5J5CA

Crystal structure of arl1-gtp and dcb domain of big1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
b'EMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 1
publication title Structural basis for targeting BIG1 to Golgi apparatus through interaction of its DCB domain with Arl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2016-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5j5cA00
1M1YE 3QPWA 4PO1A 2RGGA 3THWA 3X1XA 4ARZB 2R6FA 2BM1A 2V1UA 2AKAB 5JHGB 2EWWA 2AFHE 4Q1BA 3RAPR 1IJEA 1DVRA 1AZSC 1OHHD 1WF3A 2UZ3A 4NCHA 5CB6A 3UG6A 4TSFA 1CU1A 4NPHA 3VR2A 3AH8A 2IX3A 1CBUA 1LF0A 1Z6XA 1OV4A 3ND8A 4Z54A 1D2EA 2F1HA 1G8HA 4XOIA 5K8IA 5IHPA 3LW8A 3U44B 5FTMA 4R71A 2FZLA 4FXPA 3CW2A 3KDSE 5KO2A 1GFIA 2AK2A 2PCJA 1IOZA 4ZV4A 4DUGD 3EWAA 2ZSDA 3PUXA 4P0TA 5E7MA 5A5GA 2QE7A 2ERYA 3AQ4A 2IS2A 2C03A 3SYKA 1DG1G 2MMCA 4PQFA 4D2IA 1P5ZB 1NMXA 1Q3TA 3MG9A 1KK1A 2BDTA 4QHTA 5FUVA 2QY9A 2OBMA 3U7HB 5GJCA 2CVHA 1JEDA 1KO4A 1N6OA 1FX0B 1VG8A 4A0HA 1G21E 4UNRA 3RYTC 1U0JA 4DBLC 4TT3D 3BERA 1KZGB 2EYQA 2VP2A 4CW7A 2OCAA 5IK2D 1N6IA 1Z22A 2QTFA 2ZE5A 1HY3A 1XCPA 3HP1A 5IT5A 3QXJA 5AJYA 3SYLA 1ZC4A 2AFIE 2ZRNA 1KO8A 3CX6A 4HAVA 3SJAA 3AGPA 4LHVA 5FOXA 1YJ5A 4Q1DA 3FKSA 3A1TA 1UPTA 2H16A 2NOAA 1RW4A 1IN5A 2QRNA 4JBYA 4LJ6A 1FMJA 1Q1QA 2HCBA 2P3SA 4NU0A 2IUSA 4PAQA 3FPAA 4MGYR 3B60A 4ZI3A 5FBVB 1GRNA 3RS2A 2C98A 3TUJC 4CGZA 1JR3A 1CJUC 3TSZA 1P2VA 4OHVA 4LUCA 4XVRA 1A82A 1KYIA 4UXHA 4PZYA 2ZYWX 2XNDA 4HAWA 2HYDA 4TQAA 2F9MA 2HJGA 4IW3B 1Q44A 2C9OA 5KNBA 1JJ7A 1NRJB 3R9XA 1NP6A 5KDLA 2ZI6A 4B3GA 2QEQA 2BM0A 4P4TA 4GMXA 2P67A 2JLVA 4PPGA 1TAGA 1U0LA 3TQCA 3AB3A 5LB4A 4F93B 1XD2A 2IYWA 1KJYA 4PZZA 1M74A 4NYIR 3AVPA 5FTJA 4AG6A 1VIAA 1G3IA 3SS8A 1AK2A 1YR8A 4DKXA 3TAUA 4A6PA 1F2UB 1GNRA 1PLJA 3TK1A 2RGBA 1E96A 3NHAA 3KUCA 1PLKA 2LCFA 4E09A 1G5PA 2JIZD 1QHXA 2EW1A 3BB4A 5HE8A 3RS3A 3RS4A 2WJVA 1G17A 3RABA 1EFTA 4Q47A 5FUXA 3SZRA 3LDAA 4RD1A 2OCYC 3KB1A 3BXZA 3TR5A 1CXZA 4KJZA 1Q21A 5GJBA 5DGXA 1G1MA 2J45A 3MWYW 1G18A 4TN1A 3BH6A 3RS7A 3PVSA 2OG2A 2CE2X 2VHQA 2IYUA 1YZGA 2OSBA 1KI3A 3NC0C 3KZ1E 4NCKA 3BE4A 2QL6A 3MJRA 4LSGA 5JS7A 2QP3A 1Z3IX 3K8YA 5FPKA 2QPAA 2Q3HA 2VHCA 2IWRA 2ORIA 2W58A 4LJ5A 2AWNA 1W2GA 2CMKA 2FGKA 3LX8A 1KDTA 4MUBA 3SU8A 3MCAA 2NPIA 4EFMA 3N70A 5TB5A 2PLRA 2QENA 3PR1A 3WP1B 3ZDQA 5DN6D 4JKIA 3QJYA 1QF9A 2QNRA 1BS1A 4A8JC 4AYWA 4DCNA 4A4DA 3EZFA 1HQYE 2RMKA 5CDFE 3SBEA 2XOKA 1ZD1A 3QIAA 4PAMA 5KSPA 1DAIA 5HCIA 1UBCA 2ZJ2A 1EXMA 3B2EA 1GDDA 1A5TA 2FA9A 2XB4A 2QMUA 4OHXA 3K9LA 1KIMA 2JASA 3U3JA 1NG9A 2G1KA 3W90A 1C9KA 2DBYA 1G7TA 3OESA 4LBZA 5FPHA 3TAHA 3LW7A 3K0SA 2ZPTX 3GJ0A 3K0CC 2HLDA 1XTRA 5A4JA 3CZPA 1ANKA 2IEZA 2YVUA 2PEYA 4FMDF 1P7CA 4X8OA 2QMEA 4A6XA 5GADl 3JZMA 4NYMR 2ZYUX 1X8KA 1YZQA 2W2VA 3W8NA 4BASA 5J4VA 2O8BA 1Z2CA 1W0KD 4HSEA 1NLZA 4QNMA 4YXWD 4O2RA 1CR0A 1NBME 2IHBA 2PL3A 3B82A 3PUZA 1SXJA 1ZYUA 3PEVA 1NIJA 4HB0A 2CJWB 4ZIRB 1BO6A 1R5OA 3TW4A 4M1KA 4Z51A 2WMNB 2DR3A 3O47A 3CF2A 3U61B 3B6EA 2GEVA 3L43A 1NF3A 4PQYA 4ABYA 1BKDR 2ZJAA 1G8PA 2IW3A 4D0NA 2NMVA 5FBLB 4YMWA 2J59A 1A2BA 2WSMA 2ZRMA 2CCGA 3VHXA 2ZRBA 1DTSA 4RKEA 3RLFA 3NXSA 2ZR9A 5FTKA 4JBXA 2D7DA 1JAHA 4P4UA 2IWHA 4DHEA 1H65A 2OAP1 3KTAA 3ZIAA 2A78A 2O8CB 3IUYA 3U3KA 1X86B 2BCGY 1WBBA 2ATXA 5D3QA 4Q4LA 3T06B 2W2XA 2IUTA 1J90A 2RGNC 4ZCLA 4B3CA 4A1FA 3BWDD 2C04A 2GA8A 1W7AA 1DAMA 1HUQA 3QF4A 4IVPA 4B76A 4IXMA 1XMVA 5EP4A 3MWJA 3VFDA 1G9XA 4PC6A 5JI2E 2HCJB 3ONWA 4PX9A 3W3ZB 3THXA 1II8A 3CR7A 3D31A 4C0JA 1RPZA 4O25A 3OF5A 1EFCA 2NTYC 4XTCS 4LJ4A 2GZAA 4R9UC 2ORVA 2JDIA 1QDEA 1XMSA 1LNZA 1MOZA 2NO7A 1AS3A 2ZYVX 1NMZA 4I1OA 1C1YA 1DAEA 1E32A 2AD5A 2XNSA 4HLUA 1O3YA 4KFTA 2YC2C 2ZS7A 6Q21A 2J9RA 5JWRA 1XX6A 1AKEA 5TVKA 3WY9A 1KAGA 1FZQA 3KXIA 3RS0A 5HZKA 3SFZA 2DFTA 1UF9A 2FDCA 5CLLA 1XP8A 2BVNA 5EP2A 5JWHA 3ZVNA 3REFA 3AVXA 1R0ZA 1G6HA 2WHXA 1NIPA 2V8OA 2ZU6A 5ANRB 5BN3A 3K9NA 4HLQB 2R44A 4DVGA 5KTYA 1GM5A 3I8XA 4DDVA 5KDDA 1TF7A 2GF0A 2ODEA 2QGZA 3KKPA 3P27A 4LBWA 4OI2A 1ELOA 2GK7A 4LOAA 5JFGA 1IHUA 3I62A 2CL0X 4FI3C 1ZD9A 2R8RA 1XPRA 2FU5C 4PSKA 3VR1A 1E2IA 1R7RA 4PQRA 2N46A 3GLHA 3JVUA 3R9IA 2ZS8A 4WIAA 1EFHA 1DELA 3ZVRA 2FEOA 1N25A 4LC1A 4N0DA 1HTWA 2GJKA 1M2OB 1U98A 1N6HA 3D3QA 2VL7A 3V4FA 3B78A 1ZM3A 1QVAA 1T91A 4BE7B 4TL9A 1P9RA 1T3LA 2QTVB 4CIDA 4TMVA 4LCBA 4E03A 4BZQA 3U4QA 2BV3A 4PO9A 3SYNA 1OH8A 3GLIE 3KKQA 2QT0A 4GP6A 1F2TA 1S0UA 2VO1A 4C9BA 1XPOA 1U94A 2JJ1A 2ZRJA 4L15A 421PA 1Q0UA 3K9HA 3OEHA 4DRZA 4EPTA 4NCIA 1L7VC 4LRWA 5AUNB 3PEYA 1T5IA 3AVUA 3V4RA 2W00A 2P65A 1W4CA 2QM7A 1QG2A 4N3NA 4LJAA 2RGEA 4TYPA 4FWTA 3H2YA 2WM9B 2WKQA 1MABA 1G16A 2XEXA 4U7DA 5HCNA 1W36D 4KODA 3QXHA 3CWZA 3K70C 4QJ4A 3FVQA 2Z5FA 4BFTA 2WIBA 3K0EA 1WP9A 4IVQA 3KJEA 4PPQA 2O5VA 3KQNA 4JIMA 4LJ7A 3QF7A 3ND9A 3WNDA 5B30A 2BWJA 2PH1A 1KGDA 4DUGA 1W5SA 2F43A 2XXAB 1CLUA 2ZS9A 1XCMA 3FKSD 4CEJB 1T3SA 5SZJA 2BEKA 3WBKA 1G7RA 4JSTA 3SEAA 3T15A 3QNUA 4EPXA 5G3ZA 1RRPA 1QVRA 4EPVA 3BORA 4Q02A 1B23P 2WBLC 1D8TA 2J7PA 1JALA 4KAXA 4ZDWA 1JR3D 1JPNA 1OW3B 3U3RA 