5J56B

Rta-v1c7
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
AQVQLVESGGGLVQPGGSLRLSCVASEFSGFTLDYYAIGWFRQAPGKEREGLSSISSSSDGFTSYSDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAARLGGWASFSPQEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Structural Analysis of Single Domain Antibodies Bound to a Second Neutralizing Hot Spot on Ricin Toxin's Enzymatic Subunit.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 36
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j56B00
1EIBA 1SVZA 5EULV 3T0EB 5JOFB 1F8TH 1YJDC 4Y2DC 1A3RL 3GJFK 2B1AL 3H42H 1MHHA 3LEYL 3PXJA 3OR6A 5FUOH 4P9HH 1G7LA 1SMOA 1SYVB 2NY0B 4Y5VB 2VYRE 4K8RH 4OGAC 5I1DA 1JPSH 1AD0A 2NTSP 5DD6A 3E2HC 3ZYOA 4GG6E 4NQCE 3DRQB 4YHNA 3G9AB 4NJ9H 1BIIB 1SEQL 4V2CB 1VESA 2NY6C 5HXMA 4OFDA 3CXHJ 4HF5L 3B2UC 3U4EB 3IFOB 1Z5LB 1VGKA 1ZA6A 1C5BH 1QTYT 5HYJB 1NCCH 4R90H 4F7EB 1IGTA 5T3XD 4S0SD 4QHNA 1F4YL 4OKDA 1HHJB 1KLFA 3LS5L 2ZUQC 5EORL 1MUJB 3LD8C 3PP4H 1FVDB 2CLZA 4FZEL 2RFXB 1OL0A 3ZKSD 5D8JL 4LAJH 4QF1B 3IVKA 4PJ7A 5L2KE 4KPHL 5FHBL 3SDYH 4AQOA 2LU4A 3KWWA 4ONHB 1NBYA 2B1HL 2CDEB 1MPAL 1YYMH 2C3GA 3FONB 2UZIH 3EOTH 3OKMB 3GHEH 5CGTA 3QDJA 3G04B 2E9IA 2EKSA 4L8SA 2ATKA 3LB6C 4WU7B 1RZGB 1HHKB 3MRGB 1EEZB 5L88L 4XWOD 3L6FA 4WW2F 5TFSL 4MYWB 4X7DC 1WSST 3WIHH 2ZUVA 3ULSA 2K9UA 2PTTA 4B50A 1I8MB 1X3DA 3B2VL 1EHLH 2DKMA 5GS1C 3QUXC 5FGSA 2OJZL 1I1AA 4PJDE 4YR6A 3D0VB 1XCQA 3H7BA 4GAYA 4UMGA 2WWMC 3S96A 5T3XE 1MY7A 2X44D 1HQ4A 5F3HA 3NCBB 1IQDA 5IR1B 1ZHLB 3BH9A 1EFXA 4G7VL 2XA8H 1BLNB 5L7XH 2K3TA 4GRWE 3W9DA 1C5CL 4ORGB 3MLVL 3BGFB 1FYTD 5E9DA 2ESVB 5I1LB 4LCCA 2BVPA 4P2RD 1YUHA 3J7HA 4X6DE 2ZCKH 3P4LA 1OAKH 1U8OB 1S5IH 1AGFA 2C3HA 4M62L 2CJUL 3SDAC 4OCRH 1T4KA 3PWLA 1RJLA 3GSNH 1CK0H 1QSFD 2OJEA 1M7IA 5KJRH 2BVQB 5K9QG 3DROB 5FAAA 4JO2L 2A2QT 2J6EH 1CN4A 4RMWA 4BH7A 3BP5A 4JDVB 1YNTB 1T80A 1WV7T 4JM4H 1TZGL 2NY4D 2FBJL 5GJSL 1FNSL 2W60B 2WSKA 3BPNC 1S9VB 5F9OL 4Y4FB 5ILTL 4U1LB 1VFOA 2X2YA 4YDKL 3N50A 2VDPH 1HKLL 1HSAB 2ZPKH 5C07A 5BMFL 1BFVL 1ZGLM 3U83A 4I13B 3V5HB 4JPIA 5AWNL 5ANME 1FYTE 5JO5A 4Q2ZA 4NKIL 4P2RE 4M61B 5KTEL 3QUYC 2PYEA 2HFFB 4QOKD 1EEYA 1J1XH 3MLYH 5SWSD 4IMLB 1AP2A 4OCNC 4PBWD 3RI5K 3LN5A 1QSFE 1WLHA 3H3KA 4N9GB 1K3ZA 4IRJC 4P23A 4UINL 3UTSA 4K7PX 3QIUD 3O4OB 1FN4A 2PR4H 5IF0A 4N0UE 5JOEA 4O2FB 2PW2B 3AXLB 5HI5C 4RMSA 4M00A 3RHWF 1JF6A 4IDLA 1I1YB 1WFOA 1NUDA 2AXFA 2BX5A 2DQIH 1XGPB 3MLSH 4U1IA 2X10A 5GRUH 4MLIA 2GCYA 5MHSD 3PJSB 1SBSH 1FNEA 3K81A 3ZDZF 1EEUA 4LPXA 5DMJB 4D0BB 1ACYL 2GITB 1K85A 5I8EA 2MKWA 1WF5A 1MCOL 4OM1H 3RVTC 2QADD 5M7QA 5C8JB 4NJAH 2FB4L 1OAUH 4XBPA 3V52L 5GRVK 1Y6KR 4G9FB 4NFDA 4TSCH 4IIQB 4BZ2H 5F3BB 3FO0L 4MNHB 4QOKE 3QJHA 4W4NA 4TUJA 1R0AH 3A6BL 3JBG7 2HTKD 1DQMH 1MHEA 1ZLSL 1I8LC 1VKXA 5EOCJ 3DJ9A 3OV6A 3NPSC 1RUMH 3MFGB 1AKJD 5KN5A 3VDCA 1HEZB 3QO0A 3LPFA 3Q5TA 1D5ZB 2NZ9D 2B2XL 2FZ3A 4X80L 1JZ3A 1ADQL 4QCIB 4S1RL 3QUMB 1ITBB 3EIFA 1I7RB 5SWZB 5JXED 2D31A 4PRPD 2NLJB 3MC0A 4DZ8A 2BSSB 1EJOH 4BJLA 1JGVL 1RK1A 3A6OA 3KYOA 2AK4A 3LKNA 3NIDE 2FL5B 4GQ9L 3D9AH 1INQA 3ESVF 4YC2C 2ADGA 2EDLA 3O3DB 4J8RA 3DO3A 5CZXD 4KZEH 1NLDL 43CAB 2FJFB 2EICA 3O11A 5TJWK 4M8VA 3RJDA 1WZMA 2Y07H 1OSZB 4XB8A 5J3HD 3KLAB 4P59H 4F33B 5ICXA 5HVWA 4OAWB 1BFOA 2B20A 3QNYA 4JZNA 2ZUSA 2P49B 3S6CA 3N1GC 3PV7A 3ARDA 4QRSA 4GXUN 3S35X 1S9XB 2AK1H 5JXAH 2IH3A 1A14L 3KNBA 4O9HL 4S10A 3OX8A 3QDHA 4L29B 4LAQL 5D70H 4UIKH 3L5XL 1K4DA 2DL2A 1KC5H 5DRXB 4PRPE 3QCTH 5BRZB 1VPOH 5F9AC 3HUJA 3D39A 1Z0NA 1NUGA 2YPKA 4NHUA 1U3HD 3TA3C 1M7DA 4HEPG 5E4IA 3LKSA 5F8QC 4OGYH 4Y5YC 3SCMB 3AM8A 4XTRD 4BQ9A 5JHLL 1UEMA 4LLUB 4TPRL 1P5UA 4MQSB 2XN9D 3U36A 2AGJL 4Z7WE 3TBWB 3T3MF 3T4YB 2CLRB 1CDYA 1FAIH 4JFYB 5T5FH 2H9GA 4CNIB 3F58L 2OR8A 3WEXA 2MFNA 1J18A 4KUCF 1F97A 5I1AA 4IOFC 5F9JA 4FXKA 1D5XB 1G7QB 4RNRA 3BPLC 1T04A 3QQNA 2WUBL 3AROA 3HPJA 4JLRB 3ARRA 1I3RB 1RZFH 3FO9A 1HZHH 3VGEA 4PGBA 2X09A 2NY2C 4HIJB 2BSTA 1H0DB 5ADOH 3CLFL 3RL2B 1N7ML 2DICA 4NZTL 2E5EA 3F12A 1AIFB 4KHXH 1LO3L 5FKAB 4HUXA 3TF7C 2DTMH 1H5BC 1PBYA 4IHOB 1I9RL 3GJFH 3O2DL 3X3GH 4WW1B 1JMZA 1XGTB 1DBBH 2XN9E 1VGKB 1UXWB 1PX4A 3O9WD 1IGTB 4NBYB 1LGVA 2CKBA 2APWA 3MOAL 1KJ3L 2Q7YB 5D2NE 2QHRH 4HAGA 2Y6SD 3TPUB 3SGEI 4ZFZB 4PJ7B 2IBBA 1RUKH 2ED8A 5I8CA 4YE4L 4X7CC 4KKBD 5BXFB 4PJCF 3B3IB 3QQ3B 1DLHA 1MRFL 5CS7A 4MD0A 2VAAA 2ATKB 4RWHA 2NY5C 3OGOE 2C4XA 3BXNA 1F00I 3MX0A 2Y25A 1ZANH 2HVKA 4HKBB 3DWTA 4P4KA 1XGUB 3MLZH 1GGUA 2W91A 3GKWL 3QIUC 4WO4D 5IM7A 3T2NL 4U6XA 5EZOL 2B4CH 3P9WB 5IFJB 1BVZA 2F19H 1B2WH 3H9SD 2BRRH 3UYRH 2DMBA 1A5FH 1I1AB 3SGJA 1IKFL 4AEHL 5CJBA 3WNOA 3QFDB 5EOTA 4XMKH 1XCQB 4KTYA 3ROOA 2VDRH 4NNPH 5IK3A 4QHLA 3I50L 3V4PL 4XBGB 3VXNB 4IMKA 4A6YA 4JFXB 2YD1A 1T66D 2X1QA 5HGDA 1P7KB 5D7JB 4N8VG 1F3RB 3NIGE 2Q76A 1OVZA 2ZZUT 1BWWA 1DBML 5FYKD 1AGFB 1ZGLP 1FBIL 3RDTB 2X9YA 2YD5A 4PB9L 4S2SA 4ZO9A 3V6OE 2B5IB 4OM0L 3SJVB 3TVMC 1GGBL 1KB5H 3OXRA 3BUYA 4KI5E 4W70A 5IMOA 4K71C 3MRMA 4IRSB 5J7CC 2FEEL 1F11A 4TUOA 4DCQA 3P11L 1CICD 2R29L 4LVHC 4RFEB 4U0RC 3DSNA 3BKMH 4CW1A 1QO3A 