HB0A 4ZVKA 4GLFA 2JAPA 2IVFA 3DONA 5J5VA 4FX5A 3DBOB 4X54A 3B1JA 2CNLA 4HEHA 1P1RA 3NUZA 2FG6C 3HI6A 1ZOIA 1I1QB 3LW8A 4TTPA 4DDTA 5K8JB 4Q37A 2HW8A 3GI1A 2H1VA 3SX4A 5CU7A 1D6MA 3PXAA 1MVNA 2X4DA 1WCV1 3RIEA 3D43A 4I36A 5HBRA 4O4HA 2P67A 5IWCA 1ICEA 5FBKA 1D2AA 1PFVA 3W04A 3UJ9A 4H6PA 1CR0A 4WK6A 1S8OA 4YUAA 5FTLA 2PV0A 4EKIA 5IVKA 1U9IC 1L4GA 1DJQA 2HK9A 4NCXA 1PKXA 2FN7A 4PX9A 3V8BA 4R1OA 2YJGA 3F5SA 1D09A 1P80A 2ZI5A 4KTTE 4BO2A 2Y1FA 2HF9A 1TO2E 3FPAA 4JVMA 4WN3A 4CT4B 1EXVA 2Z5VA 1I9CA 3HCAA 1U3FA 4LDQA 2BH2A 3OWOA 1RC1A 2B20A 1PR0A 1UL1X 2D1QA 3E1SA 3EN0A 3PIDA 5CIQA 4MVCA 1KJYA 3G85A 4EW1A 2AZXA 1P1HA 1H2YA 2NVUB 4M21A 3L84A 5SYAA 1JG2A 3I42A 1A5TA 1QDLB 1SMKA 4OBXA 2W22A 4Y2PA 1M2WA 3ZWPA 2BGGA 1DZIA 2AYYA 4HNAB 3PUKA 4TVBA 1FDRA 4HGZA 3G2JA 5DLYA 2FFAA 3AIIA 3CMCO 4E6PA 5JMTA 2FSHA 2XKJE 4CXMA 1W36D 4DXHA 3U7RA 5JD6A 5K0BA 2O4UX 2DPHA 1MD9A 4LSWA 1B14A 1J2TA 1GYPA 2PUDA 1YXMA 3A28A 4BVLA 2JD0A 5FX2A 5H7XA 4JLVA 3VPSA 4ENTA 1CZUA 1RJDA 4Y1RB 4X62B 1S8NA 3AUXA 1X7WB 4RPIA 3UMYA 2NP7A 3R6TA 3BE6A 2NXEA 4RIFA 4AFNA 2JLZA 4XUDA 2V1XA 3SZLA 3AKEA 5K0JA 3G79A 3N3AC 4Y2VA 2DH6A 3ZGXA 1MENA 1Z2DA 2IWRA 1GPJA 1A8SA 1OLSB 1P33A 1XDZA 2PO5A 3IP1A 3GJ6A 4DSUA 2O2GA 2LTAA 3EAGA 4AUEA 4M38A 2PMEA 1J9GA 1UXKA 3ISVA 1QO7A 3WWYA 4AJJA 3U7IA 5DISB 1ES9A 2B98A 2HT6A 2XA2A 3D7SA 4LF8B 2J3IA 4FYIA 1KH2A 1LW7A 4KP7A 3TH5A 1OLUB 4DEXA 4F1JA 5C80A 2FSGA 2FPUA 4RGBA 4B3MB 1NXVA 2FSUA 3CO0S 1XHLA 4GU5A 3EXFB 1ZH6A 3M3PA 5F2NA 5ECDA 1HDOA 2WTMA 1GO2A 4AXXA 1RLJA 4PXAA 5BSUA 1UK9A 3NM4A 4B3GA 2PT9A 3OJWA 4DJEC 1BSVA 3OPMA 3QW2A 4IKEA 2IYEA 3MTGA 4ZA2A 3UWKA 4RGYA 3UV6A 1ZJZA 1Q1ZA 5LP6B 3ODPA 2C5BA 1SXJC 2UZ3A 2BDEA 4AAYA 3HB9A 3MGGA 1Y6JA 1W73A 4EY8A 1SFRA 4KIFA 1T8SA 1LKZA 4MV7A 5FPSA 1SBTA 1GL7A 3K09C 4IIEA 3NPAA 2CMHA 4AN4A 3QE0A 4DDWA 1JEAA 2FF7A 2H1CA 3ZHOA 3BYZA 4K26A 7ABPA 3CLRC 1KNXA 3WO1A 4KSCA 3NVMB 4Y2XA 3RYIB 2BLLA 5IXYA 4HJRA 5BQPA 3EC1A 4LECA 3G59A 3OQBA 4A73A 3H42B 2ECQA 4OLJA 3FYUA 2Q9UA 1Y0BA 1Z35A 1VDZA 3R5FA 4R1SA 3G0IA 3PDIA 4JBHA 4ZT7A 4LE1A 4KR9A 2F1JA 3QWAA 5FHRA 3TKYA 2XOKA 4ARVA 3FHOA 1SUPA 3O91A 3V1TC 1GZ3A 3L0BA 1Y4ZA 1N7HA 4F2WA 2ZB7A 3RS0A 4PXSA 4QDKA 3RUHA 1NT2A 4U39A 3INYA 3AL3A 3OX4A 2WB4A 3PZBA 4YECA 4C7MA 4NPHA 5AVRA 3L4BC 5JROA 1NV8A 2O8BA 3ETGA 5FCDA 1UBJS 2H8KA 2QLTA 3RT1A 2IYTA 5KTTA 1PDWA 2PKQP 1IUPA 3FPSA 1U0LA 4LQ4A 1MV5A 4PW0A 2C4NA 3E0XA 1HNNA 3E6AA 3OPNA 4FDAA 