3I92A 2REXB 5CK4A 3HPQA 1Z0IA 1VECA 3VKHA 3DDCA 3UMRA 1VCNA 1NY6A 1DAFA 4URYR 1BYIA 5KOYA 3G82C 1E94E 2GEDA 2FFHA 4O3MA 2G88A 3O8RA 4HI0E 3O8BA 4GZMA 1MKYA 3R8CA 1SHKA 1XTJA 4BLPA 2IHYA 4TTQA 2B7BA 5LPNA 5E95A 2J5XA 2J3EA 4Q5IA 4URZR 1Z5ZA 4KV9A 1NG1A 4KSCA 4TMTA 5J5CA 1E0JA 4A0RA 1N0VC 3CPEA 2IS6A 2I4IA 3B1YA 4KYUA 1GAJA 2CE7A 3GFPA 5GJWC 2FFBA 3JZAA 1YU9A 1OXTA 1T0HB 1U8ZA 3ZS9A 1NVVR 3IQWA 2JAQA 2KBFA 4TMWA 1N5KA 4M1WA 2QN6A 2FPMA 4TL8A 3W6NA 1Q57A 3FHTA 4MYCA 4WOPA 5TDHA 3VR6A 5J40A 3DL0A 4NYJR 5LD2B 1T0JB 3C14C 5JSZB 2P6RA 2ZSAA 2BJWA 3ZGXA 1NN0A 1OFUX 2F1RA 3B1VA 4W5JA 1X3SA 2GKSA 1P62B 1XTKA 2C9YA 4B2PA 1JR6A 1M7BA 1P75A 4D4MA 4HDCA 4YLGA 4XTRA 1PV4A 4EPYA 1ZVQA 4NBSA 4IXNA 1IN4A 1KO7A 2J0UA 1E9BA 2FG5A 3CNOA 1QHNA 2GVZC 3I32A 4KFRA 4PPFA 1P2SA 1Z63A 5D3MB 3FHCB 1I4LD 1LTQA 2XOKD 3FFAA 2GHIA 3ZD7A 1GITA 4YMVA 1MR3F 5FR2A 2A3RA 3THYA 3B1XA 4F4JA 4M22A 4MKIA 2ODWA 3QKTA 4G5QA 1RYHA 4BECA 1UKYA 1WB9A 4OBEA 2YOGA 1RJ9A 1OYYA 3I8SA 4GDFA 2HLDD 2IK8A 2BHRA 5EE5B 3B9QA 3GLFA 4QHYA 3NDPA 4OQXA 5LDDC 2H8KA 1FW6A 1AIPA 1WCV1 1HT2E 4IVRA 2ZQ5A 4DLWA 3CZQA 4Q4HB 4Q4AA 3LXRA 2A5DA 4LBVA 1HT1E 1SKYB 3VU9B 2ZSEA 1CR2A 2J41A 2TMKA 3WYGA 1VYUA 1G8GA 1YE8A 1SXJD 2C5LA 5B57C 1X1SA 1GSIA 1KMHB 3QBTA 1XEXB 4QGHA 2F55A 1Z6YA 5CIQA 3FMOB 2BOVA 2XSZA 1QHSA 3ICEA 4V0NA 4G5RA 5JHHB 2WJHA 1KSJA 1MRNA 2NG1A 5TV2A 1KDPA 2G77B 1TF5A 1W0KA 2FH5B 2QRZA 3U6KA 2QA5A 4OK6A 1GRRA 5TARA 3DMDA 1E2KA 1NY5A 4UXJA 2OBNA 4Z1MD 3ZIAD 1TNDA 1US8A 1OT3A 4WW0A 2AWOA 1U0HC 3AKDA 4BRWA 4DSTA 4C7OB 2ZANA 4M1MA 1S2MA 4Q00A 3AV0B 2QORA 4XSGA 2YC4C 4JLKA 4ZO4A 1T6NA 3R7WA 2WJIA 4ZCMA 2YINC 4KLNA 3RNLA 3C7KA 3DZ8A 1Q12A 4JVLA 1S4QA 5EQTA 4P33A 2GILA 1Q1EA 4JLBA 1EFUA 3A4MA 2JDID 1W0JA 4PC1A 1G4AE 4A15A 4OJQA 1BYUA 3L0IB 2NGRA 2ZVPX 5H70A 4DZZA 1NN1A 5EE0A 1EG7A 3V00A 2V6JA 1FFHA 1T3HA 3DOFA 3THWB 5AJWA 4BPBA 1UKZA 4QGAA 1F48A 2OLKA 4RZUA 2LKDA 2AK3A 2IYSA 1HE1C 2XITA 5J4KA 5FUWA 1TEVA 4K8OA 2ANCA 2NO1A 3Q3JB 1B0UA 4B3XA 2OILA 3ADBA 4GBMA 4V0MA 3NEYA 2IC5A 2EFDB 5EZ5A 3K0FA 1AKYA 1L4YA 1ZAKA 2QG6A 1QHHB 4F92B 4LYFA 2ZE6A 2KBEA 4HZIA 1SGWA 3ZVLA 4D80A 5HTKA 1IN6A 1AS0A 1TF2A 2GCPA 2RHMA 3FDIA 3RC8A 2R9VA 3GLHE 1W2HA 3KJHA 3VTKA 3G5UA 1JXMA 1ZNXA 1I4TD 4CZ2A 1NN3A 5EP1A 2C2HA 3LH5A 3DOEA 4QHSA 3GLIB 2BJVA 3QOFA 3TQFA 2XZLA 4X8LA 5FPYA 3ECCA 4EPWA 4TLBA 1VKJA 3AF3A 3BH0A 3NDBB 4QC2A 4BWYA 3ADCA 3WXMA 2ZI4A 2FPKA 3C8UA 1FL9A 3UMSA 1O87A 4HAUA 3TUIC 1OXVA 1T5LA 3TNFA 3L8ZA 4ON9A 1G64A 2JLRA 4OQFA 1VHLA 3IPYA 1P3JA 3CH4B 3LVQE 4KI0A 3KL4A 4BQSA 3LVRE 4A0GA 1Z06A 4QG7A 4S2EA 4JYCA 3NH6A 3S1AA 5FH9A 2JJ1D 3CF6R 1HH4A 1Q3HA 2IYRA 3GJ4A 3OEHD 5JJIA 1YRAA 3W9YA 5L3RA 4M1SA 4AI6A 2CLCX 4BFWA 4HZUA 1NN5A 1Z29A 5JS8A 5K8UA 1G7CA 2GWHA 4W9MC 2ZITA 4PHGA 2GCNA 1KDOA 3K09C 1P60A 4ZCIA 4HAYA 4H9GA 1WE2A 1E0AA 5BN5A 1GL7A 3U7GA 3CM0A 1G5RA 5LD2C 1UKEA 4IEIA 1IQPA 5SZIA 1XZQA 2D3WA 3CKLA 1ONBA 2VLIA 4TTPA 3RSLA 3ZQ6A 1GWNA 3V9PA 5EE1A 1CR4A 1E9RA 1R5BA 2FWRA 2R2AA 1SVOA 1TUIA 2GJSA 3HU1A 4GP7A 3WNBA 1XD8A 5KPJA 3KQKA 4LPSA 5DYIA 2RH5A 4TYYA 1P61B 2J7PD 3IGFA 1GVNB 3PENA 2WPDA 3PG5A 3E70C 3NWJA 1S1CA 1ZIPA 1E9AA 4V03A 4Q7MB 2O8EB 3E2IA 3AGQA 4D4JA 2D2EA 1R5NA 2MSCB 1G20E 4JL5A 2YOHA 1I4DD 4URUR 1FMLA 1ZRHA 1AA9A 3A1WA 4BFXA 1LW7A 4N0EA 4JLPA 2GAOA 5CLQA 1P2UA 1N2CE 1W4RA 5FPSA 2XJ4A 3VAAA 1G3QA 3TH5A 4C0KA 4EIWA 4F91B 2BBOA 1H8EA 4K46A 2GZHA 4Q1FA 2B8WA 1ZM2A 1N6RA 3EZ7A 2GCOA 4LHXA 1Z83A 2W0MA 2YYZA 4NP6A 4OHZA 1CTQA 2FSHA 2NZ8A 1GL6A 1N6NA 4L16A 2QI9C 5BWMA 4J0QA 1X1RA 4JLOA 4JVNA 2FE4A 3NBZC 1TQDA 2PMKA 3IBYA 2R6CA 4MA4A 3FGNA 4C0SA 3QE0A 2GNOA 1OKKA 4D81A 3ZYCA 1U9IC 3M0EA 4H1UA 2R6GA 3FMIA 2PX3A 4FD2A 4QBFA 2YWHA 1Z6TA 1XBTA 3B5JA 5JCZA 3C4JA 2C9CA 2OFXA 5FOWA 1LB1B 2RGNA 1VG1A 4B44A 1Q22A 3U44A 2ZRFA 2O0JA 2JEOA 4B71A 1X6VA 2IS4A 2QP4A 2IT1A 3CNNA 4TLEA 2FOLA 1V5WA 3SJCA 2VP4A 4KCGA 2Q3MA 4W7SA 4CRWB 4DIEA 2VEDA 4G01B 4LPKA 4Q7JB 5CJPA 3OE7A 5DIFA 3VR5A 3WHLA 2NIPA 1OJLA 1XNJA 1UADA 4BEBA 3CH5A 4B3BA 1E2QA 1ZIOA 4US0R 2ZAMA 4ZKEA 4ACAA 1QBKC 2D4HA 3ICQB 4EQ6B 1QG4A 1TU4A 2PZEA 4IOJA 2QQEA 2AX4A 3DPUA 2ZUCA 2DWPA 2J7KA 3T1QA 4DDUA 2XAUA 1SVKA 1E0SA 3EIQA 1EWQA 3W34A 4AC9A 5FR1A 2WWXA 1QRAA 3U7EB 2Q9AA 5CB8A 1PUJA 2X1VA 4FCTA 3GP8A 5AJZA 2VSFA 4D6PA 2G0TA 4L9SA 3U7FB 1HA3A 3BAFA 3L0SA 4IOLA 4B34A 5GVSA 3K9GA 2ZXUA 3EG5A 4AIIA 4EAQA 4CEIB 5JJKA 3LAWA 1SVIA 1R2QA 1Y63A 4G5GA 4M9SA 4OYHA 4LC0A 4PC3A 2FGJA 1HURA 2EFGA 2Y8EA 5K8LA 4R2IA 2DB3A 1G3RA 2W83A 1KSFX 3DO6A 4LI0A 2O8FB 1AM4D 2XSZD 3DEFA 3QF4B 4XVQA 2HJVA 1QZXA 2AD1A 4IKEA 3THXB 1E98A 4D0GA 1N0WA 3CX8A 3Q85A 1E0KA 4L8GA 2O0KA 2Q6TA 1IY2A 4HUQA 4AK9A 1HEIA 1WQ1R 1G41A 2J1LA 5DSZA 5FFMA 3ZJYA 3GLGA 2HDNB 3I1FA 1SHZA 4JT2A 2GJ8A 4PXAA 2NQ2C 1NVWQ 2FNAA 4I99A 3GCGA 2YKGA 5BYJA 3EX7C 4XH9B 3QEOA 4B75A 1FTSA 1KI6B 1I2MA 1ZU5A 3ZH9B 4EDHA 2IYZA 1S1MA 5CM9C 3BD9A 4JL6A 1SKYE 2GVDC 1ZUHA 2WJJA 4GPTA 4G5SA 1N3BA 1ZMXA 3T5DA 3IBGA 4ZDIA 3AEZA 2C95A 2WAYA 2V1XA 2ZUBA 3CRQA 5FTNA 1DEKA 3AF2A 4O0MA 4EPRA 4QM6A 4PANA 5J47A 3OFND 3N2IA 1VCIA 