5J5CA

Crystal structure of arl1-gtp and dcb domain of big1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
EMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 1
publication title Structural basis for targeting BIG1 to Golgi apparatus through interaction of its DCB domain with Arl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2016-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5j5cA00
4A9AA 2G77B 4E09A 4C0LA 3W6NA 2GXQA 3CKLA 1TQ6A 4Q9JA 3U6BA 2W0SA 3A4NA 4L15A 3SE0A 5BYKA 5TDHA 1ESNA 1XXHE 3OIYA 2FPLA 3R8CA 1KDOA 1ESMA 1NIPA 4A8JC 1PLKA 4D6PA 2GCNA 4XVRA 4DZZA 5HPYB 3HWSA 5GVSA 1JXMA 2J0UB 4KVGA 5KDDA 3EW9A 4V0OA 2WWXA 1WBBA 2AR7A 3FDIA 1Z83A 4RD3A 1TPZA 2OSBA 1EWRA 2PH1A 4GMXA 2JJ8A 2AXPA 3X1XA 1N25A 2C99A 2XNDA 1QG2A 2JJ2A 2ZS7A 3P4YA 3W90A 5SZJA 1NVUQ 2J9RA 3JZMA 3BRWD 3VKHA 4Q4HA 1VYTA 1XD8A 2CEAA 1E1RD 2X77A 2FSHA 2ZSFA 3UWOA 4BRUA 5JLJA 1SXJE 1SQ5A 4URWR 2AK3A 3WRYC 3RS5A 1GRNA 2VIIA 4HB3A 2IYZA 3THYB 1VTKA 4RCZA 2Q3MA 4F4CA 4FIDA 3KFXA 1H8HA 3Q7PA 1OFHA 2F55A 4UXIA 4C0HA 2IYXA 3JVUA 2A5DA 1P2TA 2Z4RA 1IN6A 1QHXA 1NI3A 1ZC4A 2HLDD 4JLPA 4G3XA 4QGAA 2A7QA 3LNCA 3RC3A 4WBSA 3ZYCA 1GUAA 2ZE5A 3QG5A 4XTCS 1E3MA 1K6MA 2IBMA 3K0EA 2PBRA 4K81B 4LBWA 5CYPA 2QORA 5ELXA 1LNZA 1OH7A 4LHZA 4O2LA 2VH5R 2YYZA 5C4GB 3OESA 3D3QA 3TQFA 2JDIA 3IPYA 1Z6TA 2DBYA 3DHWC 4EPXA 4W5WA 1CS4C 4MKGA 4A2PA 4HEJA 2BMDA 4P4SA 3FHTA 3WBJA 4HUTA 3W5JA 3FMOB 1CJMA 1G20E 1G4AE 3ZQ6A 1NMXA 1Q12A 4ITRC 3AEZA 3HDTA 3OE7A 3T1TA 3K0FB 3P4XA 2ZR9A 3GJXC 2XNDD 2JJ2D 3V4RA 3MWYW 1DPFA 4UNRA 3CPJB 3DEFA 1YVDA 3AF1A 3GJ0A 2XZPA 1G291 1NG1A 2E87A 1N6PA 2QAGA 3N2EA 4HDCA 4RZ3A 4C0BA 2WWIA 1TQ2A 5L3RA 1SVIA 3K09A 1W36D 4DJTA 4JLJA 4ZPXA 1H8HD 3LV8A 5DHAA 2VEDA 2HF9A 5FBVB 3QF4B 4A2WA 2CVHA 4HB2A 1TF2A 4KYUA 1TQDA 2RGCA 4LJAA 1DAKA 4HLCA 2FSGA 4OK3A 2BCGY 2A30A 3BGWA 5JBQA 3HU1A 1GNRA 4GZLA 1W2GA 4M1WA 4NONA 4GPTA 4B34A 3ZDQA 2DFKB 1FP7A 5JWRA 1MOZA 2FFBA 5DHFA 1TMKA 5LB2A 1GL9B 1Q57A 2JDID 1VKJA 2PL3A 4TL6A 3FHCB 3WMFA 4A0FA 2P5TB 3U7HB 2YC4C 2QL6A 4QHTA 3BBPA 1T3SA 1GL6A 2QG6A 4ABYA 2IC5A 3IPXA 3BERA 4G1UC 2EVWX 3EWAA 3OE7D 4NHOA 5JJKA 1TUEA 4NMMA 4DIEA 1DEKA 2C77A 3AF3A 4B76A 3C14C 4OI0A 3GLIB 3MJHA 2CK3A 4RFSB 4OQLA 3T34A 3EIQA 5J4HA 4MRVA 3SR0A 2F1HA 4A15A 4KITB 1E2MA 