3DMMB 2CUHA 3ARSA 5DJ0A 3UTOA 1JNNH 4PBVC 4DN3H 3H9SE 3ULVC 4MD4A 4LGRB 3X3FH 1A1OA 3ARBD 5IVXF 5D7LA 3KXFB 3NTCL 4JN2B 4TSBH 1ZT4B 2CSPA 1J0IA 1OD7A 2EEBA 4Q6IC 3DIFB 4ZTOL 3MREA 5IW6B 3O8XD 2EDJA 3W5MA 1NMCC 4HDIB 5EWIH 5IMMA 4LSSL 5DRWA 4OCXH 5FYKE 1JZ7A 5DJCB 5C2BL 4L5FL 1SYSB 3ARFC 1FVEB 4LNRB 1RMFH 5C9JB 1AXTH 4FG6D 4L9LA 1AP2B 3KJ4B 3QSKB 4PRHE 3L7EB 3PWVB 3BPCB 2VQTA 4OJFL 4MA8L 3PWNB 2EYTA 1SHMA 2APFA 4H5SB 1H8NA 9CGTA 5E5RB 3RWCA 1BHGA 4KXZH 4Q9RL 3MUJA 1CG9A 2H32B 1C08B 2BDNL 4H0GA 5DUPL 4EQ3A 1MVUB 4YDJB 5KOMC 1NC2D 3UO1H 4L4VA 3CZFB 1OB1B 3FOLA 3WUZA 1N5YL 5B4MD 4Q9QL 3QXUA 3IDYC 5E99L 2R4RH 2WANA 2VRAA 3BP7B 4NYLA 3HB3D 5C0AD 4ELMB 5EO0A 3RNKA 3EOYG 4TOYL 2PUQT 1DFBL 4XBPB 5DJAA 5FYKU 3UTZB 2J88H 2P5WA 2GY5A 4JFFA 1L7IL 4W6YB 5IB1A 4P5MA 1MY5A 4YFDB 3U6RA 1IM3B 1MHEB 3JUZA 3O81A 4KZDH 1IAIL 5KN5B 4ZPVA 3H0TA 5E95B 5C08A 3ULUF 3FT2A 2GAZB 3ZDYE 3G6JA 4HC1A 5K9OB 3WNMA 3GBNH 1LE9B 4Y1AD 1VERA 4NWTL 5DMIH 2ZOKA 1CXEA 4F8QA 4GQPH 1BP3B 1NSNH 2G5BB 1IFHL 3VFVB 2Q3ZA 3MMEA 3QXVA 4MA3A 4OLWL 2FX7L 4AY0A 2C1OB 4B41A 5GS0C 3KPPA 1NAML 4LLDA 2LAAA 5E94A 3BD5A 4HIIA 3RUGA 2XTJD 4YNYA 2N1KA 4ZSOE 2HN7B 5GGTH 4JN1L 4ZFOL 4APQD 3QWOB 3SE8H 5BQ7A 5EBMB 4LGPB 3AU1B 3L3JB 5LCVH 2EYSB 1OT1A 5ALCH 4J4PD 5JUEL 1MF2H 3TYFB 1CGUA 4FQXB 3GBMH 4XCYA 3QNYB 3WDHA 1S7XA 1MFDL 3GSXA 4V1DA 4KKBC 1J87A 1T20A 4P2OD 4X5LA 1OSPH 5MI0B 4WJ5A 4X6EB 3KYKL 1P2CA 2DQUH 1VACA 5FGBA 1TCRB 3KNBB 4LBEA 1RJZA 4O58H 3V6OC 5DWUL 1A6AA 4NN6B 4H8WL 4Y1AE 3PNWB 4P5TB 4NKMA 4KI5C 1DE4B 1Y0LA 1E6OH 1QBLL 1I7ZB 5C0GA 2DD8H 1FG9C 4R97B 5DFVD 5MERA 1QFWH 4WO4C 3DECA 3GM0A 3LKSB 5KSAD 4NOFA 2H26B 1YA5A 4KTDH 5CILH 5FHAH 4XPTH 4NQDB 4P2QD 3LKRA 1CGWA 2YN3A 1HI6A 3OXSA 5GISH 1TCMA 3CXDL 3LH2H 4YHKH 2EE2A 5EIVA 1HILA 1T2JA 4RFOL 2G75A 3CFDB 3MJ7B 5INCA 5T1KA 2OR9H 5B3JF 5DJ2B 1ORSA 4YHLL 1L7TH 1JNJA 4YXLH 2H9GB 3PGDA 4PJHF 3OF6D 3GJEA 1OM3H 1FRGH 3KPLA 1T66C 3MRQB 1F3JA 2W92A 2VLKB 1TZIA 1JWSB 1QFPA 2EIBA 3FB5A 1YPZE 2MHAB 2WUCH 4QXGL 3NCFB 1DQDL 4GMTL 1PKQB 3D2UD 1FFPA 2BXYA 1FIGH 2R0KL 3LIZL 2G5RA 3RZCD 5TDNA 5L8KB 5CCKH 3ZL4H 1I7UA 2VZUA 4HUXB 3T1WA 1CICC 5F7LB 1U92B 3GIVB 1A7RH 1ZKAA 4O5LH 4P2QE 4LMQI 4JB9L 4KGLA 2ZP0T 1CBVL 3EZJB 4IS6B 2WW8A 3ARBC 1XCTA 4YHMH 2IQAA 1TJHH 3NPZB 2DWDA 2J8UB 2R56L 1TQBB 1IC4H 2V9QA 15C8H 4G42A 2VDOH 4WGWB 3S5LB 3CFEA 1NCAL 2PXYC 2GJ6B 1A7BA 4I18A 3N1MC 1MCJA 4LSTL 5IIEB 4G80A 3U2SB 4PJXA 4XNXL 1DLHB 4KROD 2DQHL 4Z7UE 2DTSA 3G6DL 4Y2DA 2X7LA 5CJQH 4FZ8H 4N68A 3BXNB 3NIFF 4Q9CA 5F1SA 1HYRC 3GMLB 1ODAA 4WCYH 4DAGH 3MYJA 4CU6A 2JIXA 2YN5A 1MAML 1DZBA 3R1GL 1CDJA 4JQIH 4U6XB 4UNUA 3VXTA 1URLA 1KFAH 4UILH 1BVLB 1CE1L 5D7SH 1W72A 1M4KA 3BKCL 1S9WA 4HV8A 4UAOB 4M6OH 5MEPA 5EIIA 4YJZL 2VE6A 1X6NA 4HHAB 4HXBH 4LLWB 4N90E 4KK8C 4G6KL 1KELL 4PGCB 4GBXC 3S34H 4Z6AT 1GIGH 1KN4H 5DJYB 1EAPB 3MCLH 3ABZA 5A2FA 1KTDA 4AQ1B 2G2RA 3W11D 1Y18B 4KJQD 3GRWA 2AQ1A 4TYUA 4RMQA 1CTOA 3V4UL 5JA9A 2EC8A 2V17L 1OD9A 3O6FD 2ED7A 4HG4J 3WXWL 5IVNA 1CT8B 5GGRY 1KIPB 2C4FU 2NY1C 2WP3O 5BV7C 1Y6MR 3OXRB 1S7TB 1DDHA 4OCSH 3BUYB 4EKXA 2YUVA 4ORZC 1TVBB 4WI9A 1A3RH 4JCMA 5AYQA 5D1XB 3WL9A 2B1AH 5HDLA 3LEYH 1UZ6E 4UV7L 2Q8AL 3DYOA 1H3GA 4YHPA 5IB4B 5JHDE 3K1KC 1Q9KB 4M5ZL 5GS1A 4XH2A 1D9KB 3KLDA 3QUXA 1NC4D 1SVCP 1CFTB 1HSBA 5E08L 1A1OB 3L1OH 1SEQH 5D7LB 3SGDI 2BOCA 2CXGA 2ATPA 3O3BB 4JFEA 3O6KL 4UDUB 5JOPD 3DVFA 4OI9A 2H6PB 4LCWB 5MP6L 1K6QH 5T3ZL 2DKSA 3IDXL 1P4IL 2X4OA 4WNQA 3WFHB 3ETBF 4W68A 1F4YH 3B83A 4PJ7F 5I2IA 3VDBA 1C16A 5EORH 4OZGE 5B38B 1VGEL 5ITBL 2ZG3A 5D8JH 2G60L 3BZ4A 4KPHH 5FHBH 5GSRB 4OQ1A 1UXSB 5B8CB 1EGJH 2B1HH 1CIDA 2Z4QA 3IRZA 1MPAH 4HT1L 1WWWX 5DD0H 3SKUD 4YDIH 1KEGL 3D18A 2X05A 3MR9A 5FV1L 3VI4E 5L88H 4J6RL 3TJHC 4TVPD 1NDMB 4IJ3B 1YY9D 4QRRB 5TFSH 1H15A 1XT5A 3DBXA 4ZUWB 3FTGB 4JRXB 5J56B 4D9RE 3UYPA 4MJ4A 1YC8A 4XVTL 5I1IH 1G7PB 2E9BA 5IW1B 3IFNL 5C09D 5DFVC 4AM0A 1MLBA 2YKLL 2OJZH 5KSAC 5JOPE 1NCWL 1CU4H 4XAKE 2YD4A 5ID0A 1DVFB 1EVUA 1N0LA 4OLYL 3U9UA 5DJAB 4ODVL 1ZV5A 3QUYA 3CUPA 4G7VH 2FR4A 3HN3A 3MLVH 5ICYA 3FOMA 4Y4KB 4CN1A 2DL9A 3MPCA 4RAVA 1ZVHA 4ZS6D 3PWUA 4DOHE 3KDMA 1I7TB 4IRJA 1TVHA 4M62H 1QFWM 2ICWI 4ZPVB 2CJUH 3HNSL 4U1GC 3RVUD 3RY5A 32C2B 3G6JB 2C3VA 1MNUL 1WFUA 1OW0C 4R4BA 4TVPE 1CQKA 2OR7A 1NGPL 2H32H 5D71L 2R69L 4KGJA 1MCEA 4NC0B 3RZCC 4JO2H 1DP0A 3G5XA 4DK6A 1OGAB 1G9ML 4GG6A 2VZTA 4NQCA 3WFDL 1TZGH 3CVHB 1G7JB 2F54B 3F6LA 1FE8H 4LLDB 2KL6A 5GJSH 4MQXC 1FNSH 1A4KA 4DEPC 2ARJA 2FO4B 1B6DA 5F9OH 3EYUL 4UB0L 4M7ZC 1BEYL 5EN2A 5I73C 5ILTH 3QEUA 2LVCA 2XFXA 3EFDL 4YDKH 1HKLH 3D0LB 3B9KB 4JKMA 1NFDA 3UJTL 5BMFH 5BQ7B 3BP6A 1RZKH 3FRPA 1QLRA 1AHWC 1DBJL 5AWNH 1JWUA 3C09B 3RIAK 5KTEH 3BEVA 1A3QA 5E8EA 5L2KA 1NANI 5EA0L 5HHMB 4YHYC 2X4TA 5DYOA 2XQBL 5B38G 2EH7H 3MRBA 2I24N 2DQFB 4U31A 4LLQA 1O0VA 5GZOD 1M6OB 4UINH 1QA9A 5F7UA 4RZCA 3V6FB 4C56D 4K8RD 5DQ9B 5I18H 1DEDA 2D0FA 4L3CA 4HUVA 1AO7D 3GSWA 4HFWB 4N0CD 1KF9B 1LDPH 1ZT1B 2JK5B 1EZVY 3T2QA 3LKRB 3R06A 4FQIL 4ZNCD 3MV9D 1IAMA 4PJDA 2ENYA 1YC7A 1LD9A 3FQUB 4ZAKB 3RX7A 2Z35A 1X5JA 