5J56B

Rta-v1c7
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
AQVQLVESGGGLVQPGGSLRLSCVASEFSGFTLDYYAIGWFRQAPGKEREGLSSISSSSDGFTSYSDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAARLGGWASFSPQEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Single Domain Antibodies Bound to a Second Neutralizing Hot Spot on Ricin Toxin's Enzymatic Subunit.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
molecule keywords Ricin
total genus 36
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j56B00
4PB9H 2IEPA 4JKWA 4J4PC 5FF6A 1JZ5A 2AJSH 4LFHD 1HQ4A 3IU3A 3LQZA 1BM3H 5IIEA 1J0HA 3MRPA 1U8OB 5C0BA 2ZCLH 3K46A 3WXWL 5I8CB 1UG9A 2JIXD 2AK4D 2A9NL 1A6WL 5DMYA 4JFED 1UJ3C 4JM2B 4JJ5A 4WU5A 4Q0XH 3K3QA 3DJ9A 2AKRB 5BRZD 4IRSB 1AXIB 5TDOB 3RDTA 3F5WA 4FG6C 1KTKE 4K8RL 2J5LB 4UV4L 5JDSA 5CIPA 5K9QI 5A16B 3MSPA 4OCYH 1GGBL 4NJ9H 5F7MC 5ID1B 2DD8H 3ZT6A 2Y4SA 3MODL 4DGIL 4HZAA 3DVNA 1BIIA 3ULUH 1YPZE 3L95A 2XZZA 5TFSL 3WJJC 2PR4H 5B4MD 4APQB 2HFFA 5GRVL 3KG5A 4R4BA 1OPGH 2FIRT 3F12A 3QIUB 3JTSA 1LEKA 5J7CC 1MEXL 1S9VA 3VGAC 3D85D 1A3RL 3QAZC 5TDNB 1VERA 3IXTA 5F7HA 3V9FA 4WEMB 2AERT 3RKDD 2YZ1A 3W39A 2VZOA 2FX7H 4QRQB 4BQBA 4YZFF 5F6HI 3G6AB 2C4XA 3QFDB 1EEYA 1LK3L 2R9HC 4R3SB 5EUOA 4W4NA 5SWZD 1S7XB 1RIUL 2GCYB 4YPGA 1PSKL 2WLYA 5IFHH 1DBMH 2PYEE 1RZGA 1DE4A 3CFDA 3SGKC 1WIPA 4G6FD 1MFBH 1RJYB 3KAAA 3LD8B 3PL6A 4PP2B 5C1MB 2W9EH 3GMRA 4ZUSB 4DZBA 5GGRY 5EUKB 5J89A 2XACC 1KXQE 3HI1B 4YXLL 3VXME 4M5ZH 4DGVH 1DQQA 4JO3H 4HUWA 1S7WA 4OCWH 4X6FB 4PJ5B 4LHUB 3WKMH 3OR6A 2C1OA 2GTZB 5KVEL 1IGJB 4XXCA 3H9SD 1FGNL 2FZ3A 4YDVB 1S5IL 5IVXB 4OCSL 1I9IL 3F62A 4HJ0C 4XP4L 3HE7C 1AQKH 2XN9B 2R8SL 3SPVB 2FX8L 5TE7H 2VLKD 3OKNA 1NANH 1KPRA 4JO4L 4RA0C 2QR0B 1B4JL 5C09A 3BKMH 1C16B 2PNDA 4ZO8A 2FLRT 5IJKC 3K2MC 4NQXB 3V8OA 5CGYD 2OZ4A 3PXJA 1NFDB 2DJSA 3AREC 4XP6L 3QEQD 5EU3A 3LKOB 9CGTA 4PJAB 4TUJB 2ERJB 2IMMA 5I19H 3C8HA 3S35H 2AEPL 1BQHB 1JWMA 4G9DA 4GKSA 1HQRB 5F7KC 4XPBL 2NY0B 1QFHA 2VDPL 3QHZH 2E7MA 3PV6A 1M71A 4PJCE 4QXUH 1LO5A 4R90L 3V0AC 1A7BA 4HMCA 4C4KO 1MIEL 5HDLA 3M17A 2F53A 4KZEL 5I6XB 2JKXA 3F58L 3R06A 3VFSA 3LH2H 3DECA 3QEUB 4NZJA 5EN2B 4JKPH 5IHZA 1XF2B 1QLRB 4CVUA 3JWNC 5DA0B 4XCCH 2F54A 1S9YA 3BUYA 1XGRA 3KPOB 3FKUS 3FQWB 5MEPB 1NLDL 4JQIH 3WL9A 3UJTL 5J6GA 3LAFA 1A4JB 1JK8B 3Q3GB 3GMMB 3VFPB 5HJ3B 1PLGH 1L6XA 4OF8A 5HI5C 3V95A 2AW2A 1UWGL 3GMOA 1TZGL 1RQ5A 2J6EA 5FDWA 1MH5A 2CDEB 4OT1H 1JHLL 1SBSL 1VSCA 4X6DA 2MHAB 1SJXA 4FQQA 1EDQA 4ENEC 1U8PB 3VFUB 3BQUD 3IB4A 3UPAA 4UNTA 5CBEA 4JPVL 2JF1A 3AS0A 1W72L 4YIQA 3RL2B 1AXTH 4OF0A 5JW4M 5D7JA 2V5YA 3MLSL 3QUZB 5F7WC 2RCSL 3GDBA 3IFNH 1PQZA 5J1AA 5HYSB 5CGYC 1UQSA 1R0AL 3T2OA 3LRHA 1DBKH 2Z92A 4XPAL 1A1NB 3RGVA 1Q0XH 5E99L 2W0FA 2W65B 3KR3H 4LKXB 4FFWD 2LTQC 1QKZH 4XWGH 2GEEA 4JZJB 4OD3H 3T3PF 4HT1H 2XZCL 1FSKC 2QR0A 1AO7B 5ID0B 1LO0H 1NUDA 1CGSL 3AS2A 3U0TB 3TA3C 4PJHF 1KLGB 1A7NH 1LVEA 4LHQB 1FNGB 4NQDD 5EU3B 3ARFD 5I8KH 1G9NH 1EFXB 4UQ2A 4PJEB 2HP4A 2QKIA 3U7YL 2YA0A 1CE6B 1OAUH 1XEDA 4RFOL 3K0WA 4Z7UB 4ETQB 5ICZB 1YNTA 2QHRL 2Y6SC 2IF7A 1KN4L 4YBLB 4OFKA 1XR8B 2VIRB 3QO1A 2DMCA 2WV3A 4FXGB 4J2XA 1K3IA 2J8UE 4TVPH 5JLZB 1EK3A 1E6OL 1OAZH 1N5YH 5BOPA 2VWEC 3QDJE 5GZND 3NCEB 1FYHB 1IJ9A 1A3QA 1M7DA 3BQUC 12E8H 4Z7WF 1KTLB 3L6FB 3O3UN 4OM1H 3VXSD 4LQFH 4OLXL 1NDMB 1GGCL 1XGQA 3WL9B 5EFIB 1NCWL 1Z3GH 4YDKH 4FA8A 1AQDA 5HYJB 1BLNA 3O2VL 5DEGB 1F42A 1RURL 1WWWX 4QRPE 4E0RA 3U30C 5SX4H 4HJJH 3HZMB 3QXVA 1M7XA 2ZZUT 1FAIH 3U0PB 4CADB 1BQSA 1CD0A 4J1UB 4IBLT 5HDBF 5FGCB 3VGEA 3QCVL 3EYFB 1CF8L 1LK2B 4S0SD 1ZA3A 1I8KB 4DVRL 4QHNB 1ZLSL 4PLKC 2AV1B 5CINL 4FFYL 4WY7L 5AWNH 3X3FH 5IGXL 1OAYH 1F6FB 5BVJB 3LKNB 4Q9RH 1IBGH 1HI6B 1FN4A 1MSPA 1ZXQA 2G2RA 4XP1H 3G6JB 2VLMD 1CWVA 3HE7A 3V4VL 3BPNC 4HUUA 1OGAE 1KPVA 4L3EE 3P0YL 4KJYA 4YBLC 5DMKB 2JJVA 2D7PA 2VABA 4KTEL 3UTSA 5CZXC 3W5MA 1HZHH 4O9HL 1EA9C 2Q6WB 4NQDB 4M43H 1RU9L 3CK0H 4NO5B 1DLHB 5DJYB 3ZZ1A 1G7MA 4L4TD 3MRGA 5DJYA 1KEMH 2UV3A 1OT2A 3S4SB 2X4NB 3AM8A 4NRXB 1BD2B 1ADQA 2AXGA 3MLZL 1HSAA 1LE5A 5T1MB 4WEBH 1K8DB 1F4AA 5IW6A 1N3NB 3TN0D 5H94A 4XPTL 1YNTB 4KHXH 4QHMB 2QLVB 3RVTC 1VFOA 2R0ZL 4TOYH 1C1EH 1FG9C 1MHPL 2NR6C 4LDLB 4LRNL 3V4UL 2E6JA 2EDXA 4XI5D 2EDFA 2JELL 2G60L 1L7TL 2GTWA 1DN0A 1L4IA 4GUPA 5FEBA 1CT8B 3IAQA 2FLBT 3FO9B 3T3MF 3IXAB 3FONA 4G80B 4IOIA 4X0KA 4MCZA 3F7QA 5DRNA 4TYUA 1CDUA 1TVBB 3EYOB 4ELMF 3HG1B 3C60C 4I48A 3SOBL 1DP0A 4N90E 3QNYB 1G9ML 5HPOA 4UQ3B 2C5DC 1QEWA 3DVNB 4B5EA 1TNNA 2C3HA 4EZMA 4CNIB 3QDMA 4QY8A 3SDDB 2AJVL 2XA8L 4AH2B 1A6VL 2AJUL 2B4CC 1LNUA 2UZIL 3T3PE 5CIPB 4FQJL 1Q0YL 5F9AC 1OGAD 4L3ED 4PP2A 3FQXB 1ZHBA 3P3YA 2HH0H 4CU8A 5F93C 4GAYA 3VH8G 3MLRH 1IL1A 4XVSL 4G3YL 3LRSB 3WO3B 1N7ML 5CMAA 3LKSB 3X14B 1CGUA 4QHNA 4LVNC 3RWGB 4F9LC 1QFPA 2ZOKA 5C92A 3GIZH 4WJ5B 4PR5A 4Y2DB 2K3TA 5IFAL 1F90H 3QCUH 1BECA 1J8HB 5TQ0L 4ETQA 5KVDL 3G6JA 5DUML 4PP1D 4U1JB 1GHFL 3WNMA 3GJFH 4OZIB 3VW3H 3AB0B 3MRLB 1X5XA 1YMMB 4HKZA 4IRJC 4MGXA 1GHFH 1MLCA 5EWIH 1FYTB 5FV1L 3U9UA 3V6FA 4L8SC 3GMQA 1NMBL 3D18A 3MA7A 5EBWB 