4EFLA 1KY3A 1HT2E 5FOSA 4OK5A 2GHIA 1FTNA 3PIRA 4LWZA 1B23P 3ZQJA 2OO7A 2O8BA 4F4JA 1IY1A 1AIPA 1GNQA 1WQ1R 3WHKA 1EFUA 1CXZA 1G3MA 3T1QA 4PAQA 3CH5A 1D5CA 3H4MA 1L2TA 4UKDA 3CH4B 2ZRPA 3H86A 1KAGA 4C2TA 3RWMB 1XEWY 4Q9IA 1II8B 3WNDA 1Q21A 2W0MA 3I73A 2VF8A 3K8YA 3UK6A 3CX6A 4C0SA 2AKAB 5EXSA 4XWOA 1X1SA 4IEEA 2WIBA 2QAJA 2XTZA 3ZZ0A 1CJVC 3RHFA 1K5GA 3QI2A 4DVGA 3WBKA 3VTKA 3BFKA 4BGDA 4DLXA 4D0GA 2EFDB 4JVSB 3A1WA 4WVFA 5HCNA 4BLPA 4ARZB 3A1SA 3SU8A 4JLKA 2QSZA 1Z0IA 3B1XA 3QKUA 4FXPA 2ZJ2A 4PANA 3AQ4A 3QKSB 3DZ8A 5G3YA 1NVVQ 4ILEA 2O0KA 1Z2AA 3U3RA 1KI4A 2LWIA 4OHYA 2O8DA 1OYWA 4GP7A 2CK3D 4TN1A 3U5ZB 1F2TB 2MSDB 2IYRA 1IAQA 1VCIA 4M1MA 3AM1A 1QRAA 2G88A 3EIHA 4BFZA 4LJYA 4R2IA 1X8LA 5KNDA 3WMGA 2ZRHA 3CPHA 4LCBA 2WWHA 2SHKA 4CVNA 1G8GA 4IDHA 2AD1A 2EU8A 2UZ3A 5CLQA 1SVOA 3NHAA 4B73A 4HLUA 1KTVA 4I1OA 1P2SA 2G1KA 5FUVA 4AI6A 1XU4A 3GEEA 3BH7A 3MLEA 1Z47A 5K8TA 2FPKA 4MKIA 4TQUS 4FMBB 5EP3A 2GTPA 4LZZA 1CTQA 4UXHA 2QT1A 4X8OA 5EE9A 2F1RA 3IBYA 3CRRA 3UATA 4YXWD 1NKSA 4D4LA 4ZV4A 1XB2A 4FD2A 2B21A 2ZR7A 1UBEA 3AGQA 5TMPA 3R7WA 3BAFA 2GJAA 2WAYA 3QXJA 4ACAA 4DSTA 2CNWA 4TT3A 2R6GA 2GF9A 3KJGA 1XTKA 2VO1A 4CEIA 1VIYA 2KBEA 2P0EA 5EZ5A 2QA5A 3LLUA 5DYGA 2PZGA 5AR1A 2ZYTX 2RB4A 4K46A 4M4SA 1XMJA 1E2FA 4CZ2A 3EPJA 3U61B 1Z6YA 1ZIPA 2VTKA 5TARA 4RD4A 4M21A 1AQUA 1IQPA 1VECA 3TIFA 3ZD7A 4QBHA 5FPYA 4FCWA 4I1VA 4OBEA 1W47A 3QIAA 2WIAA 1G8YA 4JYBA 1JR6A 3SNHA 3WY9A 4B6FA 4URXR 1LF5A 2OFXA 1KO7A 1P75A 1XD9A 2EQBA 1E9RA 2O0HA 2F6RA 1Z29A 2V7QA 1UF9A 1UKEA 2VP2A 3SYKA 1P4SA 4WOPA 3U3MA 1OJLA 3PEVA 4AYXA 1T3LA 1ZD9A 1SXJA 2QP3A 3LO5A 1S2MA 2NMVA 3MGCA 5BWMA 2ANCA 3QSYA 4DB2A 5DGXA 2R6CA 4JBYA 4Q48A 2J46A 4OI1A 2CNWD 4Q21A 4TT3D 2RGNA 1AK2A 3RNLA 4KAXA 1V43A 1YE8A 1F6BA 3WNBA 1LS6A 3CX7A 2FGJA 1P9NA 4UJ5A 4QHYA 4JL6A 4O2RA 1BS1A 2ZRKA 2GJ9A 2O8CB 3BFVA 4URYR 1VHLA 2RMKA 1ZW6A 1KI8A 4L9WA 3TAUA 2GBLA 4BLRA 4M9SA 4OQFA 2J0UA 1BYIA 3B5JA 2BC9A 2BJVA 3RS2A 4XOIA 4KFSA 2QZ4A 2ZR0A 3U7GA 3PCRB 5J4LA 3W5IA 1DBSA 3SOPA 2NO6A 3DOEA 3LX8A 4YLGA 5JHGB 1IY2A 2VHJA 4JVNA 4NCIA 5CM9C 1BOFA 1KK3A 3FKQA 1VG1A 2W83A 1G3RA 2A5GA 2C96A 2ODNA 1E1QA 3I5XA 1N5KA 4WIAA 2V7QD 1NNEA 1FNNA 5HE9A 4MQBA 4RD2A 4DEXA 1AM4D 4AYWA 4RD6A 4Q5IA 2FEOA 2NO9A 2X2FA 4W7SA 1SXJD 1A2KC 5CIWA 5A5GA 4CRWB 