3LRHA 1RV6X 1ORSB 2AXGA 3QUKB 4X9GA 3MBEB 1IEBB 2DN7A 1MCOH 5IFAL 2FB4H 3V52H 4AH2A 3VRJA 5T1MB 3W11C 3BYYA 4JRYD 4I4WA 3FO0H 4ZFOB 5ADPL 2XKNA 5LQBL 4YXKL 3DUSA 3FB5B 3MLTA 3O6FC 1NFIB 4X6DA 1U41A 3BESR 5F1NA 2F53B 3NH7L 3Q3GA 4XAWH 8CGTA 1ZLSH 2DWEB 5ESVA 2B2XH 3BSZL 1OY3B 5TDNB 5DA0B 4C56E 4LVNB 1WWBX 1F58L 5KAQF 1UADC 3SE4C 3TFKD 3FT4B 4FFYH 1I7UB 1ADQH 3TA3A 3MRKB 4G8EB 1AO7E 4U0QB 4UQ2A 3UAJC 4YUEL 5JMOC 3DI2B 4ZYKA 3ARGC 3HS0A 1NJ9B 1JGVH 1TQCC 3U79A 4WHTB 4MA7L 3HG1B 2EDQA 4JGJA 1ACZA 3MV9E 5JA8B 2DLHA 3L7FB 5SV3A 4EI5D 2GUOA 1XZ0B 1A9EA 4GQ9H 4DKDC 1YEEL 3A67L 2DWDB 5EBWA 3CC5B 1FL6A 1JNHB 4TNWK 5AG8A 2YWZA 3RL1A 4FFZL 1NLDH 3DNKA 2NW3A 1Q9LB 2IQ9L 2V2XA 4DZBB 4JRYE 1FYTA 4KK9C 5I71C 4P2RA 5BOPA 1D5BA 3SGDH 2OI9B 3LV3B 3ZMRA 2GYSA 2QSTA 4K3GA 3D69B 4M5YL 2QBWA 1WWAX 4X6FB 5EU5A 2J8OA 3CAFA 3PWPA 1G0XA 3RWFA 1QSFA 5CBEB 1A14H 1PYWA 3LY6A 5JNYB 4LAQH 3C5JB 5JORB 3VXTB 3L5XH 4L8DA 4PJ9B 4N0UA 1MJUL 1H5BA 1RK0B 4JJ5B 1J88A 1S9WB 1F42A 5E70A 4DGVL 2ZJSL 1U8HA 5EFIA 4RQQA 1CD1B 4YIQB 5E8DL 2Z8SA 1TPXC 3K4AA 3MRNB 2X4PA 5JHLH 2HJFA 3DYMA 4TPRH 4LSUL 3EYFB 2YD8A 2Z9TA 2AGJH 1IAII 2F74A 4ODSL 4HW6A 2QEJA 1HINL 4M4RA 4QNPE 4OZHE 4HUUB 5DUBA 1MVFA 3D85D 1EUTA 1UWEH 5CP7B 4JR9L 3W5NA 3F58H 3S36L 5DHYB 1PG7L 3HNTL 4QOKA 5DVNA 3DARA 5JLZA 1EJ6A 4OLZL 2WUBH 1KXVC 3DGGB 1DDHB 5DGRA 4HSQA 3QA3A 4ZS6C 4CU7A 1WJ3A 5FO8B 3QIUA 4JFQA 5KZCD 1A2YA 4MXVE 1QNZL 1N6QH 3RVUC 4M1CC 5BS0E 4R26L 5CZVL 3CLFH 1S7QA 1LO5B 1N7MH 3QIBD 4NZTH 4PP2B 5DZOA 5CKGA 3C60D 1HSBB 4Y5XB 3Q48A 1D6EA 1LO3H 2X4RA 2NNAA 3QPXL 1KT2A 1XF2A 1A6ZA 4X7FC 1I9RH 1NCBL 3O2DH 4CN4A 5F9WB 2WBJB 3ARXA 4KJWC 5IMLA 3KVQA 3O45A 3UC0L 4U1KA 1LEGA 4K3EL 1CDCA 2PF6A 1LEIA 2FSEB 5EU6B 1RUQL 5CIPA 4OGXL 1QVOB 3IDIB 3T1FB 5GRJL 3MXVL 1G1YA 3P73B 1U8KB 4ELKA 3C6SA 5MEQA 4YE4H 4FQQB 4KI1A 1IEHA 1QRNB 1PLGL 2R2HB 2Z4QB 2BY2A 4KQ3H 4YDVA 2AS5M 1MRFH 1GC1C 3QXAA 4F7MA 1MLCA 4JGUA 4LCUB 3HLAB 2XWTA 4Z77A 1U3JA 7CGTA 5GZOC 2BNRD 4IDJH 4GW4B 3GKWH 4PRPA 2AJ3A 1NANH 5ISZB 2C1PB 2VLLB 5EZOH 3GZKA 1DUYB 1MLBB 2OXHA 5J11B 4AIZB 4U33A 1RJYB 4AYFA 3CH8A 3EJJX 4YEFA 1IKFH 4AEHH 4NO5A 3RWGB 4Q6IA 4RGNB 1R3HB 2VH5L 1HHHB 3I50H 3V4PH 3EOAB 1MFCL 4Z7WA 3C5SB 5EO9B 3BP4B 4KKCD 3UP1A 3FQRB 5D1QC 5IBUB 4RAVB 2C26A 3V6ZA 1DBMH 4LLMB 1FBIH 2ITDA 2UVFA 5GQBA 1EZVX 2RJMA 1ZWIA 4PB9H 4OLEA 3CNKA 4OM0H 2AI0L 1GGBH 3U82B 3K80A 3RA7L 3PQYE 3C8DA 1AR2A 4X0KB 2X42A 2WK2A 1XH3A 2BNRE 1JGEB 2NXZB 5A16B 3MODL 2JCCB 5DRNB 3P11H 1CDHA 4R9HA 2R29H 4XX1G 1T3FB 5F97E 4GG6B 5HD8C 4NQCB 4ONFL 1CVRA 4QYOA 2JJSC 2R2BA 2J5LB 3OAUL 1HYSC 1ND0A 1PQZB 2N56A 5IB3A 3KYNB 1X5YA 5TDOB 2W38A 5JPNB 1S3KL 1GZQB 3K4DA 4HMEA 2XFXB 2XN9A 2I27N 1QSVA 5T1LA 2HTLD 2HFTA 4UUJB 1PSKL 4U7SA 2ARJQ 3CFCL 4LDEB 5D2NA 3UMTA 4PJ5A 4P4RA 3FN9A 3ISWA 4S1DD 4LSSH 2ZOLA 4GAJL 1NL0L 5I16A 2Z31D 3T0WA 5C2BH 4L5FH 5J6HA 2I07B 4I3RL 1YEKL 1G7IA 3C8KB 4FQJL 4PRNA 1IRAY 5GHWH 3W2DL 3KPNA 2NY3B 3BN9D 1QA9B 4PJIE 4CVZA 1XIWD 4S11A 4OJFH 3CDYA 4MA8H 4AIXA 4AEIL 1YMMD 3W0WD 4L3CB 1FDLL 3WO4B 2BVYA 1I9JL 1DBKL 1HH9A 4QWWD 4Q9RH 3CX5K 4DTGL 4GSDL 1L0YA 2BDNH 1BJ1J 2I60H 4GAGL 3HE7D 2VXUL 4FA8A 3HMXH 1N5YH 4R0LB 4Q9QH 1LD9B 4WV1B 3VWKC 5E99H 2Z35B 5FV2A 2GIYA 1KYOJ 3SBWC 4KMQA 4YPGA 3JXAA 3EYVA 1F6LL 1DFBH 2WBKA 3VRJB 3NGBC 3ZKXC 4GRWB 4EDWL 3L5IA 4GKSA 3T0ED 5DJ8A 1N5AA 4Z5RA 3PL6B 3TJEL 5I1JL 3ZE0E 4MWFB 3SDXE 2BSRB 4MQ7A 2F8XC 3BD3A 3V6OA 2UWEE 1IAIH 3G6JF 5IBUG 3QHZL 5F1KC 1MCLA 4OUUA 3WFBH 5SWQB 5GGUB 4N0FB 1X5FA 2F15A 2VWEE 1YMME 4PJBE 3BQUD 1RZJC 3W0WE 2X89A 2XZAL 1U93B 3MNZA 1T03L 2EDBA 4NWTH 4WO4A 3HI6L 2J4WL 5IMKB 4XVJH 4ZYKB 1IFHH 2XA3A 4UV4L 2VC2L 4RRPA 2K1MA 1BECA 3IAQA 1H3WM 3H9SA 4OLWH 2FX7H 5EC2B 1KN2L 3RUGF 1Q9WA 2ZUUA 3C60C 1QR1A 8FABA 2FATL 3TC9A 1OTUD 1IVLA 1NAMH 1UKTA 2HYMA 1VHPA 4JFZH 1FL6B 2E7HA 2FH6A 3RL1B 4JN1H 3ECBB 4ZD3L 4ISVA 5ANMB 1IKNC 5AAWA 5IOPA 3S37L 1GZPB 3T0EE 4L9DA 1IGFH 5JUEH 4CMHB 2YUXA 1HH6B 3HI1A 3DUHA 4NGHH 2V9RA 3MRHB 4GRLD 4LP5A 1UB5B 1MFDH 3STLA 3QI9D 2NXYD 2XXCB 4PRHA 4QTIL 1BFTA 3KYKH 3FB8B 4EJ1C 1W8NA 5J13B 4H8WH 5A3ID 4M43L 2AQ3A 2KKQA 4ZPTA 4Q97A 3C87A 1CICA 2W0FA 1N64L 3UTPD 1QBLH 3KS0J 1KPRA 4D94A 3EKCA 2NY4B 4M7LL 4JHBA 3VXQA 3BO8A 1N59B 2MJWA 1I8KA 5CFHA 3MZTA 1GGCL 3ARBA 2HT2D 3L3IA 4TNVF 3GMNB 3CXDH 2ESVD 2VXVL 3BDBA 2F74B 3T8XB 4I2XE 4RFOH 4P0DA 4MCYB 3CFJA 2PXYA 5AZEH 4RBPH 2FHFA 4YHLH 5DHVA 3O8XA 2F58L 1ZT7B 3GNML 2NR6C 2AJZA 4L8BA 1X5ZA 2W0LA 1YYLL 4KKCC 5HHNB 2AP2A 4K07A 3GSVB 5SWSB 1FGVL 3NCCB 3H2WA 1C7TA 5C0IB 2ILLA 3ZE1F 1DQDH 1U36A 4DUVA 3WKNA 4TNWF 4OD2A 5LAXB 1A2YB 3LIZH 2R0KH 4OZ4A 2B39A 4AENB 4ODXB 4NKQB 1TETL 2EDOA 4NO0B 3UTPE 1TFHA 4QHMB 2IGFL 2X70B 2E7LC 4UBDD 2DF3A 2XRAL 5E8NA 3WJLC 1NC2A 2XKSA 4GBXA 3DX9A 4I0CC 3GI8H 3DVIA 2BNQD 1WC7A 4JB9H 5KVMC 1P69B 2BCKA 2X6MA 5IMLB 2LAGB 3O45B 2ESVE 1GAFL 4QLRA 4TTDD 5F8RC 1VFAA 1CWVA 2QADB 4JAMA 3WN5B 4ZSOA 2R56H 5JPMA 1MFBL 1XEDA 4D2NA 5HGBA 4U1HB 2HTLC 3T77B 3CD4A 3HZYA 3LN4B 4ELKB 4LIQL 5IFHL 1C12B 4PJXF 1NCAH 1UC6A 2JLLA 4OLVL 5DDHB 3LVEA 4LSTH 3CSYA 