4HIIA 4ODSH 1OAQL 4UDUA 4PG2A 3GIZL 5E2WL 2ZJSH 5EU4B 3EO1A 2Q86A 3MV8E 1M05A 5DZOA 3T0WA 5HHVH 2P45B 3HMWL 5EU6E 4ZUUA 1CE1H 2ZUQB 4G3YH 2DQEL 3MGAA 3NTCL 3PWVB 4ZODA 2F8OA 1VGEL 4LNRB 4XVSH 3IU4L 3VD7A 5H2BA 4HUKB 3MMEB 1NCBL 4X7TB 3FL7A 2VB5A 4PRBB 5IW6B 4Z7OE 3TF7C 1IAII 4ELME 3L3GA 2ICEB 5ALBL 5HGDA 3GSXA 3S34H 4Z78B 2AJVH 2VN7A 3ZT5A 4FQCL 1YQ2A 3DIFA 1ZVSB 3H9YA 1ZHLA 5DHYA 4K7PX 1HHKB 4Y19A 4JZOB 5A1AA 4FABH 2X1XR 3SOBH 4IOIB 4X0KB 4JDZA 3PL6D 1MFCL 4UB0L 2A74A 1BQLL 1N5AB 3CVHB 2ICCA 4Y4HC 5SWSB 4WW1A 3QFDA 3WIHH 1E4XH 1JF1B 4PJHE 4LLYA 4HWBL 4M61B 5H8DA 3WIHA 1JNHB 5ACMA 1EJOH 2Y06L 1I7RB 1UC6A 4XH2A 3ORJA 1AD9B 1AHWC 1S7QB 2AK4E 2OP4H 5KANI 2VDRL 1DEEA 4HXBH 4Y4KD 1BX2A 4XAWH 5TGBB 3C5SB 1WUNT 3HUJF 4G6JL 3HRPA 2OXGA 1S78D 3WJJA 1ZOXA 4ZXBA 4M3KB 4WEBL 5CEZD 2CRYA 3FQUB 4GAYB 3EFDL 1IQDA 3O0RL 4LSVH 5FKAA 1FLTX 5JXAL 2EC9U 5CJ8A 3TA3D 3BKJL 3WNNA 5DD6B 1NKRA 5GJTH 3QSKB 3VFWA 4LCYA 5GGTA 1NBVH 4KTEH 2BVPB 3HS0B 3MUJA 5ERWA 5BW7A 2YD4A 4L8CA 5DD5L 1U91A 4PY7B 5MEOA 1KV3A 4E41A 1FFRA 1GSMA 3MNVB 4PJCB 4HG4K 3MRNB 1P69B 4RMUA 2D0FA 5MERB 1K4DA 4HK0B 4JANA 5BMFL 1N2RA 1RSFA 2AV1A 4DVBB 1UZ8B 4TSBH 4JM2A 2AJXH 3KJ6L 3DSFL 1IVLA 5JPMA 4N1EA 1DBJL 5FECB 2XN9A 1AE6L 1CZ8L 4DVRH 1I7TA 1KXTB 3GSRA 3ZE2E 1JYNA 1MELA 5BRZB 3V4PL 2VDNH 2FR4B 1NCDH 3WE6B 3RWEA 2XWTA 1DSFL 4DWHA 1OSPH 4LU5L 4XNXH 1T6VN 3WFHA 4X5WA 4OQTA 1UJ3B 25C8L 2XTJB 4HUWB 5EOTA 3C5SA 4N0FA 1E6JL 3T0VA 2ZUQC 1V7MH 1B90A 4P59H 2GJZA 3S97C 4HHAA 4K7PH 3GKWH 4MS8D 1AIFB 2H1PL 4MAUL 4MNQA 1IFHL 1X4ZA 1J1OL 4DGYL 3DYOA 1GGCH 1PZ5A 4HFUL 4DQOH 3CSBA 4Y4KA 1JZ8A 5IW1A 4CJ1A 1CGWA 4XNQA 4KRPC 1DQTA 3O9WD 3TIEB 4PJFB 1N5AA 4PBWD 3OKNB 3O4LB 1K5NA 4XVJL 5DD1L 4LVOC 4R4NC 4L5FL 5FDWB 2GFBA 2QSQA 2R2EB 1AD9A 2NXZD 1VEMA 4P46B 2H41A 5MP6H 1U8OA 4DKFH 3RY6C 3ISWA 1FZMB 4PIRF 5I73B 3MUGB 1CL7L 3GSNH 1OAUL 3C9NB 3OGCB 5FYJH 4NQCE 4KY1H 3NACH 1G9NL 4M4PA 4QRUB 4GO6B 5JUEH 1T0MA 5F96H 4XMPL 3IGAB 2VLKA 2OQJA 4LLAA 4ZD3L 4BA8A 1F8TL 2Z0BA 3ARQA 5ACZB 1JJUA 3B2VH 1EH9A 1NCCL 1CGVA 4HXAH 3BZDA 2W0FB 2W65A 5GRWA 4E0RB 3B5TA 3EYQD 2XFXB 3TBSB 1LE9B 4UT6L 3JWDL 4LIQE 5JA8B 4XWGL 3MRMB 3TO2B 1S7WB 4X6FA 1R3LA 1UJ3A 1AFVH 5DK2A 2IQ9H 1HSBA 3RVTD 3H0TA 2OI9B 4J23A 4F58L 3B8YA 1NJ9B 3C60B 3MO1A 5E8EA 3QEHA 4KJWD 2OK0L 1DN2A 1NAKH 4GG8A 1T7XA 3TNNA 5B39A 1E27A 1A47A 5DJCA 3NN8A 1ZLUH 5C08B 3P4NB 3ARDB 2PETA 3OKEB 4P5MA 1YC7A 4M48L 4RRPA 4JFOA 2CSPA 3MRBA 2ADJB 4HLJA 3MNZB 3C60D 1VACA 5ADPH 2F74B 3N06B 3ZL4H 3W9DB 4FQIL 1WLHA 4LLWA 1YMMA 3STLA 4XH2B 5HDQL 2FEEL 4LGSB 3GSQA 2ZNWA 3DURB 4YO0A 2GJ6D 3TCLB 2VLJD 5CP7B 3S5LA 4F7PB 3MR9A 5GISH 3D1MC 3THML 3GO1L 4KRLB 4EEEA 1UB6A 1D7FA 4WI4A 5DJ0B 1GZPA 3ECBA 4GSDH 2BMKA 1IRAY 1DL7L 3RBGA 3C2SA 2FGZA 1X5KA 1QEWB 3Q6FB 1T1ZB 4TVSa 1BQUA 1T0PB 1WAAA 3MLUL 4PJEF 4R7DB 2LAAA 4N8CL 1X5ZA 1MIEH 1UJTA 4H8WH 1VADB 3M8OH 3WJLA 3MGTB 1KGCD 4P46D 4JFDD 4KAQH 3MV8D 4U49A 2LVEA 5I19L 1RHHB 4KRPB 5BJTB 2AAVA 1T7VA 5I0DA 1QP1A 2VR9A 2ERJC 1JV5A 2D7OA 2NY4B 2JJTA 4QRRB 4UI2A 5BVJA 4I48B 3KPLA 3WHE1 1QYGH 3U4BL 4WJ5A 3MOAL 1FNSH 1QRKA 5D1ZC 5DRXB 5F1OB 4OAWB 1LK2A 1J18A 2X89D 3CH1B 1G7HA 5IWLA 4P23B 2AEQL 5TE7L 4ZUWA 5FXCH 5DVNA 3I6LE 1P7QB 3PP4L 4PJHA 5CEZH 2AGJH 2X09A 2EIZA 2WLZA 1WBYA 3D25A 5K9QG 1FGNH 1OL0A 4XVTL 2E7LA 4OZGB 4R9HA 4ZNCD 3AREB 4O58H 5D9SB 3AREA 3VA6A 3TVMB 2OL3A 2PXYD 4WGWB 5HGAB 3P73A 2YBRA 1QVOB 2BSRA 5DGQA 5K9OA 2DWEB 1IARB 4LCIL 1P7KB 4HS8L 4YZFE 1SM3L 4NQDA 4BSJA 5E0QA 4M93B 4WWKA 5T1KB 1QLFA 3MLUH 3V0VB 2BY3A 1JNLL 3T65B 2CDFA 1PKQA 5FA3A 4KGJA 4NKMA 3IRZA 3AMKA 5HHMD 2WMPA 2O5XL 1KCSH 2ZUUA 3B43A 4I9WD 3TZVD 4U1HB 3Q48A 5GGVY 3S3SA 4QHMA 1NMAL 4TULH 1W8NA 4YHOH 2H26B 4JY6B 2DMKA 2UVFA 5GGSY 2V5SA 3RZWA 1MJ7L 5GPRA 4PJ9D 1JL8A 3ZT7A 1RAMA 5DMGD 4EIGB 5IROA 3CPLB 3S88L 5CJOL 1JF5A 1FIEA 5C0BD 3G6JF 1VFAA 1FCGA 3PQYA 3RIAF 5E03A 2J8UB 3I85A 1VPOL 3QUZC 4GBXA 5ETUA 4PRIB 3HE6D 1L6ZA 1MFEL 1Y6KR 2DYPD 4U7SA 5FM8A 3DWTA 4U1MA 2IQ9L 5FGBA 4JFYB 4OLZH 4UV4H 3JWDH 1J0JA 3K2UH 2IALB 4HZLA 3UC0L 4KI5F 3MRFA 4M61A 4XCFH 5DQ9A 1DUYA 4GW4A 5DEFB 4ZXBD 5KN5A 2CJUH 3U82B 1Z9MA 3OAYH 2BC4B 3L3KB 5KN5B 3P9LB 1H3UA 3RVVD 1KCRH 1ZT4B 3SDYH 1WCBB 4MWFA 3C9NA 1TQBC 2FWOB 1Z9OA 3KLHC 4Z7UA 4H5SB 1G0DA 2JTDA 5B8CA 1JMXA 1KGCE 4U1HA 1IC5L 5SX5H 2AJ3A 1U8QB 1FPTL 2HRPL 2D31B 2NY2D 4KDTC 3SGJC 5JW5B 4MVBD 5KSVB 5GS3A 1YQVL 4LLMA 4KHTL 2NMSA 3OB8A 3SO5A 2FL5B 1GVIA 3TBYB 3VRLE 3E6FA 1P4IL 1PDKA 4WTWA 1GIGH 3CNKA 3QFJE 5JORB 3VRJB 2DLEA 1MCWW 3BW9A 4OCRL 4YDIH 4MZ3A 4HBCH 1FFOB 1NEZB 4HWEL 4ESKA 2OMNA 4PRAA 4HFUH 4DQOL 3P77A 1J8HD 3HRZA 5T33L 3TH3T 4Y1AB 4W68A 1UXWB 4OI9A 3ZDZE 4KVCL 1QR1A 1V7ML 1P9MC 1Q9LA 4NO0D 5ICZA 1WEJL 3B83A 3QIBA 1FJ1A 4AJ0A 3E3QC 3VWKD 3OKYA 5GS1C 4LCWE 1QSZA 2DYPB 4GW5A 3UPRA 2NQCA 4LU5H 4XNXL 2H2SD 5JXEA 1Z9SA 4GOSA 2IFFL 2XV6B 3FONB 1RULH 5D70H 1ZGLB 3FB8B 2VAAA 2V2TA 1B9ZA 2J7LA 1MHEA 1HCFX 3OGOE 4ZAKB 4YE4H 2O26U 4WI5A 4BUHA 4S1QH 4JPIB 5FCUL 3VA2C 5ALCH 3ARZA 4K3EL 3KXFB 5C0AD 2UYLA 5FHBH 4PREA 5DQDL 1J05A 2X6MA 4ORGA 1HH6B 1NH6A 2ICEA 