4ZDJA 3B85A 3LH5A 3RAPR 3NBXX 3TVDA 3TR5A 4M9ZA 1KI2A 2FGKA 2YHSA 3KL4A 3QPVA 2A3RA 3M6AA 3HPQA 4S2EA 2BCJQ 2ECKA 1NVWQ 2PT5A 2HF8A 4YMSA 1J2JA 4CW7A 5LPNA 2B8WA 3TW8B 3BB4A 1I2MA 2J7PA 3BOSA 3SBDA 1G21E 3O8BA 1SVWA 2IUTA 1QDEA 1J70A 1E2EA 1ZM3A 2HDNB 4Q4HB 3T5DA 3MCAA 1Q0UA 3CBQA 4IDNA 4LYHA 1N2CE 4LHWA 3B9QA 4JZKA 3TMKA 4P4UA 2W6JA 5BN5A 3QJYA 2BEKA 2CCKA 1J7KA 5TXGA 1KO4A 3C8UA 1W36B 1VDZA 3BIFA 3O47A 4UNPA 3KFVA 4Q9HA 2QP4A 4HZUA 5EP2A 3N2IA 1NMYA 3A4MA 2CCGA 2NO0A 3O8RA 3F3YA 1OB5A 3Q5DA 1RKBA 1E1QD 1G41A 5LB4A 2CBZA 3ZLJA 2BBOA 5H1YA 1UBGA 4KLZA 1ZM2A 1OF1A 1P7CA 1T3HA 3AP3A 1KSJA 2BHRA 4IVPA 1IOZA 1E99A 3IQWA 4M1OA 5SZKB 1CULC 3PJRA 2CE7A 2HXYA 2QMUA 4IW3B 4PC6A 1T9HA 2HXSA 1XPOA 1KAOA 1YRBA 4M9XA 2JA1A 3ND8A 4KV9A 4HAZA 1AZSC 2ZAOA 4P4SB 4RJLA 3RABA 2ZYVX 2GILA 3NHBA 1R8SA 1W48A 3ZVMA 3GEHA 3PG5A 1NJFA 3IGFA 1CIPA 3EWSA 4BLQA 2J7PD 5JMTA 4N1AA 4TYPA 3GFPA 3OIVA 2WSMA 2RCNA 5JFGA 4QHSA 3ADDA 2ATXA 5CDFE 1E2QA 1KYIA 2J45A 4HAWA 4LYAA 3GJ3A 4PC7A 1JQLB 2VHUA 5C1BA 1UKZA 3ZS9A 2QAGB 2W6JD 1ZVQA 4R2HA 1H8EA 4X8LA 1UDXA 3HU2A 4JLNA 2OZEA 5EJEA 3W6OA 3PV0A 3TNFA 2X1VA 2R9VA 4RFSA 1E2HA 8OHMA 5JZVA 3ICQB 3A37A 1LFDB 5G41A 1YRAA 1N5JA 3RS3A 3LBNA 1EK0A 1ODFA 2YOHA 4FN5A 1X6VA 1IBRA 2EFHB 4NYMQ 1J99A 5L8VA 5J4VA 1KOFA 3FVQA 4OI2A 5AK0A 2BBSA 3AF4A 3I1FA 2PMDA 2QT0A 3EZ6A 1Z8FA 3OEEA 4LBYA 2HJGA 4CEJB 1I2DA 1E2IA 1AN0A 5AJZA 1GZSA 1GTVA 2V4ZA 4B6EA 2REXB 5TVKA 3L0IB 3CWZA 2WPDA 2BBTA 3TVTA 5C46F 5K8LA 1R0ZA 2XJ9A 4JMPA 4LJ5A 2IYUA 5HE8A 4V02A 5AJYA 3T61A 5B2ZA 2VSFA 2CJWA 4HUQB 5SZHB 3ICEA 4BEJA 3DMDA 4IDQA 4D80A 2HT1A 5ANRB 3L82B 3Q5EA 4AKIA 1XD2A 4M22A 5FTLA 2GAOA 2QTFA 2IYVA 3V00A 1Z0JA 3QKSA 2WKQA 1NN5A 1TNDA 3C4JA 1H8ED 2CLDX 1U0LA 2O8BB 4XD7A 1XJQA 1NRJB 1G6HA 2CL7X 2CLSA 2F7SA 3LW7A 2GWHA 1XCGB 3A36A 2ZRCA 1TEVA 5L3SA 3SHFA 2WWFA 4PO8A 4R9UC 2O52A 4OL0A 1R6BX 2OAP1 1VG0B 4AIIA 2DPXA 2WMOB 1I4LD 3NDBB 1QVAA 3P20A 3B6EA 4LV8B 2ZS9A 3OEED 2ZITA 3NDPA 4MRRA 1G5PA 1PUIA 4IDOA 4KU4A 3ZJYA 2GJ8A 2ONKA 1OFTA 2ZYUX 4Q1CA 5FTMA 3AGPA 4NPHA 3G5UA 4J0QA 2WPDD 4NH0A 3AVUA 2FEMA 2FOLA 4EPVA 4M1YA 3EZ7A 2JLXA 2QPAA 3SS8A 3CX8A 5KDOA 2FZLA 2GA8A 4BZXA 3DKVA 1ZUIA 3AVYA 2P3SA 5H70A 3VR2A 2ZI9A 3PUVA 1GG2A 3EX7C 2O8DB 4I99A 4EDHA 2HEIA 1M34E 4JLMA 4U02A 2ODBA 2OXCA 