5J56B

Rta-v1c7
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
AQVQLVESGGGLVQPGGSLRLSCVASEFSGFTLDYYAIGWFRQAPGKEREGLSSISSSSDGFTSYSDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAARLGGWASFSPQEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Structural Analysis of Single Domain Antibodies Bound to a Second Neutralizing Hot Spot on Ricin Toxin's Enzymatic Subunit.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 36
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2016-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j56B00
5EU5A 3VRJB 4XP6L 5MP6H 4ZFFB 2Z31B 2GEEA 2HKHL 2H26A 3PNWA 1IGTA 3NPSC 4U1SB 3ARSA 1HIML 3VH8B 2OMBA 2IADA 2C4FT 1DSFH 1LEKA 4AM0A 2N56A 2GFBB 2XT1B 3BEVB 6CGTA 5IVNA 5I1LB 4YHKL 3QJHB 2NXZC 2J4WL 1FAKT 3RWCA 2NY0C 4RRPA 4I18C 5F7KC 3I3BA 4GKOA 5CGYD 4L5FH 4LPUA 3K46A 4Z95H 4XTRC 4YR6A 3P9MA 4JO3H 4IHOB 4LOUC 5DHYB 2XN9A 3O9WA 4XPHH 4F7CA 1Q1JH 3P4OB 3C5JB 1MJUH 1JNLL 2DN7A 1I4FB 1XF2A 1RIVH 4QXGL 4PREB 3TWCL 2H9GB 3QFDB 5B38G 3WKML 3GRWH 4S1RH 1BVKB 4ZOAA 5D96C 1FLRL 4QOKA 2Q8AH 1J1XL 4JN1L 4Z6AT 5HI4D 4K7PH 2OZ4A 4OD3L 3KJ4B 2B2XL 3I3DA 1IZJA 4N5EC 3W11C 4HWBL 4L8BA 3RWIB 1GC1H 3U83A 5FB8B 5M95B 1I85A 5I18L 3G6AA 1KIPA 3ZHKA 4OLUH 3QJFA 3MNZA 1JZ7A 1RURH 3MV9E 1RY7B 5DRZA 2ZUXA 5F3BB 1OAXH 1WWWX 1SEBB 5I8KL 4HWEH 2DQCH 1A6PA 3WO3B 5HTSA 4UUJB 4PG2C 3U4EB 1A6WH 5INCA 2Z8RA 4MHHG 4FQ2L 1NCWL 1GC1C 1NGQH 1NC2A 2LAAA 4Y19E 4Z0BH 2BC4A 2JJTA 2MKWA 1G7JB 1BGXH 2PN5A 3QYCA 4IS6B 3QUYC 1RJZB 4LBEB 4NKMA 3JV4A 4GLRI 2NZ9D 2R4SL 5A2KH 4F3FB 1HXMA 4JFXA 1T03H 4PJBA 4WTZA 5IVXE 1AGBA 3NCMA 4CDGC 1WC7A 2YZ8A 1AC6A 3QNZA 3BDBA 3CXDL 4G3YL 3TA3C 1AGDA 3UZEA 5FF6B 4LHQB 5C6PB 2M26A 1B4JL 2D7QA 1XR9B 2YSSA 4Q9BA 2WBJB 5DVKA 4G9FB 3MODL 4PV8B 3LKRB 4F9PA 1OGAA 3TV3L 3SJVD 4KI5E 3SKOA 1ZLSH 3GJFA 4JG1H 3X3GL 3MRIB 1FNHA 3AREC 1JWUA 3KPNB 4C56A 5TQ0H 2C3GA 3H6JA 1D5ZB 4MJ4A 5F93C 1IEHA 4O51B 1FVDA 3TBVB 3MXWL 2E9IA 4JRXA 3H7BA 5EUOE 5FCSH 1QFWI 5SV3A 1NGWB 2HFTA 4LVOC 3EDFA 3KAAA 2JB6B 4HUMB 4N90D 4XP9H 2FO4A 5KVMC 2W9LA 3P9WB 3P11L 3EDEA 1A6AB 1HDMA 4U2ZA 3PQYB 4RFOL 5JXAH 4F2MB 1HN1A 2H3NA 5HHPA 1CGUA 2PXYB 3DYMA 3KJ6H 5D70H 1S5HB 2GJ6D 2F5AH 3R0MA 2PO6C 3N06B 5I19H 5CD3B 4MS8D 1AO7D 3BPLC 2V7NA 4L3CA 3O45B 1OP3K 1P7HL 1D5BB 4G6JH 3V6ZA 1DQTA 3UJIL 1HI6B 4BH8A 3JUYA 4NQXB 3O2DL 4OZFB 1YPZF 4X5LA 6FABL 3UC0H 5MEOB 2OL3H 4U6YB 5F9JA 2AXJA 4L4TB 3P2TA 4X80L 4RGOH 5GS1A 1H0DA 3CJJA 1MHHB 4ETYA 2ADJA 3S5LB 4P5TB 1GSMA 4KK5C 4M1GL 5DO2C 3HC4L 4RGNE 1ZHNB 3GJEA 3MRGA 5FCUH 2P24A 4FQIL 4X6DA 1OLLA 4XAKE 2EH7H 4NQCA 3Q6FA 3BEWA 3RNKB 4U7SA 4X7CC 2QQQA 5IMLB 1NMAH 2DLGA 1G7IB 4FTVE 4UBDD 3VWKA 1BJ1H 4ENEC 3STLA 1I1YA 1OAZL 4YFEA 2CMRH 4NDMA 3AMKA 3OXSB 3P4LA 1ZSDB 1BQLH 2K7QA 4LCWD 1N4XL 2KUTA 1FYTD 5DTFA 3VE0A 1RMFL 5GZOC 1M7IA 2ORBL 4I0CC 2X4OA 5T5FH 1PBYA 1H15B 1I7RB 5FKPA 5GZND 1KG0B 4AQ1B 1FPTL 4IEFB 5IVOA 2CK0L 2BVUA 5BZWB 4PP2A 3VXPA 1AD9B 3L3HB 1U93A 4XPTH 2FB4L 1YMMA 5GHWH 2XTJD 2AGJL 5JQHC 4Q6IA 2DQFA 4Z7QF 4U05A 2CLRB 3CUPA 3QQNA 4MB5A 4PJEA 3GSNH 1TQBC 3T1WA 1J1PH 1RD6A 3U4AA 3IB4A 4L1HA 3MV7E 4HT1L 2FLBT 2ZPKH 3VWJD 1HINL 1DFBL 2BNQB 5DD1L 5ALBH 1U6AL 4P4RA 4D9LL 5C0GB 1U9KA 3Q1SH 3RZWA 5KZCB 3A67H 4M8VA 2VXUH 4XBPB 1CICD 3FQUA 1D5XB 3OGCB 5T33H 3HNVH 2R1YB 3DVNA 3OR6B 2H45A 5AZEH 2AKRB 5DA4A 1WCBA 2GK2A 4PR5A 2XNAB 4MD4B 1SHMA 4BZ2L 3MGTB 2WAHA 1JE6A 5ESQB 4QXTA 1NGYB 1YNKL 3AAZA 1NUNB 3F62A 3QUXA 5F7YC 4S2SA 1F4WH 4KVNH 2P45B 3I50H 5TQ2L 2B1AH 1YPZB 4DVBA 5FECA 4YXHL 3C87A 4LF3A 3RZCC 5DHXB 4UTAH 5DJAB 5K9KB 5JHDE 5KVDL 1U8LB 1XGQA 2ZOLB 3RTQB 3VFNA 3FFDB 2GTWA 1N3NB 3BO8B 3OJVC 5FM4A 4NYLB 4JR9L 5GPRA 2E6JA 5EN2A 4PV9A 1XGPB 3QXWA 1T5WB 5IJKA 5AUMB 5D1QB 2OR9H 2YOCA 2ADFH 5LKNA 2XZAL 2RJMA 4Z76B 1EO7A 1Z0NA 5J6HA 4OKVA 4MNGA 1F4AA 5D7KD 5D93B 1SEQL 1T5XB 3MUHL 5ADOH 3CDYA 4L8SB 2DKSA 3C5ZA 4WUUE 2B1HH 5KBNC 1QNZH 3OV6A 5IBTH 3QUMA 3HZKA 3IJSB 1FO0H 3L9RA 4MD0B 5LCVL 4BA8A 2GI7A 1JZ5A 4Z77A 4ZFGL 3SCMD 5IMMB 4TVSa 15C8H 3DX6A 4NQEE 4PJDE 2YPVH 4NNPH 1W72H 3L5XH 5CZKA 1XGYL 3F12A 2X7LA 4MB4A 1TJHL 2VABA 3S3JA 5DK2B 4NPYB 3VJ6B 4ZTPL 4C55A 1EHXA 3JWOH 3VRJA 1GOFA 2BRRH 1VGEH 4WWKC 5I6XC 3UTQA 3HI6H 3ARBC 3K8MA 3CH1B 3QNYB 2VKWA 1MAML 4JAMB 4XWOD 4U1SA 1MHEB 4AEHH 1BEYH 2YUZA 2VWEC 1OW0C 5IIEA 3K3QA 3MBEB 4R6UA 2DQTH 5L88L 4W6YB 3BWAA 3CFBA 5D7IE 5EPMB 4CN1A 4BJLA 1T0MA 2I9LB 4D8PB 3JWOC 1QBMH 2ATKB 3QJHA 4KRPD 4P9ML 3FFCA 3VXUB 4UT6H 3NIFE 3LDBC 1BBDH 2VAAA 3T0EA 1HH6B 3DUUB 5DVLA 1BQHG 3EYSH 4U33A 3AGVA 43CAA 4W70A 5I75C 2IANA 4BQ6A 3O6FC 4P23C 3PE9A 4M8QA 2VDML 4LIQH 2A73B 4YBHA 3C5JA 3PWUA 4QXWA 3MUGA 4N0RA 5EU7C 3H9SE 3P3YA 4DAGH 2H9GA 5F7NC 3QFDA 5JW4Q 4BSJA 1IGJA 3G5XB 3BN3B 5CBEB 1MNUH 2VUYA 1NJ9B 3BH9A 4G7VH 4PJ9B 2VN4A 1UXWB 1T2QL 3TFKD 1JK8B 1WT5C 3O8XC 4NZUH 3VG9B 2LVCA 5FYJH 5JIIA 1U8NB 3E3QC 3MREA 2VRAA 3RWIA 3BRFA 3CVHL 3C08H 1IEAA 5ISZE 2H32H 2R2BA 1Q0YL 3QIBC 2ICWA 1NFDA 3EYFB 4BSWA 1T21B 3ARFB 3Q5TA 4JQXC 4DKFH 1MCOH 2YEZB 3B9AA 4LMQE 4XX1E 4XNQA 1HILA 1KENL 3VFTA 4DWHA 1MCIA 2R15A 