4WLFA 1QZUA 3PGKA 3GLFA 2BMEA 1N7GA 2CUNA 1SCBA 3AW9A 4HAVA 5TF4A 2KB0A 2WPDD 3IPLA 5EKSA 4KQWA 2PGAA 3KQQA 3ZDFA 5MF6A 2GDZA 5LYJB 1RQRA 3M89A 3T1TA 5A7FA 1GDDA 4GI1A 4MARA 3SBDA 1S2LA 1XZDA 1MW8X 2UUOA 4PPQA 5DI3A 2O3QA 3QFCA 3AVOA 8ABPA 2AJLI 2WOOA 4HRYA 5CVDA 5E8JA 5CBPB 1DNPA 1TF7A 1OA1A 2GZDA 5EKXA 1JKXA 3PLNA 3R7FA 3VR1A 5JNLA 1RI5A 1CUCA 1LVUA 3MWDB 3SC4A 4PYRA 1IN6A 3QKSA 4YJ3A 3U0BA 4AJKA 1V5FA 2IHTA 1GN8A 2P2NA 3JRXA 4HQRA 2AQIA 4TKMA 4QYTA 2C9OA 3KV3O 3AL2A 4ZAXA 4J2OA 4C6SA 1TU3A 2PZEA 3N75A 3SHTA 4RTNA 4W5TA 3UC9A 1ZXLA 1JEYB 2FEWB 1ZCAA 1N8KA 4N6OA 2IXEA 3SSNA 1Y4UA 4U2EA 1XU7A 3NAGA 2NTVA 1KFJB 2O2DA 4JASB 4OHZA 4RD6A 2KI5A 1MZVA 3DEFA 4PNZA 2SKCA 5H80A 1SXQA 2RGNC 1GA4A 1T4DA 4MAAA 1PT5A 4FFLA 3RRJA 2RE8A 1RZRD 2HV8A 1ACJA 3W4JA 1EA7A 1Y3BE 1CVRA 5FPQA 2CKDA 1CRWG 2ZJ6A 3Q3IA 1FMTA 3S1AB 1JHAA 4LJ8A 1R74A 3T15A 4BE7B 1GFSA 1Z2PX 2PUCA 1E2MA 2QLJA 1QDEA 4ZAYA 3QG1A 1P9WA 1GQQA 1TFUA 3DZDA 3K0FB 3A1EA 4PQFA 4X8HA 5A4AA 2HL6A 4K6GA 4P4GA 1RRMA 1C7JA 3GQVA 4ZZ0A 2PKRA 5LWQA 3NIWA 5LMCA 4H4CA 3D6FA 4DJ5X 3Q8KA 1WHTA 3R2JA 4M9CA 1T25A 4EG1A 1R0WA 3H4IA 2EX1A 2GXAA 2REQA 4CFZA 1CS4C 2GKSA 3T9FA 1JHMA 1T8RA 4OHWA 1JLKA 3WB1A 4WZ6A 1M6VA 2HD4A 2JFUA 3DBRB 4M1SA 4WXPA 2D1YA 3QEMB 3OIDA 2HPHA 4DBVO 5JBIA 2EZUA 4MLZA 4XWTA 3OETA 1KEWA 4FHFA 5ED4A 3SQWA 5F52A 3SCZA 4TYYA 1YONA 2YQ4A 3MWGA 2J33A 2ES4A 5HUQA 1JILA 1BC5A 4UNIA 5F5LA 1PJRA 3N05A 4CMIB 4F56A 1LK0A 2YNMC 1L7NA 3GEGA 2JCSA 4ENRA 1SOVA 1V5WA 4ZQIA 1ODCA 2IPXA 2ZWIA 3ZH9B 2ZIVB 3G49A 1L7BA 2FXIA 4G8CA 4ISBA 4O2BB 1P2DA 3TUJC 5DEIA 3AFIA 2C9YA 1LBTA 3P19A 4B6FA 1FSPA 2P1RA 4ERNA 1DGQA 3UANA 1FXWA 5KYVA 4DM4A 5IUJC 1SHTX 4CODB 2ETVA 4HNGA 4MGZR 4KN8A 5IDYA 4QPPA 4AF8A 3LQ1A 5F23A 3P9XA 1AV7A 2DHEA 1YKGA 1XMVA 2O05A 3RO7A 3U7QB 3FFXA 4EM6A 4NI5A 1Y33E 4YN3A 2Z2IA 5EJEA 2H08A 1A7AA 2EWWA 1SG9A 3ZLJA 4ND3A 1ST3A 4A92A 3R3ZA 4JX9A 5SV2A 4KAXA 1BVYF 2EW1A 2CXXA 3P2OA 4RPLA 3A1TA 621PA 4BU1A 5CA1B 1KEUA 2DUWA 3PHGA 1UZAA 2BCJQ 4QUGA 4KXWA 3W9BA 1W4BA 2OKGA 3P45A 3WGZA 1M54A 2R1TB 4EHFA 3Q88A 1J2UA 5ED0A 4Q4CA 1J2YA 1ISHA 5C35A 4EB6A 1F06A 2QNIA 3IXLA 3UB3A 5B36A 2RGRA 4HDOB 2BFEA 4PX3A 3TZEA 1M6YA 5EZYB 5A1JA 2XCIA 5DGIA 4NCAA 1HRDA 1PUJA 1WW3A 4BP9A 3PTLA 5LOVA 3ZLUA 1O6BA 1E69A 2F00A 2ZPAA 3UK6A 1Q19A 5BW6B 1XVLA 2XTZA 4KO2S 4TMTA 3TRIA 1VB5A 4LE2A 4KH0A 4IOKA 1F0YA 1RYDA 1BYUA 3E22B 3JPYA 1OXMA 4LC0A 4L4XA 1Q0PA 2QN8A 1H5QA 1CVLA 