3MCKA 5IP4A 4OLWL 4HDIB 2OS7A 3IDIB 4LDEB 1ES0A 1NFDE 4P4KA 5GGTL 3GMRB 2DQTL 3VGAB 1ORQA 1H8NA 1NEZG 4Z7UE 1ORQB 1TJIL 3I50H 2VUYA 1EAPB 3D39E 3UTTB 1C5DA 1P1ZA 3RWFA 4DZ8B 1J1XH 1RV6X 5EZJB 3HAEB 5T1KD 3EFDH 4ERSL 1PKOA 1GL4B 4KK5C 1MWAH 1N2RB 1SEQH 5GHWH 2VDLL 4ORZC 5IVXA 2O93L 4I2XE 3QI9B 1U8QA 4YNYA 2F19L 3TVMD 4RGND 4L9LA 4TUKL 1EXUB 2XKNB 1Q94A 3EYVB 4YHYB 5CBEB 2R69H 1JYVA 3QO0B 4JRYB 4L8BA 3QQ9C 5C09B 3NPSC 5D2NA 4JFFB 3RWJA 2D03H 1BHGA 4LCWD 3QWQB 4N5EC 4F9PA 4MB3A 3GJFB 3ZTJH 5I76A 3RJDA 1F6LL 2IGFH 4GRWE 1FZOA 1T5XB 4XPHH 1V7NL 1BQLH 1IM9D 4YBQC 3G5VB 4UB0H 2F53E 4L29B 2LFGA 3PWVA 5E6ZA 1MCPL 3UMTA 1W0WB 2EH7L 3DIFB 1G1CA 3C8KA 3O6LH 1NC4A 5ESVA 5HY9B 3C60A 2JCCB 3MO1B 1WVZA 5E8EB 2C1OB 4KKBC 3T08A 4OQ1A 3L5JA 1A1NA 4N90D 1B2WL 4G6MH 1YEGH 3ES6B 5CJBA 1AO7E 3KS0J 1Q72L 4P5TA 1KB5A 1YEKH 4FHBD 2VERN 2EIDA 1I8LA 2NTFA 2W9DL 2DM7A 4FQPA 2P8PA 4L4VB 4XBGB 1TMCB 4P2OA 4NGHL 2GIYA 2HMIC 1V3KA 1CFQA 1EVUA 4DKAA 4EI6B 4LVNB 1IC7H 3ZDZF 1A7PH 5EPMA 1S7VB 4U1KB 4PJGB 4K23H 3CZFB 4LMQI 3MRLA 5LWYH 4YHMH 5FIEA 3JUZA 2Z91A 1YN7B 3CD4A 4OF7A 2CLZB 3SCMC 3QUMA 4GMTL 2CIKB 2ZSVB 4RNRA 5D6DC 4MA7L 3VW3L 1HXYB 1XF5A 4WNQB 5BZWA 3RVWD 5DUBA 5CHNA 2XY1A 2V2XA 3IJSB 3EGSA 3NPSB 4P2YA 2GJ6B 3HI1A 1J10A 3QEUA 1ZE3C 4EUPB 4F7MA 4I9WE 2Y9RT 4DFIA 4QLRA 3T04D 2HTLD 2XPGB 5HHXH 1N7MH 2XPGA 3UP1A 4JAMA 1GCFA 3FFCE 5FGRA 1G7IB 3T8XB 3I75A 4LCWA 1ROWA 3PWLB 3ZKMD 2SEBA 1EV2E 1Q1JL 4WHDA 1TJHH 1KACB 4KK8D 3L3OA 5EUOE 2QQKH 2OR8A 2HJLB 3W0WE 2X70A 4MD0A 3MRDA 5A2IH 3BRFA 2YUZA 4P2RE 3EOTH 4YAQA 4V2BA 4JPKH 2XA8H 1EXUA 2P5EE 4YIQB 1LEIB 1I1AC 2J6EH 1EGJA 3DRTB 3T77B 5T3ZD 3KPSE 2YK1L 4H1LG 2MQCA 1J5OH 1F4WH 1JPFB 4AEIH 4LF3A 4P3CL 2BOCA 1PX4A 2VLLB 4TVPD 4ZS7L 5J11C 4YUEL 5D2LB 5D7IF 4X6EB 3MV9A 3BEWB 2IADB 2HT3D 5IK3A 3G9AB 1WT5C 1H0DB 3KPQA 4Y4HA 3MGOA 3BZ4B 3GUTB 1KB9K 4H26B 3QUZD 1LGVA 3L5XL 3P73B 5CLWA 4MMXC 5DFTA 3GRWL 3GJEA 1CICD 3VXRB 1TDQA 1MUJA 2KQNA 4MSWA 3ZKNC 2R0ZH 1HIML 4W6XB 2FJHA 3D6GA 3TZVA 3CFIC 1VFUA 1VADA 1UEMA 1KJ2H 4HULB 3SJVB 3W81A 3QWOA 2FCBA 5HTSA 5EBLA 3MLZH 4FXLA 4K3GA 2DLTA 3AXLA 2OR9H 3U7WL 3KDMA 1ZV5A 3BI9X 3GI9L 1S8DB 1S3KL 2EDLA 4N1HB 2OZ4H 3MRRA 2KQMA 4KQ3L 5E5UB 3RGVD 5HYQB 3R1GH 4XCYA 3REVA 4JEGB 5C07E 3BZEA 5IJVA 3RY6A 4QNPF 1UVQB 1AD0B 4PBVC 4C56B 5D7LD 2CLZA 5DJDA 4NNPH 2VSCA 3DURA 2VL5B 4UU9B 3VGDA 1AY1H 3EDFA 3QUYB 3T0XA 1FZKA 4KRMB 1LDSA 5J06A 4BM7A 2C3WA 4Q9RL 4OJFH 4CKVX 5D1ZB 4MCYB 1JYWA 3JVGC 4FZEL 4LSSL 1RUKL 1T20B 1AXSB 1ZTXL 5T3XH 3KYOB 1G7IA 1ORSA 5I71C 4OZFH 3O2DL 2X7LB 3CU1A 3L95B 4LEXH 5HD8C 3VE0A 5IQ7H 5FM5O 2OR9L 3OMZA 5EB9A 3VGFA 5I8EA 4PGEB 1FAIL 1HHGB 3MRIB 3VRJA 4OD1L 1DQDL 4LVEA 1VA9A 3F7VA 3EYUH 4QRSB 3AVEA 4P48A 5C0DA 5AYUH 4F7EA 1DEDA 1F5WA 1HIMH 3EHBD 4S1RH 1Z3GL 1NCWH 1YY9C 4WW2C 4Z7WA 3RZCB 4O51A 3NGBC 5FYKL 4LQFL 3BEWA 3VRLF 1DANT 4JPWH 3BAEH 5HVWA 1CBVL 1P6AB 1BFSA 4WO4A 4N9GB 4ZUTA 2A6JB 3C09C 5F88B 2X4SB 1CR9H 4XNZB 4WHYG 1IGFL 1MLCB 3LS4L 4NKDA 4NWUH 1H3GA 1A4KB 2NW2A 4AEIL 2A2QT 5ANMA 5EBMB 3HNTH 5DJDB 5E00B 4Y19E 1YEDA 5D1QB 2L0DA 2GJZB 1J12A 1I1AB 1QFWH 2Q7YB 3U7YH 4E9LA 1T1YB 3EOTL 4LRIC 4KI5E 3L3IA 5HD8D 5EFIA 1VEPA 4BSVB 1IC1A 4P9HL 4X7TA 3IJHA 4ZNEA 1A7NL 1OWRM 1RHFA 4P9HH 2EKSA 4ZQKB 3BN3B 3QUYD 4M7JL 5CSGA 4ONFL 4HS3B 4X6CA 5IR1B 5KSBE 3O6KL 2D2OA 4FFZH 3HC4H 4ZYKB 4IDJH 3KR3L 4DN4H 1RMFH 3I3DA 4XCNB 1A6ZA 5BS0E 3HNTL 3TBWA 5BQ7A 3CC5A 4Y5YC 4MMZC 4KJPD 2B2XL 3W39B 1R0AH 5D5MF 4WU7B 3T0EA 2D7TL 4L1HA 5FAAA 3QPQD 4U6HB 5MHSE 4MWFB 3UZEA 2FGWH 4PV8A 2E3VA 2PUQT 3C6LD 3DI3B 3GSRB 4H0GA 5D2LA 2F74A 4QOKD 1KPRB 1S5HB 4HIJB 2NY1C 3BDBA 4P2RA 4WO4B 2NCMA 4ZFOL 2Y6SD 3C87A 1XR8A 2N4IA 1K9TA 2C3GA 4JFXB 4L4JA 3EYVA 4QWWD 4S1RL 1CICB 1JHLH 2ATKB 4NGHH 2DM4A 3WFBL 1LD9B 5F7EL 2X4QA 4R26L 5F1IA 2AP2A 3EO9L 4OFVA 4HHAB 1KLFA 3CX2A 3S36H 1BJ1H 5D5MB 4BK5A 5DMJB 1I3VA 3SE8H 1FYTD 3H42L 4XZUA 2FL5A 4H0IA 4PLNC 2OSLA 4ACPA 1TCRA 3DXAA 4JAMB 1B2WH 1IZJA 2XZAL 3D2UB 5BOZG 3TO4D 3D3VB 2DAVA 1I3RA 4MD4A 1UM6H 3UTZA 1RUKH 1TXKA 3ZYJA 2ESVE 4YBHA 4U1SA 3ZYOA 4KZEH 1O0VA 3OX8A 4G8FA 4CU7A 2P8LB 5FYLL 3UTSE 4YGAB 5J3HC 4GKNB 1EHAA 5FO9A 1B4RA 2AEPH 4LARL 5MERA 1IILE 3KPMA 3QUYA 5DSCA 3A6CL 1SVZA 4CN4A 1CG9B 1TETL 5C0IB 5DSCB 1J1PL 3PGCA 3BO8A 2DWDB 4BQ8A 3MUZ1 2P49B 1NAML 4OZGF 4F7TA 1QA9B 5IROC 2ZG2A 3MCLL 2VDLH 2HKHH 4MQXD 1SEQL 4WDIB 1ZHNB 1B4JH 3X3GH 2RFXB 4ZUSA 1N4XH 1DUZA 4NJAL 1CXLA 3I6KB 3ZSSA 3M17B 4A6YA 1AQKL 2R8SH 2BVOB 4TNWF 1BJ8A 2DQUL 3FQXA 1TIUA 2FB4L 3FMGH 5JDJA 5CWSA 4KK6D 1C12A 3U2SB 4OGXH 4XCNA 1Z5LB 3GRWH 3MXWH 4OI7A 3DOSA 5J57B 3RWHA 1WICA 1QQDA 4U1IA 3OB0H 1RK0A 3I02B 4NBYB 1BZ9B 4IMLA 2R56L 4IHOB 5DQDH 1JNHA 1A7OL 2YUWA 4GXUN 4IRZH 4J4PD 2AQ1A 4U1KA 1Q9OA 1M6OB 3WSQH 3JV0A 4S1QL 3RI5F 3FB8A 2DL9A 3HC0A 2YHGA 3DX6B 2AEWA 1X44A 4GUPB 4C54A 5IFHL 3EZJB 3OGCA 5CKGA 4OV6F 4AG4L 1YEHH 4ZOBA 3RNKA 3DROB 4JPKL 1CE6A 5D1QA 2AJ3B 3GK8L 5DD3H 5HYSG 5A2LH 3VWKA 1CIUA 4JRXB 5H35A 3QFJB 3KHQA 3QQ4B 4ONOA 4JKKA 3FN9A 1FNHA 1Z2KA 1Q1JH 5C07D 3HRZB 2ZCHL 1RK1B 1P4LB 3BX7C 5DD6A 4PD4J 