2PW2B 5DMYA 5BW7C 4JJ5B 4OGYL 3OWEA 4NRXB 4Z7VB 3MOBH 2Z92B 3SE8H 1HH9A 1WZ1H 3SDXB 3VGBA 4ZSOE 2ESVB 4OLYL 2HLAB 2IAND 4IS6A 4G8GB 4HUWB 2COQA 1JGDA 4L3EB 1H8NA 4HC1A 4F3FA 5TE6H 3QDGB 3F6IA 3SPVA 1I1FB 2YN5A 4YFLF 4E42B 2HH0L 3BP6A 5TE7L 5E2VH 4NUGL 5GRVL 2XQBL 1J86A 1XCTB 4XNUH 4KUCF 1FVEB 1XR9A 4RZCA 1P2CA 4M7ZB 4NZJA 4HUKB 5GS2D 4K9EH 1R3HB 3BIKA 5LJYH 4G9FA 3RJDA 4LRNH 3VXME 4HXBL 1LP9B 3DHJA 3U2SB 1P7QB 2VXTH 1LO3H 4PG9A 4QRPB 1KCVH 1RZGA 1ZE3C 3MRIA 4GKSA 5E00A 5I1AA 3J7HA 4H1LB 5D5MB 3QHZL 4FQ1L 2NX5A 3REWA 4MNQB 3G6JF 4K9EC 2D0GA 3TBVA 4HH9A 5IW3A 3UJTL 3OJMB 2OI9C 2RCSL 4AIOA 3BESR 2Y36L 4OZIA 2WUCH 2JB6A 3VDBA 2VDRH 1BFVH 3GM8A 1A6AA 5SX5K 4F2MA 1HHHB 1C7SA 4V1DA 5SWQB 1NH6A 4NHCH 5J1SC 4YDVA 1B9ZA 2XFXB 2ZCHH 1NBQA 3S96A 3BKYL 3GHBL 2AXGA 4MAYB 3U1SL 3BP7B 1DBJL 1MWAL 3PWLB 5IEKA 2MTPA 3ZKSD 2NXYB 5DQ9B 2NW3A 3C9NB 1RZIA 2D7TL 4GBXC 1QSFE 1XF3A 1IT9H 5I1EL 1MJJB 4M4PA 3DBXB 3QEQB 1L9NA 3REVB 1I9JH 4NQXA 2VZ1A 2V5YA 2C3VA 1MIMH 3MRBA 4J1UB 4YHYC 1GZPB 4APQB 2VLRD 3B6SB 4YIQB 2AK4B 5DJ6A 1INDL 5MEOA 2OJZL 3HC0B 4AEEA 1AHWB 4OLEA 2V2TB 1GGCH 4X4MA 3KYAA 2BXZA 2MCPL 4M6NH 2NX5D 1KTRL 1G9MH 1I3RB 1MHHA 4ONOA 4MXWL 4R9HA 3WS3A 3IFLH 4P5TA 5JHLH 3MCLH 2R69L 3MOAL 3CK0L 5DZLA 2J2ZA 1HE7A 2VERN 5E6IA 3TBYB 5F3HA 5HHME 3RA7H 3D0LB 1HHKA 3TPUB 2W9DL 2AEPH 3X14A 3EHBC 4P4KA 4G8FB 5H37H 3F7VB 2FO1A 1G9MC 3D0VA 2A6KB 4MNHB 3C6LD 1GGTA 1UQSA 4TNVF 4XPAL 1OF2B 2ED7A 3AB0B 5GIRA 4H0GA 5BS0E 5HYJB 4OI8A 4P49A 4PJIB 5I18H 2DWDA 1N5YL 4KXZH 1ZSDA 3DETD 1IAOB 4RMRA 3MJ7B 2NY4C 2VDPL 1IC7H 1KBGL 3EZJB 1UWXH 4G9DB 2N4IA 3MO1A 5MEQB 1KG0A 5BZWA 4YGAB 3OTTA 4ZPVB 3T2NL 1TMCB 5KVEH 3LKQB 2DD8L 2BK8A 1H3GA 1UB5B 4HS8L 1F6AA 1Q9KB 3QEHB 1QEWB 2QQNL 4MXQD 2VZSA 4C83B 1G7MB 4R26L 3TJHC 1UWEH 2BVPB 2CLRA 4ODSH 1AFVH 2A1WL 4ZAKC 3GSUB 3IYLW 2PCPB 4R7NB 4H25A 3QCTH 4NFCA 4YHZL 3GO1L 4MJIB 4MQ7B 3GIZL 5M7QA 2R56L 5C0GA 1NLDL 3O0RL 2FATH 4Z8FH 2FSEA 4CL7A 1MCJA 3QQ3B 5IKCA 4XBPA 2YHGA 1A2YB 4JREC 1D5XA 4JM4L 4QCIB 2FEDD 2I25N 2ZZUT 2R1YA 1IQWH 3B3IB 4PBVC 3QIUD 3D9AL 1WFTA 5E9DA 4Z7WF 1A1NA 4EI6B 3NIGF 3CH8A 5FDWB 1QOKA 2O5YL 1IGFH 4LPCA 2VDKH 3V0WL 1U8PB 3H9HB 4JEGB 3C8DA 4ZUVB 2YPLE 4X7TB 5IQ9A 3WCYA 1TVHB 2FEEL 1CL7L 1YPZA 1HQ4B 2R9HD 3FKUS 4TNVK 3GSWA 2GSIB 4EN3D 1OSZB 3DO7B 4Z9KB 4KDVA 32C2B 5KN5B 3GDBA 4CJ1A 4OJFH 1TZIB 3C5SA 1YYLH 3FFDA 3BO8A 5JUEH 1D9KA 1KSRA 5FO7B 2F15A 4RFNB 1F42A 3PIQA 3V4PL 3WFCH 4ZODA 4LCCA 3RQ3A 1UXSB 4JN2A 4XP5L 4XMLH 1T5WA 4DOHB 5AUMA 3SJVB 2D4FA 4PGEA 2J5LC 4J3VA 5B8CA 2CKBL 3BPCA 3DRTA 5I30H 4M7LL 5CEXB 1KIQB 3LD8C 4Z76A 7CGTA 5HHXH 1QLFA 1JL8A 2R0ZL 2D7OA 3THMH 3MLTB 3TEUA 3VXRE 2AQ2A 3EJJX 1JGLH 3GSOA 2CXKA 1E4XH 4MZ2A 3MLUL 1KACB 1OOAA 2AJYL 4ZUTB 3ORJA 4EI5A 4OZGF 1P5VA 4NO2A 1GAFL 4XBEH 2AEQH 4Y2DA 2ADGA 3DX7B 3EZ8A 4WFFD 4Y16B 5DD0L 3WFZA 4NPYA 1TPXC 3S97C 1T1WA 3RIFK 3VFUB 5EOQH 3WJJA 5C7XL 1AO7B 4R4FL 1UA6H 4WGVB 5GJTL 1E4JA 5MHSE 4J23A 1KYOJ 1OAQL 5HGBB 3OKMA 5D2LF 1L7TH 3MBEA 3PP4L 3JWDL 3BD5A 2GK0B 2V5MA 5MERA 5EPMA 5CZVH 1DCLA 1JNHB 4ZUUA 4D8PA 4KXZI 3PV7A 3S7GA 3G5ZA 2EXYC 1WBYB 4G42B 4P46C 3SE3A 1MJ8H 3VXUA 3MV8A 3MRMB 3H3KA 1CXFA 2A83A 2E7MA 3STZA 3LB6C 3FQXB 4QOKE 4YDIL 2LTQC 2NY6D 3WIHL 5DC0A 4RDQG 4BQ9A 5E70A 4U1GB 3ARDA 4JFEA 4MVBD 2ITCA 4TNWK 4FQCL 3RWJA 5DD3L 4R0LB 1NJ9A 5EBGA 5JPMB 1Q0XH 2AK1L 4JY5H 3W9EB 4RIRA 3Q6GH 3M17B 3L95B 1WIUA 4OQTH 3I6KB 5HHQB 2HRLA 3QPXL 5HHNB 2M1KA 4BK4A 1F58L 4IOSD 2VISB 1KV3A 1ZT7B 4XVJL 1NCCH 4JFYA 2W60B 4LEOA 5IJVB 2XTJB 1CVRA 3FZUD 4ELMA 1ZLUK 2W1NA 4IDJL 4KQ3L 2D9CA 3HLAA 4O9HL 1EUUA 1I8LC 2NQCA 5BV7H 5BMFH 2PW2A 5C0AD 1DE4A 4JJ5A 1A1MA 1C16A 5DURD 1MF2L 4PYGA 1BX2A 2ESVA 4YXHH 1UENA 1RZ8A 3B9KD 4PRHD 1U92A 4JGMA 2OM5A 4ZG1A 3LPFA 4L3EA 2YR3A 3QWRD 5IR1A 3PWJA 4POZC 5FYKD 1QRND 1RZJL 4RGNC 3LHPH 1N59B 1V7MH 5BV7C 3BQUC 4WV1C 1JNJA 4E42A 5KSBF 1CICB 3PL6D 1QA9B 5DK3A 4C56E 3BYTA 5T3XD 2XI9A 3BN9C 4ZXBD 1S78D 3D69A 3K0WA 2NY1D 4P5MB 1S9XB 5F8RC 4JQVC 5FK9B 4NZRH 3K7UA 4PRPE 4JKLA 1CFTA 4QTHB 1A9EA 5C0RH 3L7EA 5D2LB 1FL6A 2ZSVA 2IPTL 1LDSA 3U2SA 3VXTA 4EIZC 4LRIC 1E4XI 3IU3B 3CD4A 5GGTA 3HMWL 3QQ9D 5HI5D 1CZ8L 4H1LA 3VDAA 3TPKA 2FBOJ 1BIIA 1A3QA 2LV4A 4IJ3B 3FN0L 3FO2A 1F8TH 3GMRA 1JGVL 4MNQA 5LQBH 3OAYK 3V6OE 4N0FA 1ED3A 1QFPA 3BYYA 4YK4C 3VXSD 2ED9A 2HVJB 3AS3A 1IAIH 4LFHG 4JKWA 5BXFB 5DYOA 4Q9RH 1FAIH 1HHHA 1DEEA 4GRWF 3W5MA 4LSQL 4JFPA 3VFGH 5SWQA 4XC1L 3LS5H 3O11A 3PWPD 2X4QA 2YRLA 2EYTB 3AU1A 3TBTB 1EMTH 4P2OC 4ONHA 3HE6D 2FYYA 3RVTC 3MQIA 3V7AE 5DMKB 3PWLA 5EBLA 5GRUH 5BRZB 1URLA 3MUZ1 3ZYIA 5FGRA 5EU6D 5HHOA 3ZT6A 4WHTB 4OLVL 5SWZA 2JELH 5C07A 3SOBL 3VXNB 3SCMB 1L6ZA 3DBXA 3EOBA 3QEQA 3ARQA 3NFNA 1MI5B 3BRDA 4J1UA 5D4QA 1GZPA 1E4KA 3EFFB 3DTXB 5DT1L 2WLYA 5CP7B 1KGCD 2Q6WB 4QHMA 4LU5L 3VI3E 3BPNB 5C9JB 1AHWA 1YQVH 4Y5YA 1A7RH 4JRWA 4K94H 1AR1D 1RULL 3CDGA 2VZ3A 1CFVH 5GGUA 4LLWB 4S10A 5KANI 4R4BB 3TBSB 4XC3H 1IAIM 4RMWA 5IFHH 1S7UB 3TPUA 3ZKMD 1JV5B 3DROB 1QZ1A 4WIQA 4FZEH 4KRPB 4K94C 1MCEA 1PG7H 3LN9A 4Z78B 2A6KA 3DGGA 5FM8A 5KSBB 5J11C 3BDYH 5IHLB 4FFYL 