4JZYA 2K7FA 3R3HA 1C50A 3OCZA 4MICA 3L1JA 4EYSA 3PX7A 4AUNA 4QNNA 1I1OA 1V47A 3K1JA 4WZZA 1W75A 4M37A 5JYBA 1QR6A 1H42A 4OO3A 1RP1A 4F8YA 2GCOB 4IIYA 2FW7A 2RHRA 3UJHA 4TL6A 1HLDA 1ISJA 1ECLA 1SC4A 3DMYA 4X6XA 4HGNA 4TV9B 3PYXA 4J43A 5JALA 1C30A 1YMUA 2BP7A 3A8TA 2FPMA 3EE6A 3TAXA 2CD9A 1HEYA 4EUKA 3AJ8A 1X1BA 1PVOA 1NMSA 3L79A 4MW5A 3SQNA 3OG9A 4OEHA 3UWSA 4TKVA 2B2NA 3NEAA 3ONWA 4DPMA 2HOQA 1HNZB 3TF5A 2XNSA 2DJIA 2B9VA 2R8XA 3U7EB 5CYPA 5I9IA 5IF3A 4PYJA 4LZOA 2Q5JA 1UQTA 4J0CA 3E8SA 2O0MA 3PD1A 4MYTA 3FSJX 4W6ZA 3WMXA 5I8PA 3DAYA 5JPCA 2O4CA 2PT5A 3K70D 4YJHA 5A02A 1LRKA 2Q4DA 1HE3A 4JKIA 5J59A 3LO5A 4BO1A 4ZT6A 2Y1OA 2FWPA 2WWTA 2YWBA 4WKNA 3R9XA 7REQA 2EZ9A 3TM4A 3AIKA 2F64A 1W4ZA 4V38A 2AOWA 1EINA 3AVPA 4HH0A 4B71A 1CUYA 4NY1A 1GQRA 3THWA 1XZIA 2F3SA 1FJHA 3PC4A 1ZBDA 5FI1B 3ZKWA 1XZCA 3QIAA 3LE8A 3RC7A 3FYTA 2WWRA 1H23A 3QUCA 3CVWA 2GT1A 4DMFA 3IAXA 3FBGA 5DN9A 2FUG1 2W2LD 1KGSA 3DEYX 5JMPA 1ZOLA 2QRUA 5DX1A 1THTA 1SUDA 4W9RA 1BS2A 5F7ZA 4MVJM 4S2EA 4ZWNA 1K3TA 4N3NA 1Y8AA 2C95A 3FTQA 2Q2QA 1DC6A 4OU4A 4XX1A 4KYIB 5JHGB 2DULA 2CDRA 3K31A 3CH6A 2VYFA 3A9TA 4BVJA 5AD1A 1J07A 3FVWA 1PEDA 5EESA 1QFMA 1OFUA 2QG4A 4D8TA 4PM4A 1CS0A 1V95A 1TYCA 3KOWA 1LLUA 3KKPA 2ETXA 3LV8A 5JNVA 2EVWX 2IUEA 5HF6A 1VP9A 2BKXA 3DXYA 3NV9A 4OU5A 5JZMA 2QE7D 2GBPA 3AJAA 3LLUA 1LPAB 4IIBA 3KHTA 4QRDA 3U49A 5DVZA 3SM9A 5DM4A 4O1MA 2F48A 2Z8YM 4J4HA 1FMLA 4MV6A 3DEJA 2PTHA 1J5PA 3E8MA 3W2IA 4QVIA 2AK3A 5IEBA 5G0SA 3A4MA 2AN1A 4EL0A 5A5EA 2JDIA 3U7GA 3AC0A 5ELMA 2ACWA 2C20A 2AUNA 2OKCA 2XIJA 3F3SA 3NBFA 4Q12A 3SIRA 1Z63A 1GU7A 4MWSA 3ZCRA 1OTYA 3MWYW 1OHHA 2NO9A 4KOAA 4MWDA 3KXDA 2IYZA 4M36A 1ENYA 2IBSA 1TM3E 3JQPA 1R4NB 2ISSD 1YZ3A 3NNSA 2Y1GA 1JDSA 1H0SA 1IEWA 2V7WA 3QSGA 5F5NA 4ZCPA 1N8NA 5ALSA 3JTMA 1OPXA 4IICA 5CJPA 4CF6A 1CY7A 3ND7A 4JB8A 2DBRA 2K4MA 1YZHA 1M34A 2FSIA 1FFGA 3EGXB 3VVMA 1UEIA 3HPQA 5AESA 5I9NA 1RRVA 3IQFA 4CQMA 2DPLA 5DLEA 5JD5A 1UIMA 2BEKA 3KEQA 1LPOA 2YIJA 4NXNB 2QTLA 1U3GA 4MEAA 5JUWA 3KTAB 4AICA 1UEJA 4K9KA 3HY6A 3LCVB 2VVTA 2XQKA 4FW8A 1TPZA 2HLNA 4IX9A 3WWEA 4IHJB 3AR3A 4MMXB 4DLTA 3B12A 4IQGA 1XZGA 1XRPA 4EG3A 2HJVA 2JK1A 2Q8QA 5A3RA 1QQ6A 4XE5A 2PPLA 3L6OO 4WLUA 2QZZA 4OK5A 2CVHA 4OQPA 1MW9X 4LOKA 5TT0A 2LIVA 3VZBA 1QGUA 3VU0A 5FPKA 3O8BA 4G67A 1Y42X 4JJ8A 1YDWA 5BSMA 4BP8A 2IIBA 4PYLA 2NTNA 3WOVA 3WP0A 1FW6A 2ZTHA 3QU2A 2Y0BA 2B7LA 3C16C 4H4EA 2WD7B 2YOFA 4IW3B 4OX9B 2EGHA 