3TBKA 1DO2A 3VKWA 1AS3A 3EC1A 3VR6A 1NP6A 2F43B 3P27A 1U81A 2UZIR 1EGAA 3BC1A 5GJBA 4QBGB 4LOAA 1IN5A 4DB4A 4ZI3A 1T6NA 4OHVA 2DWQA 2EWVA 4HZIA 4XD7D 3WP0A 2BKUA 2VP0A 1ZNZA 4BECA 4A92A 1SZPA 1CBUA 5EE5B 2Q9CA 1LB1B 2YOGA 5JS7A 2IEZA 1E9BA 3TSOA 3AF2A 2ZI6A 3CR8A 4TTQA 4NYJR 1Z28A 2YWEA 4GMDA 3ASZA 3I8XA 4B32A 3NH6A 2J0SA 2R44A 3G0HA 1P60A 1BIFA 3QXHA 4MRPA 3OAAA 5CK4A 3FE2A 4YMTA 4PO9A 1CRQA 4QG7A 4FWIB 1ZM7A 3IKJA 3DZDA 4RD1A 2AWNA 5JJLA 5FTNA 3R7WB 2EFGA 3U7EB 1E9EA 3NC1C 1WA5A 2WICA 5DI9A 5JECA 1OH5A 2CDNA 2JAQA 4CEIB 2CHVA 4NU0A 4TYYA 1N5IA 3GLFE 1QF9A 1XBTA 3QKRA 3DO6A 4BEBA 2ZI3A 1T8UA 3DOFA 1VPLA 1XZQA 5B64A 3Q8XB 1NLZA 2ZRNA 1NMZA 3KKOA 3MMPA 4EPWA 2PJZA 2OCPA 2Z43A 2DFLA 5AJWA 4ZIRA 4ESHA 2WAXA 2C9YA 3CNOA 1OH6A 1R0WA 4DWJA 1L8QA 4TYWA 2O8CA 2QI9C 1ELOA 1Z0DA 3NBFA 4JT4A 1EX6A 4US0R 2JATA 2WJHA 1NG9A 3LAWA 3T35A 2RH5A 3GJ7A 5FR2A 3I3SR 1RE0A 1X8JA 4B75A 1MRSA 4TQ9A 4WW0A 1GDDA 3RDPA 2V3CC 3CLVA 3OAAD 2J5XA 3K1JA 2GZAA 4LSGA 4Q9KA 1KSGA 4A0HA 1DE0A 1P9WA 4FMCB 2FH5B 3LX5A 4BE7B 4B3DA 3M0EA 2JLYA 1KMQA 1KK1A 3QVUA 5F2EA 3KQNA 4ZDIA 4JIMA 4DBLC 1M2OB 1WXQA 5FPHA 1YZQA 4V03A 4HYYA 1XTJA 2CHGA 4KFUA 3GJ6A 4P33A 5CIQA 5KO2A 2ZJ8A 4C0KA 2OBNA 3Q72A 3B8HA 3SJCA 3GJ5A 3ETLA 3NXSA 1NN0A 1VCOA 2ZRIA 2VL7A 4A8JB 1CU1A 1KI3A 1E9CA 5AJVB 5TB5A 1Z0AA 4FMDB 4HSEA 1GSIA 2FSIA 3B9PA 2J87A 4NP6A 2K5UA 1KI1A 3CR7A 2VSXA 1T4GA 4OQMA 4DXAA 2ZE7A 4RKFA 4US2R 3V9PA 1KNXA 3CRMA 2ZVQX 1Q1EA 3WNCA 1E9SA 4O25A 1AS0A 1WB9A 2PCJA 4FCTA 1XJ0A 2EWWA 4XWAA 3RWOA 4PXAA 5CDFA 3CB4A 2ASEA 1UEJA 4BZPA 5FUYA 1O87A 4TLDA 2B8TA 3I32A 2ZI5A 1FPMA 5M04A 2PZEA 3LLMA 3C41J 5GVRA 1NLFA 3H1TA 2ONJA 4IVQA 2QBYB 4NYIR 2ZIAA 3ZGXA 4DDVA 5J4YA 5FBQB 1ZD1A 2GCOB 3EAQA 4CYMA 2Z5FA 3FYHA 2RGXA 3L43A 1AJEA 1G7SA 4RKEA 4DCUA 4UQOA 3GJ8A 1ZAKA 4JLAA 3LW8A 4D82A 4F4IA 3K70C 3CONA 4AG6A 3I5YA 3AVVA 3CRW1 2MSEB 3QEJA 1E79A 1E9DA 1OIVA 1U98A 2N46A 4Q1BA 2FJUA 5J40A 5B58C 1YR6A 3I4LA 3NG1A 4AK9A 4EPRA 3GEIA 1JALA 1E0JA 3R9IA 4BFYA 4EPYA 4MGZR 4HZUB 4YDSA 2BMJA 3HYRA 4FINA 2J41A 4NCHA 4OHWA 2VPPA 4URVR 2PLRA 1EXMA 4MA4A 1GOTA 2FZ4A 4PR0A 3THXA 1E96A 4PC2A 2G6BA 1Z3IX 3QBTA 1AZTA 3CRQA 3EC2A 3HPRA 4II7A 1VCNA 3TAHA 3TUZC 5FOVA 1OW3B 5KDLA 4AY2A 4DDUA 1AGRA 4JS0A 1KK2A 2P67A 4D26A 5J5CA 1FTSA 1XRJA 3U4QA 1RJ9B 