1OF2A 3ALXA 3KYNA 3QDMB 3U0PB 4J4PD 5HYJA 2QQKL 3MX0A 3O6ML 4XXDB 1T04B 1YDPA 3HUJA 4HDIB 3O6LH 1HKLL 2C3XA 2XQYG 1L7IL 4XI5C 5MEQA 1KENH 1TTFA 4PJGF 2Q7YB 3SHSA 1MHCA 4R97C 1KPVB 3QXDA 4FXKB 1RZKH 4ZPVA 4A6YH 3ULVH 1KCLA 2EDRA 2HTKC 2X4NA 4OAWB 3TNNB 5L6YL 1HSAB 2E8ZA 4YHPB 5FOBB 1UB5A 3G6JA 4NNYB 4NN6C 2KPNA 2R1XA 4JZJC 1PKQA 5ALCL 1G7MA 2BVPA 1ZS8A 5HPMB 1C12A 1IL1B 4NCDA 1RHFA 5IWLA 3GSUA 1NGZA 4XMKH 1AQDA 4GO6B 2BNRB 4R7NA 4DZ8B 2NY7H 1RZKC 2BCKB 4MJ6B 1RIUH 3ULVC 4MJIA 4MQ7A 3MSPA 4D9QE 1A8JH 4OV5A 1FIGL 5TH2A 3PHQB 2YPKA 5J9PB 3QQ3A 1BAFH 4LLYB 1CDJA 3FT2A 4Y4HC 3EYOB 2LU3A 2DOCA 2HWZH 5L8JB 4S1DD 3B3IA 4OGXL 3NFPB 3WXWH 4HFUL 3UCRA 4QO1A 4KZDH 3V9FA 3MRHB 3NA9L 5FDWA 1S7WB 4PP1D 3SO3C 5D9SB 1U8PA 4G6KL 4JLRB 4X7TA 3P77B 3RI5F 2GCYB 5HI3C 2W65A 4J12A 1JJUA 1PSKH 1IGCH 4YDJA 3GSXA 1YNTA 3OKLB 32C2A 4S1QH 3VRLF 4XCFH 5FO7A 5I1CL 3FO1A 3WFDL 2CKNA 3CVIL 3S36L 4Z0XA 2CIIB 4IMKC 3C60B 4ONFH 1SYSA 1CXHA 3F58H 4DQOL 5H37G 2YMXL 4K3EH 5I1IH 4PJAB 3TJEL 5JXEC 2IMMA 4G6FD 1UJ3A 4U4BA 2HFFB 4X7EC 5JO5B 1J11A 1UWGL 4U1JA 4M9PA 4K7PX 1KJ2B 2PR4H 2DQHL 3MA9L 3TGXA 1Z9LA 4ZYKA 3E2HC 3MLXL 5B3JF 5D1XC 3WUWB 3G08A 1V05A 2YRPA 4XB7A 4MX7B 3BAEH 2Z0BA 2DMCA 1U8QB 1CFQA 2I07B 2A6IB 3ARGD 1F3JB 1D5MA 4HCRH 3DX7A 2YA1A 4MQXD 4Y1AD 4Y16A 4EOWH 5C0DB 4B7LA 2ADIB 3SQOH 2CR6A 3VFOB 2J6EL 3RL1A 1MFDL 1EX0A 3WFEH 1X5AA 1VGKB 2BSRB 5BVPH 4W81A 4ELKA 5T3ZE 2Z91B 3RY6C 3W9DA 3HC3L 4QRSB 3LH2L 1OWWA 1X5HA 2GK0A 2Z8SA 2VLRB 3NN8B 3MACL 1JNHA 4RBPH 3CMOH 1IRAY 3QQ4A 4NKDB 5D1ZC 1HWGB 5D7SH 1F4XH 1HHIB 1INQB 1TITA 3TO4A 1A7PH 3G9AB 3MRMA 4HSQA 5AAWA 2EKSA 5JZ7D 3EOAB 1CFBA 4P3DB 1TZHB 1R5IA 1BQHA 4NQVA 3WS6C 3IJHA 4UT7L 5FM5O 3DARA 2WW8A 3UPRB 4Z7WA 4H88H 1I7ZA 5IG7B 4DGIL 4PGCA 5AYUH 5C0FA 4XPFL 1U42A 1U0QA 4HZLB 2YD7A 1MHPH 3EUUA 4JPKH 4UILL 4JFFE 1UT9A 4RX4D 3P0GB 5GRJL 3T3PE 2DQIL 1INEL 1A3LL 1KEML 5JIKA 1DTUA 1F13A 1NAMH 3MJ6A 3HHRB 4Q0XL 5JPMA 1G6RB 1ZA3A 3QHFL 3WMSA 3GI9L 4IRJB 3GUTB 4YPGB 3GIZH 1MCCA 2FIKA 2DBJA 4TVPE 3L95A 3GI8L 5ESAB 2WLZA 5E95B 3I6KA 5HHQA 4OCRL 3HE7D 4OLWL 4NGHL 1XF4A 3H9YA 5IJVA 4U6HA 5J13B 4NKOA 4XPGL 5LWYL 2GJZB 1SY6H 2XWJB 1L6XA 2YD2A 3QBTB 1M71B 1N8ZB 5T3ZL 1DR9A 2CDEA 2XYCA 3QDAA 4RQQA 2DQEH 2CLZB 1V3JA 2V7HB 2X1OA 3P40A 4G9FE 2IAMB 4OZGA 5DJXB 3MLPA 4J3SA 1I3VA 1ZHLB 3QFJA 5CILH 5I73C 1Y0LB 2DQJH 1LILA 4FXGA 1KFAH 3IDNB 3IF1B 2Z4QB 4LMQI 1B0RB 5KVGH 4O02L 3VD5A 4BFGA 1KCRL 3FTGA 1FH5L 1CGXA 3QIUB 1DQLL 4LNVA 3SDDD 4HKBB 4J6RH 4Y5XB 4JPWL 3UTPD 5IW1A 5EIQA 3RUGB 4XH2B 2HAZA 4HIJA 3UBXG 5ICZA 4WUKL 2XZCH 1F90L 3PQYE 3FAWA 1AGCB 1JHLL 2BVQA 3ROLA 1QKZH 4GW4B 5C3TA 3LIZH 1YEHL 1OAYL 4H0HB 3B9DA 1Y6KR 3BPOC 1A5FL 1BZ9B 1DN0A 3PP3H 3QZWG 5DQJB 1DDHA 3EYUH 4GXVH 2CSPA 4TVPL 4JFDA 5KANG 5H2BB 4Z7OF 2PNDA 3H0TA 2C1PB 3HR6A 4HHAB 5IBUG 4CAGA 4I3RH 2LQRA 1NCTA 3FB7B 3RGVC 4X8JB 5I0ZA 3TM6A 4G8EA 1P9MA 3ALPA 1K4CB 2PTUA 4I0PC 4X6CB 3ZDYF 2EYTA 2NXZD 4X0KB 4CVWA 4MJ5B 5JOFB 4Y2OA 4L4TE 1T4KA 2NY0D 5CKAA 4FN0A 5ECJE 4Y7MA 3WJLC 5BRZA 3QUKB 3JWDH 5C0CA 3GMOB 2VOTA 4NM4L 5HDOA 3QUYA 5BO1H 4LOUD 3HPJB 1JHKL 1MI5A 1CGWA 4N9GB 3SDCC 3IDJA 3DTXA 1YJDH 5E5MB 5CP7A 1WISA 5ETUB 5IHBA 5CBAA 1KJMA 2ZJSL 1Q38A 4KMQA 4QT5B 3IXTB 2DM7A 3NOIA 1O7SA 1MLBA 3NABL 2EDKA 4OF8A 3U9UB 3AS0A 4LLWA 2P5ED 5LAXA 2GAZB 1ACZA 1OPGL 3R1GL 1DLFL 4P59H 1AI1L 1YJDC 4N5ED 1Q9WA 5IF0A 1S7UA 3ZE1E 4XCNA 4CN6A 2Q86A 2BHUA 4NBZB 4EDWL 5KW9L 3OJDB 4JM2F 1CU4L 4OIIH 1TNMA 4XWGL 1KTKE 5KSBA 5MENA 4TPRL 3MFGB 3QDMA 3CCHB 2VITB 3HB3C 1LO0H 2NY6B 3HTLX 3KR3L 4U6TA 3D87B 1H3PH 1MCRA 1ZT4B 4XXDA 3U0WL 1C5CL 1T6VN 4OLXL 25C8H 4EQ2A 4HDIA 4ZS7H 1WFNA 5I17A 3MRFA 1HZHH 3OKNA 4I9WD 1NBYB 1WIOA 3PGFH 4RAVA 1G7HB 1T1ZA 4F7PA 3ZO0A 2BNQE 3D5OF 5HVHC 2FEEI 1CL7I 1KPVA 4FXKA 4HIIA 4UV4H 3QH3B 4OAWA 4BQBA 2FZ3A 1HSAA 4G8IA 5JDSA 4LKXB 1YEKH 3TA3D 2WIMA 3LKPA 2V5TA 3GHEL 1WVZA 4CUCA 2VLLA 1A14L 5HPMA 2FBJL 1CDGA 1KCSH 4PLOB 1CE1L 2BNRA 5DRWB 2GKIA 5ESVA 2B20A 4NRYB 3RIAK 1KC5H 4QXUH 1UH2A 1YPZE 3O9WC 4MA7L 3PF2A 2HG5A 3ARED 2A0LC 2DMKA 1HSBB 5EBMB 2VXQL 5IB2A 3ESUF 2WWKO 4GKNB 4JKPL 2Y07H 1YNLL 3LS4L 3S8WA 1E27B 5GS0L 5FEBA 3BE1H 4UAOB 4ALAL 1JPFA 5DURB 4GMSL 1XR8B 4UB0L 4MYWB 3B9KB 4GFTB 5T1KD 1KXVC 1HCFX 3WLBA 1JHTB 5D9SA 1JFQH 4F7EB 3U36A 1QRNB 3MLVH 3GBMH 2ZSWA 1QBBA 2AVGA 2GCYA 4M1CC 5SWSB 4OZHF 1I85C 3PL6B 4BUHA 2W9EL 3OL2A 1ITBB 3L3KA 1J0IA 4ZXBB 5JA8B 4HS6B 1T0NB 3ULUL 3FQRA 4V2BA 4PGDA 2PO6D 1OT1A 1IM3B 2NY1B 3SE4A 1ZHBB 1LE9A 3AMLA 5DDHB 1ERNA 4M6OH 2B0SL 3C60A 1NLBH 2MQ0A 4LHUG 1AGEB 1NL0L 1I1AC 1NSNL 1P4BH 2VL4A 1LQSR 3KGRA 2ZCLL 4X6EB 1K6QL 2P8MA 2AAVA 2ZP0T 2BJMH 2JJTC 3MRQA 3MLZL 4JM2B 5IVXF 1CR9L 4WFEE 3GGWB 4ZUSA 1KJ2A 3R06A 4YFDB 3NH7L 5F89B 3VXSB 3WHXA 4WNQB 3BISA 3HNSH 2ITDB 5IT2L 1OAUL 1U8OB 3RPIB 3GJFH 3KPSA 1BD2A 2BFVL 1WEJH 5DT1H 4KK5D 4M3KB 2XZQH 5D7JB 4D2NA 5E8NA 1CT8A 4M7JL 5DO2D 2I07A 2A6IA 2P47B 4JQIH 1W8OA 4KI5F 2KZWA 4HXAL 4F33A 4PJGA 3KHQA 2PYED 2ADIA 3DECA 1P1ZB 3HE6B 3HZYA 4MDJB 4Y4FA 3VXUE 3ARUA 1AY1H 2H2SC 3KYOB 5CHNB 1IGMH 4RWYL 4ENED 5JQ6H 4JDZA 1VGKA 