4Z1MA 1W1WA 1W0JD 3BGWA 1Y3AA 1KK2A 2DFNA 4LDJA 3QVUA 1VIYA 1SVSA 1UKVY 1XF9A 3CB4A 3KXKA 1F6BA 4WVFA 2KI5A 4PFSA 4B74A 2VHUA 5FOVA 1LFDB 4Q48A 4DLRA 5L3QA 2GF9A 1E99A 4MRRA 2R65A 3EPHA 4FINA 4BZXA 4P4SB 1NLFA 1N5LA 2CLSA 2RGXA 1RE0A 3P4YA 3GLHB 2ZI9A 1TQ6A 1FNNA 2CCJA 4US2R 3LXXA 4ERNA 4AKIA 3F8TA 4RZXA 5LBIA 2GXUA 4C3ZA 3B85A 4U00A 1HE8B 1YR9A 2C96A 2IYVA 4GOXA 4L9WA 2V54A 1U8AA 3TVTA 3VNVA 1I2DA 3A4LA 3IHWA 2VP0A 2O8DB 2VF8A 3BFVA 1NJFA 4JSYA 3HYRA 3SC3A 4WBSA 2KE5A 4CT5A 5FI0B 4R2HA 3CLVA 1GILA 4C2TA 1XPUA 1XB2A 3PEWA 3DVLA 3IHLA 1DG3A 4MKFA 4P31A 5J4HA 4Q19A 3D6TB 1K8RA 2G9NA 4C2UA 1ZBDA 2OCPA 3MLEA 1G3MA 4TL6A 2CHQA 3TVDA 1BOFA 4IFBA 1PUIA 2X2FA 3VQTA 2WTUA 4JYBA 4NKRA 4FN5A 4F7WA 1MABB 4HATA 4JT4A 4LV8B 4ZIRA 1XCGB 1M7GA 2O52A 1XZPA 3HR7A 4G5OA 3CWQA 5KPDA 2ZJ5A 3IEUA 5EXSA 1HQCA 2ZIAA 4BFYA 4A36A 1G6OA 3EARA 2F43B 1A1VA 4QXAA 3NBFA 2WJGA 4Y0AA 1T8TA 1UBGA 2XTMA 3SJZA 4JLJA 4OK3A 4ESHA 2ZRDA 3RWOA 1TPZA 4KFSA 3EXAA 5EZ6B 2OLJA 3CR8A 4DDTA 4MITA 1WBDA 5EXXA 1Z0JA 4Z8XA 1U8YA 3IIMA 4PO8A 1GKYA 3L8YA 2BBSA 4HB2A 2OT3B 2FFQA 1E3MA 2AL7A 1ZNWA 2BKEA 3UPUA 4ZI2A 3AF4A 1L8QA 3AP2A 2F7SA 2XGJA 3F3YA 1KK3A 3B9PA 2RGCA 5EJEA 2NO6A 4I4LA 4C4PA 3MRSA 2BMEA 2FMXA 4RKFA 3NHBA 3QPUA 4XD7D 4JVMA 3VKWA 3WMEA 1ZP6A 4GZLA 2K5UA 3QKSA 3WYAA 1XXHA 3OHMA 3WYFA 3LO5A 5KNDA 4QJ5A 3EW9A 4IEEA 4MKGA 1GG2A 1E1RA 1KI1A 2ZTSA 3Q72A 5G41A 3EA0A 4G1UC 1FP7A 3D7MA 2IYQA 2WAXA 4HYYA 5FL7D 2WPDD 3A1UA 5BQ5A 4M9QA 5B58C 1WDTA 3ASYA 1VTKA 1UEIA 1ZINA 3WNCA 4A2PA 4TMKA 3HWSA 2W6JA 2CHGA 2CVFA 4B35A 1RVDA 2AKYA 4XWOA 3LD9A 1G7SA 4DB2A 4C0BA 2XTZA 4EUNA 1JB1A 5CM8B 4LHWA 2JA1A 3ZVMA 4YDHB 5A0FA 5G3YA 1JR3E 2GK6A 2VF7A 3TKLA 2VH5R 1ZM9A 2Z83A 1P73A 3EAQA 3TE6A 2YOFA 1TX4B 1NJGA 4V0LA 2SHKA 3MWLA 2C78A 1EESA 1H8ED 1CJTC 5AUPB 4L5BA 4B48A 2G3YA 1OH6A 1KNXA 4I81A 1UFQA 2WWHA 3SR0A 1NLYA 1YZNA 4BFSA 3E1SA 3W8RA 4M9XA 5JZVA 2C77A 4Q21A 4BUJA 4POAA 3FTQA 4DIDA 3KX2A 2BKUA 2ODBA 5DLQC 1MO4A 1OKKD 4UXIA 4HUTA 2EQBA 2H7VA 4ZKDA 1ETUA 4RD0A 4BLOA 4A2WA 4M4SA 4DC9A 4QNRA 1KKMA 3RC3A 3GEEA 2AXPA 3RSOA 2FV8A 2IL1A 3VX3A 3WP0A 2J0UB 1CJMA 4ZDKA 1IBRA 4B2IA 1E1QD 5DI9A 3GJ5A 3I4LA 1AQYA 4RJLA 4HLCA 5B2ZA 3ETLA 1GZSA 3THOA 4LV6A 3THYB 3SN6A 2FSIA 2V9PA 821PA 4MQBA 3I5XA 4HDQB 1SKQA 2DYKA 3FMFA 4FCWA 2Q3FA 1IXZA 3QKUA 2RGAA 3CONA 4F38A 2QAGB 4GT1A 2E9SA 2GBLC 3D8BA 4GNKA 1OIWA 4QL3A 1ZNZA 2A5FA 3QXCA 1SULA 3GLFB 4Q18A 3OE7D 1AZTA 1M34E 5AJVB 4B32A 3RWMB 2HUPA 4LHZA 4Q4AB 4Y0VA 2PT5A 3SDZA 1E9DA 1R10A 3NBXX 4KO8A 1Q20A 4NTZA 2HYIC 4MDFA 2ZE7A 4XJXA 3LLMA 1NVVQ 4YMUA 4ZDJA 1XTSA 1NNEA 1JBKA 5BXQC 2W0SA 1GKIA 4MGZR 4RZ3A 2GETA 4XIGS 3UXMA 4BLRA 3Q7QA 4AWXA 4II7A 4DT1B 3REGA 4D25A 4JS0A 5DI3B 4Q1AA 3KJGA 1CJKC 4FMDB 2ZUDA 3K0AB 1ESMA 3GJ8A 1XTIA 2BBWA 2ECKA 3OIUA 3PUYA 4C0LA 1FTNA 3I73A 1R0YA 3H86A 5AR1A 2ZRIA 1FPMA 4B3DA 2E1RA 1OLOA 2D62A 5EUQB 2JLYA 4ASUA 5C2JB 4EJSB 4QGFA 3AF1A 3TBKA 1KKLA 5AUOB 2WWWA 2HEIA 1II9A 3T12A 3QEJA 4LGMA 2ZJ8A 2CHVA 3U2QA 4TLAA 2OFWA 2PZGA 2QTHA 3R7WB 4B33A 4BLTA 1D6JA 4TLDA 3OIVA 1NL3A 3UK6A 8OHMA 1RC8A 1N6LA 3QXXA 1SXJE 1KTVA 2B92A 3WRXC 1OXUA 2IEYA 2ZI3A 4QBGB 1KI7A 4W5WA 3IDQA 2WWYA 1RZ3A 4QJ3A 3A4NA 4MYUA 3RRZA 3CUEF 5L8VA 1XD9A 1XU4A 2EFCB 4CT4B 4YQFA 4DDWA 3M4YA 3NKVA 2EYUA 4RSGA 5DO9A 3I61A 3F0TA 2VP6A 3PXGA 2H18A 3A36A 1MH1A 3TSWA 4UKDA 1JECA 3RDPA 2J87A 3K09A 4X8MA 2A9KA 4C0AC 4FCVA 1J70A 3C16C 1XJ0A 4K81B 3K70D 1BH2A 4M1OA 2ZJBA 1R0WA 5SZHB 1DBSA 1MT0A 1BIFA 2DY1A 2MSEB 4CVNA 3U6BA 5JEEA 3BFXA 3W5IA 2ANBA 3RHFA 4MRSA 2OBLA 5C1BA 3K0FB 5C4GB 2YWFA 1LF5A 2ZR7A 3BH7A 5CDFA 1EK0A 4R7ZA 3ZZUA 2VBCA 3VR4A 1E4YA 1Z28A 2VSXA 1YZUA 1P9NA 4Q7KA 1G8YA 4B3FX 2JCSA 5FI1B 1OB2A 2ZROA 3PV0A 4B6EA 1YZLA 5DHFA 2ZM5A 5L3SB 1UDXA 3U60B 2QQ0A 2WIAA 4XVUA 4LHYA 3DKPA 4Q03A 3LBNA 1KO5A 2WMOB 3AKCA 5JRZA 3TLXA 1PLLA 3KKMA 5D3MA 3W6OA 3T5GA 1XTQA 4WZ6A 5FUYA 4QKQA 2BC9A 2YHSA 1OFHA 2F6RA 3OFNA 4U02A 3NVAA 2VRWA 1RFLA 4M2LA 4U5XA 5P21A 1E2DA 2GXSA 1CRPA 4EKDA 3RANA 1DO0A 3I3SR 3AM1A 3AVWA 5KHOC 1NBMA 2GXQA 3TW8B 2VIIA 2IXFA 5FOSA 4KLZA 4RFSB 1CRQA 3LFUA 1IJFA 1OYWA 1L4UA 4DLZA 2JJ8A 1KZ7B 5CJ2A 4YMSA 2PMDA 3S1AB 3UKDA 2CLDX 1ZU4A 2D7CA 2OXRA 4NCNA 4Q4HA 4RZ2A 4CEHA 4Q01A 4M21A 2H57A 1NVUQ 5G53C 1TUEA 1UM8A 2OFOA 3PUWA 1AGPA 1T4GA 1ODFA 3CBQA 1UJ2A 4DLUA 1KMHA 4NZYA 2QROA 1U9IA 4BZPA 1E2LA 4GFDA 3BS4A 2WKRA 3RS5A 2MMGA 2F3RA 3Q8XB 1PZNA 3PUVA 4RCZA 2WOJA 1FQKA 1XEWX 2B8TA 4TMZA 3GQBA 2B7CA 4URWR 3A6PC 2JGNA 5DYGA 2A2ZA 3SHWA 4HEJA 1P9WA 3NTUA 3SJBA 1TL7C 4Q4JA 1OH5A 2HT6A 1N6PA 1MO5A 2VHJA 4LV5B 4I1SA 2H17A 3EASA 1AS2A 4WA7A 1HV8A 2C8VA 3AUYA 1KJZA 1W36B 4DSNA 3MJHA 3MFYA 1G3UA 3LQQA 4XSHA 4YONB 3GD7A 1RIFA 2QU8A 2OHFA 4W5HA 1ZUIA 5J4YA 1ZJ6A 1CS4C 2VPPA 5DNYB 5FBRB 4Q1CA 5HKKA 1NSFA 1JQJC 3EC2A 4BLSA 4V02A 5TY0A 2HXYA 4D4LA 1IY0A 3Q7PA 5GVRA 1XXHE 221PA 1SVWA 3QKRA 4JLMA 4B6FA 5JCPA 1CEEA 2CNWA 2PJRA 2OV2A 5J4LA 2OXCA 4LY6A 1OXSC 2P2LA 3KKOA 2WJYA 3HU3A 1YR7A 4RD3A 3P26A 2QAGC 2AHOA 3BK7A 2ZJYA 3LBIA 1IM2A 2PCLA 5IRCD 3A8TA 3GEIA 2WICA 4TQUS 2ASEA 2XTNA 