2W00A 5HZHA 1FNMA 3L8ZA 4IXNA 3X1ZA 1K5DA 3OFNA 4B44A 3CPEA 4KSBA 2OLJA 4DLSA 3S1AA 1CKEA 1N6NA 5KTYA 1COWA 1WRBA 4CEJA 1EWQA 5EXXA 2R8RA 3N5CA 2X8AA 4TMZA 2O8FB 2H16A 3KKPA 2FFQA 5FBLB 2XZOA 1X1RA 3D8BA 3G82C 3PEUA 1FX0A 1GP2A 1E79D 2ZRLA 1DAIA 1W4AA 1VG8A 1DAMA 1LF0A 4HUQA 2NZ8A 4B3CA 5HZKA 1ZNXA 4IHQA 3C7KA 3HP1A 4PTLA 3ZS8A 4L8GA 1FL9A 3ND9A 1EX7A 2GEVA 5FPSA 2IW3A 1KSFX 1UM8A 3QQ5A 4BLOA 3JZAA 1XP8A 2IX3A 2CL6X 2WOOA 5LDDC 4ZCLA 1MRNA 3C15C 1LS1A 4LHVA 2H18A 3RRZA 4GI7A 2YZ2A 5HTKA 1W5SA 1Q1BA 2AFIE 3NTUA 2OILA 4PHTA 4CIDA 1Z08A 4YMWA 3KJIA 2ZVPX 4AURA 4OK6A 1IN8A 2AXNA 1CJTC 4G5GA 1MV5A 3T12A 2KI5A 3OIWA 3OFND 4YXWA 1YZUA 1GIAA 1N0WA 1COWD 2YJTD 5KYKA 5B57C 1GVNB 3VHLB 2CJWB 4E07A 3SFZA 2ZI4A 3KJEA 1JAIA 3RANA 821PA 4GBMA 1WBDA 3O8CA 1XD2B 4GP6A 4B3XA 2OCAA 1M6NA 4Q03A 4IKEA 5CLLA 4NCKA 3UMFA 1NN3A 2AFHE 2JLZA 1R8QA 4EFNA 3CO5A 2FA9A 2ZRDA 1AGPA 3QKTA 5FOTA 4QXAA 1D2MA 2G1JA 3EPLA 1ANKA 3GLFA 2XZLA 4A6XA 1KO1A 4DEYA 5L3SB 2F43A 3PEYA 1XTSA 2ORVA 3TQCA 2EFCB 2YNMA 3L0PA 1HY3A 4U00A 2O0JA 3D6TB 4N0DA 3KQKA 1KI6A 1W4CA 3LRPA 3RS4A 4LJ9A 1FUKA 3ZVNA 2ZRAA 4AG5A 1XPRA 1CR1A 1ZJ6A 2PMKA 3MUFA 4DCVA 3VKGA 4MYUA 4NCJA 521PA 2ZRJA 2EW1A 4ESVA 2J0QA 2B6HA 1NIJA 4A4DA 3ZZTA 5AUPB 1MABA 2D06A 3PUXA 3AKCA 5KNCA 3U7FB 1FZQA 1OFUX 2LKCA 4LGMA 1W1WA 4QGHA 2H7VA 1NBMA 1G7RA 4IFEA 1ZBDA 2R2AA 4LPSA 4F93B 1OB2A 1YQTA 2ZU6A 3AVQA 1I4DD 1UDWA 1VYUA 1Z6XA 3K0CA 1YHNA 2GRJA 5C2JB 5DIFA 1GILA 1YR8A 1YZKA 3ADBA 5EXPA 1D9ZA 4MH0R 1J8YF 1DO0A 2DCUA 1NF3A 2UVQA 1KZGB 3H84A 3MJRA 3KQUA 2G3YA 1F5NA 3FMPB 3VR4A 1HYQA 2Z4SA 3HR8A 1RIFA 4TZ0A 1T91A 3CW2A 1IONA 5EUQB 2Q6TA 1G8PA 1KK0A 4QJ4A 3UXMA 2VBCA 2BDTA 4D81A 4Z54A 1E2DA 4ZKEA 1KDRA 1ZM4A 1IJFA 1QG4A 1D6JA 3U6KA 2FNAA 3CRVA 5L3QB 1D9XA 4M1SA 1M1YE 1KJWA 4GZMA 4I81A 4JKIA 3VU9A 1Q20A 1F60A 2JIZA 3ZVRA 4HDOB 4DCNA 5IT5A 5JEEA 2V54A 1PLLA 6Q21A 4QJ3A 4U5XA 4KHZA 1X8KA 3RRNA 2WHXA 4DLRA 2ZS8A 4KBFA 4B48A 3QKRB 1T0HB 2C04A 1JPNA 1NBMD 1XEFA 3DL0A 4TLEA 3I92A 2HV8A 2OBLA 3VFDA 3ZIAA 1S3SA 4QNMA 1U8AA 2B92A 1E0KA 1WCV1 1ZM9A 4GFDA 3SFVA 4FWTA 1LW7A 2H92A 3EASA 4ZIRB 4TL9A 5JI2E 3I8SA 5E7JA 4BASA 2YWFA 2J1LA 2R62A 1SULA 4D0LB 4PSAA 4A2QA 5F9HA 2XXAB 1N0VC 1II9A 2VP6A 5KSPA 2GNOA 2RGAA 4ON9A 4BLTA 1AS2A 2PEYA 3IUYA 3OHMA 4UXJA 1PV4A 