1A9BB 2E7CA 3HR5A 1QG3A 2BSRA 2DWEB 4BQ8A 2Z91A 3S37L 1NKRA 1UKQA 4JO4L 5ITBL 1R3LA 4H20L 5L9DH 4KTDL 3UAJC 3B8SA 2HYMA 3SKUD 1ZV5A 4BQCA 5J6GA 2I60H 4GS7B 5TDPB 4HGKC 2P7TB 2IEPA 1RUPL 3U7WL 1HHIA 2B5IB 2Y25A 1INQA 3HFML 2F54D 4LSVL 1NDGB 1I9EA 1Q94B 5I16A 1KB9K 3BH8B 4P3DA 2MFNA 4UNVA 2R0KL 5EO9A 3BSZH 4NN5C 3B4NA 2F74B 3RVUC 1DQMH 1A6ZB 2DRUA 5F1SA 2Q8BL 1CK0H 2QSVA 1RI8A 1LK3H 1U8MA 1BF8A 1VFAA 2A6JA 2BP3A 3QULA 3UO1L 4N5UA 4YXLH 1S7RA 2VDNL 4OZHB 3S3PA 3JUZA 3V5KB 3U0TB 4QRUB 4X99B 5HYFA 4WI7A 1K8DB 4KUZH 5KJRH 3DYOA 1G6RA 4R8WH 4IRJA 4PJXA 1CLOH 4Z7VE 2OMNA 4YPGA 5GS1C 4BFBD 3FOMB 1HEZA 5IQ7H 3GMLA 4NRZA 3SDXE 5DJCA 3VRIB 5C0EA 1Z2KA 4RMTA 5ESAA 4DW2H 1FFPA 4G8GE 2HT2C 3WFHA 3MBXL 4GRMB 3EO0A 4L3EE 2K3TA 1J88A 1ODAA 4O2CB 4KK9C 1G7PB 1JPTH 1DUZB 3QDGE 3D18A 2A9NL 3RZCD 4PRBB 3KPRD 2XWJA 5L2KD 1K2DB 5KVFH 3H3PL 3HI1B 5C0JB 1W72A 5KSAB 3VWKC 4NO3B 3RAJL 4LLMB 1XEDA 4WEBH 2IAMA 1S9KC 4TULH 5DJXA 2A6DB 1A7QH 2P5WA 1FL3A 1LP9E 3PABA 4XP1H 3QG6B 3WE6B 2EXWC 1OGTB 4ERSL 5FA3B 1Y0LA 2F58L 4QRPE 4JO1H 1G1CA 1KJ3H 3IF1A 5D5ME 2P8LB 1B0RA 2EDHA 3GMMA 2ATPB 4MNQE 2MKLC 3C09B 3RFZC 4IOFC 3ESVF 5C08D 1A3RL 4QRQB 1EFQA 1B2WL 3FL7A 1OARH 4KHXL 2ZG1A 4Q6IC 2UV3A 4HV8B 5HYIA 3IDYC 3GMPB 1GYAA 3HNTH 2A77L 4YBLB 3MJ9A 4O4YH 5GRYA 1OTTC 1U3JA 3PDOA 1CQYA 1BZ9A 3MV01 2MCG1 4NKQB 4WWKD 3O8XA 3ARBD 5AD0A 4FQXB 4OM1H 2NY3C 4K3JL 1FN4A 3EFDL 3SY0A 1Q9OB 2ZUQC 4KVCH 3MTRA 1FBIL 1GPOL 4F15B 5H2BA 1YY8B 4G6FB 3QEQE 4XVUC 4X5WA 3QIBA 3FB7A 3WYRA 3FMGH 4X8JA 5HYSA 1U41A 5HDQH 3U9PL 2AK4E 4Y89A 1LNUB 4PJ7F 2P43B 3QUXC 4MJ5A 1A7OL 4I3SL 1DANU 3D3VA 4HBQA 3T0XA 2WWMD 4M62H 5C09D 4AIZB 4L8CA 4W6WB 3CFDA 3QG7L 3IU4H 1G0XA 2GYSA 3O6FD 4P23D 2CO7B 3OKOA 3SKMB 1G7LA 4UQ2A 1KNOB 1G84A 3O3DB 3VW3L 2VZTA 3ARGB 1XH3B 1FDLL 3IFOB 5ITFB 3IDXL 2UY7A 3QPQC 1N6UA 2DI9A 4WFHD 5ETUA 5IJKC 2J88H 1S7SA 3SGEI 3QUMH 3IXTA 1I1CA 1T7WA 4I77L 4UT7H 3QDJD 1FZMB 1QLEL 2JF1A 4FTVB 2WUBH 3ABZA 1ZHKB 4DGIH 4CKVX 4WI5A 4UQ3B 1P4IL 2B4CH 3LEVH 3L7FB 3LVEA 3O4LD 1PX3A 4XPFH 5CIPA 3RY4A 4PJIE 2QKIB 2YUXA 3S4SB 2AV7A 5H35A 2AQ3A 3DO3A 1U91B 1YA5A 4XNXH 3OKEA 3C5ZC 4JCLA 3BMWA 2F8XC 1CFSB 4JFOB 2ZWLT 2BOCA 1INEH 2DQIH 5DS8A 2P44B 5DQDH 1LEIA 4LFHD 1CQKA 1R3KB 3E6FB 3WL9B 5CS7A 3JWNC 4HULB 3QIBD 5I71C 1MFAL 4PY7B 3FQNA 4DKEH 2B4CC 1XIWA 2DBLL 3DI2B 3CFJB 4D0CA 4IMLA 3IDMB 2VITA 4NZTL 5FHAL 5FYJD 4LASH 1ZT4A 2DQUH 1KELH 1FORL 2Z31C 1NMCB 2HKFL 3OAZH 4X7FC 1ACYL 3RKDC 5HBBA 5DEZA 1LGVA 5D7IF 5JW4N 2DYPA 2VDQH 2E9JA 5KAQG 3RRQA 4MJIE 3HPLB 2E27L 5BOPA 3QH3A 4JANB 4P2QA 4NM8H 2XA3A 4HJJH 4TSCL 3NIFF 1W2KT 4WW2A 1AKJD 1FG2B 1JN6A 3VU2A 4OI9A 2BSTA 2ZG2A 3DUHA 4YDLB 5F1IA 4KQ4L 5M94B 2D7PA 1J5OL 1OWRM 3T0EC 4PJCB 3EOTH 4S1SL 4PRIB 4KJQC 2G9HA 2DLFL 5IB5A 3FB6B 2APXA 2FJFB 5D71L 3E0GA 1NFIB 5CJOL 3CU1A 5T5NF 4BZ1L 4PJ7B 1HSBA 3N0PB 3S35H 4FG6C 1KPRB 1FGVH 1K5NB 1U95B 1PYWB 4N0UA 1VB9A 1F90H 1UM6L 1I7UA 4JZNA 3P30L 3IDUA 1FGNH 3GB7A 1VERA 1EFXD 3QO0B 2BSSA 2X4RA 3TH4T 2G60H 4NSKA 3LQZB 3JTSB 4DOHE 3SJVE 1CLYL 3GKZA 3BKML 3L3JA 5SWSA 1EO8L 3AS2A 5DJZA 1HNGA 3D39D 3GFUA 4P48A 3IRPX 5EA0L 3X11A 1A4KB 1YZZA 1T0NA 5TDOA 4X9FA 1A0QL 1ZHBA 4PIRF 3SDDB 1MVUA 1KPUB 1FFRA 4HC1H 3X12B 2Y7QA 4N90E 2BSED 1FP5A 5E1HB 5IMKB 4GBXD 1QFUL 1KTDB 5CJQL 4MJ2A 2E9BA 2VR5A 4X6EA 4AJ0A 4CNIB 4CW1A 1M05B 4ETQB 5E6YA 3OX8A 4JHWL 4JM2A 3GK8H 2CD0A 2LAGB 1S9WA 1PLGH 1I3UA 3G9VA 3ARVA 3U46B 1AO7E 1JHKH 4RRPG 5I8CB 3CXHK 3RPIA 4FFVC 4FP8H 1TJIL 2HJKA 5D7JA 2DQGH 5F88B 2ZJSH 4HX1A 2FX7H 3PWVA 5JPNB 5FO9B 2RR3A 2C3HA 2QR0B 4PUBH 2ZG3A 4OGAC 4ORGA 3EHBD 1ADQL 1ZWIB 4K23H 2NY2C 2H41A 5EZJB 5DJYA 2WV3A 2VLKD 4HBCL 2NY0B 4I18B 5DEFB 3QIWB 1KN4H 5CZXD 3RWEA 5I1HL 3LKNB 5B39A 4DN4L 5AWNL 2X4UA 3N9GL 3LN5A 2DF3A 2OZ4L 4D94A 4CN4A 4UIMB 3IDGB 3ZLQC 4JDTH 5IUSA 1MCWW 3ZSTA 1FCCA 1F97A 3AFLA 3NIGE 5ACZA 4J3UA 5FA4B 5IMOB 2AJ3B 4UIKL 4B41A 2WP3O 4F57L 3FQWB 3TN0B 3BT2H 1B0GB 2PXYC 4XCEB 4D9RD 1JBJA 3BH8A 1KJVB 1IC4H 2P5EB 2H8PB 3QEUA 2DDQH 4Y4KA 2DTML 1C8PA 4LKCB 1TJGL 3TJHD 5I8EB 5ACLA 4ZAKD 4TUKH 4HGWA 1CVSC 3JV6A 1FQ9C 3RBGA 5BJTB 1NCDH 1DL7H 1FLTX 4XMPH 5F6HJ 3GHEH 1A22B 3MV9A 1N6QL 5J06A 5FM5M 2WWKT 1CN4A 2XTJE 4M5YL 4KKAD 4WTZG 3CFKB 3HZMB 3QXAB 3BGAA 3U0TA 4KJWC 1OP3H 1J05B 4ZQKB 1IC1A 4ODVH 4TN9A 2YKLH 3D25A 4NHUB 3UYPA 2WQRA 1MWAB 2E3VA 5E4EC 4JRYB 2NW2B 1DBAH 4Y19A 5EBWA 4P5TC 4MMZC 5CCKL 4GRMA 3K1KC 4NZDA 5E7FA 2O26U 3BXNA 3FQTB 3L3DB 2A9ML 1RJCA 3LKOB 5E6IC 1DUZA 3O2DA 4H8WL 5IEHA 5IVXA 4O58L 2XG4A 4P4KC 1JTPA 1YEGH 4QWWC 3HI5L 1MLCB 3HI1A 1GZQA 5C0JA 1J8HD 5KSAA 4O2EA 1FSKB 4AMKH 4NO3A 5HGAA 3MCG1 5LGHH 3KPOB 5E08L 3I2CL 3OKKB 4NO5B 5D2LE 1IE5A 4QY8B 1T1YA 3HZVB 5J1AB 3QG6A 3PJSB 2HRPH 1OGTA 3EW3B 5CUSL 2NMSA 1BREA 1IM9B 1GGBL 3DSNA 2ATPA 2VQTA 3CC5B 1VACB 1KN2H 5CEYB 1V7NH 3K74B 3BGFB 1WICA 3EKCA 2BOBA 4QRQA 4RMQA 1SJHB 3FN9A 3WO4C 2RBLA 3UTZA 4JFZH 4L29B 2CJUH 4M43L 2GITB 1ZANL 3GMPA 1YY9C 4OCYH 1J1OH 2Y1VA 2FL5B 3IGAB 3DUSB 4WJ5A 1T2JA 1MCSA 2ZUVA 4LSSL 4MSWB 1G9EA 2HMIC 1MRDH 2JB5L 2PO6B 4PPTA 1V8HA 4XRCB 4K3GA 1T89A 1RVFL 4P57A 