2CXXA 1E1RD 3NBYC 3VKGA 1E2PA 2Z6VA 3L82B 5FOTA 1JJVA 5JRJA 1Z08A 2D06A 3RRYA 1DAHA 3P4XA 1PVOA 3CPJB 4S35A 3TUZC 4A8JA 2W6JD 1Z0DA 2PX0A 2UZIR 2CK3A 1OIVA 3T61A 2WWIA 2ZRCA 1GIAA 3A1VA 4NONA 4ESVA 2AN9A 4MGIR 4XD7A 2IYXA 1S3SA 5KNCA 1XJCA 4HLDA 3SHFA 3SNHA 4OHWA 4B73A 5KDOA 1XD2B 2GXAA 4XWKA 2QPTA 3CNLA 3SFVA 1QHHA 1TQ2A 2GEUA 2OEPA 2G6BA 2IA5A 2RHDA 3K0CA 1E2NA 4LYAA 1DAGA 2A5JA 4M53A 2W6IA 3GEHA 5FL7A 2IF2A 1KMQA 3R9WA 5GJVC 1E9FA 3X1YA 2GESA 1KO1A 4P3YA 4EJSC 1G19A 2QBYA 2ZU0C 4D26A 5JLJA 2B6HA 4GI7A 3GLIA 2QSZA 5TXGA 5H8WA 2MSDB 4OJKA 1YKSA 2YNMA 5G40A 1DAKA 2Q21A 4ITRC 4A92A 3BIFA 4BFVA 3BJIC 1KSGA 3T1TA 1KJWA 1OSNA 1FQJA 2Q9CA 2V7QA 2Z4SA 4IDOA 4M0LA 1GRQA 1E9CA 1KY2A 4C30A 3AVOA 3H84A 2JJ2A 1RRGA 4BFZA 4B43A 3IO5A 2IXGA 2CCKA 1KAOA 3KB2A 3MGCA 4JLNA 5EXPA 4KFUA 3LV8A 4WZBE 3FMPB 3FB4A 4ARZA 1K5DA 1K5GA 3NIBA 4IHQA 3KFVA 4DSOA 2G0NA 1KI4A 2P0EA 3CO5A 2IYYA 5KYKA 3DZDA 4UNNA 2CDNA 4Q7LA 2GJAA 3TGPA 4QGGA 1OB5A 4KU4A 4OI0A 3FYHA 5JI3E 4IJMA 5AUQA 2UVQA 2V4ZA 3EPLA 2G83A 3KXLA 5KSZA 5JEDA 2F1IA 4JLVA 3F5FA 4KBFA 1E1QA 4LK2A 4OK5A 2QPOA 4Q9IA 1XRJA 2CL6X 3NH9A 1KSHA 4UJ5A 3DM9B 2VSOA 1Z0KA 3UATA 3VX4A 1TTTA 2PZFA 5CYOA 4IOMA 3FKQA 1J2JA 3M6AA 3OEEA 1UAAA 4UQOA 1QHYA 1LV7A 2QT1A 3LY5A 4PAOA 1P72A 2ERXA 2QMOA 3HU2A 1Z8FA 3P20A 2AR7A 4CDGA 5CYPA 1QHIA 4GL2A 1W44A 2D74A 1KI9A 2ZREA 4DSUA 2DWQA 1IXSB 4NYIQ 2I1VB 1R4AA 4LBYA 1FX0A 1J7KA 3CX7A 3MAAC 4HB3A 5HR5A 2LKCA 1CJVC 1IAQA 4HUQB 1T8UA 3GLGB 1E79A 2L0XA 2O8BB 4PC2A 3HPRA 3T34A 1YQTA 3AP1A 4ASUD 1E2JA 2P6UA 1W46A 4F4IA 3EPKA 1JEEA 4Q9KA 3X1DA 1SXJB 3ADDA 1KHTA 1ZW6A 2O8EA 2YJTD 1XEWY 2FN4A 1FUKA 3C41J 1P6XA 3QI2A 5M04A 3GJ6A 2X2EA 4I1VA 2YZ2A 4NDZA 3UANA 3GLFE 1H8HA 4D82A 4GOKA 4KITB 1NKTA 1RRCA 4MYTA 4JKYA 1MV5A 1JI0A 4P32A 3QENA 3P32A 4TYNA 3K70B 4AD8A 1LS1A 4MYHA 3AVYA 1N6KA 1AJEA 4URXR 4PR0A 2EFEB 1W5TA 1WMSA 1Z2AA 2BCJQ 4PTLA 3CIOA 1E2FA 4MH0R 3PEUA 3KTAB 1GOTA 4YC7A 1IN7A 5SZKB 3ASZA 3AKYA 3EZ6A 1JAIA 1BMFD 4DLYA 2ONJA 5H68A 4L4UA 2ZSFA 3BBPA 1NVXQ 3FWYA 4AKGA 4F4CA 2JLWA 5L3QB 1IONA 3LNCA 3W3AA 3ZQJA 3WRYC 4B47A 2R62A 4C0QC 4JMPA 1YR6A 3EPJA 3QBVA 2PJZA 4IRUB 3EZ2A 1TMKA 1II8B 4I1UA 5HZHA 3CRMA 3UWOA 1X8LA 2ZRPA 3LBHA 4O2LA 1G4UR 3AF0A 2ZSBA 1E2GA 2HF9A 2WKPA 1F2UA 2ZYTX 4WXRA 3MMPA 4H1VA 4PPNA 4N1AA 4KHZA 1WXQA 3OAAA 2OUKA 1F5NA 1VHTA 521PA 1GL9B 1SQ5A 2BMFA 1W36C 2HT1A 2BBTA 3IIJA 1COWD 2H1LA 3N5CA 4Q1EA 1PJRA 1RRFA 2IXEA 2ONKA 1RYFA 4MKHA 3TRFA 3HR8A 5DH9A 3C5HA 1NI3A 3H0KA 4GRAA 5DE3A 4NYMQ 4KVGA 2IYLD 5F3WB 1EFRA 4FW9A 3RRMA 2XJ9A 3DHWC 2F3TA 3J81k 3A1SA 1IN8A 4JVSB 3N2EA 4EQ6A 1GNQA 2OZEA 1E9EA 4LJ9A 3B1ZA 4KSBA 5FL3A 1W49A 4WZAE 4LYJA 1NBMD 4LYHA 2I1QA 4DEYA 4TZ0A 3C15C 2KWIA 1LVGA 1N5IA 3GFOA 1EGAA 3HJNA 3ZZTA 2FJUA 3E5HA 4V0ME 1VMAA 1V43A 2GRJA 3GJ3A 2WZQA 1Z0FA 1EX7A 3WMFA 1F60A 4CEIA 1NMYA 4OQMA 2WSSD 4JL8A 1E9SA 3VNUA 3W6PA 1KDRA 2OE2A 3KKNA 4A9AA 3CPHA 1U81A 1WA5A 2GAAA 2RGDA 3EC1A 3SI7A 3O8CA 4LJ8A 2N42A 4PC7A 3WHKA 3U4QB 4BFUA 2O8FA 1ZC3A 4EFLA 1TU3A 4OHYA 2N1BA 5E3HA 5AJXA 1F2TB 3GJXC 4GMDA 4A2QA 1U90A 3GMTA 2DCUA 4DLSA 2KSQA 4JLAA 3IILA 2WWFA 4QM7A 2EFHB 2HXSA 3AP3A 4DXAA 5HE9A 2J46A 2IF0A 2RKOA 3IO3A 3Q9LA 4AURA 3ZD6A 1KK0A 3OIWA 1XXHB 3QKSB 3WMGA 3UMFA 5DISB 2JLXA 3RRNA 1OXXK 1GNPA 1KI6A 2CJWA 2GBLA 2D2FA 3FE2A 2WV9A 1VDZA 4UNQA 1VG0B 4IDNA 5HKKD 1YHNA 2PT7A 3BC1A 4QBIA 4RCYA 1MRSA 3LLUA 1EWRA 3H4MA 1ESNA 3BB3A 3QPVA 1GKUB 4DCSA 1TQ4A 2QGNA 1A7JA 5C46F 2AXNA 2CNWD 2RB4A 2NO9A 5L3VA 1VYVA 1A2KC 4GSYA 1FUUA 3JVVA 4OQNA 2OCBA 1S9DA 3U3MA 2JLSA 4OI1A 2O8CA 2Z4RA 1JNYA 3VMFA 2YWEA 4RY2A 2A30A 1Z6GA 2ZAOA 1GTVA 2I3BA 4RVCA 4DCVA 4G0NA 2DPXA 4JLDA 3HDTA 5H1YA 2WWGA 3PJRA 2UKDA 3X2SA 4TTRA 2ZE8A 3SQWA 4AYTA 5F9FA 4KVAA 4P4SA 2ZVQX 2GZDA 3X1ZA 4URVR 2XB2A 4D0LB 2CK3D 1Q1BA 4AG5A 2H92A 2QAJA 4XWAA 2FX3A 1XWIA 5E7JA 2B21A 4PHTA 2IUUA 3T1OA 2NO0A 2A7QA 4WAUA 5JWOA 3U5ZB 1ZD8A 2DFKB 4TSFD 1KOFA 1XMJA 1LS6A 4MUAA 3HYTA 4MDEA 2FFAA 3A58B 1LY1A 2O8DA 3B1WA 4PZLA 4HAZA 3L0OA 2REOA 2W6ID 3OZXA 4PHHA 1S3GA 3EIHA 4WXPA 3LRPA 4M1TA 3PIRA 3H1TA 1D5CA 4US1R 2VTKA 4NL4H 2X19A 1DE0A 1R8QA 1SXJC 2A5YB 3AVTA 2QE7D 1KNQA 1OHHA 4NH0A 1XEFA 3UIEA 5IF9A 3P1JA 4B2LA 1G8FA 2H5EA 1XDBA 1XJQA 2FSGA 1NKSA 4DLTA 1E69A 2VYFA 4JJKA 4HAXA 4QOSA 2V7QD 4FMCF 3KQHA 1D9XA 1C4OA 1KI8A 2BEJA 2IS1A 4AYXA 5TMPA 2JJ2D 2Z0MA 5KSYA 2QUZA 4IDHA 3C5CA 3LA6A 1W4BA 3EA5A 2CL7X 5K8TA 4EFNA 4DCTA 5JECA 1ZM7A 2J0SA 3NC1C 3PCRB 5EE9A 2YWGA 3GPLA 1F3OA 3ZLJA 2QMHA 4ACBA 4CF7A 3BRWD 5KUTA 1FOEB 4IOKA 2F1JA 3LQRA 4FMBB 4OI4A 1GUAA 721PA 5KU1A 4AKEA 2ZI5A 4YDSA 1DADA 1MO6A 4DB4A 3G0HA 5BYKA 2ZRLA 2ORWA 2W2TA 4AKHA 1AGRA 4TT3A 1RKBA 5JBQA 5IK2A 3BOSA 1IXRC 2J0VA 3MD0A 2XNDD 2HV8A 2ZRAA 3B7GA 2JATA 4MRNA 3BFKA 4LZZA 3OEED 4QRHA 4BRUA 2XX3A 1P2TA 2VA8A 3EWSA 3R20A 2E87A 2ODNA 4DEXA 2VHTA 2V55B 5KSOA 1U2RA 4A0FA 4HLUC 4RD6A 2ZI7A 1OH7A 3O8DA 1RJ9B 4V0OA 1ZM4A 2F9LA 1UEJA 2QP9X 3SOPA 3SQXA 5CIWA 1M6NA 3QQ5A 1VPLA 2DFLA 1AQUA 1E79D 2P5SA 4GOJA 4NCJA 1OF1A 4JZKA 3KQLA 3QXSA 2Q9BA 1YZTA 3ZZ0A 1UBEA 5LB2A 4NMMA 