1G7JB 2PO6A 4N8VG 4WWKB 1ACZA 4MD4B 3NFNB 4JO2H 1HXMB 3UCRA 1B0RA 4HWEH 4RGOL 1SEBB 3BDYL 4WTZA 3OR6B 4HBCL 4I0PC 5D7JD 4R96B 4ELMB 1T5WB 3FCTB 1QFWI 1A6AA 1FVCA 3I6LD 3C6SA 2AS5M 3RWDB 4FN0A 2Z31A 1WK0A 2DQGH 4JHWL 3PJSB 5JW4R 2P46B 5ITFB 5SWZA 4ODHH 3LQAC 2E7CA 5GRVK 1PW3A 1AC6A 1NAMB 2JJUA 4P9HC 1BQHG 3PWNB 2X44D 2XWBB 3J7HA 4FQ1H 4RWYH 3FFDB 5E6IB 4EN3A 1T6WA 3PDGA 3QH3B 4CVZA 5F9WB 1MFDL 2ADGA 4LLWB 3JWOC 1UVQA 2ICWA 3L3KA 1MLBA 1KJMA 3T4AB 4O00A 1KENH 3GMQB 5EBWA 2FJGB 1D9KC 3F7YA 1VKXB 2W9DH 4Y16C 4PLKD 4RGNE 4Z76B 3P4MB 4M7KH 4N8VA 3ZKXB 2P7TB 5C0GA 2PYED 1BMGA 3CSYA 4WCYL 1XGRB 1T7ZA 1GZPB 2YC1A 3BZFA 4NBZB 4WGVB 3EYSL 3ZKQD 5E7FA 1HHHA 2EO1A 3QI9C 3EHBC 5C6PB 3V7AG 1S9VB 2CKBB 2KPNA 1MFEH 3MRRB 5KSAD 1B3JA 5T1KA 1OWWA 4QF1A 1VPOH 3MV01 1V7NH 2NZ9C 4I5BA 3MV9D 3QIWB 4XPHL 3TV3L 4PV9A 7FABH 2BSSB 3TIDB 4EQ2A 4D0DA 4XMLH 3SDAA 4F57H 2X4RB 1ZK9A 3DX6A 5CJOH 1AO7D 3MA9H 1X4YA 1MI5E 1X5GA 4R3SA 2VISB 1Y0LA 4QRUA 2DQFA 2CDGB 2ZNXA 4JO1H 1UZ8A 3E0GA 3D3VD 5CEXB 5C08A 4CMHB 3EZ8A 4L9LB 4UQ3A 3PWNA 5E5MA 4C56E 5C70A 3BPLC 3F5WB 4Z7VA 3HG1E 3V6ZA 4C56A 1INEL 4AT6B 4U1NA 3RTQB 2I60H 5GGVL 5GGUB 3SQOH 4DEPC 2EYTB 1DDHA 1KCSL 2O5XH 3MRMA 3T4AA 4RAUB 5L7XH 4LF3B 1TJIH 3QEQE 1AHWB 1NDMA 2AXFA 5I0ZA 4U1LA 2Q20A 5ESAB 2EDJA 3C8KB 3O8XC 3VMNA 1IEAB 2VJXA 4WFGE 1UA6L 4LSTL 4WO4D 5GRJL 4OLVL 4NCDA 1U3HC 1K8IB 4HIHB 4P5TC 5FA4A 3HZYA 1T3FB 1V3JA 3SE3A 2UVEA 1T80A 1V05A 2VOTA 1DVFA 2EDOA 5HI5D 4CJ0A 2V7HA 5IV2A 3BQUA 1F4XH 4FS0A 4BSWB 5FYJE 1OP3H 2IFGA 3FQTB 2ADFL 1XGTA 1A4KA 1JMZA 1ODAA 2AGJL 2NZ9D 1MHEB 4UBDC 4ZAKA 4GKNA 4D9RE 3B2UC 3GHEH 2VLLA 4UDUB 5ILTH 3ME0A 4JFHD 5CILH 5IOPB 4HQQL 4KUCF 5EOQH 1KTRL 5DF0A 5C0EA 5ITBH 1U92B 4O2FA 5GGQL 4PV8B 1FIGH 5C9JA 4ZNEE 1WEJH 1YY8B 2ZUXA 4MD5A 1QYGL 3P0GB 2Y1VA 1PEWA 1R3JB 3OPZH 3O2DA 4KVCH 5EU7C 4JFZH 5I71B 4Y8AA 1MVUB 3ZYIA 2A38A 2NY4C 2C3VB 1NGWB 3L3OB 3BSZH 3ILQD 4FZ8L 4NZRL 3DMMB 1ITCA 4L8SB 2R29H 1AR1C 1U3ZA 5FOBA 5D5ME 4PRAB 4UIMA 1EPFA 2J8UA 4KJQC 3LPGA 4GRLD 2X7LA 2BNRB 3WNLA 3QNXA 2VDOH 2OSLB 4X7CC 5F1NA 5MEQA 3EFFB 3JXAA 3QDMD 3PABA 4NRZA 5HXMA 2HG5A 4KVNH 2VXVL 2DI7A 3IFPB 1UH3A 3THMH 1TTUA 3RTQA 3BGAA 3QDGB 3L9RB 4AIZB 1IAOB 2QTEA 4FMFA 5HDBE 2FR4A 4N0UE 4P46A 2NXZC 2YEZA 4CGTA 1HN1A 3DPBA 4AZ8A 1PX3A 3T2PA 1FORL 1PJ9A 5HDQH 5IB5A 5F8QC 3QRGL 3UROR 3NBNA 3VXNA 2H8PB 5GSVA 5DMIL 2MMXA 3ZL4L 1GPOL 3BXNB 4EDWH 3PP3K 3QDJA 3UDWC 4S10A 3BO8B 3C5ZB 2HFFB 3FT2B 5AEAA 3WN5B 4UT9H 3GNML 5I74C 3QISA 3JWOH 4U2YA 3TZVC 2VZSA 1UM4H 1T7YA 1CFBA 5GS0L 1MFAL 2WNGA 1WBXA 4OZFB 3LIZH 3JWOL 4QRSA 4IJ3C 4F58H 1KIUA 1Q38A 1YYLH 3GB7B 2NY4D 4CAGA 1Q9KB 5D7LB 5IM7B 2VDML 4Q58C 2BY2A 4EDWL 4NFDA 4RZCA 5DMIH 2GY5A 4OD2A 3LKPB 1NCCH 2QADD 2XQYG 3B2VL 2AABL 4NN7C 4JHZA 5CCKL 4UIKH 3U83A 4N9GA 4YHOL 1XIWC 3RRQA 4KKAC 4FP8H 1NMAH 3W2DL 5JIKA 1DN0B 2CIKA 4I3SH 1FYTA 1LO3H 2EDHA 1EJ6A 4CVZB 3QDHA 4W4OA 5DVLA 1D6EB 5FYJL 3WE6A 1C5CL 3RHWK 2FSEB 3GSNL 5JR1L 4IS6B 4WFFD 5HHNB 4I3RH 5KVFL 4OZHA 3VWJC 2CLVA 2CK2A 3VFVB 3UTPD 3BPOC 4M62H 1D5IH 5J12C 4LL9A 1U3YA 4WI8A 1QSEA 4YHLH 1EIBA 4K2UL 5DD1H 4XVJH 5IBLC 4IRSD 1UCBH 4PJBB 4U6TA 2MJWA 4JM2F 5IB4B 4PJ8B 1PZ5B 2VQ1A 1SYSB 4FZ8H 1T83C 1JGUH 4NZTH 4Z8FL 2QV2A 3E6HB 3LEXB 4UZGA 1F6AA 2G5RA 1IFHH 1U95B 5L0QB 1F2QA 2UZXB 3ZE2F 3QDJD 3GKWL 5I73C 1J0IA 2HYMA 4P59L 1H3WM 1CFSB 3MYJA 2FJFB 3F7RA 2P5EA 4MX7B 4OZHF 1QSFE 3PP4H 2AEQH 3GSQB 3V6OA 1FN4B 3TYFA 3EIFA 1WCBA 2AI0L 5TPWL 1NCDL 2R4RH 4TQEH 3GHEL 3BP4A 5GSVB 4ZUTB 5FECA 1IKNC 1QBLH 1KOAA 2ADFH 4PJ5E 3NH7L 2Y7QB 5C0NC 4JR9H 1P53A 2CDEA 1UWEH 7CGTA 4Y5VA 3QO0A 4L8BB 4P5KB 4PJ8D 5BS0D 3UPRB 4U1NB 1NUGA 4LVHB 3BEVA 2BRQA 4I18B 3KPMB 1EMTL 2DN7A 4A6YL 3FN0H 4P3DA 4G5ZL 2JK5A 2F54B 5E08L 4F80A 4L1DA 3JV5A 4HUXA 1JZ2A 5T1MA 1C12B 1D3CA 1OARH 1WISA 4Z0XA 1I3GH 1X6NA 2G9HA 1H5BC 2JCCA 4POYA 4ZQKA 3BOVA 3OHXA 3C6LB 4Y4FC 5L7XL 1SYSA 2B1HH 3BFOA 1U0QA 4F33B 1Q9WB 2IANA 4PGDB 3FT4A 5INDB 2IANE 2NLJB 2CO7B 4LSVL 4WIQA 5I66B 4G9FD 1DJSA 3GZKA 1P5VA 1R3KA 2QSVA 1QSED 1CL7I 3QULA 2DQCH 5KAQG 1IM9A 3BH9A 4NHUB 4HUVB 2HKFL 2F53D 3Q6GH 1RZJH 3STZA 3KPPA 4XAWL 1ZLUK 1I7ZA 2IAMD 4IOFC 1VGKB 2EIZB 2PO6D 4S11A 5D6CB 4YC2C 5C0ND 4CW1A 3DROA 3AMLA 5ADPL 2XKUA 1JWUB 4PP1C 1S7TB 3ARDC 3T2NH 4M48H 3MLVL 5CZKA 5E1HB 4U05A 4JHAH 3DBXB 4F15B 2EEBA 3FHAA 1CU4L 1I1FB 4D9QE 1KLUB 2CUHA 1AGEB 4U0RB 5KOVC 3KYNB 4HGKC 1EZVY 4NRYA 4B7IA 2VH5L 3STBA 4OKVA 2QQNH 5D96C 5IEHB 4GXVH 1AFVL 3EYSH 1JGVH 4GLRI 5ACLA 3AFLA 4LPTA 2FJFA 5DJ0A 3IYLW 3WHXB 1HSBB 3S36X 3BZFB 3HZKA 4HXAL 3O45B 1WBZA 4G6KH 5DFVC 5EC1A 2ZSWB 4R7DA 1M7IB 2X10A 4NYLB 1NGXB 3NFNA 5JUEL 1BVKA 2D7QA 3QQNA 4N0CD 2K7QA 5DURD 5C9KA 3QJFB 2E27L 2YD9A 3JV4A 1GGIH 3K1KC 3DV6B 3RBSA 3ZTNH 5F9OL 4XPFH 1I8KA 4NQCA 3FO9A 3RIFF 4CMMB 1X9QA 4MJ2A 2IAMC 4FOMA 2DDQL 5DJZB 2GITB 4KKCC 4JFPA 4GRLB 1OAQH 1BGXL 4ODSL 5DK0B 2YEZB 2Z4QA 2D0HA 2VXUL 2G2RB 3CU7A 4G9FA 4J3SA 3GBML 5DJXA 3OKLA 5KVDH 1EGJH 5TQ0H 2FECL 3BDYH 1QSFD 3OKOB 5IFAH 2W60B 4JY4B 2IQAA 1AGBA 4XHJD 4JO2L 3FT4B 5HVHB 1SMAA 4C83B 3SDXE 1CDCA 4ZAKD 