4A8JA 3QVVA 1CRPA 2IF2A 4EJSC 3K9LA 4PAMA 2REBA 5HKKA 4C0AC 2HT6A 1G6OA 3D31A 2WWYA 1TEXA 3KX2A 4NCNA 3I61A 3K9GA 1Z2CA 2RGBA 1XMSA 4Q7JB 3DDCA 5KPJA 2G0NA 1Z06A 3RSOA 4PX9A 4Q1AA 1TAGA 2JIZD 4TMVA 2A5JA 2ZAMA 3K0AA 1CP2A 1JQJC 2GXSA 1ZC3A 1NJGA 3M1IA 2D2FA 4JBXA 5HCIA 5KOYA 3EPHA 4U7DA 1U99A 2HYIC 1ZRHA 1G18A 2VA8A 1R2QA 3VNVA 2JLUA 3EG5A 1AKYA 2ZRMA 2QE7A 2IF0A 1QHYA 1JAHA 4TTRA 4Q4AA 3RS0A 3ZIAD 1E9FA 4FCVA 4MGKR 3NBZC 2QBYA 1GRQA 4PPFA 3CF6R 4HLQB 2QY9A 2WM9B 2AHOA 1NVXQ 5H68A 2GCOA 3TRFA 4BFTA 1GAJA 4DLUA 4B3FX 2YKGA 2IUUA 1A2BA 2JLSA 3WYFA 5KHOC 2ERYA 1GKIA 1CR4A 1NL3A 2OBMA 3DKPA 3X1WA 4M8NE 5IDVA 3ADCA 2JJ1D 3GJ4A 1XMVA 1D2EA 1FMLA 3CM0A 5BN4A 4DLWA 4Q4LA 5HKKD 4XTRA 2XB2A 3PR1A 1U94A 4B2IA 5LD2C 1SVSA 1KI7A 1W44A 4RSGA 1DOAA 3MWKA 2V1UA 4CGZA 3I72A 5FI0B 2LCFA 3B7GA 4R71A 3ZVLA 4TL7A 1OXTA 1CJKC 2P65A 3CWQA 1U9IC 1YR7A 1MO4A 1TX4B 4DLVA 1NY6A 4KI0A 4D4KA 4W5JA 1J90A 1X3SA 1G5TA 1ONBA 1DAGA 3KUCA 3T1OA 2A5YB 3X2SA 1II0A 2WWGA 4JLDA 2YINC 4M1TA 2W2TA 3X1YA 2IS1A 4TMKA 3DM9B 3IEVA 4CT5A 2IHBA 5FL3A 2QE7D 3FHOA 3SZRA 5UKDA 2ORWA 5A0FA 5EP1A 1RJ9A 4DLTA 4L5BA 2P2LA 4WA7A 4ZDKA 1KGDA 3VR1A 2VP9A 3KTAA 1HA3A 1X86B 3SJBA 2GF0A 2O8FA 4WXRA 4NE2A 1JJVA 2VSOA 5FUWA 1J8MF 2AKYA 2CCJA 3MFYA 1U0JA 1UJ2A 4EQ6A 3K70D 5EE3A 2IS2A 2KBFA 2AD5A 4AKGA 2EYUA 2IYYA 2AK2A 4Q18A 1RW4A 3THXB 4Q9LA 1UKYA 4D2IA 1ETUA 3REGA 2R6FA 3GLHA 5FFMA 1PLJA 2WJGA 3WP1B 4B71A 5CK5A 1G1MA 2QRNA 2BV3A 1UBFA 3WYAA 5FOXA 3KKQA 1ZIOA 1JJ7A 4MYCA 3U3JA 5H8WA 4DIDA 1YZNA 5JSZB 3LQRA 4PPNA 1HQYE 5CYOA 4PZLA 3HR7A 3U4QB 3K09C 2BBWA 3Q7QA 1CJUC 1C4OA 3B13B 3S1AB 4G5QA 5LBIA 3Q9LA 4LK2A 1TU4A 1W4BA 1WMSA 2OV2A 2V1XA 3RLFA 2WZQA 4S35A 1DS6A 3A58B 4JSYA 2W2VA 3BFXA 1FX0B 3W8RA 4XVUA 4BQSA 4GDFA 3U44A 1EFHA 1EG7A 1E6CA 3AB3A 4P0TA 4BFVA 4KO8A 4LC0A 1R10A 4EAQA 1Z0FA 3MWLA 1OLOA 2GXUA 3IQXA 4MITA 1FQKA 2X19A 5FR1A 4DSOA 2H17A 1A82A 3K9HA 5IHPA 721PA 1W7AA 1MT0A 2R65A 3EIEA 3KDSE 4M1KA 4DT1A 4TLBA 1P72A 1P73A 4PAOA 1WDTA 4TSFA 3FPAA 3VR3A 4M2LA 1R0XA 2W6IA 1FUUA 1RFLA 1N6KA 2MSCB 4GT1A 1VHTA 1ZYUA 1XTIA 4KFTA 2C9CA 1OPXA 5F98A 2QEQA 4UJ3A 3LWNA 5C4MA 2CMKA 1G3QA 4AD8A 5G40A 1CF4A 4QBIA 1LY1A 1E2JA 4Z8XA 1KY2A 4O3MA 4NYJQ 5K8UA 5IRCD 2IEYA 1F3OA 1P5ZB 2ZI7A 2W58A 3UANA 2XGJA 2FWRA 1NLYA 2KB0A 2N42A 