3BPLB 3FO0L 4XNYL 2DAVA 4FQXA 3UPCA 5DD6B 3V7AG 5BRZE 3CMGA 1Q9OA 3PHOA 1CLZH 2VQ1B 1FZKA 1UYWH 3MROB 5IOPA 1DUYB 4AH2B 5I8OH 1UZ8A 3U30C 5EZLB 2OTPA 5DHVA 5D6DA 2X1QA 2EXYD 3B8YA 4WHYH 4P46D 5JLZA 1LNUA 3I84A 4YXKL 1ZA6A 5CEZH 4XAWL 5GSVB 1MCPH 2HFGH 4ZTOL 1PJ9A 4GAJL 1AP2A 3LB6D 1A6VL 3EJZC 1PY4A 4OFVA 5ID1B 1D9KC 1KNOA 2OL3B 3D2UA 3S37X 3FT3A 2IH3A 1MEXL 3IFOA 1SYVA 3TLRA 2KQMA 2PYEB 2R0WL 4U1LB 4F7MA 3INUL 3ARRA 3TZVA 3DX9A 1L0YA 5B8CC 3FB5B 3NTCH 1QSEB 5DR5L 1M7XA 4FTVA 4GAGL 1E28A 1X6LA 1OLZA 5F1NB 1AIFB 4NWTL 1ORSB 1A7NH 3QDME 1Z5LB 2NY5H 2F8VA 3UZVB 4AZ8A 1HOCB 5F9AC 3S4SA 3NCJH 1DQJA 1F11A 5IVZB 3U6RB 1NMBL 3T77A 4PJ5D 4L8SC 4LRIA 1YEEH 3KXFD 1RUKL 1CFSA 1YEIL 4P99A 4DEPC 5IW6B 1XCQA 4EI5C 3D85A 4J7RA 2F54B 1OP5H 3FB8A 1CDCA 4X4XA 1DBKL 5AZ2H 2J8HA 2CQVA 2NY5C 4HKZB 3DVIA 4GW1B 4HIXL 1TCMA 1AGFB 2EIBA 4Y2DC 2KDGA 4JO2H 1KCUL 1KTLB 3QEGL 1MCHA 3WJJC 3VFRB 5HGDA 1C7TA 1UCBL 1CXEA 1GCFA 4KFZC 1BFOB 3MV7A 2PW1A 3TVMA 1YEJL 3LMJL 2IQ9H 3DMMA 4POZD 2DJ4A 3MBEC 4RGND 2WINB 4L4VB 4OFKA 1UVQA 4MCZA 2JK5B 4LEXL 4JANA 3BQUD 3BP4B 5IBLC 4B7IA 2QSCH 4K7FA 1T1XA 3WD5L 3CFCH 5L2JB 5DEGA 3T1FB 3SE3C 3BN9D 4YE4H 4OCSL 3T8XB 3UJJH 3L1OH 3RWFB 3QUZA 5E7BA 3M8OL 4FS0A 5J89A 4PRIA 3B5TA 4AEFA 2ZUUA 2AXFB 2VXSL 1D6VL 2V5SA 4NWUH 4H26A 4YHIB 5DK0B 1DBBH 4FFZL 5IHZB 4JB9L 2EEAA 3FAXA 4MWFA 1NEZB 5HY9A 4N8CH 4ODTL 1QACA 2YD6A 4XNMB 1NFIA 3RZCB 3D1MC 1FZOB 4ZPTA 1OAKH 3KPRB 2EH8L 3ARDC 1ETZB 3MZTA 4HLZH 4JPIB 4KAQL 5JHDA 1KPRA 1YN7A 2X4PA 1U95A 5F21B 1PYWA 3ES6B 4UOW0 3MLRL 3MRDB 4PJ9C 4TRPH 3QO0A 2FH8A 3CDCA 2I24N 5KSVB 3LKSA 3BUYA 4PJAE 3TP4A 3O3UN 3VG9C 3NACL 3FO9B 4KKCC 5HYQB 2ICEA 3ECBA 1ONQA 1IMHC 2OCFD 2Z9TA 4P2RD 4CVZB 1FHGA 4P2OD 4YAQB 4DK3A 5FYLH 4KRMB 3RVTD 1SJVA 2Z35A 4PTUA 4MXVE 1XZ0B 1SBBA 2V9TA 1EUTA 2NTFB 3DXAD 3X12A 4WUUA 1MCBA 2ZCKH 4MCYA 5HPOA 1KTDA 1SVCP 5E8PA 3GKWH 4TSBH 3IAQA 1RFDL 3MLSH 3V4UL 5E8DH 1WGOA 2CUMA 3VH8G 1BWMA 3HCVA 4ISVB 4HWZB 1C08A 2EEDA 4XT1C 4CNIA 2CDGB 3K2MC 2N7BA 3LQAL 4PJDA 3W0WB 4ETQA 1P84K 4YUEL 3CVHA 4N9OB 3QO1A 4U1NA 3EDKA 4JZJA 4WWKB 1N2RB 3X3FH 1FNGB 1FG9C 3ARBB 1R24A 1NGPH 4P3CL 1FO0B 4PLJC 1CD1A 4OCMC 3NA4A 1F00I 3U7YH 3WSQH 5GGTH 5L8LB 4P9HL 4X7SH 4ZUWB 4H1LH 1XGTB 1O5DT 3OKDB 1CGTA 3Q3GA 2Y5TA 5F88A 4S11A 5JPNA 4H0IA 1RPQA 1NBVH 4LARL 2VLRE 5D7IA 4YGVA 2YC1A 2Q3ZA 4OT1H 2F5BL 1JNNL 1JRHL 1NDMA 1FNSH 5L7XL 1RUQH 3LDBB 1ZEAL 4QRRD 3A6CL 2XRAH 3QIWA 4RAHA 3JZ7A 3SBWA 3H42H 1P69B 4B5EA 1ND0B 5I75B 1R0AH 3O6FB 4P23B 1E4WL 5IHUH 1MCKA 2E6PA 3W2DL 2O5XL 2OXGA 3IDGA 1DANT 1RU9H 4MDIA 3IETA 3WIFB 1MFAH 4LHUD 4HAGA 4U6XB 3T4AA 5I15H 3MNVB 2IH1B 5IMOA 5K9QI 3LN4A 2OTUB 3H9SA 5C0BB 3TH2T 4HK3J 1K8IA 3QDJB 4TSAL 3SKJH 5DUBB 4NQED 3RBSA 2HTKD 1QBLL 1RZFL 3FQWA 3TN0A 4XPBH 4XCEA 1MRFL 4WTWA 3O4LB 3MLWH 5E99L 3U4BL 3OF6A 1I8IA 3UTSB 1I9IH 2H8PA 3VRLE 4GG6B 4PGBB 4P5KA 2VSDA 1CDIA 4K2UH 3VXOA 2FJHB 4AENA 3DSFL 4JY4B 4X9IA 3ET9F 1IC5L 3TIEB 2EEBA 5CINH 2JTDA 3KPLB 1NBZB 4K8RH 5BJTA 2NXYC 3JTTA 5DRXA 4IDLA 1GJIA 3ULVD 3EAKA 3DIFB 2MPAH 4GUPA 2R4RH 1U58A 3EO9L 4YO0A 3VI3F 3C6SA 1QYGL 2A38A 3I6GA 4GQ9L 2IPKA 2ZUYA 4APQC 3NPZB 3HZMA 3QXAA 5EZOL 3ZDZF 2EICA 2BZDA 3O3BA 3P0VL 4Y4HD 5F96H 1F2QA 1AHWC 2IGFL 3MJGX 4UOJA 4NHUA 4K8RC 3RWDA 3RNQB 4UV7L 3BHBB 4Y5YC 5ADPH 3RP1A 5B3JE 2NNAB 3VGHA 1JPST 4RISL 4JRYA 5KSUB 4BFIB 4LSPL 5DUMH 4ZSOA 2AJSH 3BVNB 1NAKL 3DRQA 5EG6C 3L3DA 3NZ8B 3FQTA 1BLNB 1W8NA 3DJ9A 5HI3D 5F97E 5TFSH 3V52H 4MQSB 4K71B 1IEBB 2RIKA 4ODHH 4OLZL 1AKJB 3P30H 3MJ8B 4U49A 2R0LL 4KJYA 5IV2B 4G43A 5CJXA 2V2XB 3SGDH 4X4YB 2GJJA 1MLCA 3CSPA 3H3BC 1F4YL 4ZD3H 4MAUH 1T3FA 1I3GH 5SV4A 5DI8A 5IGXH 5I1GL 1SM3L 2XQYK 3KPOA 1MH5B 3OKKA 4U1HB 4QY8A 3RUGE 5DJ2A 2RB8A 3VXMA 2KH2B 5JOEA 5JXED 5D8JL 4OB5L 4L9LA 1VADB 2EIEA 4L3AA 2ARJB 4TUOB 4K07A 5TGBB 2XXCB 4WO4B 4EBQH 2F53D 5FGSA 1R5WB 1KLGB 5GGQL 1Z3GL 4LCUB 2AJXH 4R96A 3V8CA 5E24E 1QLRB 2Y23A 3HRZA 5ISZD 4LCYB 1UB6B 1HXYA 1VACA 4NJAL 2IBZY 3HG1D 5D1XD 1EFXB 1J0HA 1IAKA 4MA8L 4TUJA 4PJFB 1JZ2A 3L3GB 2HVKB 4L29A 3CZFA 3GM0A 2E6QA 5J3HD 5IWLC 2UUDH 3DUSA 4OFPA 4LLQA 3D39B 1WITA 1NCAL 2HFEB 3PHSA 4X6CE 2FGZA 4CADB 4FABH 5T1LA 2EC9U 1S7QA 4FQJL 1S7XA 1UH3A 1SJEB 1YYML 2NZIA 4MA3A 3MRNB 3KPPB 2G75A 1DN2A 5CP3A 2VQ1A 4F37F 1G9NH 1Q8MA 3IFNL 4KU1A 1JYWA 1KIUA 1QSFA 1WTLA 4K3DH 3S88L 4OIAA 3GZKA 1MCQA 4YHYB 4HJGB 1HHGA 5IFAL 5DSCB 3KYKL 5EZLA 4IM8A 1EBPA 1TZGH 2WP3T 4WFFE 5D1ZD 4HK3N 1R3IL 3MYJB 1S9YA 5F7EH 1I8KB 2IFFL 3KYMB 1JWMB 5HDBE 4H5SA 1MRCH 2NLJA 2OR8A 5GSVA 1T7YA 5DLML 1G9NC 4NO0A 2D31B 5E03A 5EIIB 2I5YL 3AM8A 1ZT1A 1CE6A 3JBG7 4OD2A 4PJ8B 2UZXB 5F9DC 1UM4H 1UWXK 2RAMA 2AEIT 1UJ3C 4GMTL 1J8KA 2ARJQ 3SDYH 1TJGH 3FB5A 3O4OC 1FC2D 1MJ7H 2DQDL 2FD6H 4O5LH 4U1KB 4WFGE 1JWSB 5FUCC 5JDJA 5IFJB 4OTXH 4NQDB 3ZMRA 5CGTA 2A74A 3VA6A 4E41D 5FFLA 1PVHA 2R8SH 1WZLA 1OM3L 3RDTB 1BJMA 1WTGT 4M5YH 1P6AB 1U8KB 4NQSB 5FHBL 2CDFB 3BZFB 4AYFA 1L9MA 2AJUL 5EWIH 4UT9L 2CKBA 2FWOA 2CRYA 4LPTA 4HKZA 2IG2L 1TNNA 2W91A 3ALWA 3HS0A 3ISWA 4Y16C 2XA8H 4XGZA 1TIUA 3ROOA 3DV6B 4ZAKB 1A1OA 2HJLA 4XVTH 