4K7PL 2CGRL 5I1EH 3ARBA 4YDJA 1NJ9A 3K8KA 4QYOA 1JTPA 3SCMD 3WHXA 4X9BA 1TQCB 5AG8A 1OSPL 1DSFH 3FOMA 4TVPE 4HPYL 1NCAH 4H88H 4IIQB 4JG1H 2X9XA 4LPCA 3V4PH 3SGKA 3U9PH 2QKIB 1JGLL 2VL4A 3AROA 3CFKA 3KWWB 1YNLL 3LEVH 3QHFH 4FQHA 5HPMB 1DBJH 4NBXB 1G9MH 3ULVD 2OQJB 3WSQL 1BJMA 5IF0B 4BZ1L 1XFPA 5KW9L 3SJVD 4FQQB 4UOW0 5BMFH 5F6HJ 3BMVA 1A7OH 3SGEH 1FVEA 4M7LH 3PNWB 1QHOA 3D5OF 4U0RC 4RNRB 5TE4H 5FGCE 35C8H 3RWIB 5E9DE 4IS6A 4PTUA 4U33A 3W82A 4BH7A 2V2WA 4QCIB 4MDIB 1H15A 3DUUB 2B7DT 1T1WB 1I1YB 4LRNH 3ULVL 3B4NA 3SDDC 3G9VA 1C1EL 4GKOA 2NY5H 1CK0L 2DQUH 3RTQD 2F9BT 4DEPB 5ABDE 3IETA 4HKBB 4PREB 5EO9A 2SEBB 4QXTB 5IR1A 3O4OB 4P5MB 2Z31D 4NYLA 4JDTL 3X3GL 3LKRB 1F3DH 5C0AE 1FC1A 3LKRA 2HKHL 5JNYB 3MCLH 4G6JH 3MYZA 3QEHB 4M00A 4D9QD 3VMPA 4DN3H 3QUXD 2X5PA 2B8OT 4U6XB 1OTUD 1ZLVH 1MCFA 2DLFL 1C7SA 2VR5A 5C0RH 1QLEL 5TF1L 3A6CH 5DO2C 1CFVL 4LARH 4Z5RB 35C8L 2EICA 1C7TA 3I9GH 4PJXF 2UWEA 1NBYB 4Y4HB 1QRNE 3WIHL 3LQMA 1I8IB 3D39D 4HLZG 4XHQA 5J9PA 4OF6A 4MJIB 4B41A 1MFCH 1CQKA 4K3HA 3K4ZA 3MNWB 1G1YA 2D3VA 3TN0A 3TVMC 3AU1B 4F9LA 1G7PB 5T1DH 4LK4A 3SE3C 1KPUB 3VDCA 1G7PA 4WENB 1KCKA 3EBAA 5CINH 1AO7A 4NQEE 1XCQA 3RGVC 4OUUA 3WIIH 4U6VL 3LN4A 3QCVH 4I3GA 1MWAA 5DJ8A 3LN5B 4RMQA 3OXSA 4AEFA 2DTML 3IJHB 3SJVA 4YXHL 1BIIB 5HGAA 4JRWA 3S36L 5AZ2L 2C1PB 3FB7B 4HJJL 4PJCF 2CKBA 1RURH 4I18C 3WFBH 3AGVA 1WSST 3B3IB 4PRBA 5K59F 1CE1L 2WK2A 3WLBB 2KKQA 4NNYB 4U1SB 5HGBB 1RI8A 4GXUM 4OZGE 1NEZA 5ICYA 1MRCL 3OV6A 2ZJSL 1R3HA 1OTUC 3A67L 3H9HA 4OM1L 2WBJB 4X8XA 2VAJA 1OSZA 1BD2D 4KROD 1EGJL 2VLJA 3MZGB 4HBQA 4IRJB 5EWIL 1JBJA 4G80A 1E6OH 2J1KA 2D7TH 3EDEA 3RL1B 1VESA 3ZDYE 5EOCJ 3IRPX 2IBZX 5HHNA 5HDOA 3CFCL 2I26N 3QFJA 3S35X 2F54E 1W2KT 2DYPA 3WO4B 3TT1L 1KULA 1H15B 1CFTA 1EEQA 3DUUA 1BGXH 3K7UA 3L5WA 2APXA 1IAOA 1RMFL 1KJVA 2DDQH 4PJGA 1OTTC 5EU6B 4X6DF 3C5ZA 4D9RD 1U41A 3ZE1F 3PQYE 4ZFOB 5IMKB 1U8NA 3O6KH 4WV1B 4LGRB 2EEDA 3Q5OA 4OGAC 1T3FA 4IOSD 5D2LE 3LQAL 4RAHA 1SYVA 1VEOA 1QZ1A 4D0BB 1CGSH 2EXYC 1FFOA 5FV2A 1GOGA 4JRYD 2VNCA 1FV1B 3B9EA 4WW2A 4XNYL 5EO1A 3FQUA 4OD3L 2P5EB 1N6VA 4RGNB 3RWHB 1A6VH 2AJUH 3I3EA 4LQ1A 4JZJC 1N6QH 1HOCB 2RBLA 3PABB 4NRZB 2W1NA 4X4XA 4OZFA 1U95A 3MBEC 3C8DA 1II4E 4J3TA 3I6GB 2FBJH 5DUPH 4HV8A 5LXGL 5ESQB 4ELKA 4HS3A 2FNBA 4YXKL 3EDJA 2A6IB 3LS4H 2B1AL 3PWUA 1IGFH 1YY8A 3GSWA 4ZPVA 1JHTA 1IC4H 1U8HB 3VXUE 3RDTB 3NIFF 1WFNA 4GW1B 3LKQB 5CSBA 1C16A 2XTLA 5EDXA 1U8PA 3VFUA 3CJJA 4R97C 1JUFB 5JQ6H 1K2DB 4Y4FB 5IOPA 1AKJD 2ESVA 2ICES 4MCZB 1L7TH 2G60H 1CI5A 3VXOB 1J0ZA 2Q7YA 5F9JB 4U6HA 5IHBA 2YSSA 3T4YB 1KIPB 1CDHA 1CFTB 1J8HE 2YPVH 1A6PA 4MDJB 1XF4A 3H7BB 2P5WB 1ZGLP 2P4AB 3MZTA 3B9AA 3BMWA 5DS8A 4XNZC 1PY9A 3O6FB 2EZ0D 4YHPA 4P3WA 1RJLB 4WWID 3SBWC 4JQIL 1XIWA 4ZYKA 1IGTB 1RZ8B 3UYOD 5IQ7L 4AL8H 2B1HL 4AYFA 1BF2A 4PB0H 1XMWA 5E2UH 3TWCH 5JNYA 4B7LA 5ESVB 4FQLH 4LLUB 4NP4L 3RVXD 1F13A 2Z9TA 4PJ8A 4OM0L 4QWWC 5EBLB 3HG1A 3GMPA 4HW6A 5HYIA 4OF3A 3QWRD 4JZNA 4HS6A 5BW7C 4Z7OF 3K1DA 1IAIM 2AEIT 2X1PA 5HGGS 3W0WA 3VRIA 1AY1L 3HHRB 5KS9F 4A6YH 3RY4A 5LGHH 4ODXB 4NNPL 2MCPH 3RQ3A 2ADGB 2VZTA 3SGDH 3NCJH 4R2GC 4LSPL 1RVFH 4H25A 4LPYA 4RBPK 1YN7A 3X3FL 1UWEL 1ONQA 1T83A 1A1OA 4C4KT 3CZJA 4ZPTA 2GITA 3DYPA 2OZ4L 1FVEB 4NKIH 5IW3A 1S3KH 4L4TA 3ZHKA 2CLRB 2EDBA 3QNZB 5I1LB 5ISZE 3BKML 5F7DB 4U1GB 3HLAA 5CJQH 5E8NB 1NQBA 2MQ0A 2O5ZL 4UMGA 4JHBA 1FFNA 5MENA 1ZGLM 4PJ9C 4XP4H 5E9DB 1IGJA 5A2JH 1S5IH 2G9HB 3NPZB 2NY2B 3O3BA 1P9MA 5GXBB 5DFWH 4QOKB 3IJSA 4NQEB 4NC1E 5TE6L 4OLXH 1FL5A 3CLEH 4NQEA 2CDFB 2ZWLT 4QTIL 4P2QA 4NT6B 2WBWB 2NXYB 5AUMA 4QT5A 3TIDA 5B4MC 1I9RH 2XG5A 4PGBA 4XXDA 3S4SG 1WITA 1WV7T 4HLZH 4K2UH 3WIFA 1KG0A 2W0KA 1PVHA 3BPOB 2GYSA 4KUZL 1MJ8L 2AJZA 4JJ5B 4U6YB 4WU5B 3P9MB 1KN4H 2E9JA 2BOCB 3MNZA 4D0CB 2H3NA 2BX5A 2ICWI 4HFWB 4X6DB 4RFOH 4KK6C 5F7NC 4PRID 1P84J 2W07A 1CFNB 1CQYA 4OZIE 4MJIA 1LK3H 1LO3L 5HYFA 1XF4B 2E9IA 5M94B 1K4CB 5CBAA 3MLYL 3KXFE 1DLFL 3WD5H 4I1NB 3M1BA 1FAKT 3RTQC 3PG2A 1VKXA 4NKOA 3T3ME 4KH2A 4UIKL 1SMOA 3IDJB 5DD0L 1H5BA 2GJJA 2CLRA 2YZ8A 1QLRA 1D5ZB 3ET9F 2X4NA 1A3RH 1EAPA 5JZ7C 4NO3A 1QKZL 4GJTB 5IW1B 3LEYL 2RAMA 4OGYL 4WI9A 5JW4N 1OPGL 2HT3C 5E2TH 3FB6B 1T1ZA 1N6UA 2PR4L 3T0BA 3OJDA 4MXWL 3GM8A 4KV5E 3GSUB 4MA7H 5D2NC 4QXTA 4JKLA 2RQ8A 5DO2D 3TZVB 4PG9B 4L4TE 4GMTH 1UM4L 4MAYC 4DGIH 4PG9A 5A40E 4L9LC 4NDMB 1DEEB 4RGMC 1KT2A 2VTFA 5AD0B 4UT9L 4NJ9L 1Q94B 2HJFB 2HFEB 1W72H 3RZCC 1NFDA 1FFPB 3O8XA 5I16A 5B8CB 1D5XA 1OHQA 4K71B 3WO4C 5EPMB 1TVBA 4Y8DC 3ZKXC 3ZHDA 1ETZB 3VXOA 2XICA 4LASH 2IPUK 3BN9D 2MHAA 4HUXB 4NNXB 2PXYB 5IVZA 3LHPL 3JBG7 1HINL 4RQQA 5C0CB 4G6FB 1U8LB 1A6WH 4YQXL 5E1AB 1D6VL 2OTWA 1RUQH 2P5WA 4X4ZA 3BIBX 3TBVA 2QEJA 2I9TA 3V0WL 1U2HA 2Z4QB 2VXVH 4KVNL 5ECJE 1T2XA 1AH1A 4NUGL 1YEGL 2EXWC 3T1WA 3VFRB 1KB5B 1KNOA 2BXYA 3H0TB 1U9KA 2BNUA 3VXTB 1R3LB 4DW2L 3CDCA 3FCTA 4F37F 3MOBL 3F58H 3O6LL 1P84K 2DJ4A 3QBTB 5C7XL 4C56D 2DLIA 4JCMA 4UAOC 4R8WH 3DI2B 1UCTA 3D85B 3GBNH 3G6DL 4JLRA 3CGTA 4EI5C 2ATPB 4G9DB 1S5HA 4HIJA 3QO1B 3NCMA 1WFOA 3B5HA 4TN9A 3VFGH 3DSNA 5FUCE 3G6JE 1PFCA 3V6FB 2X2YA 