3T1VA 2YWGA 5E7MA 2HCBA 2Z0MA 2XNSA 4BWYA 3RS7A 3TKLA 4JSTA 1E0AA 5JCPA 3AUYA 1CLUA 1OKKA 5JRJA 2F9MA 2NG1A 4F38A 3FWYA 1Z0KA 1KMHB 1OXUA 1EFTA 2YWHA 3IEUA 4LBVA 1MR3F 2IT1A 3DM5A 1Q3TA 2IK8A 3F8TA 2AX4A 5KUTA 1F2UA 3KJHA 3UMRA 2I3BA 4LHYA 3L0OA 3GLFB 3JVVA 2ZTSA 3C5CA 1U8ZA 2BWJA 2XOKA 2PX3A 5EUMA 2IYLD 1E4YA 3F0TA 3FMFA 4TSFD 5BQ5A 1KI6B 2TMKA 3ECCA 4GRAA 2W6ID 1E2KA 5BN3A 3FMIA 4QM6A 3B2EA 2B7BA 2ZM5A 1XCPA 2IXFA 2KE5A 2NTYC 3LDAA 2WSSA 4K8OA 4LRWA 1MABB 4WZBE 1NN1A 4YMVA 1JI0A 1W0KA 2OFWA 4L9SA 4LYJA 3CIOA 1BO6A 2WV9A 3QNUA 5L3QA 4JL5A 2GXAA 4QGGA 5D3MA 1GM5A 1OXSC 2KJQA 3BWDD 4P3YA 1XF9A 5CJPA 1ZU5A 4B2LA 3PENA 1OKKD 5EE0A 4MYTA 4IRUB 5FTKA 2PJRA 2VP5A 1QHSA 1N5LA 2BM0A 3LBIA 1ZCBA 2YC2C 5CJ2A 2PLFA 3ZZUA 3L2OB 3A8TA 3P32A 3EA0A 3LXRA 2DR3A 3AVTA 4UNNA 3QG1A 4Q01A 2OHFA 4GNKA 2DFTA 4PFSA 3ONWA 1Q22A 3UG7A 4KCGA 4L16A 4C2UA 1N3BA 5GJWC 2G9NA 2XOKD 4PO1A 4Q66C 1DARA 1DELA 1OXXK 2IXEA 1FMJA 2BJWA 5KNBA 4MDFA 2XXAA 2RGGA 4DKXA 4Q02A 1VIAA 2V55B 4CEHA 1YU9A 2QU8A 3GCGA 1P2VA 3QEOA 5E7IA 3KUDA 3QXCA 4LV5B 1NBME 1N6OA 2OLKA 2VHTA 3V4FA 3WRXC 3IIJA 1SHKA 421PA 1UPTA 2QMEA 4LJ6A 1XTQA 4BPBA 3VU9B 2WSSD 2ZJYA 2WJIA 1UADA 2IUSA 1KJZA 1W0KD 2DHRA 2GVDC 4A0GA 4EJSA 5AJXA 5E4FA 2QUZA 2IYSA 2ZQ5A 4V0KA 4E03A 2O5VA 1NSTA 4ZO4A 2GETA 1RYFA 1C1YA 2V6JA 2FU5C 3SC3A 3KKNA 5HR5A 4XSGA 1KO5A 3MG9A 3KB1A 2CVFA 1QVRA 1SVLA 4NYIQ 1SXJC 2D62A 1SKYB 4HAVA 1OV4A 3QENA 5F9FA 1KJYA 4QKQA 2WJJA 1FP6A 2WKRA 3RRYA 3SEAA 4JLBA 2DWOA 3TJZA 4JVMA 2FF7A 3RRMA 4ACBA 3QF7A 2ZJAA 4LHXA 4LX0A 4LUCA 1E32A 4B47A 3SBEA 4GOXA 2D4HA 3LFUA 3THWA 3K53A 3FOZA 3FTQA 4KXFB 1H65A 4O0MA 5FH9A 4TLCA 3KKMA 4D4MA 1SVKA 2XX3A 3NEYA 4A1FA 2GBLC 5FOWA 1HE1C 1M7GA 1IN4A 4XSHA 4UNSA 4EFMA 4YC7A 2WVJA 2VLIA 1JB1A 3K0AB 3FFAA 4IOLA 5J4KA 2R6AA 2FV8A 4ZKDA 3W6PA 3EPKA 4MKFA 4Q7LA 4RZXA 3FKSA 1YZGA 4M0LA 2CLCX 3P26A 4JJZA 4RZUA 2OESA 2OEPA 3VQTA 3WYGA 2GK6A 2C9OA 3KQLA 1SKYE 2GK7A 2MMGA 1EESA 4Q4AB 2QTHA 1B0UA 2JEOA 1YZTA 2Q3FA 2ZUDA 3C16C 4MGIR 2IWRA 1U9IA 1FOEB 1ZU4A 3E1SA 2CXXA 1F48A 5FL7A 4FMCF 4DLZA 5DLQC 3IIMA 3EARA 1U2RA 1YJ5A 2OCYC 2RAPA 3IBGA 4PSKA 2VHCA 4DDTA 1QHGA 3NH9A 4M53A 4LJ7A 5DNYB 1T5LA 4OHXA 1US8A 3K70B 3EZ9A 1JEEA 4IOMA 4MYHA 2XITA 2RGDA 3CNNA 1FW6A 1DTSA 1KDPA 1RRFA 2ZXUA 4G0NA 2FPMA 1IY0A 