2H5LA 2OILA 3HCEA 5J2TF 2YXLA 3I01M 4O4JF 5JOQA 2VYVA 2C7VA 1CEYA 2VUIB 2PVPA 2CL7X 4NRDA 4QQKA 1IFXA 3P9KA 4G5QA 3RC2A 4QJ5A 4WFQA 3P2IA 4D4KA 1A82A 2IYQA 1H3FA 2WQZA 4WZBA 4YMSA 3U3OA 4QATA 2P2ZA 1DAHA 1LLCA 5JE8A 1UM9B 1E98A 1AKMA 3O8LA 4Y2SA 1AIPA 3FJ1A 2B4TO 4LF4B 2V7QA 1A9PA 2XQVA 5GWXA 1SCIA 1HQDA 2EFJA 4IFIA 5JSFA 2WINI 5T8KA 4F5DA 4CEJA 1EK6A 4HLCA 3AP3A 1QG6A 4N5DA 4OMFG 3GP8A 2PSDA 1T3GA 2NZJA 5FPPA 1BQ3A 2UVQA 2ZJ8A 3DL7A 1Q0UA 4ND2A 3GZJA 3E05A 4FWIB 4G09A 1FJ2A 3LQ2A 1OIVA 4I7EA 4BV9A 4D9HA 2D1RA 3KDSE 1P2UA 5KMGB 1SXIA 4Z4QA 4QLBA 3HZZA 3MA0A 4CL8A 2WB2A 2OCDA 1JH8A 4KJZA 4V02A 1LNSA 1JP7A 2DFKB 2FMHA 4BGDA 2R84A 3A6PC 1N9GA 1Z5NA 3FI0A 1XVVA 1VKZA 1YD7A 1I9GA 1PGQA 2V03A 4L5AA 4CMAA 5B1YA 5K05A 4JBXA 3OWXA 5ALZA 4IILA 3J7TA 4UEKA 4J7CA 5EPUA 2DWUA 1U9ZA 2ZYAA 3RRZA 1A9RA 1RXVA 4ZAVA 3IQDB 1DRKA 1R0SA 3DQQA 4TYMA 3HXPA 1YZLA 3RYCB 2GTPA 2IUTA 4ATNA 1DAKA 4L0DA 4LDPA 5TV2A 4LXIA 3JQ9A 4C3VA 1G9SA 3X0DA 1GDHA 1XTRA 4XH9B 1H0HA 3P52A 1K8RA 3WG9A 1D04A 3PRHA 3JQAB 1BEZA 1YULA 3G0BA 4TYWA 1Z68A 1WTAA 1UQUA 4CQJA 1UPAA 2ONKA 3A3NA 3H1FA 1E4VA 1UPBA 2Y0CA 4F5EA 3MOIA 1W19A 2OXIA 1E1LA 3V7FA 1JYEA 3KLMX 3QF4B 5L7TA 2FWRA 3HU2A 3VYVA 1XAGA 2H1LA 2YC4C 3K8ZA 4Q4HA 4TZKA 5HQTA 2I7XA 4GL4A 3I72A 3QENA 4G5FA 4N39A 3SSAA 3VM6A 2HX1A 3W2HA 4NV3A 2AZMA 5BN5B 3M3HA 3PUHA 1GPYA 4OPMA 1P29A 3HXMA 3ZXSA 4KN9S 2WF9A 1DDOA 3WE7A 5CH8A 4ALMA 2ZRHA 3MTAA 4UM8B 3ZWAA 3JASB 1RU3A 3LBFA 5CT8A 5BURA 5IJWA 1TT7A 3CG0A 4FOLA 1HPLA 4IZIA 1V6CA 3R20A 4Q05A 5AUOB 5JY6A 1NJ2A 1M8JA 1MT0A 1FSSA 1ZESA 2BEWA 1A8UA 2FN3A 2DUNA 2JCGA 4MCJA 5EQDA 4CN9A 2IYWA 3BH7A 5KNCD 3KOMA 2BTOA 3FCXA 4XARA 3USCS 5I9BA 1P3JA 3DKIA 3EDYA 2FGKA 3AIMA 3OF3A 4MQLA 2Z4RA 1E9AA 3MAGA 3OTIA 1CTQA 4EHJA 3FDJA 1ZRNA 4KQ1A 2ZI3A 3K9QO 3ZE2B 3RM3A 4MVYA 1ORTA 4M1QA 1RYYA 1UZLA 2E5LB 2JLRA 1OWOA 2Q3LA 3UAGA 3KUDA 2C2HA 3NASA 1CD5A 1KQOA 2PS0A 1ISSA 3ZD8A 2QMUA 2LW7A 4CTJA 1YVEI 4LYAA 1QSGA 5CX1A 2PYDA 3T5CA 1MZPA 2HNAA 1DHTA 4NP6A 3STWA 2O06A 2YVQA 5IT9A 2W8BB 5FBVB 3T1YB 1JAHA 3AEQB 5E9WA 5GZ6A 3TKAA 3TOSA 5CK4A 4E6EA 3QPDA 2H3EA 4DT1A 1MQSA 5IC4A 4U4AA 3FNGA 2Z0MA 3WRWA 1CIVA 2X5OA 3CRRA 4RHTA 4UM7A 2GUGA 2NO4A 5B7PA 1KZ4A 2DQ4A 2QZ9A 1JFTA 5DYNA 1UFQA 1VFPA 2F1RA 2JIMA 4HATA 1NKSA 1IPEA 1K06A 1CJKC 2RAFA 4LJ5A 4ZI5A 2IELA 3ROGA 5AK6A 4UXHA 4CE6A 2BI4A 2VP9A 4LQLA 4RA6B 3RVRA 4HNVA 1PJLA 1QF9A 2Q9AA 4HRXA 1BXRA 1A98A 1E7WA 2EF0A 1EI9A 