3QPQC 3OAZH 3D25B 3DARA 3DUHA 1FZMA 5E6YA 5ITBL 1HI6A 4W6YB 4J3UA 1DTUA 4APQD 4HPOL 4TPRH 2ARJQ 3EYOA 1YNKL 5HHPB 2NY3C 1P5UA 1MCRA 1KYOK 4ENED 5C0EB 3VXRD 2X4SA 3Q1SH 2Q8BL 4HIXH 3HNVH 3AU1A 1KUMA 3V7AE 5D7KD 4PJAE 1J86A 3V5DB 1F4XL 8FABA 4N5ED 5JHDE 1PAMA 5GGTH 3QXDB 5KVEH 2JE8A 3LPWA 3UYRL 4OZIF 5KSUA 3FFCB 1YEIH 2HA1A 5BRZE 1BWWA 1UGNA 4QF1B 3O4OC 4JO3L 3GSXB 2P43B 1PBYA 5E8DL 3BUYB 3KPOA 4M5ZL 4DGVL 4YXLH 5DK2B 2ZKHH 1FQ9C 1HSAB 2P8LA 4G6AD 4LGPB 2E9BA 2NY6D 4WFED 3QNXB 4QGTA 3UJJH 1OOAA 2DM3A 2AK4B 1S7SA 3QAZB 3IT8D 5BV7C 2VE6B 3H2WA 1JN6B 1E28B 1XH3B 1JN6A 1PSKH 5T5NG 2Q8BH 4ONGL 4PJGE 3IFLL 3VXSE 2H6PB 5GJSL 3NIGF 2PXYA 4XX1E 1JI2A 2I60L 5DRXA 2W60A 3BPLB 4JFFA 3RWJB 3G5XB 2EYTA 2ZPKH 5IMOA 1INEH 3MNWA 3SCMA 2XI9A 1U8KB 2FH6A 2LE9A 1S7QA 4C59B 5D7SL 1NSNL 8CGTA 1A1OB 5D6DA 3U0WH 3VFGL 1ULVA 4G9FB 2EZ0C 5IMMA 4JO1L 3RVWC 2HVKB 5LG1A 4O4YH 5T33H 5C6WH 1A1MB 4ODUA 3EOAB 5E8OB 4KXZI 4OZHE 2V17H 7FABL 5KSAA 3HZYB 4R8WL 3EKCA 1K8IA 4HIHA 3DX7B 5I8EB 1JWSB 1Y18A 1ZSDA 4X9IA 5C7XH 4UINH 5ICXA 3ULUL 1I1RA 3NA9H 1GC1C 2EKSB 4N0YH 1P4IH 2P8MA 3FN3A 2DD8L 2R0WL 4UV7L 4KHTH 3ESVF 1G6VK 4GMSH 3EOYG 3DHJA 1MF2H 2HWZL 3KPTA 4N1CA 3LKOA 4YJZL 1P6FA 4HH8A 4NKQB 1LILA 3O9WB 5EZLB 3VXUA 4Q0XL 5ADOL 5KTEH 4PTTA 3QNYA 1KENL 1JNNH 1QACA 1U92A 2CJUL 4KJQD 4LKCA 4O2FB 4Y5XB 4NKDB 5TJWK 1DR9A 4PRHA 3KYOA 2ORBH 5IVZB 2DMBA 4P2RB 1L0QA 5F6IB 3UC0H 2ZCLL 2C3XA 3IXAA 1HKFA 1GOFA 1U8NB 4QNPE 5B38G 4FQ1L 4RWYL 2R1YB 2FSEA 1R24B 2AQ3A 3ALPA 3BESR 4OB5L 5I1DA 4JFFD 4NOBA 1N3NA 1MI5A 2F58L 2J8HA 4K94H 1MJUH 3V5KB 3CCHA 2EH8L 4K7FA 5E2TL 1DVFD 3DVIA 1CICC 5K93A 2BNRA 4U31A 4X6CB 4XNQB 4PRNB 2OL3H 2NLJA 3S88H 3EJZC 2ZG3A 3ULVF 4MQXC 1GH7A 2A77H 4NQTA 5CZXD 3O41A 1FNEB 4L8DA 4ZUWB 5MI0C 3MROB 2ZCHH 5FM4A 1J87A 3EUUA 4OLYH 2GSGB 3C5JA 3MA7B 3QG6B 2MNUA 3MLYH 4UUJB 3WD5L 1KC5L 1OLZA 4MJIE 3GK8H 1JGEB 2D31A 5FO7B 4NFBA 2HVKA 3LN5A 4HWBA 1A6UH 4C58B 3SDCC 5L6YH 5C0JB 1MCNA 4ZUUB 3CLFL 2LTQB 3T2QA 1FFNB 5HYJE 3KYNA 3KPRD 4XNMB 3REWB 3ARTA 3GFUA 3N9GH 1KPUA 3O2WH 4RDQG 4BJLA 3L3JA 4X9GA 3RUGF 2P5ED 3L3JB 2ESVB 3FRPA 4GLRH 1FH5L 4GRMB 5IESL 4R0LA 1I9RL 2XZQH 1IL1B 2R15A 5IB2B 3TEUA 5F3BA 4ZDHA 1IM3A 4KWUA 4RZCB 3CLEL 2ZUWA 2JJWA 3MXWL 1WBZB 3QPXL 2EE6A 1AIFA 3C5ZD 4PRIA 1KJ3H 4OFPA 5F71A 4Y1AA 3FMGL 3VFWB 5C0CD 3T0DA 5FA4B 5ISZB 2P42B 4P2OC 4HGMA 1YEEH 4W81A 5I66A 1YPZF 5D1XD 3QRFM 3ARRA 3MQIA 1Q9WA 1P4BL 2IANB 2QSCH 3ARFB 4PGDA 1A64A 1N4XL 4LLUA 3EJZD 3LPFA 1G9NC 1T7WA 2BP3A 5IMLA 4M9OA 1X5LA 2BSTA 3ARGB 1NAMH 1I9JL 4HK3J 4EI6A 1H3TA 3G6AA 4OZHB 5DJXB 1G9EA 4ZFGH 3NCJL 2VLKE 1KJVB 1A21A 1T66C 5LGHL 3V6BR 2F8XC 2Z91B 5I1JL 4M7LT 5B3NA 1X5YA 3CZFA 4HH9B 3PWPD 5I30L 2I5YH 4LCCB 3PHOA 4H8WL 1F4YL 1BOGB 3JV6B 4OUOA 2ZG1A 1LEKB 1DQJB 3FT3A 4NP4H 1LE9A 3BGFC 1RZIB 1B0RB 3BQUB 3QDGE 1A3LH 4M5YH 3V6OC 3FJTA 5JXEC 4EBQL 3NVQA 4RFEA 3HZKB 5JO5A 4AMKL 4UTBH 3W0WB 2BDNL 3F6LA 4LMQE 3WEXA 3MUY1 3OXRB 5F7EH 3LY6A 4XGZA 5CUSH 3PUCA 1LEGB 2OJZH 3SO3B 1NC4D 2PTUA 2CIIB 3CX5K 3MFFB 1X5FA 2R1XB 4UBDD 3ULUC 4DKDC 1W0VA 3KLAB 3QEGH 4P5KA 4EXKA 5D8JL 5JQ6L 3WDHA 3VWJA 5I1LA 2EC9T 1OW0A 3WUZA 3KNBA 1XIWB 5DRWB 1JPFA 4DOHE 4G8IA 1D5MB 1NAKL 2NNAA 3N1GC 3WXVL 1DBAH 2FRGP 3VH8A 5AZEH 2B2XH 1U3HB 3W0WD 2NY1D 2R4SL 2OK0H 2BXZA 4Z7VB 5DUPL 4MDJA 2X4PB 3L7FA 1S9XB 4LKXA 4HWNA 4MA3B 2X4TB 4IOFD 3HC4L 4AM0B 5C3TA 5ERWB 5GRUH 1HE7A 5IKCA 4EQ3A 2WM0A 3TO2A 1DBBH 1R3KB 2BZDA 2WIIA 2JIXA 2QQLH 1KJ2A 2WBJA 5JXED 3LQAH 4D9LL 1RK0B 3NACL 3DLQR 3MRQA 4L3CB 2FD6L 2LVCA 3ILPB 5I1CH 3IFOA 1A7RH 3FO1A 4U7KA 5I18L 4YHZL 5MP6L 1TPXC 1GJIA 5C0AA 2O61A 2X41A 2IAND 4CVXB 3HAEH 4PGCB 3CFCH 2R23B 4NWUL 3V6ZB 1Z0MA 4UU9A 3C09B 1CR9L 2FO4B 2D9QB 3QXDA 3BE1L 3SCMB 3H9ZA 2Z35B 3PNWA 4JPWL 2C4FT 2EKJA 2Y25A 1G6RH 3T1FA 3A67H 3KNBB 5E8PA 1CGYA 1KN2H 5F97E 3BGFB 4GAJH 1MRCH 5MHSD 5BVPL 4GAGL 1S7UA 2EE3A 3FB5B 4KTDH 1P7QD 1AGCB 4OFYD 2Q7NA 5HJ3A 1KG0B 4JREB 3AS3A 5E5RB 25C8H 4EUPH 2ZSWA 1GXEA 1URLA 2YBRB 3I6GA 1KBGH 5SWZB 1LEGA 1QNZL 3CVHL 5AZ2H 4GS7B 4YWGH 3DMMA 4H1LB 1AI1H 3NIGE 4YXHH 1OCWL 4MS8C 5IKCB 1LQSR 2BNUB 3VXTA 4RRPG 1HWGB 2H6PA 2WWMC 5E2JA 2P24B 3WIIL 5F9WC 5FFLA 3ARPA 3WKNA 5TDPB 1AE6H 3TM6A 3HMXA 4LCUA 5EU7E 1CGTA 3S37H 1MIML 3HI5L 1EBAA 1OB1B 1EO5A 3RU8H 3OZ9L 3QUMH 3CIQA 5LGJA 4NNXA 4S0TD 4ONHB 2XTJC 4BKLB 5I1HL 1DCLA 4M1GL 2VXQH 4RAVA 3OKOA 4OI8A 1S7TA 2DKUA 3HE7B 4WUKL 5KSVA 4RCAA 1I8IA 2VZVA 2FX9H 3MRJB 5E00A 3D0VA 5TF1H 4RISL 1QLEH 4JFEE 2OJEA 3VG0L 2DLFH 1HDMA 2XA3A 4Z7UF 1R5IB 3RFZC 3CFBB 4DN3L 4KQ3H 3VDAA 3BKJH 2BVQA 5DI8B 3GI9H 5HHOA 4AENB 5LGKA 2R1WA 3O0RH 3BUTA 1IE5A 3TFKD 2ARJB 3MRCB 3KDMB 1NFIA 4HC1L 4YFLF 5GIRB 2DQHL 1EZVX 3O8XB 5I16B 4LPUA 3KWWA 3HB3C 1NC2B 1E4KC 3IDMB 4OTXL 1AGFA 4JM2D 4NNYA 5LBSH 5HI4D 4HXBL 3TNMB 1O7VA 3L5HA 4L8CB 4LSQL 4XGZB 4X4ME 1U6AH 4Q97A 3QEQA 3ULVH 2Y06H 3A6BH 5F89B 3FO2A 3ROOB 1WZMA 4LNVA 2VLRA 1YEDB 3OWEA 5EU5B 4K9EL 2VL5A 3TBVB 5J11B 4PJHB 2XQBL 3K4DA 2KUTA 4P3CH 5K33A 1T0MB 5HSFA 4FABL 2GI7A 5E8PB 3VXNB 4P4RA 5IVNA 3WMSA 2YK1H 4YX2H 5HGHB 3WYRA 1AP2B 2IPKA 