1MCWM 1T2QL 4S1DC 2EDDA 3KR3L 4WDIA 3QG6A 4YDVB 5HHXL 2DQCL 1ZE3C 2DQHH 1ZEAH 1AKJB 3LRSB 2D7QA 3G6DH 1KTLA 2Z31C 1F4XL 4EDXA 3WLWC 1GXEA 4UTAL 1JF1B 1KYOK 4HGMA 3G5VA 1D3CA 4Z7VB 4Y1AA 1QFUL 1E6JL 3R1GH 1MAMH 1CD0A 3IU3A 3DHJA 1AGDA 4Y8AA 1P7HL 3IDJB 1X5IA 1CE1H 3QUZC 3BKCH 3RRQA 4XP6H 4M1GL 3WDIA 2A73A 4WU5A 4HBQA 4QWWC 1P1ZA 5FKPA 4K94H 2V2WA 1DEEA 1HDMA 5HSFA 4G6KH 1KELH 2YPVL 4YHZL 4HH9B 1NEZA 3IDGA 1NUFA 1EO7A 4APQA 1HHIA 4ZUSB 2XXMB 4JM2C 2UUDK 1KJVA 4NO2B 2V17H 3NCJL 5EIQA 3V6ZB 3CFBA 1IM9B 3WXWH 4JRWA 3MJ6A 5HVHC 3QISA 3AMKA 1ED3A 2IG2L 3T0EC 1YPZA 4URTB 4P2OA 2J2ZA 4J3SA 5SWZD 2CRYA 4JY5L 4R2GD 5TH2A 1JZ5A 2LV4A 4M7LT 2R1XA 1XH3B 5FUCC 3P2TA 4Y5VC 2NY0C 3VCLB 1PAMA 4I3SH 3GMRA 4D0CA 3GSUA 5LBSL 3UDWC 5GGRA 4FHBD 2Q8AH 1SJXA 1MFAL 1U3HB 5FYJH 4M5ZH 1A9BA 1DLFH 1MJJB 3DTXB 4YAQB 5KSAA 2DLIA 5E08H 1PFCA 1JWMB 4P2QA 3JWNC 4DFHA 3RPIA 2H8PB 4R7NB 3IETB 3O6KH 3LHPL 1OTUC 5MP6H 3D1MC 5T3ZH 3IDXH 2A6KA 4PLJC 1IAIM 1U58B 2CK2A 5D2NB 4NNYA 3OF6A 4PJ8D 2B0SL 5EZLB 2ZOLB 3PHSA 1T5XA 2FIKA 3GSRB 5K59F 1NQBA 5ITBH 2G60H 4G43A 3QP3A 5MEOB 1G7IB 1V3MA 4Z7UA 5SWZE 5F44A 4NBZB 4HX1A 4HT1H 4P3DB 5ESAA 1ZHKB 4ONGL 2X4NA 1KEGH 4G9DB 1WEJL 3RZCA 3QXDB 1WWCA 2E8YA 4MMZC 2BP3A 3SCMD 4HWBA 5ICZB 1HH9B 3GSQB 1MWAA 1FZOA 1SJEB 3SGKC 4XVTH 4M3JA 3RY6A 1A6UL 4EBQL 2MPAL 3IFNH 3ARQA 5BVJA 4V2BA 3UTQB 1OAXL 2YKLH 2R1YA 4RX4D 4X4XA 1MOEA 5D5MB 1NCWH 3O9WB 1WAAE 1T0PB 4ZDHB 4RWYH 1AHWA 5GRZA 4YPGB 2HT2C 2KDGA 1SEBA 4WTWA 4OLYH 5FO7B 3EYVB 3BGFC 1TJGL 5DJZA 5LGJA 3EJZD 5B21A 4ODVH 3BMVA 5ESQA 4OFYD 5DJ8B 1KCUL 3QG7H 3N06B 25C8L 2OQJA 2YA2A 3BZEA 4LKCA 2VDML 4G8FB 4MSWB 1U0QA 5BRZE 4YHIB 2Q20A 1L6XA 3DX8A 5FYLE 4OCMC 3HNSH 5C6WH 4KDWA 4GH7B 3WS6C 3P9LB 5F89B 1MNUH 3T2OA 3CFKB 5D71H 4GG6F 4I0PB 4K55A 4XP9L 1KIQB 2XZQL 5I1HL 1F90L 3WE6A 3VFOA 3CDGB 5JHDA 3NFNA 2Y7QB 3QULB 1UKSA 3CU7A 4MNGB 5T1DL 1G9MH 1LNUB 1QR1B 3RZWA 2XI9A 4Y4FC 4HPOL 3DSFL 4NHCL 2J12B 1PEWA 2PYFB 2C4FT 4OUOA 3V2AR 2VLMD 3IJHB 3EYUH 4PY8J 4UB0H 1BEYH 2E6PA 3JV4B 1EUUA 2F5BL 4ISVB 3UJTH 2XWJA 5LWYL 2AJSH 3BW9B 1DBJH 5IOPB 3DX7B 3O6FA 5EC1A 2VLRB 2GFBA 4OZGA 1EVTC 2W9DH 3EO1B 2IH1A 3DGCR 5EA0H 2DYPB 2EZ0D 1JYNA 2X4SA 5CMAB 1FZMA 2XQBH 3QDGB 4PREA 3TIEA 1E4WL 1S7SA 2H2SD 3SE4A 2AV1B 4PP1D 4K9EL 1W0VA 1O7VA 4RMTA 3WHE1 1WK0A 3N9GH 2A6DB 2AV7B 1R3JA 5EH1A 4G8GB 3Q5YA 5C3TA 5INDA 1NC4A 2AABL 4POZD 1NBZB 4PJDF 4X99A 4FQIH 2FX9L 4XPAH 1XGQA 4HFUL 3X11B 5D7JD 2VLME 4WHDA 5FEBA 3IFPA 2X4UB 3UBXB 3VW3H 3MFFA 4NO3A 4G6JL 3BI9X 4XNMA 4LCYA 4GRWF 5F7DB 4XP1L 4IIQC 3O8XB 4H20L 3GMOA 3F7PC 2LU7A 4L8BB 2W65A 3T0XA 2C7UA 2W9LA 4L4TD 4UDTB 3SJVD 4X6DF 4YGVA 5E0QA 2KZWA 4DVBB 5ADPH 2YMXL 5HY9A 5LQBH 2EEDA 4YXKH 3BKJL 1ZGLA 5HBBA 5CJOL 4IRSD 5HYIA 4PJGB 3T3PE 1R3KB 3NH7H 2N7AA 3UPRA 1LK2A 5IHLB 3SDCD 4MS8D 1A7OL 3AS2A 3DMMD 3BRFA 1AR1C 1FG2A 1WZKA 1F58H 3HNVL 1V05A 2AKRA 2YPLB 4HJGA 4LSQL 1NLBL 1A1NA 4QRQB 3KXFD 5I75B 3MUZ1 3IRPX 4YUEH 1NC2B 1FHGA 4PB0L 5BJTA 1FNHA 2H2PD 3VFNA 2BCKB 2CH8A 4ENEC 3GO1L 2DJ4A 4HLZG 5C0AB 4K2UL 4OF5A 3T04D 5H2BA 3A67H 2R9HC 4ZSOB 3VMOA 3FB6B 4UTBH 3HE6B 5E2TL 4FFZH 2EO1A 5FDWA 1WBXB 4L4TE 1H3UA 5CSZB 3SJVE 2RQ8A 2IQ9H 43C9B 4XXDA 3X13A 2A83B 4WWKD 1WT5C 3KYMA 4IOSD 2FD6L 4P9HL 5A40E 4PFEA 3ARTA 1NGQL 3I9GL 4M5YH 1JPSL 5L0QB 3VRLE 4F7PB 1U91B 4XNUL 5I1CL 3KG5A 1KCLA 2ZUXA 3QEGL 2OTWA 3QDMA 3SDDB 2FYYA 1B90A 4BQCA 2GT9B 2WNGA 4XMLL 3IU3B 4LLYA 1AGDB 3KXFE 4JFDD 1XR8B 3TO2A 1MJUH 1SBBA 3MGOA 5C0BA 2ZCLL 2VSCA 5HHOB 3SCMC 2A73B 4DGVH 2ZJSH 4WU5B 5ABDE 1ES0B 5IG7A 2Z8WC 4X7TA 5I9QB 5E8DH 5EBLB 2XTJB 3T4AA 2AW2A 3GDBA 4YO0A 4I3GA 4LSUH 3V5DB 3GIZL 2ZSWB 5LGKA 4ZQKB 4ODSH 5EPMA 1BOGB 1HINH 3REVB 3WHE0 3MRIB 3UBXG 4NQEB 1SJVA 4LLVA 5IQ9B 1YDPB 2CRZA 4R4FL 3S36H 1PG7H 3R4DA 3MLUL 2CRMA 5H37G 1FV1B 4OLZH 4C58B 3PGCA 4P2OB 1UB6A 2DLEA 3HHRB 5DGQA 3LZFL 2OXGA 2J7LA 2YEZB 2UUDH 1YN6A 1JHTB 1CD8A 1QNZH 3GMRB 4CJ0A 3GSUB 4U6VH 3RWDA 4C56A 4JFDE 5HDOA 4R26H 3GMPB 5DEFA 3V0VA 1U8PB 5CZVH 3V8CA 1A9BB 1AO7A 3MRLB 4MNQB 4ELME 3BWAA 1KLGB 3NIDF 1BQUA 1EA9C 3QPXH 2ADFL 4KRMB 4EUPB 2VISB 3EAKA 5A2KH 4IOIB 1Q8MA 2O61A 2XPGA 1NCBH 1JUFA 3MV9A 1KG0B 4H26B 3EYQD 3BDXA 3PP3K 3LKOB 3TNMB 1OAKL 1QPXA 1S5IL 3UC0H 4K3EH 1IT9L 3DX6A 4FQXD 4LMQE 1RUQH 2Z92A 1PY4A 2MNUA 4PJAB 3FN3A 2DQEL 5GRJH 3MXVH 3ZKMD 4YWGH 1OTSD 1OTTC 4JRYA 2RB8A 5FA3A 2VL5B 4K3HA 3JWOC 1ORQB 1VADA 4WTXA 4PGEA 1DQLL 1PLGH 2ZUTA 3D2UB 5ESAB 4LEOA 3VXOB 2EZ0C 1ZLUH 3SN6N 4BFIB 1DL7L 1KLUA 3WIHA 3HCVA 5FA4B 2UZXB 2XIDA 2JJSA 3VRIB 1FZOB 1I1AC 3NOIA 3JVGC 4Z7OE 3OQ3B 2DDQL 1WFTA 4XNYL 2FDBP 5DRZA 4EI5A 1A64A 2SEBA 1DUZA 2EIZA 1JIBA 4LQFL 2VH5H 4L1DA 1SEBB 4NQXA 1GRWA 3B5GA 5D7JC 3OKEB 1MCSA 1CDUA 1MFCH 2WAHA 5DO2C 4HZLB 4QTHA 4GOSA 4PY7B 1ZVSB 4OZHA 3MRDB 1VFBB 1QBBA 3IXAA 3M1BB 3RDTC 3PE9A 3JTTB 5D96B 2OQJB 3LPWA 2B5IC 2PR4L 3BZEB 3K4ZA 4YQXH 1AQKL 1T1WB 4KKAD 4KROB 3K8KA 3P77A 3PABB 3BYTA 1PZ5A 3D6GA 2DQDL 3GSNA 4HIHB 3EHBC 4OV5B 4IRSC 2AI0H 1MH5A 2DQIL 3INUL 1DQQA 5EBGA 3RA7H 4LKXA 4OGZA 2J6EA 3DMMC 1WISA 3MODH 2A6IB 3WE6B 5BS0A 4MJ6B 