5FL3A 2IDKA 1ODKA 2P4UA 3UMCA 1W4RA 3TZBA 2QU7A 5HTKA 1DAFA 4PZ9A 2ZWPA 3H9QA 1A5SB 3G89A 1MA3A 3COJA 3S68A 1ZQ1A 2ZS8A 3A04A 2OFPA 3ZLVA 4F2GA 1EE2A 2P7HA 2XEXA 1XHEA 3FSRA 4FFSA 4GWGA 3NRJA 2LUOA 1JR3A 2IA5A 1JI3A 2PGOA 3N8HA 4JI5B 3N6VA 1YT5A 4RK0A 3TLZA 3BMQA 1PQUA 2CLIB 5BOSA 1EUDA 3E9EA 1YU6A 3AHGA 4B4KA 1E1YA 4FINA 3JVVA 2PRKA 1Y98A 3IQWA 4IXMA 4TL9A 3TTTA 1YRYE 2AFIA 1YR8A 3ZI4A 1BWRA 4P6VF 4J6EA 4I19A 2WPNA 1BOFA 5FWDA 4YPFA 2J67A 4RV4A 2X7XA 4YRRA 1HDIA 2O7RA 2D62A 4YO7A 1PZFA 1FSFA 2E4VA 4W8HA 1Z83A 1QO0A 2GCOA 4R84A 3W9UA 4LXUA 1R37A 1LPSA 4L4RA 4B74A 4CZ2A 2F8TA 2TS1A 2OZEA 2GTHA 5EP4A 3A3PA 2QG6A 2X4GA 1QV7A 1HMPA 3AU9A 5T41A 1KORA 2QL6A 3L93A 4PBTA 5BN3A 3UMMA 4PHFA 4Q3CA 4A5OA 2Q2NA 1L7AA 2Z2ZA 3UYKA 4Z4CA 3CX8A 3RKSA 1CT9A 1FU4A 5CB0A 2CV0A 3WWZA 4NOJA 1JL3A 3SKXA 1N9ZA 2O0HA 3K5WA 4HR7A 2EP5A 3G1TA 4GRAA 2O2CA 2N42A 1PSWA 1ZD1A 4BJHB 2WVAA 3A1CA 4BQPA 4DIEA 4IDPA 4TWZA 3MB5A 1R4ZA 2X1LA 1N2CA 2P5YA 1KBQA 1SUIA 1UAYA 1KVSA 1NYQA 2VCEA 3QVMA 2HJ9A 3U37A 2HB6A 5DGCA 3WKBA 3AVUA 4IYJA 3FTFA 1JAYA 4Y6QA 3OMXA 4KQJA 3HDHA 4HB3A 4ZMRA 4DLUA 2JGDA 2H1HA 4JUIA 2GILA 2RKBA 3E3LA 4R51A 1PBTA 4RVDA 4R3UC 4C3ZA 3AJDA 5TX7A 1U0RA 3RVOA 1C4WA 2CHUA 4CIXA 2DY0A 2C5AA 5BORA 2J9YB 1Y7LA 1SVWA 1SHZA 2BT4A 3GFFA 4UHDA 1RFGE 2WD8A 1KDOA 2B1JA 3GQBA 4C88A 2QD3A 4IIXA 4RTLA 4ZO6A 1RBYA 3RAEC 4TN1A 3IVGA 1GPKA 2MSLA 1SBYA 3WXBA 2FK7A 2QTCA 1M6WA 2LCFA 2XDWA 3GJSA 3OIFA 2CHVA 4KSBA 4X5OA 5IHXA 2EP8A 2SCUB 3GUYA 1I01A 2BKLA 4IZOA 3W2FA 4EGJA 4EJ6A 1B8PA 1G3QA 2DT5A 3M1AA 4KYVA 5KNDA 4KNVA 5AW0A 4DTCA 1KEVA 1Z4JA 1RBZA 2PZJA 3FPHA 3IQEA 1O58A 1QBGA 4HLDA 4UW9A 4W4TA 4ZV9A 3RRXA 1E7QA 1PRYA 2BI7A 2QV7A 4OD0A 3TL2A 3UG7A 4LTDA 2COKA 3SR0A 2P40A 4IWYA 2CJFA 4P3XA 1OYYA 4WCFC 4B2IA 3NGMA 4GLOA 4N6NA 2FZCA 3LLCA 4NDAA 4DLPA 5A5VA 2BZ0A 2PX8A 2ZYTX 2ODWA 4L8WB 3UT5B 1E6CA 4YFVA 1JWLA 1V16B 3VR5D 5LZ2A 3DW1X 2L19A 2ZB8A 2RAUA 3C5HA 3PRKE 4YALA 5DT9A 5C4IA 3OCUA 5TIIA 3KPJA 3TR0A 3QFHA 1FYEA 1KY4A 3RADC 3WGQA 2J41A 2XGJA 4IKOA 1F9EA 2WF6A 5TQ2B 4Z0HO 2P4HX 4XEUA 4Q4AA 4HVCA 3H97A 5HRUA 3PC8A 1XUOA 2RBKA 4XWWA 1LSJA 5L3RA 5JC1A 4JC4A 1JKMA 3WIUA 3TCNA 1V6SA 3RWMB 3ZWVA 1XELA 4E13A 2VZEA 3HR8A 1ZKMA 3AM3A 1E2BA 1G98A 4N5LA 1P0CA 1DXOA 1T8PA 2MU1A 4D3YA 2OPBA 5LBTA 2ABWA 5KX5F 1DJOA 1KAHA 2EIXA 5H83A 1X7XA 3QBEA 1G8SA 3VAAA 5DHSA 3S2GA 4DQXA 1IUKA 3RTAA 4F84A 5JMOA 1UXIA 4TYNA 2B0CA 3G7NA 2R0QC 2O8DB 3TUIC 