3D48R 5IB1B 3RU8L 1QRKA 5ICXB 3QWOB 3SGDI 1H3UA 5CJ8A 3TNMA 1YN6A 5C8JB 4IRZL 3WN5B 3NIDF 1JMXA 4EXKA 1FRGH 4HMEA 4N0YH 4HF5H 1L4IA 4NJ9L 5HHMD 2ICCA 5T1MB 4L4VA 1C1EH 1W0VB 3WEXB 1MFCH 4XVSL 3MRJB 3BP4A 3L5WB 3ZDYE 5L2JA 1CD9B 1JPSH 5C0AE 1KULA 1P7KA 4G5ZH 1TVBB 1DQDH 1RIHL 2H6PB 2SEBB 3TO2B 2CLVB 3TO4C 3RWFA 1YEFL 2YD3A 3W39B 1BVZA 4GLRH 4WHYG 5BS0D 1U8HA 3PGCB 1CBVL 2DM2A 4PRHE 4M1DL 3T0VA 4HPOL 2PETA 1DVFA 4YHIA 3IXAB 2FJGA 5IHZA 3BWUC 1T80A 2YPLA 4CU6A 4WI2A 5FYKE 1QRNE 4N1EA 1NEZA 2WANA 2UYLB 5LXGL 4XNMA 5F6HI 3EYVB 3T3PF 2MHAB 2IALB 3UTTD 5T3XE 3BZEB 5JW5B 3AXLA 1NANH 2Z93B 1J8HB 5I1KL 5TPWL 1DZBA 1MELA 3V4VH 3ZZ1A 1JZ6A 4I1NB 4Y5VA 5I74C 5DVOA 3QHTC 3WIHA 4ACPA 4NP4H 2DL9A 2J5LB 4Z7UF 1TETL 4OM0H 1SBSL 4GXUM 5JW3L 4Z18A 3RGVD 4LAQH 3BDXA 3LD8B 5F9OL 4YEEA 4HUXB 4I0PD 1QFWH 3WIIL 2DKMA 2DLIA 4CVZA 4HQQL 4YAQA 2HP4A 3AY4A 2HT4C 1NC4D 4Y8DC 3VXSE 2Q87A 3STBA 3UX9B 4QHNA 1BBJB 1U3HB 3VXRA 2L7JA 5AG9A 3TT3L 3G04A 2X4SA 3I02B 4OCXH 3UYOD 2C7UA 2J8UB 3GEWB 3VGGA 4HWZA 4M48H 3SDCD 4LPVA 5DD5L 4X6BB 3SEPA 4MQTB 3W0WA 5E8EB 2PTTA 2QLVB 5K9QG 4QYOB 4U6VH 4M3JA 3MMEB 3M1BB 1N2RA 1GHFL 1CGYA 1JPGA 1U8IA 2FX9H 3SDAB 1MEXH 4KZEH 2XKNB 4ZUWA 7FABH 5AAMA 3TBWB 3OKDA 2VH5H 3ZKXB 3E6HA 4LNRA 1IKFH 2VLJB 5FYKL 1FL5B 1QQDA 2R23B 5EOTA 3RL2B 1RZ7H 1R3JB 1MREL 1HHJA 1KGCE 3SE9H 5DC9B 4PB0L 2L7UA 1W0WA 5T3XL 4LSDA 1QFWM 1NKOA 35C8H 4JVUA 5T1DH 1PZ5B 1NMBH 1V5JA 1RUKH 4OBRA 1SMAA 4IJ3C 3HB3D 3MNWA 5DJDA 3W82A 5K9OB 4P0DA 5GSRA 2WIIB 3KS0J 4XP4L 2H1PL 1EJOH 5HSFA 3KNBB 5A40E 4X98A 4HLZG 1FYHB 2R1WB 3MNVA 3UBXB 5CLTA 4DKAA 2WSKA 2FHBA 5C0BA 4YNYB 4X8XA 1E6JL 4OIBA 4JFFB 2W0FA 3TC9A 3P9LB 1MPAL 4XBGB 4OFYA 4OZHE 1P9MC 2L4OA 1I1AA 2VMFA 5E2UH 3LY6A 1D7FA 3QZWB 3PWNB 4OF3A 1FE8L 5AEAA 4PJ5B 1BZQK 4OZ4B 4HUVA 3VCLB 1NBZA 2APFA 3G6DH 3V5HA 1D5IH 4IOIB 1M6OB 4U0QB 4Z7UB 2F19L 3HRPA 3GIVB 3I75A 2XN9D 3IKCA 3O9WD 2CH8A 2D03H 2XZZA 1QP1A 2A0LD 4G7YL 4HEME 2AV1B 3V0VB 1U8JA 4QTIH 1CF8H 1S3KL 1KEGH 2VXSH 5H94A 4R7DA 5FAAA 1GRWA 4BKLB 4DTGL 2Q76A 4L8DB 1LEGB 1WBZA 4QOKD 5KSUA 4WTXA 5IROA 1NANI 4ODUB 4KTEH 4M6ML 4M00A 4LLUB 3ZE1F 4YWGH 1YQ2A 3C8KB 1T66C 5INDB 4M1CD 5BV7B 3BQUB 3QI9A 4WV1B 3TCXA 3MLRH 1YECL 2AABH 4H1LG 4DFIA 2EDBA 3MJ8A 2WM0A 4MLIA 1HCVA 3T65A 3B83A 4X4YA 5GGVL 5J57B 4FQHA 3RKPA 3ULUF 2G5BB 4OFYD 4U7KA 1AXIB 5ILTL 2R39A 4PRPA 4PRDA 4D0BA 3QWQB 4U1HA 4RAUA 1UFUA 2BY3A 1NC2D 3OXRB 2R29H 1Q72H 4IRSB 4TUOA 5F7LB 5TGBA 1F45A 5F1KC 4WO4A 4KJPC 3R8QA 3V5DB 2FGWL 1RUAL 1R5WA 1KLGA 2ERJB 2WBKA 1PQZB 4PS4H 4YK4B 4YHMH 3V6OA 3O6KL 4DFHA 1OTSC 4GRWH 1NCBL 1BVLB 3T0BA 4IBLT 1LO4L 4OCWH 1HQRB 4PGJA 4BSVA 4ODXB 3ZL4H 4AL8L 1UM5H 1CCZA 1UGNA 1ZTXL 2OSLB 4GT7A 2NTSP 4NT6B 3NFSL 4GRLA 2VLMD 5EORL 1FFNB 1OGAD 3W5NA 4P2RB 1KLUA 3RX8A 4DN3L 4CMMA 1F6FB 4S0TD 4NNXA 2H2SD 1M7DB 1RK1B 1SJEA 5DWUH 3DXAB 1VEPA 1FVCA 1CGSH 1KOAA 4C56D 1EA9C 3KLAB 2ZUSA 3QAZB 1IILE 4Z7NE 1RJLB 1I9RH 5GISL 1I7TB 4JRXD 2EKJA 3UAJD 4Q9QL 1KIRA 1N64L 4DGVH 1KT2A 2EDTA 4MB3A 5EZIH 4HMDA 1FJ1B 4EQ3A 3MYJA 3S34L 4CVXA 1E4WH 2PYFA 3HAEB 3MRCB 2C1OB 1DBMH 5D72H 3V7MA 3GSVB 3P0YH 3ZYZA 1OSPH 5HGHB 3KPMB 4R90H 1F4HA 3C2AH 4HW6A 1MIEH 4OSUL 2BDNL 3SE4C 3RVUD 4XZUA 5C6TL 5E2WL 4DVRL 3C60C 1KJ2H 3PUCA 2DIJA 3S35X 1LO2H 3FT4B 4PJ8A 4GKZB 4JVPA 4KY1L 2OK0H 2I9TA 1MQKH 3A6BL 3TT1H 4LSTL 4QRRB 3WUZA 2GT9A 3WXVH 5J11B 2IQAA 3LSOB 4NQDA 1T83A 2OP4L 4O2FB 1NCUA 4WU7B 3FN3A 2OLDA 1QYGH 5A2JH 3DI3B 4QF1B 1GIGL 3DURA 2HT2D 3IJYB 1WWAX 4KMTH 3P0VH 4EUPA 1MAKA 4U1MA 4R97B 4KK9D 1RUMH 4FZ8L 1P5UA 2ZKHH 4RFEB 5KS9F 2J3SA 3ZT7A 1OCWL 4QNPF 3GNML 4NQCD 1EHLL 2X4TA 2B39A 3CGTA 1LO5B 5JNYB 4I5BB 4O00A 4Y4FC 4XCYA 5HJ3B 4OFIA 4M02A 5IB1A 3VWKD 3VMNA 1WV7T 5FUZL 4PJCE 4LSRL 2FX8H 1AJ7H 3ZTNL 1AQKH 2AJVL 2UVEA 3QWOA 4FMKA 4LSUH 2UZIH 4PRIE 3WN5A 4KH2A 3DOSA 1W0YT 4LLDB 4GSDL 4I13B 3F5WB 4FQLL 2EXWD 4ZFOB 4HFWB 5T1MA 3EO1A 3N1QC 2BHYA 4F7TB 3WEXA 4LVHB 5DJ8A 4Y4HB 5TE4H 4PJ7E 2X70B 4NUJA 4RMUA 5E2TH 1TVBA 4IOFD 1FFOA 1N0XH 5JOPD 2BX5A 3T04D 3KDMA 3QNXA 1PDKA 1YMMD 3F7YB 1GGIH 1EEYB 2XIDA 4LLVB 3DV4B 4LPYA 5I1JL 4QHUB 4HG4K 4NQUA 3QA3B 1J0ZA 5E94B 5EOCL 4JPVL 1JMZA 2BMKA 3BKJH 1H8OA 3QRGL 3HKFA 1U2HA 1I8MB 4KMLB 1IGIH 4DUWA 1YEDB 4ZS6C 1G6RH 3K4AA 5JR1L 1FZJB 1OTTD 4GAYA 5C9KA 5KTEL 1TQCB 4WDIB 3NAAL 2BVOB 2CGRH 5I9QB 3TYGH 3WFBH 3IAPA 2NY3D 2XXMB 3PG2A 5C2BL 4Z7VF 2JJVA 3UTPE 4YH6A 5I1DB 1AE6L 3SDXF 1LDPL 4UTBL 2ZNWA 4FNLL 4IRJC 4NC1E 1BFTA 4XVUD 3UYRL 4LVEA 2XWBB 2YK1L 2F53B 1K4DB 2JIXB 3LZFL 4HUXA 4U1IA 2W92A 2VE6A 3QUXD 2EDNA 4BYHA 1VKXA 4JG0H 1B90A 3HG1B 1XGRB 4ONGH 4OF5A 2Z31A 4ZFFA 4DGYL 5J13C 1BBJA 4X4ZA 1U3HA 3OB8A 1MFEH 4LCIL 5TF1H 3EDJA 5FOJA 3BZ4B 1E6OH 1RK0B 4XCCL 1LP9F 1YC8A 3VH8A 4JHZA 4KHTL 1CG9B 4F58H 5K9JL 3QPQD 5E8EA 4ZOBA 2IAMC 2GFBA 3BEVA 2QQLH 4KGJA 4UINH 3S9DB 5D5MF 5I1LA 5DUPH 3LRSB 3LCYA 2Y06L 4RBPK 5KS9B 2C4XA 4HPYL 3I9GL 3O41B 4DUVA 4UDTB 4ZFZB 4NCC1 1UJTA 4F8QA 3SDAA 3MJ9H 4KPHL 5DXWA 4JY6B 1IFHH 3TBWA 3HMXL 2EDJA 3Q5YA 1BF2A 2EC9T 2VLJA 4IHOA 3C5ZD 1FL5A 2R23A 3O2VL 2IBGA 1KB5L 5DHYA 4BUGA 5D1ZB 