4HH8A 3C08L 3FZUC 3UTTB 1U8MA 4M4PA 4WFHE 1AC0A 4OM1L 4EZMA 4PG9B 5IHZA 3RVXD 3VWKA 1LEKB 3OAUH 5E2UL 5B39A 1S7UB 3L3GA 3SBWA 4NT6A 2A0LC 3ROLB 1S3KH 1PDKA 2GJ6D 4O2EA 2YD7A 1R0AL 2C9AA 4OFPA 1SY6L 2VLKE 5HYSB 5ETUA 3FAWA 3L3KB 4NKOB 3PF2A 2EE6A 4MD5A 1PSKH 5FCUL 2HT3D 2PO6B 2ADJB 1KENL 3D85A 1PKQE 2EDNA 4MXWL 2R39A 5HI4C 2YRZA 1NGYA 3KJ4C 4GAJH 1EV2E 3P4OB 1NDGA 4ZUUB 4ZOBA 5E5MA 5ACMA 5AD0A 4I3RH 1YEKH 3X14B 1S7SB 3AAZA 4FQJH 5FB8A 3W2DH 4X5WB 1NAKL 4CADA 1W0VB 1FCCA 3RWJB 3HRZB 2NW2B 5ID1A 3G5YA 4U4BA 3LQZA 2C3WA 1AD9B 1WBYA 4MHHG 4PTTA 5F1OB 5JW5B 4XZUA 3MYZA 2H3NA 5K33A 5BCAA 1FDLH 1EMTL 3OAZK 5INDB 3O3EA 3F7RA 1I9JH 3VWJB 1W0WB 3C60A 2GTWA 4EI6B 1DBKH 4PV8A 2J8UE 4ZFFB 2W0PA 4Y19B 2FWOB 4GAGH 2VXUH 5DK0B 4ODWA 5IVZA 5FM8A 2Y07L 3SHSA 2F8OA 1JZ8A 2GJ6E 4X6CE 3T65A 5GIRB 3VGFA 1T7VA 4OT1L 3OB0K 1IKNA 4MJ5B 2Q8BL 4LDLB 4M8QB 3GMOB 3NIGF 3TNNA 5DTFA 4E41D 1YEDB 2C7UB 4FNLL 4EDWH 5JXAL 2IWGA 5HY9B 1B0GA 3V7MA 4CVXB 3TJEH 5I1JH 2WWKO 1KC5L 4JKLA 5D1XD 2P8MB 3L5WB 1CGXA 4KI5F 1OP5H 5KS9B 4HUWB 1K2DB 2K7QA 6CGTA 3QHZH 3TO4D 1IGYA 1T0NA 1D9KD 3PQYA 4UIMA 1J8KA 1JN6B 2BZDA 4OGYL 3QCVH 4LPCA 3U46A 2BNRA 4W6XB 2XZAH 2OSLB 3OJDA 1T6VN 1T03H 2EKJA 4F7CA 3EO0A 1D5IL 2L7UA 3HI6H 2J4WH 3TLRA 3IF1B 4Z76B 4QY8A 4JVUA 4LCWD 5C09B 2VC2H 3ULVL 5FK9A 1R5IB 4M93B 4H25B 4QXTA 4LDOB 4BZ1L 1RZ8A 5DQDH 2FATH 4QHUA 3W82A 5CBAA 4W6WB 3SKMA 5H2BB 1OCWH 3QJFB 1T1XB 1ZS8B 4E41E 1JNLL 5F7MC 2D03H 2HRPL 3DUUA 1B0WA 3FQTA 4ZD3H 1MJ8L 4MJIB 4FQXC 5T5NG 2QL1A 1MHCB 5IHBA 3S37H 5HYSG 1MAJA 1GYAA 4ZG1A 1KJ2L 2HJKA 4U1NB 3VXSD 3M17A 1OTSC 3HA0A 5MI0C 3GB7A 4QRRD 4RA0C 3IB4A 3NVQA 2FHCA 4YFLF 3L95A 4NN6C 4JPVL 3GI9L 4QTIH 4X6BA 4P5TC 4PJIA 2MKLC 4PGJA 3BE1L 1U95A 4R97C 4RDQF 4M6NH 4LLYB 5I0DA 2E7LA 5BVPL 3AUVA 5ECJE 4PRBB 1DBBL 3SDAB 1NMAL 3MA9L 3WJLA 5HPMB 4LCWE 2Y5TA 4P49A 1DVFD 2JB6A 1KTRL 4ODHL 4M7LH 2QHRL 5C1MB 1A8JH 1J8HB 1GGCH 2BVOB 4F7TB 2OTUB 2QR0B 2UY6A 2VXVH 3SQOL 1YEGL 5D93B 5EPMB 3VFGL 1EHAA 2HT4D 5ALBL 1DCLA 3GNMH 5EU4B 4L4JA 3D3VA 3I6KB 1YYLH 3ZTNL 3VXSE 2MQ3A 1TXKA 2Z31A 3PGCB 3KPTA 1FGVH 4FQPA 4QRRE 3VJ6B 1UB6B 3VXUB 5GS2H 3SDXA 4MAUH 1UH4A 3WNPA 4FMKA 2IJ0C 3ZDYF 2UWEA 3ARYA 1RIHL 1YN6B 2R0WL 1XIWA 1OGAD 3GMMB 4Q9BA 4U6YA 2CUIA 3PGFL 1YMMA 3W0WA 2F54D 3QUZA 2FHBA 1J0YA 2GSIB 1F4HA 1M05B 1TETH 2VDRL 4NNPL 1AO7B 2V6HA 4XCNB 2DQGH 1T1ZB 4PRAA 2IGFH 1YN7A 2Y23A 3MLRH 3EO9H 2XRAH 5ACZA 3GJFA 3HE7A 4QGTA 1B0RA 2ZKHL 3UCRA 1QLFA 1CDBA 5GS0L 1U8NA 3DV6A 1IGJA 3RVXC 1GOHA 2PKDA 1KJMB 3DVNB 1TQBC 3PG2A 4F9LC 5CP3H 4G6FB 2V5RA 1GAFH 5J9PB 3IKCA 4LQ1A 4JM2A 3QQ9D 3FN0L 3B6SB 4Y16D 4LIQH 2Y36L 5IFHH 1RZIB 4BA8A 5DQJA 3RIFF 3T0EA 2HLFD 1H3TA 2LQRA 4GUPB 4OLVH 4LPYA 1VADB 2BNUB 4XNZB 2A74B 3KR3H 5HHXH 2DQCH 1S8DB 3SKJL 4P4KC 1EK3A 1SYVA 3TZVD 1OGAE 1F4XH 4DN3L 1KUMA 4UTAH 3UDWA 3DRQA 3S3JA 2F54E 3HR6A 3CLEL 5DVLA 3H8NA 3MV8B 1QFUH 5EG6C 3V4VL 1E6JH 4TVSa 4EUPH 4HKXB 3U4EA 3IFOA 5TE6L 4ZAKD 1Z5LA 5IHUL 3FFDA 4EXPX 4M1GH 3MBED 4F7EA 5DRZB 3QFJB 1PW3A 1JPTH 1HHJA 4PV9A 3RGVB 1BREA 3KLSA 4LARL 1MUJA 1FVDA 2RFXA 2NTFB 4QF1A 2YPVH 3OJVC 2VUYA 3S3PA 2GI7A 4I2XA 3I2CH 4I5BB 1BBJB 2DI7A 4ONHA 5I8OL 5KSBB 1B6UA 2F53D 1FLRL 1YY8B 5HHQB 1G6RL 4YC2B 3FONA 3OKMA 3G04A 3NCJH 1YPZF 3MUY1 2NYYD 4WU7A 5CEXB 5EDXA 5HI3D 1RZGA 3MRGA 1HHKA 5D72L 4GRLA 1G84A 1KB5A 2IG2H 3GSNB 4Y2OA 4HWUA 1GHFL 3CK0L 1JZ4A 1GL4B 4JY5H 4AEFA 5D1XC 3TWCL 1I8MA 5C92A 1UCBL 4QKXB 4GXVH 5F7NC 3VXMD 3SPVA 3SGKA 1HCVA 5LBSH 2R4RL 1JV5A 1MFAH 1I9EA 1J0KA 4EQ2A 2EDHA 5B39B 3MA7B 3MBXH 3QR2A 5IESL 5IR1A 1ZHLA 3OMZA 4DW2H 1BLNA 3OG4B 4TSAL 1S7WB 3ARED 2ESVA 3LHPH 1J05A 5I1LA 5ETUB 1GGIL 4W4OC 2D4DA 5DJDB 4Y5YB 4NQVA 4KZDL 1U8OA 3ILQD 2F53E 2FH8A 2EDTA 2B0SH 4HUNB 3RP1A 4EXKA 4Z7UF 1RIUL 4PJFE 5DMIL 4UOW1 5E5MB 1KCSL 2BVQA 1UENA 5FB8B 1UM4L 3BKYL 3WS6A 3MGTB 4IJ3C 4JDVA 1CFBA 5ID1B 4ONGH 3I6LD 3HAEB 1QBML 3VXME 3HG1E 1BZ7B 4WIQA 2W60A 3QIBB 5D9SB 1D7FA 1S9VA 6FABL 4KDVA 3ZKND 3MCKB 4U1LA 4X9FA 1V5JA 4J1UB 2YR3A 1HSAA 3P30L 1VSCA 2MPAH 5F7HA 3LMJL 3V5HA 4G8IB 1DVFC 3U7AA 1OAXH 2APTA 3TV3L 1UVQB 3GM8A 3EYOA 4M61A 2UY7A 3OAZH 1Q1JL 1XAUA 3TNNB 2HWZL 1TJGH 4IMLA 2QQKH 4Y4KC 2C5DC 4NZDA 5FDYA 3K46A 2A77L 3LDBB 1T1YB 3WNLA 4DGYL 4N9GA 1KCUH 1D6VL 1LP9B 2CO7B 3OB0H 1KACB 1YMHB 3MV7D 1K4CB 2VDMH 5BV7L 2CK0L 4O2FA 2E6QA 2PW2A 3AXLA 3EDEA 1I9IL 1S78D 5D7IB 2XV6B 3I6LE 3NN8B 4O4YL 3BGAA 1UZ6F 5DD3L 1X7QB 5FHAL 1WCBB 5JW4M 4P57B 4MAYB 3OJDB 1T5WB 1ZLWK 4JHAH 3EO0B 5F88B 3OL2A 4YHKL 4XP9H 1CL7L 3PJSA 2XZQH 4J3OC 4P3CL 1F90H 2OL3L 2W59A 4FXLA 3H6JA 5I19H 2GITA 5T1DH 1L7TL 5FK9B 1JPFB 3I3DA 4YXLL 5EU6D 5C8JA 4HPOH 3DSFH 3TM6A 5T5NF 2BVUA 4NHCH 4G9FA 3B9KC 5GGTA 4IIQA 5F3BA 4MNHA 3S4SB 2BVTA 5B39G 5C0EB 1JZ6A 2F5BH 3J8F7 3L5HA 3C09C 4OZGF 2ERJB 4R4NC 2EDFA 5E6IB 2GSGB 4KAQL 1HEZA 1FIGL 5L9DL 4XX1E 1D5ZA 3WIIH 3UXFA 3M17B 5HDBE 5HDQL 1JGUL 3T0DA 1CZ8L 3MV7E 1EPFA 5CCKL 4GKZB 3K7UA 1PG7W 2HLFC 4QCIA 3QUMA 5SWZA 1I7RA 1KXQE 2EC9T 1E4WH 3UZEA 3VI4F 2NLJA 2RBLA 3FO2B 4PJIB 2BSSA 4K9EH 1U95B 1OWRM 3P4MB 4XHQA 1WCQA 3LSOB 1CE6B 1S5HB 