4BZ2L 4U2ZA 1BFOB 4I77L 1MVUA 1VENA 5J9PB 2FIKA 4CBPA 2Y23A 4OZ4A 2W0LA 3NN8B 4HPYH 3FQNB 3HTLX 3DNKA 3SJVE 2FH8A 5K9OB 3QXUA 1A2YB 5D7IE 2OM5A 3GI8H 1N0XH 4OSUH 3U79A 4P2OD 4MB5A 2FJHB 1BOYA 3F7VB 2PTTA 3QXTA 1TVHA 3NTCH 4PRHD 5DEFA 3ZHLA 4WFFE 2YPKB 1SHMA 4MNQE 4U0QB 4OCNC 2VLME 5HHXL 2H9GB 2KZWA 1W8OA 1WWAX 3MPCA 3FB6A 3D3VA 5HI4C 4NM4H 3P0VH 4IRSC 4IIQC 3ZTJG 5D72H 1QOKA 4OAWA 2GCYA 4YPGB 4KKNA 4YEFA 3GBMH 2X1OA 4RA3A 3O81A 2DI9A 1OP5K 4DTGH 5DUMH 3VXRA 3H3BC 3PHSA 4JRYA 2VKWA 2APFA 1LD9A 1WFTA 4K23L 4XI5C 4I18A 4KQ4L 5H37H 4MQ7B 2BHZA 1ZANL 1KCUH 5E94A 1GGIL 4G8IB 1MNUH 3VJ6B 1FDLH 5HHME 3KGRA 1KCVL 1N8ZA 1E0OB 4BQ6A 2E8YA 4GS7C 3VDBA 4PJFA 5EUOF 3T8XA 2GK0A 1JPSL 3GMNA 2Y07L 4G6KL 1Q0YH 1FDLL 3C6LA 3MTRA 1ADQH 1ZANH 1LP9F 3TJEL 4NDMA 3IFPA 1WTGT 4LHUA 1JVKA 4WO4C 5CFHA 5T1LB 2J8UF 4P57A 3O3EB 3QA3A 2VH5H 4LLDA 2CKNA 3MJ9H 5TQ2H 3RX7A 3TPUB 1INQB 4HGWB 4QXGH 4PRPD 5D71H 4JHAL 1WZLA 1INQA 1XF3A 4HWZB 3ARFA 4OQTH 2EDYA 3T2NL 2VSDA 3P0VL 2P1YA 2N1KA 4GKSB 1BQHA 1JWMB 3OJMB 1AP2A 2YUVA 3HC0B 2R69L 4K8RC 1ZGLA 3GSNB 3REWA 4TUKH 5FO8A 4ZPTB 3U9UB 2F19H 4XC1H 1ONQB 4WFHD 4XPTH 4RGMB 1F3RB 5D6CA 2HKFH 3Q6GL 1N0XL 3P4MA 2DQCL 5FM5M 1MWAL 3T09A 3ARXA 4N0UA 1WFUA 4ERSH 3BP7B 3LZFL 1D5MA 2NNAB 3O3DA 1CS6A 3P30L 4Q9QL 4NO2A 2HFGH 3QIUA 2JCCE 4M7ZB 3E6HA 1M4KA 5BCAA 2FZ3B 4YDVA 2WINB 3E1F1 2Y36H 4OV5B 2UY7A 3O41B 2MKLC 3PWUB 4F37K 5KSBA 1HQ4B 2Z31C 3P0YH 4QT5B 2XQBH 5HGDB 4ELKB 5TH2A 5D7LA 5IM7A 3VCLB 1XR9B 5JOEA 3SE9L 3O4LE 1JFQH 3F8UB 5CAYB 1EMTH 4RX4A 1FL6B 4N8PA 1BEYL 3A6BL 1OAYL 3MV7A 3IS0X 5FCUH 1UYWH 1U6AL 4WY7H 4FFYH 5AWNL 1F2XK 3VXPB 4YNYB 4QCIA 2R39A 4M02A 3NH7H 4ALAH 5ACZA 4LP4A 1U8LA 1I7TB 5CGMA 2IPKB 5FOJA 4RWHA 4OF5A 1KJMB 2AV7A 3S7GA 3L3HB 3V5KA 3QZWA 5E95B 5BXFB 1RJLA 2ICWB 1ZLVK 5I1AB 5E70A 4JM4H 4P23C 1XGPA 5T1LD 1EEZA 1YJDH 4P3DB 3K4AA 4M03A 3QQ3A 5F1KC 3VI3E 3UTSD 4I13B 4JDVB 4YDKL 1G7QB 4Q74A 4G43B 4Z0BL 1TTFA 4M1DL 4EVNB 3AS1A 5C6TH 2NY2C 4Z8FH 4KXZH 1FNLA 12E8L 3MRBB 4X7EC 4D3CL 5D1ZD 1UCBL 2VXQL 3IDMA 4I2XA 3GBLA 5DHVH 4TVPL 3UTZB 4I5BB 4R6UA 4U1GC 3FO0H 4Z7VE 4KI5C 1C08A 5B39G 1D5IL 4R4FL 1MRFL 4BH8B 2KDGA 2A83A 1BPVA 1C5BL 1XIWD 3S37L 4P2QB 3JTTA 1ZA6A 2VXTH 4I3RL 5KSBF 2W9LA 4PJ9A 4JN2A 5D4QA 3BWAB 1HXYA 1XF5B 2H32A 4HIIB 1FPTH 2HRPH 5TGBA 1CTOA 4JANB 2DICA 1A1MA 2J4WH 4HKXB 4AK1A 1IEBB 5FYLE 3L6FA 3SDYL 4ZDHB 1KSRA 4IRSA 5L2KA 3WN5A 3WFEL 5IK3B 3FB5A 1J7VR 5E1AA 2CK0L 1UXWA 2CMRH 3TFKC 1A9EB 3GMLA 3DXAD 4XCFL 3GJFA 1JZ7A 4I0CC 3VWJB 3PWJB 1FRGH 2NZIA 1BJ1J 3AAZA 3V52H 1BVLA 2VDMH 5L8LB 2EYRA 2A6DA 3OKKA 4Z95H 3HG1D 1A22B 2A0LD 1YYLL 2ITDB 1SJVA 1G6RB 1NKOA 4AIXA 3HC3H 3TT3L 5BJTA 2Z93A 1DBKL 1FC2D 1QFUH 2IPTL 4ZS6D 4EOWH 1BLNB 3RDTC 3IFNL 3O3EA 2VZ3A 3WEXB 3GNMH 4HMEA 3WUWB 4DUWA 3FTGA 1CD1A 3LVEA 3OJDB 2M1KA 5F7YC 3QB7C 1FNEA 2Y72A 4L8DB 3MBED 3WHE0 4ZUVA 1GPOH 2VMFA 4PLJC 1J11A 5EO0A 4JCLA 3MGOB 1H3PH 1P7QA 3L3DB 3X12A 4D94A 4U7MA 5DC4B 1FORH 3ARBD 5I76B 5BXFA 2JB5L 3IDIA 4QKXB 2Z8VC 5EORL 5BZWB 5A3IC 1FO0A 4L4TB 4ODUB 1YYMH 2YA2A 2ED8A 4KRNA 4YPJA 4MQ7A 3VMOA 1G7QA 5GRUL 1OQOA 5CZVH 4XCCL 4WV1C 3GSOB 5I17B 3IVKB 4PG2C 3E8UL 3WS6A 3TO4A 2BOBA 2VDOL 4Z7NF 4RQQB 1OAKL 4XCEA 3ARYA 2LU4A 1EAJA 2C26A 5TDNA 2R4SH 3CXHK 1UH4A 3QIBD 5ID0A 3TGXA 3MGTA 1DBAL 1M6OA 1XZ0B 3GSUA 3WXVH 5SWQB 5DQ9B 4HS8H 3S4SA 4Q6YA 1FNFA 2VDPH 4KI1A 3GSWB 3S35L 4YEEA 4YBQD 2PKDA 2IAMA 4XXDB 5CKAA 2HLFC 3RAJH 3V6OE 3TBWB 1AKJB 1Q9LB 4X4MA 1T0NA 5AYQA 3SDXF 3TP4A 3WNKA 4XP6H 5ISZA 3K8LA 3H7LA 5FDYA 4H1LA 4R2GB 2H26A 2YPLA 5CUSL 5E6ID 1FIGL 3NAAH 3BRGC 1RJYA 4JY5H 4NQXA 4R2GD 3W11D 3MRHA 5ILTL 3BW9B 4P4KC 3ULUF 3GSNA 4Y0GA 3MOAH 1A5FL 4OCSH 1FGVH 3VFVA 4MCYA 3QUXA 1G0YR 5L0QC 3ARBC 4G42A 2VR4A 4B50A 1KEGH 4FQXD 3OKLB 5CEYB 5SX4I 4F3FB 3BP5A 3B9DA 4S1SL 1S9XA 4OCWL 2VDQL 5F9DC 3DO3A 3O6MH 1RJCA 3IS1X 5I30H 4KAQL 4PFEA 5I1JH 4JQVC 3EW3B 3M8OL 1PKQE 3UXFA 4WW1B 3RA7H 2VXSH 1IAMA 4OFDA 4X7DC 4JLRB 4YDJB 4OGAD 4MJ5B 5KSBB 2A9MH 3FQTA 2FHCA 5EO0B 4WFHE 1CYGA 1RIUH 3S96B 3SKNA 4GSDL 3T0EC 3SQOL 3GO1H 1YECL 3DETD 4NHCL 3RVVC 3FHQA 4GG6A 4KV5F 4NQVB 5CLTA 1EUUA 1ERNA 4TUOA 4JY6A 1JE6A 2VIRA 1C8PA 4GAFB 2FEDD 3HPLB 4HKZB 3EDDA 2DTSA 4PJIF 3LD8C 5IJKA 1KJ3L 1G0XA 3GSOA 4FQIH 3CSPA 5KSUB 5C86A 4MNQD 2HVJB 1UB5A 5TF0A 5DQJB 1MEXH 3HI6H 1XCQB 1OGTB 4F57L 5FO8B 4QRPB 5DXWA 3S3PA 3MFGB 3KJ4C 2YN5A 3W11C 2XZQL 3TV3H 1YN6B 3BIAX 4CL7A 4G8EA 4N0RA 5KS9E 4D0DB 1FH5H 5EC2A 1ZWIB 3B8SA 2DF3A 3PGDB 1SEBA 3TBTB 1FG2A 4JB9H 4W4OC 4N0UB 4YK4B 5MI0B 2K1MA 4G7VH 3O2WL 2ILLA 3GMMA 3MODH 4Z6AT 4LCUB 2YD2A 2BRRL 4OCYL 4U1MB 4TNVF 1TCRB 3DXAB 1AJ7H 1QQDB 4U1IB 1HYSC 4LHUG 4M6NL 5DYOA 1CLZL 2H3NB 4HFWA 5DYOB 1U8JA 3D39B 3UTTE 2XY2A 5EIIB 5FHAL 1CLCA 4FQ2H 5HHOD 3H8NA 4Y16A 4Y5YA 2BERA 4D2NA 3SKMB 3QIWC 3NZHL 3AY4C 3PXHA 3ZKSD 2WBJC 4XBPB 2FATL 2FJGA 4WEUD 4WI6A 1JNJA 1YEFL 3QUXB 2A77L 1MFDH 3QNZA 4UDTA 2Y7QA 4UNVA 2H8PA 5JIHA 2V9TA 1CL7H 1WWBX 1I8MB 3O3DB 4QY8B 1MCBA 3EOAA 5E8OA 5EIVA 2V9RA 5IMKA 4ZFOA 4LKCB 2EH8H 3CSYB 1UT9A 4ODHL 2FO4A 2V5MA 1OP3K 1GC1H 4ODWA 4QO1A 