3DKVA 2VP9A 2GDJA 2XXAA 4DJTA 5FTLA 1Q1ZA 1W47A 3LWNA 2FPLA 4UNSA 4CEJA 1CIPA 2C99A 1H8HD 2CEAA 2LWIA 4TQ9A 4BGDA 3KFXA 3UG7A 4TYWA 2EVWX 3AVQA 1T9HA 4JJZA 4NE2A 3BB1A 4NYJQ 4E07A 5JJLA 1DOAA 2J0QA 3U3OA 4LX0A 1UDWA 3TJZA 4MRPA 1WRBA 1DARA 3MUFA 4UNPA 4IFEA 2ZEJA 2JIZA 2O0HA 1J99A 1JXOA 1US8B 1E6CA 4HB4A 4LWZA 4OL0A 2P5TB 1YVDA 2OESA 3T35A 2PBRA 1Z6AA 3DM5A 3AKEA 2Q0HA 3FHOA 2ZR0A 2XZPA 1SVMA 3GLGE 1DS6A 1W48A 5EUMA 3AVVA 1Z0AA 2QM8A 1VG9B 4FIDA 3PFIA 4UJ3A 2NPFA 1SVLA 3ADKA 4TMXA 2GTPA 1R0XA 1J8YF 1VCMA 3FOZA 2ZRHA 3CRW1 3L2OB 1J8MF 4DLXA 3L0PA 4C0HA 1S9HA 2X77A 3IIKA 1DO2A 1HYQA 5AK0A 3KJIA 3QUSA 1BMFA 3OAAD 4OQLA 4RD2A 2A5GA 4X8HA 1GP2A 1II0A 4KBGA 4QFMA 1CF4A 2QAGA 1R6BX 1N5JA 1P4SA 4ZPXA 2X8AA 1G291 1X8JA 5DN6A 3I72A 4DCUA 1ZUNB 3TIFA 3QSYA 5F98A 4PSVA 4CEHB 4V0KA 2R6DA 3TMKA 5C18A 3NEJA 4TWZA 4HDOB 1EFRD 1JQLB 5JSZA 4Q9LA 3CRRA 3R8FA 4BLQA 4RFVA 5FOUA 2G1JA 2OO7A 3T1VA 4MGKR 1D2NA 1R8SA 1TEXA 3RVBA 1E2HA 3IQXA 3QG1A 4Q9HA 3DMNA 3TR0A 3NG1A 1M8PA 1N0UA 4TYQA 1Z07A 4M9ZA 5CK5A 3VHLB 4CYMA 1CR1A 4DT1A 2FSFA 2QZ4A 2WVJA 3KUDA 4TL7A 1OPXA 2DHRA 1Z47A 3AUXA 5DI3A 2JLUA 3K0AA 1COWA 3WBJA 5BN4A 2BMDA 4LJYA 1CULC 4PHFA 1SZPA 621PA 4A82A 3B8HA 5C4MA 3I5YA 4Q4JB 5UKDA 5JMTA 1FP6A 4YXWA 4NHOA 2EWVA 1ZCAA 2PLFA 4EJSA 2P6NA 5F9HA 3SE0A 5EP3A 5CITA 3MSXA 3LX5A 3IKJA 1JPJA 2FF7A 2ZJOA 3KQUA 121PA 2FZ4A 5FBWB 2RAPA 1CKEA 2ATVA 4RD4A 3EIEA 5F2EA 4KYIB 5E7IA 2JLZA 2IBMA 3FFBA 3A37A 3CRVA 1U99A 2IYTA 2EU8A 3TSOA 2PEZA 2R6AA 1YRBA 3QKRB 2CBZA 1YZKA 2XZOA 3PITA 1UBFA 3VU9A 4FWIB 1OIXA 4G3XA 5B64A 4R98A 1KY3A 2NZJA 2WSSA 4HZUB 1VYTA 4OKSA 2ZRGA 5ELXA 1E2EA 4M1YA 1XMIA 1M7HA 1EX6A 1XEXA 1AN0A 2V3CC 1G5TA 3IEVA 4IDPA 1CP2A 2BIFA 3GJ7A 4Q66C 5IDVA 5BW8A 2ZJZA 4A8JB 1OE0A 3K53A 4IDQA 2KB0A 1VCOA 4AY2A 4E5UA 1IY1A 4PSAA 3Q5EA 3UWKA 1S96A 4YMTA 2KJQA 2BMJA 3QVVA 5DHAA 2ZRKA 2OAQ1 1L2TA 3B13B 4DLVA 1D9ZA 3Q5DA 2REBA 5E4FA 5EE3A 4C7OA 4JBWA 2V6IA 4E22A 3W5JA 3GFTA 5AWFC 4Q9JA 4TZ6A 5L3SA 4KXFB 1KI2A 1DPFA 4Z8YA 2QBYB 4M8NE 3QY0A 3M1IA 4ILEA 1OFIA 2DWOA 5FBQB 2QSYA 3IPXA 3EZ9A 2OM2A 1W4AA 3PQCA 1QHGA 1E4VA 1ZCBA 2WOOA 2Z43A 3QG5A 2RCNA 4QBHA 2HF8A 3ZS8A 1TADA 1D2MA 5EXTA 4BEJA 4FMCB 1A4RA 4D4KA 1S8FA 4TLCA 2JLQA 3CF0A 3K1JA 3SBDA 1K6MA 2GJ9A 2VQSA 5FPTA 1E2MA 4MRVA 1ZNYA 1FNMA 5HPYB 2VP5A 2GCOB 4RFSA 3VR3A 2ZETA 1XFAA 1MO3A 3X1WA 2FEMA 1NSTA 4DWJA 3MWKA 1OFTA 2YV5A 3OIYA
chains in the Genus database with same CATH superfamily
5ALYA 4Q4CA 4PO1A 2B4KA 3KT8A 3P9CA 3OQPA 1AK9A 2R6FA 2QLNA 4PGHA 4RHEA 3X1XA 4ARZB 3W79A 2AFHE 3WE7A 1WZUA 1UCFA 4PXYA 5AK5A 1VA5A 5ILQA 4AUNA 4DJAA 3ASVA 3P9KA 2H7YA 1C9YA 1XMOB 3VR2A 3AH8A 3S55A 2HA5A 1LF0A 1I01A 2EP5A 3QVKA 5CR9A 1Z4QA 1D2EA 2ADMA 2HLNA 1A8SA 1G8HA 2NU8B 1DFIA 5K8IA 1V0JA 3E1GA 3LW8A 3ONEA 3HV2A 3UT5A 2PU7A 1T25A 2MWMA 4KPYA 3PRYA 4CKZA 1AD2A 2PUJA 3E7WA 4EB6B 3T4XA 1JRLA 2QV0A 2AK2A 4CV0A 3DBOB 1Z38A 4MW7A 2F3SA 2FK8A 3EWAA 4L75A 1TK9A 5A5GA 4MKHA 4MYRA 3SZMA 2VPZA 1ZO8A 1T6BY 3C1TA 4KACA 1G9TA 1Q83A 1XKXA 1R0BA 2MMCA 3MILA 4PQFA 4D2IA 2BGTA 3MG9A 1KK1A 1INLA 2BDTA 2HXGA 3FRIA 2QY9A 2OBMA 5BR1A 3A3YA 1VJGA 1G2PA 3ESQA 5A03A 4A0HA 5ESWA 2GOYA 1TI7A 3F5SA 4R81A 3GZ4A 2XMRA 2HWWA 1NM5C 1Y4ZA 2JFFA 3GI1A 1C50A 1X38A 2Y1FA 3ROZA 2VP2A 4NRDA 1WDMA 5EQDA 4CW7A 8ABPA 3D8SA 1DBRA 1WCIA 3HKCA 2WIDA 1FZTA 1LTKA 3HUTA 4DQDA 1ZR4A 2PX8A 2EKZA 2YFHA 3RTGA 1ZW1A 3AGPA 1TD9A 4EMUA 5FOXA 1YJ5A 4UHHA 1R18A 4Q1DA 2IRWA 4HFNA 5HRUA 1B2LA 2F4VB 1UPTA 1DV2A 3TLZA 4MWSA 3JYHA 3AFMA 4BO4A 1XR3A 1SCKA 2Y2VA 4MQLA 3DVAB 2IOFK 3B60A 4BLWA 1Q11A 2FEKA 4ZI3A 1P19A 2OM6A 1GRNA 4PCUA 2X0EA 1RWNA 5C1OA 2YV3A 3TUJC 2ZWAA 1JR3A 1EK1A 1CJUC 1CUSA 1OBFO 2JAOA 2G7ZA 3ANXA 4M37A 5LQJA 4PM4A 4WADA 4PZYA 4AS3A 2MDTA 3BHIA 2ZYWX 1QQ5A 4G6ZA 1BEEA 1OILA 5CT6A 3H2IA 4HAWA 2CHEA 4O59O 2F9MA 1U1GA 1TO6A 3IR6A 3QW2A 1CE8A 2C9OA 4TT8A 5LLTA 3TG2A 4QO8A 1NRJB 5JAUA 2R1VA 3R9XA 3SC4A 4EGJA 3HMQA 5I48A 4XEHA 1Z75A 2HRQA 3L7DA 4FTWA 4YH1A 5AHRA 2DG2A 1E3JA 2C5EA 2C3OA 2GEBA 2P6MA 3AB3A 3M9XA 4F93B 1XD2A 4GPIB 3WWEA 3AUAA 1H0SA 4RTQA 4YV2A 1I3LA 1VIAA 3SS8A 3PTAA 1A9XA 1IHXA 4DKXA 2FMHA 5LU8A 4KWCA 3IOMA 2IEBA 2RGBA 1OI3A 3FDJA 3KUCA 5B37A 5AM4A 2PZMA 1SXPA 2ACWA 4FFWA 4FM9A 3D5EA 2JIZD 4FDVA 1DJMA 4TRNA 1SD5A 3K2BA 5I9IA 4LSZA 4J7XA 5D1HA 5EL0A 4R1OA 3RABA 1TTPB 1QQ6A 5GQSA 3QEMA 1ES9A 4UU7A 3KB1A 3U4DA 2BEVB 1SFRA 3F46A 3JQ9A 4C6RA 4EGSA 4CIYA 5HKBA 1KBQA 4MR7B 4RTRA 3QMWA 1Q21A 2YXNA 3AR5A 4TN1A 4IJVA 4ZCPA 1K86A 2ZWVA 3KO8A 3PVSA 3U4CA 4BJHB 2WLTA 2NZYA 1C7FA 3IHKA 2VHQA 3MMXA 3A14A 5CBPA 1AURA 1YZGA 1L1QA 2SCUB 1QO7A 5CVDA 5FA6A 3AJDA 1O2DA 2XNCA 2BZ1A 4HS4A 4MWDA 1B16A 1JG3A 5JMOA 1Z3IX 3B1KA 2QPAA 5DVZA 2VHCA 1MJ5A 1PG0A 4OBBA 4TKUB 2N47A 3AEQA 3TQOA 2X4DA 2CMKA 3Q2KA 3QV1A 4J2OA 2FGKA 4E4TA 1QO9A 2CLLB 3A1NA 4H3KB 5BR4A 5KKCA 1GRVA 2HF2A 4OQDA 1KDTA 3WDSA 2AG6A 4XDHA 3SU8A 3ZDZB 2NPIA 3KSMA 1UL1X 2IEGA 4CM8B 3AJAA 1RXUA 5TB5A 3ZU4A 2PLRA 5AJHA 3PR1A 5JJBA 2WHEA 4JOQA 4KQCA 2DY0A 2HZBA 4O3FA 2C4UA 3SX4A 4A8JC 3EGIA 5HZGA 2HADA 1FFXA 1X7ZA 1ISIA 