3OB8A 4S1QL 5FYJD 1WTGT 3TVMB 4KJPD 4X83A 3FQNA 3EDKA 3RWHB 4RGND 1RQ5A 2DBLL 1TJHL 4J3XA 3O3DA 3SO3B 1IC4L 2AABH 4J23A 5EU6E 43CAA 4ZAKC 1K5NB 2FJFA 2FX9H 3FB7A 4UOW0 4WEBL 3VFRB 4HFUH 1X4XA 4LVHB 3MBEC 5T3ZD 1IAKA 1O7SA 4KY1L 1LVEA 3KLAA 1WAAA 4HS8L 4G6JH 1H8SA 4OAWA 2YD3A 3FFCB 4Z7NE 1N4XL 4XP1H 4H20H 5F7FA 1CFNB 4PJ8A 4KKLC 1JPGB 3EJYC 5CEZH 3QPQD 1S9XA 2IAMB 3I85A 5HJ3B 2IADA 2YMXH 4RCAA 4OKVA 3SDXB 4HMDA 4L29A 5CJOH 5HYQB 1UH2A 3F7VB 5HI3C 1KFAL 5DRXA 5BRZA 5ISZE 5A1AA 4LVNC 1J1OL 1XGYL 1KJ2B 1TLKA 1A7OH 3E3QE 4NM4L 1YMMB 4PJBB 3ARFB 1MRDL 3DV4B 2LTQB 4KU1A 1RIVL 4LFHD 2WZPD 2GY7B 3HNVH 3SCMA 1MCDA 1QBAA 4R7DB 4LSQH 4RGNE 1NLBH 4JG0L 4XPHL 4WEMB 3MCLL 2O5ZH 4LLUA 1KIRB 2JJTC 1I3GL 3HE7B 4XCEB 3PHQB 3AFLA 5BZWB 3ARPA 4HWBL 3OR7B 3T4YA 3TBWA 3WD5L 5L6YL 4JFYA 1UJTA 4JCLA 3GO1H 2X1WL 5T3ZE 4CNIA 5GSVB 4Z7QE 4K2UH 3VFMB 4XRCB 4BFGA 1D5XA 1G7QA 1Q0XH 1HE7A 2VERN 5CLTA 5E2TH 4CJ1A 1G9NC 2OI9C 3EFFA 4JLRA 3S4SG 5DQJB 5BW7C 2NY3D 4LRNL 1I3RA 3AS0A 3ILPB 3FJTA 4HIJA 4P3WA 2FD6H 3OKLB 1H0DA 2JCCE 1NGQH 3RL2A 3I9GH 1JGDA 1AIFA 4XNUH 4PJ9C 5FYJU 5I1CH 3BQUB 5FKAA 3L1OL 3REWA 1RHFA 1V7ML 2HG5B 3QEGH 3SO5A 4IHOA 4NDMB 2QQLL 2DM2A 4XMLH 5EU3B 1AGBB 1MCFA 3QNXB 1KNOB 3ARUA 4WW1A 2E9WA 1XGTA 1A4JB 1K6QL 2EDXA 4KQ4L 2ZCLH 1UXWA 2EDEA 2IEPA 3FFDB 1DQJB 5I15H 2P8PA 3W81A 3LQAC 4PV9B 1EBPA 2Q7YA 1LK3H 1L0QA 1DSFL 3GUTB 3TPUA 5EUOE 4ZFZA 1DQTA 4I2XB 3PL6D 3WHXA 5BXFA 1P9MA 1EGJL 3GIZH 3B3IA 5GRXG 3QQ3A 5DD0L 5I76B 4YDIL 1S7RA 4GRLB 2IALB 4R4FH 4CAGA 1MCCA 2JJWA 1KB5B 3MLUH 2A9NL 1DR9A 4HKBA 1BAFL 2MQCA 3QI9B 4NC1C 1XGUA 2NXYB 4KVCH 1QFHA 2EE9A 5I1IL 3LZFH 4K3JH 5IFJA 1IEAB 1CFQB 4PYHA 1S78C 3SPVB 5DS8B 4NNXB 3S7GA 4Y5XC 1CU4L 1JV5B 1MCHA 1FL3A 3JVGA 3QFDA 3U7YH 4OFKA 3RVWC 4XBGA 1RPQA 3VXNA 4WI8A 3RTQB 4JFXA 2XZCH 5F9WC 2WBJC 2ADFH 3V7AG 3OPZL 1P7KA 5D7JA 5GPRA 4HJ0C 1J05B 2BC4B 4I9WD 3F65A 2DBJA 4NQVB 1IT9H 3RDTA 4BSWB 3KPSB 4PPTA 3MUGB 4L4TA 2DQEH 3SJVA 5I6XB 1FL5A 2WV3A 4B0MM 4IRSA 1G6RB 2WQ8A 1DQLH 3GMQB 4LHUB 4QRTB 5DUML 1B4JL 5EO1A 3SDCA 1KEML 1O5DT 4RFEA 2D4FA 1IGMH 3DMMA 4M9PA 3WJJC 2HVJB 4N8PA 4C83B 1FE8L 1GH7A 1XF4B 1DL7H 5LGHL 1IILE 4O02L 4JY4B 4WI5A 3VD3A 2CLVB 3KXFA 3MJ8B 4JN2A 1ZT4A 5J11C 3KPQB 4U3HA 1CTNA 5E8PB 1RZKL 1HQRA 2BNQB 2UZYB 3DIFA 2DDQH 3LPGA 4XNYH 2E7MA 5IW6A 3EYOB 4HDIA 1FC2D 2BFVL 4I9WE 3ES6A 3MRFB 4LQFH 4QNPF 4OZHF 3DURB 5DJCA 1SYSA 1FVEA 3N0PB 4LNRA 5C9JA 2AJUL 2EH7L 2O5YL 4KRPB 1UZ8B 3L7EA 1JFQH 3PWVA 5EU7E 3BPCA 4POYA 3IAPA 5C6TL 2HLAB 4M03A 4XHJD 4BK5A 4NSKB 5JDJA 1AQKH 3PWNA 5I18L 3QPQC 3HAEH 4H5SA 5CEYA 2DQDH 4NO0D 4ETQB 1LDPL 1KBGL 4GKOA 4MXVF 2NXZC 4YBHA 3MO1A 2WLYA 3INUH 2H32A 1C08A 3BWUC 4JFPB 1MVUA 4YDJA 1NFKA 4ZUTB 3CZFA 1TJIL 2CIIB 3VMPA 1OB1A 4JREB 5BZDB 4JFDA 2ADIB 3C08H 2J5LC 4GO6B 3OKOB 3BP7A 4MZ2A 4WHYH 4ELMA 1N2RB 4NWUL 5DI8A 3U1SL 5DVMA 2OMNA 3VGBA 1CLZH 3KPMA 2P8LB 1K9TA 5E2UH 5CGMA 3H9HB 3UTZA 1ZLWH 5FOJA 5J1SC 5DHXB 3B5HA 2OYPA 5SWSE 3ZTJH 1SY6H 3MRPB 1IM3A 2CPCA 3RKDD 4XAWL 3HR5B 3SY0B 3S9DB 5FCUH 4GLRH 4HS6B 4JO3L 1KENH 4XVUD 4MXWH 4HCRL 4OTXL 3MTRA 1GVIA 1Q9OA 2GAZA 4FFYL 4JZOB 5IQ7L 3O6ML 2NY3C 5K9OA 1LE9A 3MROB 3RBSA 3PV6A 4R2GB 5DVOA 7FABL 2G5BA 1NAKH 3VXRD 3VFVA 4OIAA 3WO4C 5BV7B 2C1OA 5MHSE 4TTGA 3UTSD 3FQNB 3P9MB 3RX8A 3OJ2C 2W9EL 1EMTH 1LHZA 2A9MH 4MB5A 5ACLA 2VDNL 4F9PA 1FFNA 5CHNB 3K8MA 3NZHL 3G9VA 1MI5B 4R0LC 2HN7A 1G9MC 3WIFB 3S88L 3FB7B 3PXHA 3QWOA 5DMKB 5EBMA 3AU1A 2OL3B 3L3JA 4F37F 2EYSA 4J3UA 4OCYL 1IAKB 4MA1B 2QKIB 1U3ZA 2R23B 1J11A 4NQSB 5SX5K 3TYFA 4OT1H 1IM9D 4GW5B 4FQXA 5L2JB 2Q8BH 2XWBA 3UZQA 4HZAA 4PJ8B 2F8VA 5TGBB 5IJVB 4FNLH 4X6EA 1IZJA 2IADB 1TCRA 4HD9A 4OKVB 3P0YL 2OLDA 4Z7VE 3I75B 3PNWA 3VFWB 3DETD 4P5TA 4YFLI 5AYUL 4CN6A 4XWOC 1DE4A 3QNZB 1I7ZA 3VXRE 3IDNA 4N0RA 1CLYL 4NZUL 3OAYK 4HPYL 4ZUVB 1ADQA 4Z18A 2H26A 5J89A 4R96B 2VR9A 4NQDA 5F70A 4E5XB 1D5IH 2X5PA 3MLXL 3SOBL 1QUNA 3CFDA 3MJ7A 4Z9KB 5DJ2A 1RURL 5CKAA 1I75A 2AXHA 2FX8L 4NCDA 5C0RL 5KVEL 3ULVH 1UWEL 5DJ6B 1P4LB 4BZ1H 1FO0L 1BM3L 3MRQA 1UGNA 1Z6JT 4Y7MA 2VLKA 4KMTL 1JWSA 3F62A 4PJEB 2QSCL 1JNLH 2MHAA 4CMHC 2HRPH 3EFFB 1MJ8H 3QDAA 4UQ3A 4CKVX 1PKQA 2E7CA 4BUGA 5FM4A 4RMRA 1N6QL 1I1RA 3Q0HA 1BZ9B 3HPLB 1KV3A 3U0TB 1KJ2H 3EGSB 4K7FB 1W0YT 1R5VB 1FP5A 5EU7C 5I1GL 3QBTB 1JGDB 2D7NA 4PJIF 1CGSL 5J13C 5DURD 2D7MA 4MGXA 4JPVH 3GI9H 3BH8B 3IGAA 4OZFB 3REWB 1U92A 3GIVA 3BE1H 1G7MA 4QRUB 4N5ED 2IBZY 4UT7L 2ZCHL 4MX7B 5BVPH 3RAJL 2NY4C 1NMAH 3MA9H 4IS6A 3QRFM 2P8PB 4BZYA 2J8UA 4ODHH 3D39D 4F9LA 5TPWH 4GKNB 1A02N 4MMXC 5IB5B 3S5LA 2P7TB 2GJ6A 1TMCB 4X6CA 3AC0A 1E4XL 2AEQL 5IIEA 3WHXB 1A6VL 2ZUYA 3SQOH 1YEGH 3MNVB 2X4QB 3VFGH 3VD5A 4KQ3L 3U2SA 4PR5B 3DVGA 4JKKA 5ALBH 1BJ8A 1S7RB 3ZE0F 4LF3A 4M7ZB 3SDXF 1U8IA 1QQDA 3GMLA 3ZTNH 1CL7I 2UWEF 4IDJL 5SX4I 1I3VA 4G5ZL 4X5XB 4I0PD 3NZ8B 5FO9B 2P24B 2XQYK 4PJBF 5F6HI 1BVLA 1JHKL 3SKNB 1J0ZA 1RIHH 2R0WH 5JTWA 1BQHB 4JFOB 5E6ZA 4YHYB 4FRWA 3TBVB 3PGFH 1FL3B 1RZJL 3IJSA 4HHAA 5D5ME 4LLWA 4Y4HD 2JJVA 4PGCA 1V8HA 5GGQL 5DJYA 1EAPA 3FKUS 1WVZA 4NZJA 3G6AB 5IBLD 2V5MA 4HGKC 3O2DA 