5I48A 1KZGB 2VBCA 2RK6A 1Z5PA 4BRUA 1MVOA 3KJXA 3NBQA 2WWFA 3DMDA 2I22A 4IUCS 1DDGA 4LDNA 5E7QA 3WL5A 4E2ZA 3HL4A 1U2SA 3KRTA 1J8MF 4BX3A 1WE2A 3QX9A 4D4IA 4YCMA 5F3DA 3CCCA 3VNUA 2EZ4A 2WEKA 2W0SA 4PZEA 4X8OA 3KEOA 1DKOA 1SC6A 2IS2A 2VDUE 2RGBA 1T3LA 3H8VA 3VR6D 1E94E 4DA4A 4C76A 3B3GA 3RKUA 5L3QA 4RYLA 3SQLA 4TL8A 3UENA 4IBOA 1YJCA 2QSZA 1EXWA 1F6DA 4KTVE 4Y18A 1X1RA 4NYIR 4UU7A 4D4MA 4DDUA 4Q3EA 1E61A 3AVQA 2G8NA 1EESA 3EDMA 4N9QA 2A58A 5HM6A 2I6GA 3ZE1B 3N8IA 1I4DD 3I6IA 1DFIA 3JQ8A 4OYRA 2FW8A 3EF3A 1GTVA 5IH3A 1IE3A 1RRGA 2ZSHA 4OI0A 3H2BA 4FFBA 3VH3A 2EHDA 1L5MA 5TSDA 5IHPA 4CNBA 2WBLC 1RPTA 1ISFA 3IKLA 3K0CA 4ZICA 2XSZD 2ZB2A 3EIWA 3WLLA 4YUZA 1MEOA 3CKMA 4TOIA 4G07A 1U0FA 3P94A 1V43A 3EFHA 3JSAA 5IBRA 1JG1A 1G3RA 3MZ0A 1L5ZA 3I9MA 2G1PA 4AX8A 2B92A 2ENWA 4PQYA 1SZPA 2NUTB 5JQWA 4RTOA 2CWDA 3SYKA 4UFNA 2H9AA 1YRQA 2XDAA 5ABPA 5C0OE 2D5CA 2Q5FA 4YP9A 1WTCA 2P2GA 2BEJA 3IXQA 4ZO4A 4MYDA 4P83A 1P0MA 3FIJA 4PZAA 1J1UA 3R3WA 2VH1A 1ENOA 3LPMA 4P4SA 3K6SB 1VKJA 1V9SA 2YOGA 1Z2OX 3VC3A 5JXWA 3GCGA 2GKGA 2NUAA 3F9RA 5CVEA 1L5NA 3EYWA 1KQGA 3BJIC 1SM4A 4I50A 1B2RA 1U11A 2CLOB 4PLTA 3UKJA 1C7FA 3EGVA 1SIBE 2Y9MB 2VR1A 4LI3X 3PGVA 5ALVA 3H17A 5KOIA 2OMEA 5LZ9A 2AL7A 1LRLA 1UFRA 2JGNA 3I6YA 1ABFA 3CVUA 5SYMA 1U8XX 3ASYA 2OVFA 1DIOB 3AEZA 2OBXA 5C5IA 4XDHA 5K2OA 3FUWA 4BB6A 1LBIA 1QUEA 2RJOA 2CDCA 5T4HA 5FFNA 3MWEA 3GWGA 2X2OA 3K0AB 4BEVA 1DKPA 2P62A 4FFOA 3D7MA 2BJVA 1IN1A 3OKFA 3AFGA 3ZK8A 1HG1A 3LF1A 4DLBA 3IYLW 1LVHA 1TK3A 4DV5B 3SNKA 3AF4A 2Q4TA 1ONOA 3SBOA 4ZFNA 4B33A 1SUSA 2DJ5A 1XTIA 4LYFA 5A2QA 2V3CC 1QK5A 1URPA 2BR4A 2VPYA 3WGKA 4N5HX 3QNWA 2J45A 3OZUA 3GD7A 3NYRA 1GZVA 1A7JA 3PSAA 4DZZA 3L0CA 2JG3A 1XEXA 5AM5A 3K96A 1CJVC 2PWAA 3LCMA 2AE2A 2C7GA 4LXHA 4DQUA 1UMCA 1NHGA 1XZFA 2X1VA 1XZEA 4XQGA 4DA0A 4CIWA 3MQFA 2IODA 1S4MA 2OP1A 5H16A 3RC1A 1M1YB 3L6BA 1RZRA 3SJ7A 5HUJA 4OK3A 2ZRKA 1AA6A 3JS5A 3BWCA 1IJFA 1FJXA 2FRXA 1KJ9A 4LVOA 3SJAA 5B3LA 3LS2A 5DNWA 1UKZA 2H5IA 3SFTA 5T3UA 3ZV6A 3AI3A 5L3SB 3PFCA 1R0CA 3O74A 3PT9A 4LJAA 3DBVO 2DC1A 5IYZF 4DV1B 2COUA 1EWTA 1P73A 5IULC 3P96A 4KGDA 1XR3A 2JIBA 3I09A 4JIGA 2J3KA 4M8NE 3NU1A 1Q74A 3BIWA 4ETNA 2YHAA 5AVUA 1KZYC 4RABA 4EZIA 4QPDA 1ZU5A 1VRWA 1JZQA 2AOUB 2IPOA 3CEAA 4GDMA 1JHPA 3WA6A 5I7HA 1I0IA 1Z16A 1L6RA 4JU8A 3DV2A 3OTWA 4QHTA 3ZNPA 4LZZA 4QM7A 1ARZA 2I1LA 4UMFA 3I9KA 3O90A 5FWYB 1G16A 3DE7X 3QBVA 2TMDA 2Y27A 5DHFA 4BBJA 1ABBA 