2XNHA 2R60A 2XOKA 2PBLA 3AESA 3F3SA 1DAIA 3PUIA 3QIAA 4HO1X 4IWYA 1OWLA 4R84A 5HCIA 4FB4A 1IMOA 4INAA 3GGCA 5COBA 4MULA 2VTBA 3TCNA 4HZGA 2CFOA 2FZKA 3CZMA 3IKLA 4BEVA 1OZ0A 1XVVA 1RQ2A 3SPXA 1PEAA 2G1KA 2QVYX 5L9AA 3NMUF 1KH3A 1I7QB 2EF1A 3P9XA 4LBZA 3F9IA 4KQ1A 4U2GA 4BXOB 3AU8A 2YX1A 3K0CC 3LUFA 3WLKX 5IANA 2O54A 4TV8B 2BI4A 4Q7QA 1G5FA 1XTRA 1RPJA 1T3ZA 1F0YA 1RLOA 2GAJA 5YASA 3PYMA 3FMGA 5DX1A 1Z2PX 4A6XA 2C5SA 2XODA 3JZMA 1NXOA 5FPQA 1X8KA 1YZQA 3NU1A 4BASA 2O8BA 4U4AA 1KFCB 1W0KD 4JQZA 5CLHA 3P0FA 3ZE1B 4O2RA 4X66B 4PY2A 1NV9A 3W7AA 2PL3A 4X44A 4QSMA 4YMLA 4RZHA 5H5JA 3PEVA 3Q7TA 4HB0A 3DZFA 3R7DA 4AO6A 3LLVA 3O9MA 1R5OA 1U2PA 5T3YA 4NNOA 5F7OA 4M1KA 4PG4A 3GIDA 1KQGA 3N76A 4QUJA 3CF2A 3M89A 4Q3KA 3UJ6A 1CNFA 1D2RA 2QJWA 1IM5A 4CV3A 5E6RA 4QG3A 4B3SB 3DBVO 1YKGA 3DVQX 1CIVA 4U2FA 3P71T 4ZCRA 4C89A 1A2BA 1E5LA 1NV8A 2WSMA 4TGLA 4ESOA 2ZGVA 4MWEA 1NFFA 2QYTA 4AJ4A 2MYTA 3OJEA 1NMSA 3RBZA 1NJ2A 4HQ6A 4KMMA 4RKEA 1EUZA 3ND6A 2PANA 2ZR9A 1L5YA 1OY1A 2BSAA 2XGMA 3FVVA 5HGXA 5JNTA 1IBKB 4IDFA 5AW9A 4P4UA 2IWHA 4X94A 4DHEA 3G8DA 3TZLA 3DO5A 1SOVA 5M3BA 1DL5A 3CEAA 1EE9A 2B61A 2FUEA 3EGDB 2BCGY 1WBBA 3FLEA 3OIGA 2ICAA 2W2XA 4Q3CA 4WA8A 2HSGA 1OA1A 2IUTA 3UUWA 3F47A 2FKAA 2I78A 4ZCLA 2OXEA 4A1FA 3BWDD 5JDIC 3PPVA 1ZGBA 1HUQA 3QF4A 4YPFA 3QFHA 4HF7A 1G9XA 1LGYA 4FZ3A 1AUXA 4PX9A 4P93A 2P0AA 4XQEA 3KNZA 2IHKA 5I7RA 3H5IA 4G9BA 5FQNA 4XTCS 1JMYA 1DBWA 3ZHVA 1FFGA 3RFXA 1R1DA 3WJAA 2JDIA 4YMHA 3ORQA 1XMSA 3V80A 3ZWBA 1AS3A 1XTTA 1K06A 4QU5A 2VNSA 1E32A 4I1OA 3ZKWB 4DPLA 2Z3VA 4OQQA 4RXUA 5CT5A 1NXTA 1O3YA 3MJCA 1FFAA 2YC2C 2ZS7A 1VQ1A 4ID9A 5CXXA 5DX8A 2XT9A 1Z5UA 2AKEA 3ZZNA 2XXJA 1XX6A 1AKEA 3IODA 4M88A 3WY9A 1KAGA 4HWGA 4D9MA 5ECDA 3RS0A 4QLOA 2FPGB 5I8ZA 3SFZA 4YUYA 3DDHA 1L5HA 3IKTA 2FDCA 1GHTA 5CLLA 5FBZA 3KXPA 2PLNA 3CSSA 5JWHA 4U6QA 4BRZA 1U31A 2WJWA 1R0ZA 3AR2A 1UFKA 2V8OA 2UZAA 2HV9A 2ZU6A 1FBNA 3R6DA 5D3ZA 3ZCUA 2Q8NA 4E0BA 2R44A 4TTJA 1QRUA 4PFJA 5DNCA 5HOEA 3WK8A 1SCNE 2OZPA 3FNFA 4ZYLA 3WGUA 1QIDA 1PEKE 2AZDA 4GI3A 2IUEA 1POWA 1E5XA 2ODEA 3NWBA 3O4IA 4CIWA 4ZMBA 3N8KA 5KTRA 1ELOA 4LOAA 3VR3D 3WV5A 4ZFNA 3B3FA 4B4DA 2CL0X 2LVBA 3NZEA 1XPRA 2I4MA 1XIVA 2JBAB 1THGA 1G8KA 4OJYA 4PSKA 1X7YB 2BKXA 1E2IA 3ZI4A 1MGOA 3EQ2A 3H65A 1G59A 4L3OA 1C5KA 3GLHA 4P9NA 2OMEA 4J1TC 4RJKA 5ALVA 2ZS8A 1FDOA 3L7CA 1BRMA 1WJGA 4WIAA 1T9BA 3ZVRA 2XCIA 3OQVA 1N25A 4LC1A 1R4NA 3DEZA 3C4VA 1M2OB 3NHRA 3F9RA 2OA0A 1GA6A 2Z04A 1Y6RA 4HAIA 3ILVA 3GG9A 4DV4B 2XADA 4FSDA 1HPLA 1T3LA 3BCRA 1UWVA 4PX5A 1A5SB 2Q2QA 3O31A 5ERGB 1BFKA 3CZ5A 5T6MA 4CF5A 1D2CA 3U4QA 2DHQA 2GYWA 1RC1A 1RHMA 2CXPA 3F90A 3SVLA 1LX7A 4QZVA 3SZLA 4EJ2A 2VO1A 4C9BA 2GBFA 2UAGA 4GM1A 2ZRJA 3W2FA 4L15A 2DQYA 1Q0UA 4DRZA 4ZVKA 3CUWA 2L2QA 3K4QA 3WWOA 2C7RA 4U7JA 4YRDA 5C7OO 3AVUA 1FLVA 3K5PA 2W00A 3OWOA 1CRZA 3I1IA 2SKEA 1W4CA 2JG3A 2G1UA 4RIEA 1E66A 3U48A 1G20B 2HHJA 2RGEA 4FOLA 4GSLA 3TCKA 2V6FA 4TYPA 2V0NA 4BNVA 3N2NA 7AT1A 5CT9A 3WB2A 4FZ5A 4OSOA 3ZHOA 2FEPA 3JSXA 2WKQA 1MABA 1G16A 1NNLA 2ADOA 1QP7A 2GRAA 4MWCA 3RUIA 3U9TA 1P7YA 2X0RA 2XVZA 5KKAA 4JT8A 5D86A 2J5RA 3K0EA 2Y1DA 5B58T 2ZM6B 5CVCA 3EXHC 2Z1DA 3DZBA 3ND9A 3ZE0B 4DUGA 1KGDA 5C5CA 2F43A 4G25A 3UMBA 2GHQA 1XAIA 1M2FA 1Z5NA 9ATCA 2J4CA 1T3SA 2I9KA 1FSFA 3AG5A 1QH0A 2BEKA 4YRGA 1G7RA 4LRUA 4N76A 1AKWA 2Q6KA 5G3ZA 5LLSA 1Y4DE 4CLDA 2VQFB 3EFOB 5A5DA 2WBLC 2J7PA 1USGA 3ZJ4A 1D09A 1JR3D 1SPXA 3F5DA 4CDNA 4K8RB 1GYRA 2OHOA 1MJGM 2NT4A 4F96A 4ZTZB 1Q3KA 1Z0IA 5IAAA 2WG2A 5DN9A 1VECA 1K66A 2WUWE 4LXHA 5CHYA 3SP1A 2PAFA 5CW1A 3M7IA 4DZRA 3BZWA 4Y2PA 5KOYA 1JGTA 4IGIA 1AF7A 2W8ZA 3NXKA 3T5MA 1HYHA 2FFHA 2PZKA 3A6HA 4AUEA 4DC9A 2YVAA 3VAYA 4CM5A 2JEZA 5ALXA 5JNSA 5JSHA 3OC6A 2HDWA 5CEFA 1JVBA 3EUFA 4MCIA 1W5FA 1SHKA 1ZD4A 1XTJA 4NBTA 2IHYA 4QFBA 3DS8A 2R6HA 3C3WA 4XEUA 2OY0A 3NP7A 4GOND 2J5XA 5E95A 4LF8B 4Z4CA 1H9AA 4Q5IA 2XKKA 1ODTC 3A2NA 3F78A 1QAMA 3H99A 4M9UA 5CXSA 1WUTA 1GYQA 4CETA 1FDSA 4U2EA 4KYUA 5DM60 4D0RA 2CE7A 5A1TA 1SBCA 1OXTA 1Y3HA 3RO7A 4KWIA 4BNWA 3H3FA 3H8VA 3E5RA 5FHRA 3OH8A 5U4XA 2KBFA 2JH9A 2GKOA 3NHZA 3HJUA 1U0GA 4KN5A 2FPMA 3F6RA 1SCJA 3A6LA 3ODGA 3HB7A 3OQ6A 4WZBA 5TGDA 3RLIA 4O5OA 1XLTC 2G25A 2ZJ3A 4MPPA 3RVRA 2Y0EA 3ENZA 4UW9A 3JQGB 4JP2A 4YBRA 1NI4A 5TDHA 3VR6A 3OPVA 4ALMA 4NYJR 1ZGJA 3NTRA 1ZRNA 2A9QA 4JJ8A 3RB8A 4GM4A 5EESA 2LDBA 3C14C 3S68A 5EWLA 4WBNF 2X58A 2ZSAA 3CINA 3ZGXA 1H4VB 1NN0A 1OFUX 1X3SA 1AKUA 4EG4A 3A7EA 2ZT7A 3MIIA 1P62B 4DQKA 5L95A 5K99A 3IIIA 2FZVA 4FYIA 1U0FA 4HADA 4FJ0A 2H2DA 2FQWA 4G0QA 3BHNA 3TS1A 4AJHA 3J81A 1NYLA 4OUDA 1PV4A 1RPNA 4JGIA 3KVVA 2PZLA 5JAPA 2Y0BA 1BA2A 3WKEA 5DIZA 1IHDA 1X92A 2FG5A 3ZJUA 2GVZC 4HSGA 3UWPA 1C7ZA 5F78A 2AEMA 1Z12A 5DGIA 2XOKD 3H11B 3FFAA 3R3XA 2WK1A 4N0MA 4D8WA 5EJ5A 4FFBA 1C4WA 5IT9A 3THYA 3FGZA 2BTOA 5G4LA 4E2FA 4R0MA 1VFPA 4R9RA 2W2LA 4MQ4A 4JQYA 2WE7A 2NUTA 1Y5IA 1YRYE 3TZBA 1KH2A 4M8SA 3CZRA 1YBAA 1PZMA 2VAPA 4REOA 2BD0A 1PS8A 4IV0A 1K6IA 5CXUA 1ULHA 2VJPA 1R0LA 3PA6A 2ZQZA 2BHRA 5EE5B 4W5QA 3OQNA 4OQXA 4G4JA 4C20A 4AJ1A 1QH9A 3LDHA 3KOYA 