3P4OA 4OD1H 3ZE0F 1I4FA 5JMRA 4PREA 2DTSA 2PKDA 3BGMB 4YHOH 2X1PA 4YHNB 5HVWA 5CWSB 3BKCL 1BVKA 2P5EE 4PRAB 3LEXB 3L6FB 4HWNA 4DZBB 5K9OA 5GJSL 3K2UH 5IB3B 5IM7B 2HA1A 4UU9B 3RKDD 3N85L 1BM3H 2R1WA 4MA1C 2GHWB 5FB8A 2P48B 1Q9LB 4AG4H 3RVXC 4HIHB 2VXVH 4UI2A 1IVLA 4JFFA 1A6TB 3CX5K 4Q2ZB 5J0BA 4XBGA 1EAPB 5F3BA 1PFCA 4PBWD 1SEBA 2X9XA 4UUJA 3V6FB 3LEYL 4E41B 3U4EA 3FFCD 1KYOK 5IESH 3CFEB 4JHAH 2O61B 3T0ED 3OHXB 4NKIL 4LQFH 4JRYE 3ZYJA 3BD4A 4IOIA 2E7LA 1C5BH 2GUOB 4KJQD 1G7JA 4BM7A 4I9WE 5MP6L 4Z7UA 5CD5C 1RJZA 3LRGA 4LBEA 4YZFF 5CIPH 1P6FA 3GIVA 4WHCA 1NAMB 3VG0H 1K3ZA 4YX2H 2YBRB 1EGJH 5J4MA 1FV1B 2AV1A 3MCKB 4Q58C 3ZE2E 4FG6D 1IQDB 3O3AB 1DSFL 2JJUA 4TQEH 5ANMB 4PJIF 3ZTJH 5FF6A 3NCEB 1Z9SA 4BKLA 1QHOA 3OPZH 2APTA 2WBJA 1WIPA 2UWEF 4PV8A 3WNOA 3LKRA 4LLUA 2IBBA 1EHNA 3B2UC 5I73B 3KWWB 5KG9B 4L5FL 1IBGH 3VFPB 1PEWA 4Z95L 5E8OB 2CIKB 3GBNH 4JO3L 3KS0H 3KPNA 1MFBH 4XPHL 1D5ZA 1SMOA 1Q1JL 4O51A 1MJUL 4PFEA 1XIWC 4YQXL 5J8OA 1RIVL 1NGWA 2VDLH 4R4ND 3GRWL 4S1RL 2JCCB 2QHRH 3T0AA 3OXRA 1D6EB 2EIZB 3PQYA 1JI2A 4IRSA 2Q8AL 4XP6H 3V5DA 5EC1B 4HIEB 2PXYA 3UTTB 4AQOA 2HKHH 5B4MC 4K7PL 1S5HA 4G80B 1GC1L 1HIMH 4OLUL 5CD3A 5D7LB 4FFVD 1BVLA 3O45A 4WW2C 1RURL 5J12B 1D5BA 1OAXL 1HQRA 4PRNB 4HWEL 2DQCL 4YHKH 1ES0B 1HI6A 4UNUA 2J4WH 4OGAD 3P4MB 2J8OA 4G9FD 4OZFA 1NGQL 2NY2D 2MWCA 4U6YA 3TYFB 1HYSC 1NC4B 4Z0BL 2CR3A 4MD5B 5JORB 1RK1A 1BGXL 4ZDHB 1H8SA 2YD8A 3S98A 5HVGB 3CPLB 4L4TA 1A64A 4WW1B 4FMFA 3S5LA 1RJLA 1T03L 1JNLH 2HT3C 4QXGH 4UAOC 1UG9A 1QFHA 3TWCH 1CDBA 1ZAGA 1ZHNA 1QR1B 3WKMH 1IKNC 4X83A 2CUIA 2Y5EA 2PYEE 1FLRH 4PJHE 3RNKA 1J1XH 3HAEA 4JN1H 5EUKB 4V1DD 5IMLA 1ZXQA 2H1PH 3Q48A 1JTOA 1QSEE 1G7IA 3T2OA 2EYRB 4OD3H 3KPMA 3PL6C 2B2XH 1QHPA 4HWBH 4NIKB 3RHWK 1ZLSL 3OXSA 4JG1L 1E6JH 1RJYB 5TQ0L 3DGCR 2UWEB 4GKZA 5KOMC 4Y0GA 5I8KH 4U3XA 1H15A 1I7RA 3IVKB 3ZT5A 1ZLVH 2F54E 4FQ2H 4XP9L 1AD9A 1NCWH 3L3HA 2UZYB 5F6IC 4KJWD 4JM2C 1JGEB 4J3OC 5JXAL 5EU5B 3T4YB 3NGBB 3G5VB 4WEMB 4WU7A 3U79A 2H26B 3PNWB 1IGTB 2R4SH 4ZNEE 1HKFA 3KJ6L 5D70L 1UACL 1X44A 4I3GA 2F5AL 4P5TD 5D7JC 2LABA 2IADB 2CPCA 3CXDH 4X9GA 4AM0B 1LEKB 4KK8C 2BNQA 5E6ID 4G3YH 3LRHA 4L4VE 4G6JL 1B4JH 3MLYL 1Y18B 4P4KD 4QWWD 3MODH 4M7KL 3OGCA 3RWCB 3TV3H 3RIFF 3UC0L 2OL3L 3OR6A 2AKRA 1PKOA 2XNAA 4MD4A 3MGTA 3ELAT 3X3GH 5ESQA 3P9MB 4QKXB 1NGYA 4RGOL 2XN9B 3O9WB 1R5VB 5HGGS 3MXWH 1XF2B 5I66B 3N50A 5LVEA 3ILPB 2VQUA 3KPRE 2IWGA 5K9KA 5DJAA 1VKXB 1U8LA 3RTQA 2ZOLA 5FCUL 1FCGA 1N3NA 3P11H 3SO5A 4FHBD 4NYLA 2EH7L 4RFOH 2X9WA 3MRKB 3ZKQD 4Y4KC 1NMAL 1XT5A 1XGPA 1RAMA 5D1QA 1YY9D 1JUFB 3IS1X 3OBAA 1YEDA 4L8BB 2CMRL 3SN6N 3G6AB 1KIPB 3QJFB 5DRZB 2HMID 3UJIH 5T5FL 4TNWF 1T5XA 1ZTXH 4L8SA 4J4PC 3WUWG 5INCB 3O2DH 5I1DA 2D7MA 4XPTL 3IJSA 6FABH 1NC2B 5GHWL 4MD0A 1I1RA 5F70A 3GJFK 2BC4B 5E9DD 5IMMA 2XWBA 2JIXA 2VDOL 4QGYA 4X80H 3W0WE 2ILLA 2MJWA 2QHLA 4NKMB 3JV4B 5DVMA 3GSNL 5SX4H 2GJ6B 4LL9A 5DK2A 1J1PL 4JFXB 3VJ6A 4PJBB 1U3ZA 4KKBD 4M1GH 1WC7B 3QNZB 3CH1A 4UNTA 3HC4H 3QNYA 1WUNT 3MXVL 1AGDB 5ALBL 2CRZA 3BZDA 3EJZD 4JAMA 2EZ0C 2VWEE 2YSSB 1D9KD 4FQIH 1MHEA 3LOWA 3A67L 5KSAC 1EH9A 2VXUL 3WKNA 1DEDA 1CG9A 1AD0B 5CEZD 5T33L 3HNVL 2I9LA 3KVQA 5I2IB 1OAZH 5AZEL 2ATKA 3BJ91 4KI5C 3GJFB 2BDNH 5AG8A 3O41A 3VGEA 1N4XH 4UDTA 1RMFH 1T7VA 2AXHA 1F4WL 1O0VA 4KVNL 3I50L 4MHHI 2ORBH 1HH6A 1FVDB 2HTLC 2B1AL 3C09C 3DUUA 4JY6A 2FR4B 4U0RC 4JRXB 3AUVA 1FPTH 3VFVB 4D3CL 4UTAL 1NFKA 2CK0H 3MUY1 2CXGA 5EU7E 2A73A 4EI5D 2FB4H 4WFHE 1HDMB 1WF5A 1VEOA 2AGJH 3ARWA 5C0BE 1JYXA 4HMCA 3QDJE 2H3NB 5MI0C 3G5XA 2KQNA 4Y2DD 5DGRA 5CBEA 3UTSE 3O4LE 3JVGA 4PJ9A 4WFED 2OR9L 1UXWA 2ADFL 4LIQE 4NN5B 3KLHC 1JK8A 4HT1H 5DHVH 4GG6E 3RWHB 4LCWB 1HINH 1FYTB 1T89C 1DFBH 5IB3A 3SKNB 3K4DA 4FQXC 1BQUA 4L3CB 3E3QE 5DD1H 3RVVC 1U6AH 4D9LH 3AVEA 1U8NA 3V6ZB 2EDEA 5CJ5A 3ETBF 4F15C 5ADOL 3MBED 2B1HL 1QNZL 5IBTL 3EYFA 1T21A 3ARFA 5IBLD 4M61B 1FO0L 5D6DC 2HJFB 2YEZA 5F9JB 4BZ2H 3ZDXE 3VXUD 15C8L 1PEZA 1YNKH 4NNPL 3EYQD 3MV8D 1W72L 3L5XL 2O61A 4NRXA 4Z7VA 2Z92A 2ADJB 5TQ2H 3SDXA 3MV11 5H8DA 3JWOL 5FGCB 3VWJB 2HLAA 2BRRL 1VGEL 4G8GA 4HUWA 3HI6L 5KVDH 3QRFM 3GJEB 3QDGA 2P4AB 4HS3B 4X6DB 4JR9H 4AEHL 1BEYL 3ARDD 3Q6FB 4JFED 3BEWB 4B0MM 1I1FA 1IQDA 4HAFA 3ULSB 2DQTL 3TZVC 1K3IA 1X4YA 2X89A 1XCTA 4UDUB 1FVEA 1X5KA 4R2GC 4RMSA 3STLB 1I1YB 1QBML 4PJ9D 5C1MB 4NDMB 1R3HA 2IPUG 4UT6L 5KTEH 2XZAH 3VE0B 1LP9A 1G6VK 4KKCD 1M7IB 1P7QA 1KCKA 3EYSL 2X4OB 4QRPA 2Z8WC 5FKPB 1SEQH 3VFPA 5D5MA 1FFQA 3VXPB 4LIQL 1GL4B 1U93B 1YMMB 5LCVH 4M4RA 4ZFGH 5DMGC 2BY1A 4Q6IB 4AK1A 4DAGL 5SX4I 1P4LB 4PJFE 3IDYB 5DJ0B 1XGYH 3CUPB 2XTLA 1TJHH 4PJEB 1MNUL 3ARYA 4RA0C 1NMCC 4G7VL 3UDWA 4ZTPH 2ESVD 1H5BB 2R2CA 3HA0A 5EC1A 5FYLD 3D39E 5HYSG 4NZUL 3ILQC 1AXSB 3TVMC 4L3ED 2XFXA 4P4RB 1MAMH 5FYJL 3DMMC 1CFNB 4G80A 2NY3B 4PLJD 4MAYA 3BP7A 3C08L 5D7LA 3FQUB 1EAJA 5L88H 1QSZA 5DQ9A 3CIQA 3C9NA 3DVNB 1WFOA 1EZVY 4PRNA 1MCOL 5CKGA 4DKFL 1MJJA 1O7VA 1WCBB 3OQ3B 4PR5B 3QUZC 1MAJA 4P9MH 2Y06H 3REVA 4QXTB 4APQA 3B6SA 4YIQA 4S2SB 2AK4A 3MOBL 3TYFA 3SE8L 1WZ1L 3HC0A 4DVBB 4MD5A 5FECB 5JORA 2V2TA 3ZDZE 2VDMH 1I3RA 