1YB1A 5AICA 4CEHB 4D6PA 5KPJA 1OTXA 1R15A 2QRVA 4MV1A 1ZR2A 2EYUA 4UCWA 1Q11A 4EMUA 4NX2A 6LDHA 1QC5B 3I2GA 4R2MA 1PL6A 3T5DA 2DWCA 3QBTA 3L1VA 1NUQA 3HZRA 4OLHA 1BMQA 2HPVA 4UTXA 3ZU5A 2DKNA 1XZKA 4JLMA 1IBLB 1USWA 4KZKA 5DNEA 1MCZA 4OHKA 3IBCA 1Y3HA 2XQJA 2Z98A 3KT0A 1MXFA 4C4RA 2QX6A 4B82A 2JAHA 4L78A 1YA6A 1CUBA 3G82C 1OWLA 1Y1KE 2I6XA 3ABRB 4L8LA 5LDHA 2VLIA 3IOCA 5IAAA 3DMRA 3I64A 1PZXA 3ML1A 3WYCA 4ZI7A 2QXUA 4C4PA 4BAZA 2AUTA 1AGPA 3C3PA 1RCTE 2X4LA 2W7TA 3EEFA 3MINB 3V8RA 1K7CA 4NFYA 1W0CA 5C1BA 1RKBA 1UC4B 3QSYA 5DTIA 2XYGA 2ZSKA 5ALUA 1G8GA 3EPKA 3TLXA 2I1VB 3IE2A 1N25A 2VZLA 2J3DA 1NIJA 4EBBA 1U4NA 2E6UX 1A77A 2ZSFA 4FGKA 3EARA 2IWHA 1GWNA 4D57A 3RIHA 4A8JC 5BVHA 2QNRA 3TINA 3GPLA 4BY9E 1XAHA 4JFRA 4GAEA 4GGOA 2WW8A 4ZOBA 1DPGA 3DT6A 3IQGX 3NCHA 3UATA 5DLPA 1ZG3A 5LM3A 3UJ7A 1UJ2A 3KB8A 2H2IA 2UXDB 1ZN8A 4P3OA 4TLAA 2LPMA 2QT0A 3NIDB 1P74A 2KS6A 1UUFA 2JBAB 4KHZA 3BQMB 2Q6KA 2Z4SA 3T4XA 3IUEA 2JLSA 2WYWA 3ROMA 1G5FA 1G8HA 1LQTA 1T26A 4Y6RA 4KWCA 4RS4A 5DE3A 2DR0A 2ANCA 4BX0A 4CCSA 3QPWA 3M0EA 2PQ0A 5HQ3B 1I0ZA 2JLXA 1JJBA 4WFJA 5DHQA 3DGFC 3IR7A 5DWQA 1NW5A 3O47A 1EFVA 1PQYA 2C31A 3DZJA 3ORSA 5H5JA 1FLNA 4AMVA 5AUQA 4BQQA 1QIMA 4Q24A 5JV5A 2IUFA 2BHNA 1CWUA 3X1WA 1RXSA 1UC8A 3EOAI 2HUPA 4IMPA 4BFCA 5JH7A 2ARKA 3NVDA 3D4OA 1T2EA 3K6KA 2TSYB 2VAVA 1JT2A 3KCQA 4MI9A 1TYAE 4U6SA 3UPUA 3T06B 5B58C 3X1JA 1MXHA 2PS1A 5F9HA 2HCTA 1KJ8A 1ZN9A 1NTOA 4EA6A 4F6CA 2VCHA 1G20A 1HNWB 1QF7A 2Z30A 2VJAA 4NU6A 1NURA 3VUEA 2IY7A 1KEZA 2Q4BA 4TQGA 3DQZA 3KNZA 5I7SA 5GTDA 3TSAA 3NLLA 1FX0B 2RIPA 4ZKDA 4JUDX 3EMDA 4Z4IA 5DNUA 3A6LA 1IHUA 4RLHA 1J97A 1NBHA 4JLSA 2ORWA 2AN3A 4NMLA 3IAHA 4GT1A 4JBYA 4NR0A 3VU8A 3I5AA 3OTHA 1EFCA 4O8ZA 4YV2A 4BP3A 1XF1A 3VZSA 5CCXA 2OZPA 1SOAA 1M5UA 4PNPA 2AF3C 4YH1A 3E2PA 4FGUA 3HE3A 1ML3A 2BRUC 4KKXB 3FVRA 1TC1A 4CPDA 1WMEA 3CNEA 3G8CA 3IAM1 1CBUA 2Z2XA 1Q1AA 3SYTA 3KQYA 4BCCA 2RBEA 2QJRA 4ARAA 3TZLA 4JC0A 3EVBA 1FUEA 4QGSA 2GDJA 1TM5E 3JQ7A 2AD1A 4M1WA 1I6KA 1W59A 3GHYA 3FKQA 4RKFA 4BRSA 2O8EB 3WL4A 3AONB 3A9WA 5IEJA 4BBZA 4YLYA 5HE9A 5CFNA 3KQUA 2QUIA 1DEKA 5EPEA 4RLSA 2IHVA 1FFHA 4K2AA 2YJ5A 4EG0A 3DJYA 5KYXA 2XD4A 3TI7A 4BBPA 1HDCA 2BFMA 2W2MA 1JEDA 1GYRA 1AUPA 3UOGA 2ORIA 3IO5A 2PX4A 3OECA 4AC9A 1DRWA 2K2QB 2PX3A 5EGNA 2QE7A 4BJ6A 3SSMA 5CDTA 1MQ8B 2WZCA 3IIMA 3OLWA 1NLMA 4MV5A 1VG9B 2A0FA 1ONSA 4Q47A 3H2KA 4ILKA 2WHEA 5DGTA 4F4HA 4TQAA 5DK6A 2XE6A 4D9JA 1UMBB 