4ZTOH 3UPCA 1WC7A 2DQGL 4JHWH 4OIBA 2OTWB 1FLRH 1K6QH 1A6TA 1T04A 4K3DL 5H94B 2YRZA 1XT5A 4ZTOL 1S7RA 5DJ6B 4UT7H 2BVPA 3HS0A 5JW3H 5FA3B 4RGOH 3QEQB 4DUXA 3BKCH 2AXHA 1ACYH 4X5XA 2WUCH 5EZJA 2AJYH 2H2PC 1KB5H 1J1OH 4DGYH 1N64H 1ZHLB 4DK6A 5HVHC 3OHXB 3TJHD 2FATH 3U48A 5JHDB 4MAYD 2LU7A 2LU3A 5ADOH 5KTEL 1EVTC 4J3WA 3SKOA 2BCKA 2VDKH 2YPLB 3BVNB 4LSRH 4FXGA 5CD3A 3FAXA 2Q3ZA 3QULB 3BVNA 4D8PA 2P48B 4I0PB 2Q76B 4CNIA 4M9PA 2PYFB 2CO6B 1CLZH 15C8L 3MROA 1YEHL 3ARGD 4K71C 4M6NH 3FQNA 1AJ7L 4F9PC 1CICA 1VHPA 2ATKA 4A6YB 1ZWIA 1AHWA 3KJ6H 1G9MC 3MV9B 1U3JA 1U3HA 3QIWD 1T20A 1FO0B 2B20A 2UWEF 4XP9H 4G7VL 4TSBL 1PY4A 3NA9L 4JB9L 1AGDB 4L9DA 2D4DA 1HHJB 4IRZL 4TNVK 3ZDYF 1MAJA 3VFMA 1MQKH 3P40A 1RZKC 3BD4A 2IPUG 2FDBP 3TNNB 2V17L 4JZJA 3NIDF 2OJEB 2WSKA 4O2EA 5IEKA 5DD5H 3KJ4B 2FYYB 2MKWA 1FBIL 4K94C 2PYEB 2R9HD 3UAJC 4JFYA 3WFCL 3IDGA 5BV7B 3AUVA 2ADIA 3FRUB 1ES0B 4ISVB 5IQ9A 3PIQB 1IQWL 1K8DA 2R0LH 4F7EB 43CAB 5GJTL 1S9YB 3U36B 2V9QA 3UO1H 1Z5LA 1ZVYA 5D96B 3UJIL 3UYPA 1BD2A 1ZA6B 5JXAH 2ZPKL 2Z93B 3RIFK 2EDTA 2X89A 4LHJB 4FFVD 4NPYB 4NSKB 1FFQA 3QXWA 1ZHKA 2PCPA 5IT2L 3IFLH 2PCPB 4NM8L 1M05B 3CFJA 2MWCA 3Q5YA 3FTGB 4V1DA 1J1PH 4CDGC 1TETH 3INUL 3D18B 3HR6A 5HHMB 1CLOH 2CXGA 1WBXB 2C7UA 1HDMB 2VO5A 2ITCB 1FP5A 3RA7L 4APQC 3SDXA 2X4QB 2CXKA 5D7JB 1T04B 2ZKHL 4P9ML 4WVRA 1DQML 4MXVF 1E4XL 5IB2A 3U4AA 2BVOA 1IEBA 4L29A 4R0LB 4HF5L 3QQ3B 3F7YB 3PGFL 5E8NA 3PHQA 4PJXE 3MRCA 5HHOE 6FABH 2FO1A 4O02H 4WWKD 1MRDL 1OTSD 2K9UA 1AGDA 4X6DE 3C6LC 4WTXA 4PJIA 1V3LA 1UEYA 4ZFFA 5J13C 4G8GA 3OJ2C 1A5FH 3ARED 3R0NA 3BDXA 5DJCB 1NCUA 3RP1A 1KELH 3GM0A 1E28A 4LAQL 1X4XA 1P7KA 5ALBH 5DGRA 2EE2A 2RR3A 1I85C 4K7PY 4P4KB 3SE8L 1SQ2N 4MJ4A 3BH9B 2JIXB 3HUJA 2GFBB 1IT9H 5F7LB 5EIIA 1FNGA 4I0PA 4R26H 3U36A 3IU4H 1XCTA 2AXJA 1HHIB 5CJXC 3DGGA 4LOUC 1SJHB 4JZNB 3UDWA 1C5DB 1P1ZB 3RWFB 3HMWH 2IG2H 4DJMA 2IAMB 1BAFL 2XXCB 4J12A 5GSRB 3RAJL 4Q2ZA 5E2WH 1H9VA 4PYGA 3NMEA 4NQDE 2DRUA 2R2HA 3VFMB 1JZ3A 3FRPG 1HHJA 2WWKO 3VGHA 1YDPA 3L3HA 4MYWB 4ORGB 1U8MA 1MCSA 5C3LD 3MREA 2BY0A 3R8QA 2V5RA 3MOBH 4ISVA 3HE6A 5J6HB 3ULSB 4XWOC 5DQJA 4RIRA 3VFOA 4MDIA 5FB8A 4DN4L 1T2QH 4NQCD 4NUGH 4PY7A 5DDHA 4NCC1 4FFZL 4G42B 3LCYA 3WJLC 1IGML 1B0WA 4ONFH 4X83A 4HJ0D 3C6SB 3EJYC 1A9EA 3TIEA 2CKBL 1HINH 5E9DD 5B21A 5JA9A 2RB8A 3LKPA 3PWLA 5EORH 3PWPE 2HH0L 4R4BB 3T0ED 4LASL 4PD4K 4LEOA 5LQBL 4GG6F 2Z8WC 3HZMA 5T3ZH 1J0YA 4FQJH 1TJGH 1R3IH 1KJ2B 2C7UB 2HT2D 1DFBH 2BFVL 5EOCL 3V5HB 2WANA 4JRYE 1I1AA 5DJAA 2D9CA 2JK5B 2L7UA 4EIZC 5A2FA 4QRQA 3MJ8B 4JRXA 2VLRE 5HVFB 3WLWC 4HEPG 3BYYA 1X7QB 43C9B 1KF9B 3I2CH 5BRZA 3CVIL 2WZPD 2J2ZA 1GAFH 3QDJB 1S7VA 4PUBL 3BAEL 1ZHNA 3R8BB 4P23A 4Z95L 4IEFB 1UFUA 2BJML 3QZWB 4OGYH 2EC8A 3W9EB 2ED7A 1DDHB 4LLQA 2DM2A 1NC2D 3V4UH 5B38A 3U1SL 5BV7L 2RHEA 2B5IB 4TOYL 1KNOB 4TSCH 1FVDA 2R0KH 3KYKH 3FOLA 1L7IL 4KHXL 3IDGB 4Y19D 5DZNA 1Z9LA 3DTXA 4NN5C 3SHSA 1Z6JT 3RWCA 4WUUD 3QWOB 3WFEH 3EOBB 3KPPB 1DQDH 4PJ5A 3MYJB 3FOMB 5M95B 3P9LA 1HHHB 1NL0L 4JN2B 3DXAE 4RFEB 5JO5B 5J56B 1RY7B 3D85A 1AGFB 1C08B 3EJYD 1NGXA 2JJSA 1LP9E 4FZEH 4LSSH 1EHLL 3BD5A 4ODTH 5KJRL 4KK8C 1MRFH 3UTOA 4KUZH 5GS2H 3LS5H 2CIIA 4OJFL 4NUJA 3FO0L 3BPNB 5DA4A 2VZ1A 3E6FB 4FXKB 1RIHH 2V2XB 3FQRA 3QG7L 5L2JB 3VD3A 2C3VA 4LVHC 4GQ9H 5GS0D 4QTIH 2W38A 1T1WA 3DMMC 4EJ1C 5C6TL 2GK2A 4N8VB 4M1DH 1SY6A 2DIAA 4F7CB 5IMMB 2ITDA 5C9JB 1IM3B 5TDOA 1NCTA 1NANI 4HAFA 2OR7A 1ORSB 1T66D 5LJYH 1LO2L 1XF1A 4OBRA 1TZIB 3DRQA 2PW1A 3SY0B 3MACL 3F12B 1B6UA 3KPNA 3MX0A 3OX8B 4LCCC 2E7HA 5D7IB 4Q9CA 2XTJD 1YUHB 2GTWB 3MACH 1KJ2L 5BO1L 2DIBA 1L0YA 4NKIL 4AIZA 4LPWA 5TDPA 2WWKT 4MJ5A 2H9GA 2XXMB 1JTTA 2VYRE 1WWCA 1UYWL 4KGLA 4Y2OA 1FE8H 4JG0L 1Y6NR 3QG6A 5F1NB 4X4XB 4PJFE 3L5XH 4M8QA 2MCPL 3VFTA 4GQ9L 2N56A 4PJDA 3QI9D 3QG7H 1N5YL 3OJVC 1WZKA 3RWEB 4WHYH 5J12B 1A0QH 3EDKA 1DE4B 4Y5YB 4X6BA 3RZCD 2XT1B 1FSKB 1TPXB 3NA4A 4ETYA 1I1FA 4ODTL 5KJRH 1EHLH 1F4WL 3NIDE 1WTLA 2QHRH 3IJYB 1BOGA 5J1SC 5A16A 2HFGL 4P49A 2Z35A 1FZKB 3RKDC 5DEZA 4AL8L 2VWEE 3BHBB 4ZFZB 2YR3A 4NN6B 5I8KL 5IBTH 4F7CA 4XRCB 1G7LA 3TA3B 3DMMD 3VXUD 2VC2H 3G08B 1BFOA 1T4KB 3REVB 3WN5C 3SDCA 4TSCL 4G8FB 3LEXA 2XIDA 5INDA 1UZ6F 4M4RA 2IALA 5DR5L 3UBXG 3ZYZA 3LKQA 4GW1A 1U3HD 2H32H 5LWYL 1JPGA 4IJ3B 3B9KB 3X11A 1GAFL 1QR4A 1TNMA 2VLRB 1NGQH 4QXGL 5INCB 4DOHB 1FHGA 2YPKA 1NBZA 3G04B 1TLKA 1SJHA 1ZEAH 2B1AH 5IHUH 4TUOB 1S9WA 1U58A 3MJ9L 5TQ2L 2CLVB 4C55A 1RUMH 2AK1H 2F5AL 1QSFA 3BRDA 1EERB 1UADC 1WGOA 1I7RA 1NC4B 5HY9A 1A7PL 5FUOH 4NO0B 2CRIA 4FQXA 5IB4A 1R3IL 4J3XA 1AGEA 1SBSH 2O5YL 2LQRA 1E4WL 4XNYH 1JWSA 1Y18B 5JLZA 5L9DH 4OT1L 5DWUL 3C2AH 5LQBH 3HA0A 3JV6A 1TZGH 2NXYD 2OTUA 4N68A 5GZNC 3D69A 1OAXL 1BD2E 1KCVH 3RKPA 4JZOA 3KYMB 3S9DB 1IGMH 4GG8B 1YEKL 5IIEB 3UJTH 4TTGA 1NLDH 4Z7WB 2NTSP 2YXMA 5D7KE 2GTZA 5JHDD 2NY6C 4M1CD 2Q1EA 3LB6C 2P47B 1XF2A 4DTGL 3TNMA 4LSUL 2BCKB 1MCPH 1BZQK 4J1UA 1FYTE 3X13A 1H3VA 2IGFL 4XTRC 3N50A 1JHTB 1NGZA 1AR1D 3N0PB 2I07A 2HAZA 5CIPH 2R2BA 4B53A 3HAEG 1CDJA 1IGYA 3QA3B 2VAAB 5AG9A 2A1WH 2F8VA 2IWGA 1PZUB 1BZ7B 4Y2DD 1BAFH 1JGDB