2ZUSA 2O1SA 4EKEA 1TCAA 2QTGA 3E9RA 4IVRA 3CZQA 4Q4HB 1IEQA 4DLWA 3DB2A 3B12A 5BN1A 2ZTUA 3FYSA 2A5DA 3E27A 3G7UA 4LBVA 2ZSEA 1CR2A 2ZDHA 1R3UA 5JPCA 1YE8A 1LDGA 3S8YA 4MVJP 4K6OA 1SO8A 5BRJA 2WD7A 2QJFA 4KNWA 4V0RA 4HKTA 4X85A 5HIJA 3II6X 4ZOLF 4QGHA 2F55A 2Q7XA 2X6TA 1WTCA 4OD0A 1MX1A 5GZ1A 1PDOA 4WJZA 4DLLA 3ZUGA 1K75A 2X86A 3GQVA 3ICEA 4ZVQA 5J5AA 1TUBB 3FYCA 1SU6A 5H7XA 3WXBA 4CR7A 5DGDA 2A1UB 4L22A 3SFTA 5K0SA 1EXNA 1E7MA 2B4QA 4FW8A 1BE8A 1DU4A 3CLTD 3I42A 2BZGA 3TQSA 4OBXA 5C1PA 1J9GA 1T5HX 4PBRA 1CNMA 1NWCA 5LIRA 2CT8A 3VZQA 2XH8A 4OK6A 4BNUA 3R77A 2FPSA 3DMDA 2L19A 1XZKA 1DC4A 1IVNA 4B4OA 3DG9A 2EP8A 2G08A 3FDXA 4Z1MD 1TNDA 3H2GA 4ZAWA 1I8TA 4WW0A 3GYGA 3O9VA 4C7OB 1ENOA 2ZANA 1S2MA 4RUKA 3AV0B 4V0SA 3DMGA 4XSGA 2GSWA 1WZIA 2ZOSA 1RKQA 4YIHA 2HK9A 3RI3A 1U7XA 2A1IA 2WJIA 5DSTA 1LV8A 3R7WA 1OXKB 1GGMA 1HMYA 1O97D 2YINC 1T9DA 3RNLA 3FVWA 4Z3KA 2R11A 2YXDA 4RYDA 3HGQA 4RZIA 4P84A 1RXCA 2WI8A 3EIUA 1S4QA 1DB3A 2HMVA 3C7TA 2V8BA 3EGVA 4L0CA 1RWXA 5TT1A 2JDID 2QN7A 3AI7A 1ADFA 1JEAA 3HEBA 1G4AE 1NBOA 4AN0A 4IR7A 5DTEA 4IIUA 3QKWA 1D5WA 2DR0A 2I0FA 2IDZA 2X8LA 1E7RA 4PQGA 3WYEA 1JLRA 1Y4AE 5EE0A 2AH5A 3B8EA 2H1OA 3C3YA 1EG7A 1FYWA 1GUFA 2R48A 1KVTA 1TKRA 4KAAA 2UDPA 4L57A 1VJ1A 1VJCA 2GBPA 1FP1D 3QVSA 3KUXA 1PFYA 1F48A 2OLKA 3MWEA 2B7LA 4JP5A 3GVHA 1W73A 4R2JA 3TAXA 5KBYA 5EIXA 2B3DA 5MF6A 1WU7A 4EHNA 4B3JA 1B0UA 2ZK7A 2JIOA 2AI1A 1OVMA 3EF1A 2R68A 3B6MA 2OILA 1PZHA 1ZN9A 2WDPA 2HHLA 2RC5A 4V0MA 3JQBC 1GQQA 1JR4A 3MUNA 3VDQA 4WGFA 1LWOA 4E5SA 1KORA 3P2KA 3G02A 2C4VA 4PF1A 2XR1A 1KBOA 1JHYA 3IVGA 4ODIA 1SGWA 4YP7A 4RDXA 1ZD2P 2C5HA 4B8ZA 2RHMA 4RADA 2Y1LA 4FJ1A 5J47A 1W2HA 1T26A 1UMBB 5IVDA 4D9KA 4ROTA 4RNCA 5D5HA 4XRGA 4CZ2A 2V58A 2C2HA 3HACA 2I6TA 2R4UA 3GRKA 3LH5A 4QHSA 1MTZA 5FPYA 2P2SA 1T4MA 3T1NA 1PI3A 3P2YA 1VKJA 4J0JA 3KCNA 2YIJA 4KNVA 4BWYA 2XUHA 3AFGA 2FPKA 3UMSA 2QVGA 1XVAA 4IIJA 4HAUA 1L5KA 2ODAA 4E5KA 5BWOA 3C1AA 1FQWA 3QX8A 4RVOA 5HJ5A 1A9SA 4ON9A 1G64A 2JLRA 1QGZA 1KXZA 1MIHA 2O3JA 1OUMA 5A3SA 1XZ8A 2FKNA 3IPYA 3CH4B 2CNDA 1IG3A 3BWBA 4L0QA 1RFGE 4R2XA 3ZBPA 1VE7A 5DXFA 2CVZA 4RMGA 4CQNA 2O4UX 5JJIA 2X7HA 3GJ4A 1YRAA 3IAXA 5L3RA 2WUGA 1S2IA 5B7NA 1RLIA 4QOIA 3HFJA 4BNIA 4AI6A 2YJGA 4HQRA 2I6QA 2GUWA 5EFOA 2B8JA 3F5QA 5CAEA 1AUOA 4DA4A 5DHUA 5K8UA 1P9OA 2Q1TA 4MI6A 3PE4A 4PHGA 3JWGA 1M8GA 4L6CA 3F7NA 1TM3E 1TFRA 1WE2A 2NVOA 2LW7A 3AL2A 3PC8A 4H9GA 4K5QA 3VC7A 3W4IA 3CM0A 1QIGA 1UZUA 4GPBA 5T67A 2RHBA 1K89A 4IEIA 5DRTA 4NOJA 6YASA 5SZIA 4NAHA 2G70A 4B5KA 1EUCB 1ONBA 4A03A 2VLIA 2OQVA 1QP8A 3KQYA 4RC9A 4P53A 3T5CA 4O8CA 1U3TA 1U6IA 3M3DA 1IBSA 1KEEB 1K8YB 1P0FA 1V25A 3MTQA 5TSDA 1JDUA 4DCGA 2O1WA 3LDFA 4QFCA 1CR4A 1E9RA 3DZJA 4H17A 1P4AA 1R8JA 1SVOA 1JVNA 2GJSA 3H2SA 3HU1A 3WNBA 4KRXA 3FR7A 3G59A 3HEAA 5DYIA 3KYIB 3C87A 4YAUA 2X5JO 4F0JA 1TK2A 1P61B 2J7PD 5AHXA 3VZCA 2QRVB 2UXCB 1GVNB 3RIXA 1A9QA 3GG2A 1WD7A 1QDUA 1S1CA 2ETVA 2JEYA 1L9XA 4GICA 4YCAA 5J1TB 4D79A 3E2IA 1LJUA 1VPDA 3AGQA 3H5NA 5DHRA 3FY4A 1R5NA 4NBNA 5AW4A 2VF5X 3W9BA 2A0XA 1RD4A 2PRSA 3RKRA 1I4DD 1ZRHA 5H81A 1JXAA 3PT5A 3A1WA 5AVUA 1PR2A 1KE1A 5BV1A 1TYEB 1QGUB 1F8UA 2GAOA 3LIPA 4JLPA 2MOKA 1W4RA 5FPSA 4PCAA 3D4LA 2INGX 2XJ4A 4DS3A 4PG6A 1DXOA 3CW9A 4JNCA 4F91B 1C3JA 4MZDA 1H8EA 2VF4X 4K46A 3K71B 2BFCB 2GZHA 5E9QA 5EGSA 1PDWA 4DCNA 1ZM2A 4GRIA 1OAKA 2PRKA 2ZVJA 2YYZA 1DZIA 3EXG2 3EZ7A 1C3EA 1CTQA 1JV2B 1Q1NA 3CVXA 3GARA 1GL6A 3O93A 3IBCA 2QI9C 3AR9A 1KRHA 1DTEA 4JVNA 2O3SA 4JLOA 2VUHB 4KKVA 4OQPA 3H1AA 3IA7A 4PZCA 4W5TA 4PRLA 3HWWA 1CDEA 1W76A 2GD0A 3ZG6A 3S5UA 1LDYA 3FGNA 3K0BA 5A2QA 1IN1A 2I1WA 3V8PA 2HMYB 2YMQA 3FCSB 3PJFA 4JCOA 1GU1A 2BTQB 3ZKAA 2O0MA 4D81A 1BWSA 1BWRA 1ZQ1A 2Z1MA 1XAJA 3B48A 3FCEA 3ZYCA 2HQ1A 2JGRA 4ZJUA 3R6TA 1EBFA 3M5WA 4FD2A 1XTUA 1E7SA 1Z6TA 1ZVMA 2HM7A 2IUYA 5HSGA 5JCZA 4BOYA 2OFXA 5FOWA 2I66A 2RGNA 1VG1A 2DC1A 3VR6D 3OZTA 3QELB 4YJ2B 2OPHA 2OOSA 1T9GS 2BUCA 3DQQA 2D0IA 2K2WA 2J5BA 4C08A 2MJLA 4Y2VA 3HCNA 3H05A 1H6DA 2FSSA 2YJ3A 2DQKA 3G2LA 4N54A 4YP9A 1CY7A 1TKAA 1ABFA 1BW9B 2FOLA 3TX2A 3Q6MA 3C98A 4NEGA 4QYIB 3RV4A 4DC0A 1EM8A 3D4IA 2JD1A 1DKLA 4OP1A 3O8OA 5AM5A 3UGTA 5B7GA 4FDAA 5G0VA 4NMXB 1F0NA 4YRNA 3WYCA 5CG2A 1E2BA 2TECE 3EVTA 3OE7A 4H7FA 4UQLA 4U8GA 3VR5A 2FPUA 2JIDA 2NIPA 2FCRA 4LVNA 4BEBA 3HYCA 5I9TA 3KSZO 4ZGWA 1ZZEA 5CVUA 2DF8A 3IL2A 4C4ZA 4PG5A 3T99A 1A9TA 1WQ3A 1UIRA 3U7QB 4C88A 1F12A 4P92A 3AY7A 2Q0QA 1JEJA 3IXMA 4UTPA 5JMWA 3CZAA 1QBKC 3R3ZA 2VCYA 1IHYA 4DMRA 4JUFA 1SKBA 1QG4A 2PZEA 1ISFA 3KBOA 4ND3A 4XASA 4ZANA 1I7SB 2W2LD 2VJDA 4BMDA 5JADA 3GLFB 2DWPA 4GKBA 3L7NA 5HF5A 2JBWA 3H9BA 1E0SA 1D0VA 2E48A 3DBHB 3EIQA 3ELWA 3JALB 3B6KA 4G26A 2WWXA 4WASA 2RAFA 2QJTA 3ZPXA 4AC9A 3O4HA 2VNJA 1PSDA 1BOOA 1QCDA 2V6GA 5BNIA 4MV7A 3TD2A 5CB8A 1PUJA 5IAOA 4DSZA 2A9FA 5CNKA 4ZI7F 4D96A 3L0SA 4B34A 4IOLA 1ECBA 3K9GA 4PTYA 4AIIA 4CEIB 4IIFA 2PR2A 4S1VA 5JAQA 3RFTA 1OI4A 2OXFA 5B3LA 3ZHSA 2YUTA 3CUVA 3VZDA 1VE1A 1SVIA 2F8SA 4DDMA 2GK3A 1EUYA 3M34A 2VDJA 2EFGA 2P90A 2PGIA 3V9AA 1DIRA 3ILHA 2ZSKA 2VZ8A 3KBBA 5D84A 2DB3A 