2ZKHH 2V2TB 1Y18A 1FVCB 1HHGB 3V95A 5GS0H 2AEPL 4KKNA 4J12A 2QADC 4JM2F 3IFLH 3WN5C 1OF2B 2VLRD 2EDRA 1CT8A 1AXSB 5D4QA 4XCCH 4CGTA 1KIPA 1JL8A 2DYPD 3FN0H 4FQLL 3R0MA 4L4TB 3THML 2KQNA 3QDGD 2HJLB 2HTKC 1S7TA 3RKDC 1T7XA 2Y36H 5E4EC 1E4JA 4X8JB 1FL5B 4XP4L 1TVBA 3A6CL 3IS1X 5F6IB 1FGNL 1ZTXH 2NZ9C 4BKLA 5D1XA 2K7PA 4HGWB 4FTVB 5EO1B 3SDCB 3SKJH 5IB4A 3C5ZD 4G8GD 3TO4A 1Q9KA 5I66B 5AUMB 4MNGE 1D9KA 4FABL 5JXEC 2P43B 2NY7L 3O3AB 1CFTA 3WUWB 5E00B 3CLEH 5GRWA 3V4VH 5IV2B 3O3BA 5TF0A 4OZFG 4UDUA 5EB9A 2H6PA 4JDTL 4LCWA 4CDHA 5TE6H 3TT3H 1GOFA 1HQRB 5IHUH 3H3PL 3WFHA 4HMCA 5CZXC 4I8DA 1HNGA 3ZDXE 4WFGD 5J1AA 4W4OA 2VLRE 4LARH 3ES6B 5B38A 3BX7C 5A43C 3BMWA 1EDQA 1TQCB 5J3HC 2Q86B 3C6LD 5GSRA 1JK8B 5GHWL 3FHQA 1UXSA 1NKRA 3B43A 3QDGE 5B8CA 5I8OH 4E42B 3W9EB 3R8QA 1FLRH 3TN0B 1G6RH 4WWKB 4ALAL 3QZWB 1A0QL 2A1WL 3QO1B 3E1F1 3NCYP 2AJYL 3VXSA 5D72H 1J9CT 3X12B 1Z9MA 2XICA 5CEYB 1NDMA 4QRRA 2YPLD 4G8GE 1GHFH 4ZUWA 3FTGA 3CK0H 4JRXA 4O51B 3MO1B 4XWGL 3STZA 5C71A 2I60L 3TWCH 1G7PA 4XNQA 5IW1A 1UCBH 2IPTL 3HMXL 1U3HC 4PTUB 4GRMB 4JFDB 3MRRB 1P6AB 1FJ1A 1PGRB 1QYGH 1BQHG 4XTRC 2D7TH 5DI8B 1DTUA 1DVFA 5JR1L 3CH1B 4WI3A 3KPMB 3HE6D 5I1EL 5IESH 3OGCB 3VGGA 4TSAH 2QV2A 4YHOL 3FRUB 5D2NC 3ALXA 4Y4KA 3ZYJA 1IGCL 1LO4L 3D25B 1GGIH 4PJGE 3WFBL 1I7TA 2EYRB 4MDJB 1UJ3A 3FQWA 3T0VA 2WIMA 1Q9OB 4UT6L 4PGDA 32C2A 5GS2D 1RIUH 3QHFL 1M71B 1FNLA 5C0DB 3SDDD 1KCSH 3PV6B 2YPLE 4XVJL 1Z9SA 1UM4H 3BKYH 2CR6A 5E7BA 1L0XA 1FAKT 4GFTB 1OGAA 3G5ZB 5HHOD 3VI3E 5E2JA 1QBMH 3RI5F 3CVHA 5F7YC 1G7JA 2F54A 3CCHA 5E6YA 3IS0X 5C0AE 2FO4A 3U30B 6FABH 1FFNB 2ICWJ 4JFZL 5FGRA 2P42B 2DIAA 3WUWG 4CUCA 3D0LA 3B9KA 5K9KB 3P30H 3O9WC 5I74B 5F96L 5H35B 3LMJH 4OD3H 1QKZL 1UFUA 2OZ4L 1IGFL 5KANI 3TV3H 4NQED 2BY0A 4NGHL 4GT7A 4HKJB 1R24B 2Y6SC 1BD2B 2XWBB 1A21A 1Q1JH 2YC1B 1U9KA 1UQSB 3LS4L 2HWZH 4Y16A 1J5OH 5IROA 4WUKL 2IBZX 2A77H 2DQFA 3CMOL 4DGYH 3QEQB 1M6OA 1JP5A 3OKDB 4AK1A 3PHOB 2P5WD 3SGEH 1D6VH 3V6FA 1FPTL 2VAJA 5SX5H 3S36X 1PG7X 5DQ9A 5BV7H 1INDL 1MCIA 3IDNB 2CK0H 3QZWG 1I9IH 2OP4L 5HHOE 4HFWA 4MNQD 1F4WL 1ZT1A 2WWKT 2JK5A 4O4YH 4I0PC 4IRZL 5DD3H 4P46B 4JDZB 2VXTL 3E6FB 1BBDL 5C08D 4RAUB 3ARZA 4MZ3A 2XTJE 4U6HB 3KGRA 1CL7H 4P3CH 1T89C 3FQUA 2OL3H 4ZAKA 3CIQA 2XYCA 4WW2B 4KFZC 3QUKA 5AZEL 3MBEA 3OAYH 1IEBA 1NAMA 3PDOB 3MACL 4NQEE 5IBLC 3VD7A 5T1MA 1HWGB 1H3VA 4ZFOA 1PVHA 4R3SA 3T0BA 1R3IH 1NFIA 4XPFL 4LIQE 4UQ3B 3UPAA 2F53A 2YSSB 4D3CL 2DWEA 2H1PL 4KAQH 5L9DH 1NH6A 1E27B 2A38A 3TBTB 1SJHB 5HDQH 1JGUH 4DKEL 1CZ8H 3I3EA 3O41A 3FT4A 1PZUB 1I8IB 4JO1L 3MRKA 4G8EA 1OARH 4MNQE 3IGAB 3CZJA 3DRTA 3GI8L 1G7MB 1NJ9A 1A6WH 2V5SA 4WHTA 3VXMA 4EIZC 3HG1A 4YDLB 2JJTA 3L7FA 4S1QH 1XZ0A 4O2CB 1ROWA 4D9LL 2DBLH 4IEFB 5C70A 4MLSA 3CC5A 2CIKB 2AEWA 1JNHA 4PJAE 1BFSA 4JFHD 4F3FB 1WAAF 1MEXL 4WEBH 4XB7A 1Q9LA 2VN7A 5IB2A 2R1WB 4X6CB 4DZBA 5IWLC 3O8XC 4WI4A 5DT1L 4M48L 4KY1H 1CD9B 4HS8H 2GJZB 3LV3A 1OT2A 1EO5A 1ZEAL 5BW7A 2YHGA 3DVGB 3NAAH 1N4XH 4A2MA 3D69A 1BVKB 1FO0B 2EDWA 5D6DC 4LF3B 1KPUB 3PIQB 1U8IB 1FZJB 4FG6C 4NM8L 4X6FA 1QQDB 4KRLB 5FGCB 5JQ6L 5CBEA 2FJHB 1ETZB 2N4IA 1F2XK 1KSRA 4UU9B 4OZFH 4ZXBB 3CU1A 4X4ME 4C4KT 4XT1C 5JNYA 1G0YR 3C5JA 4ZO8A 5DFWH 5JORA 4PJ9A 1W8OA 2IFFH 3UTTD 4CMMB 4KTEL 1RK0A 1JI1A 1J1OH 4JJ5A 3QQ4B 1XGYH 4XP6L 4NM4H 3E6HB 3ULUL 1RZ7H 1YEHL 1MRDH 4G6AD 1CD1A 3IJSB 4K94L 1RIVH 4YIQA 1HXMB 4HS3B 3MRNA 2ICWB 1F6AB 4JG0H 4XPHH 3I84A 4YZFE 5B4MC 3EYFA 4U49A 1K8DB 1I3GH 4OIIL 5C0FB 3QWQB 3HB3C 4JFHE 3MOQA 4HWBH 3WD5H 4U1SA 3MSPA 1I85C 4HUUA 1HOCB 5L6YH 2YXMA 3MJ9L 2PO6D 2MCPL 5CP7A 4CBPA 3HE6C 4C55A 5DHYA 3VGAB 4E41B 1DN0B 1CIUA 2AXJA 3DGGA 5CD5D 5KVGL 4OBRA 2W07A 1UYWL 2BY1A 1R3LB 4LRNH 3MOBL 4FQCL 5FO8A 2Z8RA 2B7DT 4I3SL 4BKLB 5C6PB 5L0QC 1VEMA 1BQLH 3MV7A 2PTVA 1AI1L 3UTTE 3TO4B 1LO5A 3RHWK 5FYJL 1DLFL 5CJXA 3SDDC 4PP2A 1NKOA 2AJXL 3VWJD 5CWSB 1HIML 4Y5XA 2BHZA 4Y2DD 1GSMA 4Y19D 4LSRL 1V7MH 4HIEB 3QYCA 2QQLH 1YEIH 3BGMB 1I1FA 1EO8L 2WBJA 3K1DA 4OGAD 2JIXD 3WDJA 5I9QC 4KQ4H 5AEAA 3DXAD 1UACL 2FSEA 2XTJC 5EU6A 1HXYB 3KPRB 5J1AB 1YNLL 1QVOA 2NY6D 3IDIA 3T1FA 3VD4A 4HUMB 4APQC 4HIXL 3MRJB 3P73A 1F6FB 1DSFH 4L3AA 3B2UD 2Q87A 1U8KA 2FEDD 4Y88A 2EDYA 2OK0H 4J4PC 3DOSA 1MFNA 4FQQA 3DO7B 3S5LG 1QRNA 1PJ9A 2R2HA 2XOTA 4KV5E 3IDUA 1X5AA 2R4SH 4ZOAA 4QT5B 3M8OL 1IL1B 4P2OC 3VXSB 3T3PF 4LCUA 3HLAA 3IXTB 3WBDA 2A9NH 1BAFH 5CAYB 4GW4A 2CGRL 4M3KB 1P5VA 3WJJA 1K8IB 3C8HA 4Y8DC 4XCFL 4YBLB 3STZB 4D8PB 5ISZA 4HKZB 4XNQB 2C1PA 2VLLA 4Y19E 3L3OB 1DUYA 3QUML 3EOBB 4AIZA 1FJ1B 1RJYA 5F93C 4HQQL 1M7XA 4HK0A 4I77H 2APVA 3RWGA 4RWYL 3BIKB 1AFVL 2CR3A 4Q6YA 1R3HA 3DXAE 4P9MH 1HHHA 4MDIB 3EOAA 2I9LB 3GK8L 1EFQA 3C5SA 5EO9A 3BP4A 3OPZH 4MJID 3FQRA 3QG7L 4J3WA 2WINA 2DIJA 2IPUK 5DR5H 2X41A 3NA4A 3U4AA 4LLMA 1CGVA 3VFPB 1UJ3B 3FQWB 5KS9E 3BPOC 5CEZD 3BHBB 1QLEL 4FQ2H 4PRDB 4PGDB 4R6UA 1LO0L 3UYOD 4X0KA 2VKWA 5E8OB 1JGEA 3S37X 5A16A 4LEXL 3VRLF 2EDKA 1X5LA 2JCCA 2V7HB 3ZZ1A 5DUMH 5DRNA 1B4JH 3SDAD 1MHPH 1KOAA 1KEMH 3RBGA 1T3FA 2BOBA 5C09E 1Q72L 3CCHB 3MV01 1PQZA 5FM5M 3KYNA 3RY6C 5LGHH 1G0DA 1J8HD 