4D8VA 2PMDA 5KYWA 3AERA 1N2XA 3W1WA 1PV1A 1NQ5A 1JFVA 3K2BA 1UP7A 3GG2A 3KUCA 4FHEA 3TEJA 4F71A 4LDAA 3PIIA 2AJTA 1EZ1A 2P9GA 1FW8A 4QTXA 421PA 4OQQA 4GVXA 1AUXA 5FBRB 5KYNA 3LI2A 2PWZA 2Q1WA 3G6WA 3H75A 4US1R 5E1MA 4C1NA 1M2HA 4X0EA 1EM6A 1ZUNB 3ITEA 3WK7A 1D7AA 5LLTA 2GS9A 4YROA 4P0QB 1EQAA 3AETA 2IYOA 1YTLA 4I3GA 4RLFA 5HIAA 2GOYA 4ZVQA 5K3FB 2PH7A 2IYAA 1U0JA 1YA4A 1M7HA 1KMCA 2R7MA 1K5HA 2TRSB 2AI3A 3ZWBA 4KJXA 3D7RA 4G36A 4FFWA 1KTIA 4HAOA 1HV8A 4ZV4A 1DUIA 1FDVA 2QSUA 4EP1A 3IERA 4GM0A 5FTWA 2PFSA 4MKZA 4Q00A 5F12A 3CSSA 3VISA 3CEMA 1OZGA 3KJEA 3KJHA 3VZRA 1OB2A 3ST7A 2FRVA 2GO7A 2IHUA 2A9RA 5KVQA 3GV0A 1WO8A 3KZXA 1HLPA 2Q1XA 5DLDA 3F1LA 1ESCA 1O8BA 4NECA 3R5KA 5CHYA 4Y2GA 3W6UA 4FFDA 2HF2A 2QSJA 3DKPA 3ZIUA 1JR6A 1BU5A 5KIAA 1AZWA 1TLLA 3JRWA 1R0LA 4C01A 4I66A 2XLCA 1KVTA 1EWYA 2NV6A 5BQ3A 1MAVA 1FSZA 4FYPA 2R1VA 4JSTA 1C1DB 4UUPA 2SECE 2YCBA 3QXHA 5LQMA 3LA8A 2B4AA 4D81A 5TS2A 4IGKA 4IWNA 4C89A 4MS1A 3FMGA 3MCZA 4W5WA 4YMHA 1B73A 1GUFA 1Z0IA 3HKDA 1X1EA 4L22A 5HK8A 5HILA 4WBNB 2QTAA 1B6RA 2VK4A 4XPIA 1GGEA 2RFLA 2I99A 2RGWA 4KIUA 4BIMA 2A1IA 5KI6A 1B0ZA 3BIFA 3EXAA 4MIOA 2AH5A 4X7PA 3IR6A 3ZCXA 4KPEC 1VJ5A 5KYUA 3LBHA 5JJIA 2OGWA 4B43A 4D1YA 2R8ZA 3FY4A 1GSAA 3O82A 1N92A 3Q12A 4OYYA 2Q5LA 3ELUA 3HP1A 4MR8A 2QL9A 4PN3A 1XEWX 3WMEA 1J9EA 1U90A 5TLSA 2UXBB 4TQ9A 3WK6A 3MT0A 1M6EX 3AT1A 1WKBA 5KJEA 3PE4A 1HOXA 4W5JA 4WX2B 3WTCA 3UCXA 2VJOA 3CX7A 1GNPA 1NBMA 2A5GA 2E4XA 3G9ZA 1BJTA 2B1QA 1RWBA 4NBKA 4OHMA 4Y7DA 4BVAA 5MN6A 2CJYA 4RORA 2BLNA 3UB2A 3QVXA 1NVVQ 1DDIA 3GARA 3T54A 5KOHA 3ZBQA 5ADHA 3SHQA 4CCYB 2QN1A 1E2JA 1EVKA 2BM1A 3GDGA 4ISCA 3V46A 1KERA 3CT4A 3BCSA 4ZIRB 5JYEA 5KC9A 3AR9A 4PG5A 3NKFA 1DO0A 1PW5A 3HG7A 1EP2B 3QBJA 2OGUA 4FR2A 4JLJA 4LYEA 5D3ZA 3N53A 3VSEA 4MHTA 1T29A 1JFFA 2LV8A 1BE8A 3JWGA 3WKDA 5GADl 3L2OB 3BGIA 1AGRA 1UKEA 1W29A 3UJBA 3QLJA 2NSJA 3NGXA 4FN4A 4HPWA 5JAQA 2OCAA 1U04A 3HDJA 3PE3A 3N8DA 4HWSA 4QXQA 1NBWB 1VM6A 5A62A 1DVRA 5D3QA 1PBNA 1Q5PA 5EJAA 5A71A 3RANA 1D1QA 1WOYA 1YS4A 1EGAA 1GGVA 2QRKA 3PT5A 3RRBA 1O95D 1W0JD 2BTQA 3QPAA 4HEQA 2ACVA 4ZAGA 4M1MA 3OZWA 3RARA 2QA5A 2D2VA 3OMLA 2VHZA 4LPSA 1KO4A 3SEZA 4L8YA 4ZK2A 4MMYB 3CWZA 4P80A 4H6XA 4KYUA 4QU5A 2NZXA 4G4SO 1QRDA 2Z95A 4P4TA 4D8UA 4MUBA 5B3JA 1PP4A 4MUNA 1EU1A 1G4AE 4ESHA 4LOAA 4LBYA 1U1EA 4FBGA 1WCIB 5HZHA 2IS6A 3C8ZA 1EBBA 5KSZA 4NZYA 4DV2B 4IX1A 2BHLA 3QUTA 3L1IA 2WHXA 2IXGA 3RHZA 4NPCA 5LZ8A