2R3SA 1G3RA 5AOVA 5B3JC 3MBIA 4ZGGA 4GE0A 2HJVA 1FMFA 3QA9A 2C00A 4N40A 2FUNB 2YQ5A 3O1LA 3THXB 3DE4X 5IARA 1DKOA 3ZQUA 4D0GA 3FDZA 5JQGB 1E0KA 5F3DA 3ZWYA 4AK9A 1GU7A 2P2ZA 5DSZA 1Y1KE 2GEKA 1KC3A 3JD0A 2J9FB 1MAVA 4FR2A 5EJ9A 3ZDDA 1SHZA 1ZK1A 4EARA 4ZOLA 1JA0A 1TYBE 3GCGA 2YKGA 4TTTS 1O95C 3EX7C 1OZAA 3L01A 4B75A 4LQCA 2VXOA 3GJZA 4PLVA 5EJ4A 1Z3CA 4JHLA 1ZU5A 3VJKA 4X41A 3RUDA 3OC0A 2XNKA 4R8LA 1IAVA 2J32A 3MBOA 5H9VA 3EFHA 5IC6A 5TQ2B 5HRAA 1CFJA 4RTNA 2NYUA 4CF4A 1SKYE 4YAFA 5L53A 1ZMXA 1V5EA 3WDMA 1UJBA 2Q4OA 2WQ7A 1BZYA 4R16A 4JKOA 4RV5A 3C8MA 1XVIA 3FNBA 4IDCA 4XUCA 4HRXA 3OETA 4F21A 1CUWA 4I5GA 1DEKA 3DOOA 5K0TA 4EPRA 4QM6A 4PANA 2VPWA 5ER9A 2VVTA 3N2IA 4KMSA 4MVJA 1CDDA 1ZMBA 4ZXPA 3DLHA 2RGRA 1ITZA 2O59A 5FYDA 1E58A 1G5HA 2BGKA 3BGWA 1KK2A 2DFNA 2EW2A 3DE3X 4BN4A 4C7JA 2PRYA 1K7CA 1SVSA 1XF9A 1V2HE 2NPOA 1F6BA 3O6VA 2P9YA 4IHJB 2CYAA 4B74A 1LFDB 1IVYA 2R8XA 3FSJX 5FRDA 2HWYA 4MJLA 5HJEA 3WMRA 5BW6B 3EPHA 1FNCA 4BZXA 1DUVG 4H3HB 4PNPA 3REQA 2I2XB 4HEHA 1RE0A 2H4JA 1ESEA 2VDWB 3QPCA 5KAPA 3FYUC 2XZTA 3VVCA 3SXUB 3NHJA 4Y2UA 4ERNA 3REOA 4C3ZA 2WYIA 5BV2P 4YAOA 3VPGA 1YR9A 1QX4A 5KHAA 2C4HA 1UJMA 2BZSA 3TNYA 3TVTA 3FPBA 4Y6LA 1E7WA 3OSUA 2FQ1A 5C32A 5AVYA 3L0DA 5IFLA 3IQEA 1T0UA 1IQUA 2YYSA 1LBSA 1PKEA 5I4CA 3TKYA 2BDUA 1ADBA 1LI4A 2DULA 3IVRA 1RYMA 2KE5A 4M1EA 4RQBA 3IQGX 4PYJA 3HKDA 1RMYA 4CT5A 4DIFA 3FPLA 2I6SA 3EMVA 3CLVA 1GILA 1U1EA 1Z39A 1OBOA 1LSSA 4R40A 1MC1A 4YRAA 3JARA 7ABPA 4A27A 5LQMA 4ZQIA 3QUBA 3WI7A 2X1MA 4G0VA 1ID8A 1K8RA 4QBTA 4MQMA 1ZBDA 4KGDA 3RAFC 5JROA 2HBRA 1BOFA 1NC3A 4TXHA 5ITWA 2PX5A 3J80A 4HNTA 4L73A 1JSXA 4B3MB 1YRQA 2OWEA 3AU9A 1O0SA 4JT4A 4UFPA 1XCGB 2OV8A 1JFFA 3CWQA 3ORRA 1AHNA 3UWDA 1B6GA 4D9NA 5KPDA 4QOJA 1ZOLA 1HQKA 2P2CA 5DNDA 1V1RB 1U80A 1JDVA 1RWPA 4DKJA 1YS2X 1C30A 3LL7A 3DDZX 4XUEA 4QXAA 4YHBA 2MSNA 4HNGA 3VPDA 4PS0A 1DDOA 1Y8ZA 1NX9A 1DEOA 1UBGA 1PSWA 4KO2S 1K6XA 4X20A 1DKQA 4JLJA 3RUFA 1XRSB 2WQ6A 3RWOA 3EIFA 3BPSA 1T5TA 1AG9A 1ZSNA 1U4SA 4H31A 1OTYA 3MWGA 3KYBA 2CC2A 4YAIA 5AVWA 3V1TC 1JLLB 1Q6YA 3LX4A 2HCRA 2PH5A 1KJIA 3IIMA 4PO8A 5FORA 1GKYA 1YRLA 3RUHA 3PNLA 3TSYA 4ZZIA 2Q5CA 4WESA 3HJBA 2M6KA 4IRXA 4O08A 2FFQA 5CB4F 3R3VA 1UK6A 4FJ2A 4Q4DA 4FR5A 4OHMA 3F3YA 4KLRA 5IJ0B 2I8AA 4HOYA 1QP4A 1Y42X 1Y9ZA 5IAJA 2J9GA 1C8LA 1O9GA 2QPLA 3E9YA 3JQAA 5IT4A 5JVDF 2KS6A 3G8BA 4RS3A 1JN0A 1F8YA 2K5UA 5HKLA 4BCDA 1XXHA 5KVCA 1HTTA 5KNDA 5KYYB 4IEEA 4MKGA 4KVFA 3HL4A 3Q72A 3H1PA 1N2CB 1NQVA 1TW3A 2XDQB 4C1BA 1JLMA 2FSUA 3TZQA 4JJGA 4MPTA 3LRXA 3DGEC 3ITEA 3GFSA 1VTKA 1UEIA 1A69A 1EDZA 4R1UA 2JKZA 4AG3A 1RVDA 4UAGA 3A3KA 4A73A 1MJGA 3BIWA 2XTZA 4EUNA 1JB1A 3KTFA 1K08A 3ER8A 1OWOA 1JXQA 3ZVMA 1X42A 2AR9A 5FI3A 4Y9UA 2VF7A 1X1QA 2Z83A 1S89A 3ER6A 4QYSA 2VDUE 4CMKA 1YOVB 4BP9A 3EAQA 4JK3A 2WIGA 3WL7A 5BWBA 1Z7EA 2R8PA 5CLJA 3WLIA 1RAEA 2C78A 1U65A 5DBOA 1EESA 1H8ED 2KW5A 4CLOA 1UIMA 2RC6A 4ZV7A 3UTDA 4DCCA 9LDBA 4RY0A 3SR0A 1L4FA 3EVDA 3DKIA 1PQUA 2NO5A 4EL5A 3OZRA 5HQTA 2Y1WA 4EM6A 4M9XA 3T7IA 2C77A 1CERA 2IU3A 3NT4A 1PRYA 5E8JA 3RVSA 2ODBA 1NPYA 3TQQA 4BVGA 3NIGB 4ZKDA 4HUTA 1NQXA 1YDWA 1Z37A 3TX6A 3JD3A 1SJ9A 2FW7A 3GEEA 3RC3A 4XLZA 2IL1A 2YQ4A 1VL2A 2WRZA 3D2LA 4QODA 3SZGA 5KU7A 3C24A 3UB2A 1EHCA 2C3YA 1HK7A 1CQJA 1MPXA 3TW6A 2AI3A 4Y8VA 3I4LA 3F3KA 5JO0A 4ETIA 2OZLA 3OQMA 2O7NA 4RU1A 3OPYI 2RI6A 3KU4A 3NETA 3N8GA 1RKVA 5C8DA 4YCLA 2HJ9A 3L8DA 1PU2A 4MWZA 2FSIA 4ONEA 4WCFA 3DOUA 3K9CA 3KCQA 1LBQA 3I5XA 3WYDA 1TO2E 1ICIA 4F97A 3HSYA 1BX1A 4YJKA 4D41A 3IEXA 3QKUA 4MVJG 2L82A 3KZOA 4GT1A 4ZI7B 5K6RA 1HX7A 4GNKA 4HYTA 1ZNZA 2A5FA 3VI3B 4EELA 3R0JA 1X7XA 1ICEA 2BKVA 3OJWA 3DBRB 2PMCA 3OE7D 4GS5A 5AJVB 5IJAA 3TEJA 3WGNA 3VR5D 4QGSA 2NNWB 1OAOA 3RWMB 2F9FA 2HUPA 1B1AA 3UFBA 5BUQA 2I2WA 1B3BA 1NF8A 2PT5A 4Y0NA 1ZMRA 2F2TA 2XE6A 4ZODA 2Q5EA 3GGJA 2H5IA 1PFKA 4ME6A 2HYIC 2HGSA 1M6WA 3UFXB 4LISA 3FVTA 1RXYA 4FEYA 4BNKA 1NVVQ 4NJEA 4YMUA 1K63A 3T1YB 1NNEA 1O03A 2CSUA 3AR6A 2W0SA 3FPJA 3OEWA 4D3ZA 4ZO9A 4DT1B 3NBUA 4D25A 3REGA 2XRYA 1T4BA 2DQZA 4M1ZA 3SWWA 5CPFA 1IPHA 3OTGA 5EKXA 1OX5A 3RSFA 1EP2B 4BBJA 3WFZA 3PFWO 1IHPA 1NULA 4C0LA 4YDRA 1FTNA 3I73A 1R0YA 4WDRA 3E4DA 1U9ZA 4CTNA 6GPBA 2PYIA 1FPMA 4EK9A 4LQDA 1EWKA 3F74A 3IFSA 1DJQA 5ALWA 4CUKA 5CB0A 2HJWA 1N8NA 3I4CA 6REQA 5IS2A 1STOA 2DZDA 3BE6A 3HCAA 4PLGA 1V6SA 2YBDA 2Z4TA 3L7LA 3A6EA 4CLEA 1R50A 3AF1A 4X84A 4OQ4A 5KNBH 5K0ZA 5AUOB 1SEVA 2WWWA 2HEIA 2W9XA 2VJQA 1DV1A 1U8XX 3G7NA 3QOWA 4WH0A 5CT8A 5F2OA 5BURA 3EDRA 3KVNA 4LGMA 2J6HA 3GWZA 3U2QA 1A5ZA 4CM7A 2OFWA 3UHPA 1X9GA 2FXVA 3R23A 1KQNA 1RWMA 2BE9A 1UUFA 3DCJA 1R15A 4I19A 2Q8PA 4BLTA 5EINA 5JDCC 6PFKA 2H1RA 1MAUA 3VOTA 4J0KA 1NL3A 3UK6A 1EGMB 3G5AA 1SXJE 3NB0A 2AJBA 2B92A 2WABA 3L49A 3WRXC 2NN3C 1OXUA 4ILKA 3O1JC 5CA0B 2ZI3A 4JLUA 2YZNA 2NU9B 1EGQA 1HWYA 4TS4A 5JXWA 2HO5A 4DV0B 3F6PA 4P4LA 2QVXX 3OPYB 4HMOA 4Q12A 5IJZA 1CJBA 4H6PA 2J6BA 1Z16A 3ND5A 1F4VA 3W6ZA 4YQFA 3F49S 3P0EA 4DDWA 3QVMA 2Q50A 1V4NA 3NKVA 4RA9B 4V39A 4KAFA 3SD7A 3VSCA 3W05A 3W0LB 3I61A 2WHRA 3EXIB 2F3PA 4UTXA 3LQYA