4N1CA 4WW1A 4MNQD 12E8L 5EU4B 2GTWB 5TE6L 2VZUA 3UMTA 4PJAF 3TBYA 5EN2B 3D0LA 4PV9B 3BKCH 4XNUL 1LD9B 4K55A 4M93C 3ZTJG 1T2QH 4K9EL 4NFDA 1LWRA 4G8FA 3F7VA 5J7CC 4MNHA 4LRNL 3K1DA 4MXVF 2VXTL 4NQDE 1LO3L 5CAYB 4MNGB 1KCVL 4PJIA 4IIQB 5ELIA 5EFIB 3A0OA 3CVHH 1IAOA 5JTWA 3MJ7A 1Q0YH 4PB9L 4L9DA 4RMVA 2NXYD 3QUMB 5HHOD 3HZKB 2UWEA 5SWZD 3L9RB 3QISA 4G9DA 5C07D 4Z77B 4E5XB 3QEQD 5DGQA 3SGKA 2WUCL 2PUQT 3F12B 2VDRL 4OGYH 4APQD 4D9RE 4ZMAT 1BFVL 4WCYL 4WI3A 3LKQA 2G5RA 3T4YA 1Q9KA 3VGAB 4OLYH 3QEHA 3G5VA 1QEWA 4K8RD 3UTQB 4J3TA 4NHCL 4C83A 2EO9A 1EK3A 4RCAA 2LE9A 2ZCHL 2PCPA 5K33A 2ENYA 5IIEB 1CIDA 3CLEL 2HH0H 5TE7H 3BWAB 3CFBB 4NUGH 2XY1A 2XQBH 1T0MB 2QADC 1IT9L 4MZ3A 3SGJC 4M5ZL 4MLSA 1Y18A 3I6LE 2VZOA 3FFCB 1I9JL 1GXEA 1A2YA 3PGDB 1K85A 1MIML 2DL2A 4QCIA 2JE8A 2VAAB 3T0EB 4HXBH 4U31A 3QIWC 3SBWC 4OZIF 2D7NA 43CAB 5HYJD 4YDKL 4EI6A 1EBAA 2IANB 1GGCL 4KUCD 1S9VB 3T2PA 4M8QB 3QHZH 2AQ1A 1PAMA 3H9HA 3MRRB 4FQ1H 4ZUVA 4M6NL 3CZJA 1G9ML 1R5VA 1TVHA 3PWUB 3IFLL 5JHLL 3MUGB 4YQXH 3UJTH 1HQ4A 3MCLL 5I66A 4M7LT 2W0KA 3ILPA 3RVWC 2RCSH 1ADQA 2GSIA 1OSZA 2Y36H 3DO7A 3RA7L 5KN5A 1TZIA 1J8HE 1EVTC 1IGJB 2AEPL 3PXJA 3TN0C 3BH9B 4JVWA 5EB9A 3MRKA 1UXSA 3SJVA 1JUFA 3UPAA 3BKYH 3MREB 3GHBH 3MZGB 3U1SH 1DBJH 1MWAH 1IEAB 1S8DB 5CEXA 1KIQA 2R2BB 4MJID 3A6OA 1IC7L 2ICWB 1NFDB 1F6LL 2EIDA 4BSWB 2D7TH 5I1EH 4XNQB 1HILB 3MLTA 4AEIL 3VFTB 1R6VA 3NCCB 4ZUTA 4HH8A 1INDH 5KVEL 1HH9B 2J8UE 2OJZH 1X4XA 3ME0A 1JGDB 1UWEL 2MCPH 4ODSL 1AFVL 2GJ6A 4MXWH 2R69H 3EJYC 3CK0H 3MOAH 3SPVB 3VFUA 3QCTL 4N8VB 4LDLB 1AO7A 3BP6B 5B39G 5CJXC 2W9DH 3FOLB 5HGBA 1OTUC 4RZCB 1GH7A 1P2CB 2FATL 4Z8FL 3MUJA 3RUGF 2AI0L 3EDDA 2VLJE 3BIKB 1FSKC 5A43C 1KLFA 1AD0A 4W4NA 3NIDE 4XPAH 4JDVB 2NY2B 1IQWL 5I2IA 5FV2A 1WBYA 3OB0K 4G42A 4PG9B 2DJUA 4L9LC 1RZGB 1BHGA 4GKSB 5E00B 1N5YH 5I1AB 1IGFL 4KDWA 4KROC 4TYUA 2VDKL 2NX5B 2VDPH 1KBGH 3REWB 3FQXA 4HH9B 2FR4A 4BH7B 3BGFC 4N8PA 3VFVA 3QDHA 4OZIB 5C0NC 2M8XA 4OJFL 3T2NH 1YYLL 5C0IB 2DM4A 5JUEL 2DD8H 4HS8H 5FGBA 3WFCL 5CP3H 4X6CF 5CSBA 4V1DB 2QQNH 3C6LB 1T7ZA 4YDVB 4R26H 4XMLL 5A16B 2A1WH 4Y16D 4R0LA 3S96B 1UACH 2DICA 2VYRE 2AXGB 3L3IB 3RWHA 4LCWA 4YHZH 1FYTA 3GO1H 5IEKB 5I30L 4I8DA 3SKNA 4PJ5E 3W9EA 3KXFE 2NW3B 5HHXL 2R56H 1RZIB 4E0RB 3M17A 1XF3B 1NLDH 3BJLA 3MLYH 3O0RH 1VFUA 4Z7UE 5HHNA 3THML 2VISA 1JGLL 1E4XL 2C3VB 3MRBB 4JM4H 1FC1A 1ZT7A 4M7KH 5A3IC 1VEMA 2W60A 5DJ6B 5HDBF 4M61A 3UTOA 2HJFA 3D9AH 4A2LA 2O5YH 4YLQT 3V0WH 3TO4D 5E4EB 4XBEL 2AEQL 2I27N 5DFVC 3WS3B 4CMHC 1CL7H 3VWJA 3AM8C 5EOQL 4YC2C 5E6IB 1UA6L 5F3HB 1HHKB 4DK6A 3X14B 3CSYB 1N59A 4HS3A 3V4PH 4P4KB 1L7TL 1CICA 1QA9A 2YD9A 2X5PA 3ULSA 3D0VB 3X13B 4XP5H 2XKUA 5CZVL 4UDUA 1UQSB 5GGSB 5DMIL 4P5MA 1S9XA 3CFIC 4B53A 5GIRB 5FK9A 1NUFA 3DWTA 1MJ8L 2CKBH 4KKLC 2DWDB 4K3HA 4LDOB 4QTHA 1NPUA 3V6BR 1T20B 5D2LA 4M7LH 1MQ8A 4X9BA 4LVNC 3IU3A 2R0ZH 1CTOA 3MO1B 4EN3B 1YMHB 3MLUH 1JF1B 2AJYH 2HT4D 2Y72A 2EE2A 3Q2CA 1CLCA 3DVGB 8FABB 3WO4B 1GAFH 2NYYC 1F6AB 1P4LA 2VDOH 3ARTA 5DJ0A 2HVJA 3OR7B 5DD0H 4OV6F 5BXFA 1X7QB 2I26N 1H5BA 4H25B 5C7XH 1Q0XL 4R4FH 5ID0B 1AXSA 4JY5L 5GJTH 3MXVH 4P2RE 3QFJD 4ODWB 3UXFA 3H2WA 3Q6GL 5CGMA 1OAQH 3TBTA 1CFNA 2CO6B 4OQTL 1JP5A 2FSEB 3ZSSA 1H3WM 2V9RA 2X05A 5IKCB 5DMKA 3DXAE 3PP4H 3W81A 4WHTA 1NCCL 1QD0A 4XTRD 1JZ8A 1ZLWK 3VXNA 5E9DB 3SCMA 1A1NB 3U30B 1JYNA 5BV7L 4LGPB 5BMFL 1PZUB 2C3WA 4NN7C 3F8UB 3EFFA 1DVFC 5IQ9B 1EXUB 2Q6WA 4YDIH 3DLQR 3RIAF 5C9JA 2FECL 3WIHH 3JWDC 2FH6A 3GSWB 4D3CH 2EDFA 3BOVA 5EU4A 2DLHA 3C5SB 1HNFA 1D9KB 3LHPL 4R4BA 3V8OA 3TBSA 1V7ML 3S4SG 3PIQB 3JXAA 2OQJB 4LCCB 4JN2B 4FQCH 4JFDD 2IJ0C 3W11D 4C58B 4Y5VC 1LD9A 5DD3H 3V95A 3MYZA 1B0WA 1JV5A 3DROA 3QXTA 4B50A 1TFHA 4PGEB 4NZRL 3LV3B 5B8CB 3BPCB 4QRRE 3DRTB 5C0RL 4Z78A 2AK1H 4ELMF 1OP5K 1F5WA 1QLFB 3U0PA 5C86A 3ULUE 2EDQA 2WK2A 4IIQA 4W4OA 3QPXH 3AY4C 5EFIA 1F58H 4BZYA 1T04A 1F3RB 5BRZD 3GSOB 2HLFC 5C0CD 1F8TL 4XVJH 4DEPB 5LQBL 4XXCA 4EI5B 3QUYD 4NO2B 4D0DB 4IDJH 4KQ3H 4E5XA 3UROR 2Q7YA 4O9HH 4OCNC 4FOMA 4KK6C 5F7MC 1MI5D 4Y2DB 2ADGB 3TNNA 1IAIL 4YHPA 5FOBA 1MF2H 4Q9RL 1FAIL 3JV5A 4NNYA 1T1WB 3IFPB 3VFGL 2F9BT 1XAUA 3LS5L 4HD9A 2UY6A 3UZQA 2Q20A 1IL1A 1RZJH 1EMTL 3OKMB 3ULVE 4DZ8A 5FV1L 5EO0B 2BCKA 4I48B 4MJ6A 5GRUL 1T66D 5MERB 4ZUUB 2JELL 5L0QB 3TCLB 3PHQA 3G5ZB 1EO5A 5J9PA 1U2CA 4LLYA 5C0AB 3EYOA 1QO3B 2WWMC 3MV8B 3PGDA 3VD7A 1Z0MA 1RZJC 2A83B 2IPTH 3STZB 1AH1A 2W59A 3NFPA 5EH1A 5MEND 2ZOKB 3QDMD 4UMGA 3HMWH 3MRHA 1YQVL 1CZ8H 1II4E 4PRHB 1S9VA 1S7WA 1A7RL 3VXQB 1XMWA 4K94L 3MRRA 4Y8AA 1S7TB 3FN0H 4JLRA 1JGVH 1CFVL 1HYRC 3P77A 3KPTA 4KJPD 2X44D 3ARDB 4JFEB 2BVYA 1UZ6E 4XC3L 5JIPA 2ITCB 3OKLA 3KHOA 3RWJB 5B38B 5IFHL 2XY2A 1OTSD 4FZEL 2CIIA 5J56B 1U3YA 4LSQH 4LK4A 1AC0A 1V3LA 1PG7L 4I0KA 3OJ2C 4XC1H 1IAMA 4RIRB 3WLWC 1QFOA 4PJAA 3BDYL 1G0DA 2HFFA 2XICA 2F53E 2BNRD 5JO5A 2XWTB 2BVEA 3PV6B 1ZKAA 1S8DA 3FRUB 3VGFA 3OGOE 3O6LL 4OLVH 4JFYB 4LEOB 3OSKA 3SOBH 1E0OB 1G1YA 4ELMB 3HG1E 3HLAB 3WUWA 1DE4B 1RZKL 4A6YL 3ULVL 3E1F1 4MX7A 1A1MB 1C16B 5CMAB 4LU5H 4ZFOL 1BX2B 1U8QA 2XOTA 1RZ8B 1U92B 5IROC 1F3JA 3PWPB