1JCKA 1E4XI 1LQSR 4JE4B 1R6VA 4O02H 4LGSB 5TDOA 5JPNA 1J1PH 4HEME 5HHPB 1KXTB 1G7HB 1GZQA 1N3NB 3L9RB 2AJSL 5DEGB 1AQDB 2AAVA 4UUJA 4LSVH 5GRYA 4MJIE 3RU8H 3WFEH 1E0OB 4HLJA 2W9DL 4M1DL 5EUOA 1ZSDB 2BFVH 3RJQB 5KSVB 1CFVH 5EUKB 1ZLVK 5SV4A 3VXUD 4Y16B 2I07A 5D96C 2AJUH 1IC5L 1FFRA 3QXTA 1CLCA 2O5YH 3C8KA 4PS4L 3QIWB 4KROC 3BRGC 3IAGC 4NCC2 2DIBA 3VH8A 1IC7L 3S97C 4XXCC 5C6TH 4EVNB 3N9GL 4WWID 5A2JH 2KUTA 5C3LD 1LDSA 1PKOA 3NCYS 3TZVB 1WUNT 4DUWA 2Q3AA 1Z9OA 2PCPB 1KBGH 3PWJB 1F45A 4PJCB 2VR5A 4XPAL 1I3UA 4MB3A 1J8HE 4ELMF 1TJIH 1U3YA 1X5GA 1GGYA 3OZ9L 4R0LA 4WV1A 3VW3L 4UT9H 4G6AC 4DN4L 1IE5A 4G6FD 2CDGB 2A6JB 4YEEA 4QHKI 5GGVL 4AL8H 5H94B 4NWUH 1NAMB 1JHLH 4GS7B 3RWEB 3U1SH 4NKDB 3H9YA 4HBCL 3CVIH 3L3HA 5DZLA 1WZ1H 4KJQC 2OM5A 2YRLA 2MMXA 2VZ3A 4R3SB 3BOVA 2Z91B 1QEWA 2ORBL 4H1LB 4LVOB 1YQVL 4AT6B 2PO6C 3PL6A 3VXUE 5J6GB 4MWFA 3RVTD 2BSRA 4F2MB 4G7YL 5SWQA 4JO3H 5TF1H 3JV6A 1RHHB 5GGUA 4HCRH 3BAEL 4N0FA 4OTXH 4PJFB 4NUGL 3S8WA 5EOCL 2G9HB 5CD5C 2CDFB 3O41B 1V3JA 5IQ7H 3O6MH 3JWOL 1U93A 2PW1A 4NC2B 3MV8D 3HZVA 4ZFGL 3KHOA 1BPVA 5IMKA 7FABH 3BUTA 2APBA 4L1HA 5I0ZA 3B5TA 3DRTB 1BX2B 1GC1H 4L3ED 3VXMB 1J0HA 1U8LA 5EC2A 4UNVA 1J10A 2V5YA 3QFJD 3VWJC 4OI8A 1TVDA 3RGVD 2Q1EA 3LN9A 4IBLT 4Z7OF 4UNTA 2W9EH 2VDNH 2AVGA 5EZIL 4UTBL 3WS3A 3NZHH 5FOBB 3ECBA 3F7QA 3S88H 5ANMA 5IB2B 5GJTL 3AREB 2DM3A 3LEVL 2YBRB 4OCYH 1GZPA 3E8UH 1HH6A 3AS1A 1FNAA 2OMBA 3MRHA 2FEDC 5IVXB 1UB5A 2D0HA 4ZNEE 1NFDE 1MCPH 5C0JB 5ENWB 4S1SH 1V3KA 1TTUA 4OCWL 1NCDH 1L4IA 3FB8A 1FNFA 3P0YH 5HPOA 3MV8E 3OHXA 1MQKL 1F4AA 5AYUH 1YY9C 1C5DB 4X4YA 4KJYA 4RBPK 1IAOB 1CLYH 1Z3GL 4NZUH 4MCZB 4L3EE 4HPYH 4RMUA 3O6LL 4K9EC 3QFJE 1MCKA 3P40A 1XF5B 1N59A 4D0DB 3LKQB 3QWRD 3GMNA 4C54A 4RGMB 3MLXH 3SOBH 4M93C 4I1NB 3TA3D 3T8XA 3I02A 4MCYA 4U1SB 4IM8A 1RURH 1BJMA 5KSBE 4RFNB 5C0RH 2FX8H 5KVEH 4J7RA 1ZT7A 3BDYL 5DK2A 1JYWA 2KBGA 3VE0A 4B7LA 2Y5EA 3CX5J 1FO0H 1BM3H 3LQMA 1N8ZB 5A2LH 5HHNA 4X98B 3GSVA 5SWSA 1PEZA 4KMTH 4Z95L 2QSCH 4N1EA 2VLJB 5C0IA 4H1LG 2VDKH 4XMPL 5LAXA 2NX5D 4IOFD 4U6VL 5D2LE 3MV7B 4OIBA 1FNGB 2HFEB 4AENA 4ODXA 5I1GH 1N26A 4NO0A 1CGSH 2DOCA 4QHMA 3MQIA 2X70A 2NY2D 1C8PA 1X4YA 3O2WL 3BEWB 3GGWB 3PWPD 1I1FB 4M7JL 4UT7H 2ZCHH 2P5ED 3LKPB 1QSED 2J8UF 3RAJH 2GK0B 1U8JB 4JQXC 3TIDB 3O4LB 3QCUL 3SE3C 4ACPA 3WN5A 1A3LL 3W39B 2YA0A 4X6CF 1CFSB 4NN7B 4U1HA 4WGVB 4YWGL 3T77A 5D93C 1X6LA 3LN4A 1S7VB 1C12A 4LSPL 2YXFA 3TBSB 5DDHA 5K9QI 1E4XH 2AEQH 5E2WH 1A6VH 1AKJA 3LRSA 2HA1A 4KUZL 1WFNA 1VEOA 2NX5E 1WIUA 2VIRB 1IJ9A 4M02A 3VFSB 1WGOA 1JF1A 5DEZA 1P4BL 5KVDL 3HC3L 3QH3B 4MAYD 4Z7VA 5JXEA 4G5ZH 4P9HC 3TT1L 2OTPA 4K8RC 2O5XL 5KSUB 3VXRA 5AZ2H 3IDJA 1JHKH 4EN3B 4N0CC 3PWPE 2VNCA 3GEWB 3VXPB 4OQTA 3CPLB 4ODBD 3BFOA 4HK0B 2P5EE 1QSEE 4BSVB 1RZJH 1JJUA 4BM7A 4RIRB 1Q94B 5GGQH 1ZVYA 3VFTB 2J1KA 5CD3B 4HH9A 4FQHB 4X7SL 4BFBD 3QEHB 2WIIB 4JO4L 1YECL 4ZUSA 2AEPH 2WINB 5E6ID 4NO2A 4YQXL 1A1MA 3ET9F 1IM9A 1LP9E 2GK2A 4I48B 2YD9A 2P47B 5EZJB 4NRZA 1AJ7L 5T33L 4FQLH 5D1ZB 1RI8A 3THMH 4XNZC 5D7IE 1TNNA 4B53A 4XC1L 4XP4H 3ZHLA 3A6CH 3TBYB 1FGNH 3IJYB 3VCLA 4PJHB 3V5KB 2FLBT 5TDPB 3TVMD 3TFKC 2BOBB 1OWWA 4YK4B 1U3HA 3CXHK 4FABH 1MJJA 3DTXA 2NY7H 4YAQA 1IGIL 2HKHL 2Z93B 1JWMA 4XP5L 4E9LA 4DKAA 5LG1A 2H8PA 3AVEA 4NN5B 4R7NA 1Q0YL 3IETA 4X8XA 1JBJA 4C59B 4E0RB 4EI5C 2XKUA 4JDTH 4X7EC 3RGVC 3ULVD 4QEGA 4YXHL 3H3PH 3FFCD 1YEFL 1U58A 1AXIB 1EAJA 1XR9B 2R0LH 5EZLA 5EUOB 1T83C 3ZHKA 3GSRA 1YZZA 1OAQL 2IAMD 1Q38A 4JZJA 1X4ZA 2IANB 5MEOA 4LPTA 4XPBL 5DZNA 2E27L 2COQA 2FECI 5DSCB 5JDSB 3LOWA 3AGVA 3JV5A 3VH8B 1X5XA 4P3DA 1ZHKA 4ALAH 2D9CA 1A0QH 2A1WH 12E8H 4ZMAT 3BZFB 1C7SA 5ITFB 4G9DA 2AJYH 3ARFD 1D5MB 3QXDA 3OBAA 4N1CA 3DYPA 1ZLVH 1REIA 5L8LB 1INEH 3WLBB 4KXZI 5ICZA 3TCLA 3GSQA 1SJEA 4XWGH 2GEEA 4OFVA 1CDGA 2IPTH 3ZT6A 3MLPA 1H3PL 3BN3B 3UTQA 3WNNA 1QG3A 5D5MA 3HC0B 1OPGL 3ZKQD 3O9WA 1A6PA 2BSED 1JMXA 2NQCA 4ZDHA 3ULVE 4HUKB 3VD9A 2YK1L 3FFCE 5JR1H 5FO7A 4KH2A 3L3HB 1NGWA 1CQYA 5I1EH 4BQ8A 1NGZB 4NRYB 2F5AH 2CKBL 1QEWB 4HJJL 2I9TB 4YHOH 3V8OA 1IGCH 1LO4H 3ALWA 4N8VB 4ZS7L 5T1LD 4G8FA 4MSWA 3C9NB 4YHIA 3JV6B 2FGWL 5IEHA 3QCVL 4UT6H 4WI6A 3P9LA 4PJ5D 5F89A 3QHFH 2PW1B 3HZVB 2DM4A 3CFKA 3KPOB 1ZHNB 3RIAF 3M45A 3HZMA 4I0PA 3V7AE 1KIQA 3U48A 1QHPA 4JY6B 3CDGA 2Y7QA 3QULA 4RSVA 3QIBC 4MNGA 1U8LB 5J06A 5BO1H 4LVEA 1LNUA 4GG8A 5DQDL 1T89A 2CKNA 5TQ0L 1MHHB 4Y4HA 2PYFA 3OR6B 1OCWL 3RWIA 4OV6F 3IJHA 2JE8A 1BOYA 1G7LB 4LFHG 3WS3B 4N9OB 4K3DH 3JV4A 2D03L 1AD0B 5DD6B 5I1DB 5GS0D 3FL7A 1RAMA 4H1LH 3ZLQC 4YHNB 3BW9A 5F96H 3OSKA 1QKZH 2OZ4H 4A6YL 2R0ZL 3DX7A 2VLRA 4XC3L 4FFVD 3LDBC 3EO1A 1P7QD 2DYPA 1ZA6B 4F80A 3LS4H 5CMAA 4QHNB 3WFCL 3QDGA 4Y0GA 4KK6D 2DJUA 4WUKH 3ELAT 5F21B 3CMOH 2AV1A 4PJ5E 2CLZB 4M6NL 3OHXB 3IVKB 4DUXA 1FPTH 5DLMH 1QACA 3VH8G 2A6DA 4AG4L 2AV7A 4X4YB 3KWWB 1NBYB 1INDH 3C5ZA 4KJYB 4G8GA 4MAYC 1QFWI 2OP4H 1F4WH 3QDJB 1TTGA 2EKSB 4L8SB 4IRZH 1UEYA 1NBZA 3RTQD 4U05A 3VG9B 1F3DH 2VXTH 3L6FB 4KI5D 1WICA 1BBDH 3X11A 4N0YL 4NFBA 2X89D 2X4UA 3UBXA 3I02B 4OF7A 4WFED 1CYGA 3ULSB 2PTTB 5F7DA 5IWLA 2HH0L