4IOJA 4D0NA 2KSQA 2QMHA 4MKHA 2D7CA 4XJXA 3NEJA 4Q1EA 2ATVA 4FMDF 2WJVA 3GLGB 1WE2A 1GKUB 2OT3B 2Q9AA 4LDJA 2ZUCA 4Q00A 4W9MC 2G83A 2FMXA 1IJEA 4G5RA 3M4YA 2Q9BA 3FFBA 4PSVA 3FKSD 2F1IA 4DUGA 4B35A 1S96A 2FG5A 2PX0A 2HCJB 4Q1DA 4RVCA 5G3ZA 3TE6A 5DN6A 5C18A 1ZUNB 4POAA 5JSZA 4BFXA 3CF0A 3UKDA 1S4QA 1SVMA 3HU3A 4XH9B 3CUEF 4PQYA 2ODWA 5FL7D 3MSXA 2XB4A 4G5SA 3KTAB 1G3IA 2N1BA 3SDZA 3QUSA 2GJKA 4LJ8A 5TY0A 4DCTA 2XAUA 1HEIA 3VAAA 3QPWA 2EFEB 3RVBA 1RC8A 1IM2A 4FW9A 4IVRA 3AVXA 4TMTA 4OQXA 3IHWA 1DG1G 1T5IA 2GCPA 4EQ6B 2QM8A 5L3VA 4KODA 1RYHA 5AUOB 1N6HA 3HJNA 1R7RA 2J59A 3AVOA 3GLGE 1N6RA 4JLVA 4JVLA 4I1SA 2YVUA 4P31A 2ZSEA 2EYQA 2AWOA 3GLHB 4N0EA 2HYDA 1G7CA 1ZP6A 3OEHA 4Q47A 3TR0A 5DO9A 1BH2A 2XSZA 1M74A 5J47A 3SN6A 2IHYA 4EKDA 2QENA 3A6PC 4PHGA 3VX3A 2H5EA 3SYNA 4DSNA 2OXRA 1L4YA 4XWKA 4WXPA 2QQEA 3K9NA 2JLQA 2REOA 2QMOA 4KLNA 2NPFA 5FPKA 1R0YA 4C7OA 1YR9A 4DUGD 5A4JA 1T0JB 3BH0A 3MWJA 1TQ4A 2ORIA 4V0NA 5DN6D 1TF5A 5GADl 1SGWA 3X1DA 1A1VA 4GL2A 1W46A 1G16A 1TU3A 1EFRA 2C03A 2GKSA 3U44B 2ZSBA 3UPUA 5F3WB 4Y0VA 2QQ0A 3A1UA 4RCYA 1TTTA 5KSZA 2QROA 1XEXB 1XWIA 4OI4A 4ZDWA 1G64A 4QM7A 5P21A 3D7MA 4XIGS 4JBWA 1W2HA 3GLHE 5GJVC 4ASUA 4DT1B 1G7TA 4NBSA 4A0RA 4OKSA 2D74A 4TQAA 1KMHA 1JR3A 1Z5ZA 1HE8B 4JLOA 4Q4JA 3ZD6A 2B7CA 3C5HA 4PPQA 4B43A 4Z1MA 3H0KA 3TW4A 3H2YA 5EQTA 1XJCA 2BIFA 4Z51A 5JEDA 1IXRC 1Z22A 3OEHD 3DPUA 4LI0A 3O8DA 2GJSA 4MRSA 2E9SA 2XSZD 3SQWA 1DAEA 1VMAA 1XNJA 1R5BA 3PQCA 4G01B 121PA 1DVRA 1MKYA 4HLDA 4JL8A 3GLIE 5AWFC 1IXSB 4YDHB 3NKVA 1TL7C 3ZH9B 2ANBA 4X8MA 1R4AA 2XEXA 1OHHA 1IN7A 2F1JA 2HUPA 3R20A 1N6LA 3SI7A 3TUIC 3U2QA 4EPTA 5K8IA 1CR2A 1ZINA 1S0UA 1XPUA 2GEDA 2ZEJA 3B1VA 3W3AA 1NY5A 1KKMA 5FUXA 1EFRD 4IJMA 4PQFA 1DAHA 4Q1FA 3TUJC 4RY2A 5DI3A 1GKYA 2WMNB 4BLSA 4B74A 1F2UB 2OAQ1 4ASUD 3GP8A 1I4TD 3VMFA 3PUZA 4C0QC 1QHIA 1P9RA 5JRZA 5JJIA 1JR3D 3L8YA 4HAYA 3A1VA 2P6UA 3LD9A 4Z1MD 1Z6AA 4GOKA 4LPKA 1D8TA 2IA5A 4HB4A 4V0ME 1LVGA 1XDBA 2WWWA 4DHEA 1XMIA 2WTUA 1UAAA 5DISB 1Y3AA 2NQ2C 3KQHA 1E2NA 4WZ6A 5DE3A 2A5FA 2O8EA 2ZRBA 3PUYA 2CL0X 5EXTA 1AKEA 1CEEA 1OYYA 1VYVA 4F7WA 1Q1QA 1P62B 1NVVR 1G19A 1VG9B 1Z07A 2CE2X 2VRWA 5EE1A 2PCLA 3T06B 4ZCIA 2QRZA 1RPZA 3QY0A 3CZQA 1MO6A 2NPIA 5D3MB 1OHHD 2RGEA 3BB1A 3BB3A 5KSYA 3RYTC 1QZXA 2IL1A 3AKEA 1S9DA 3IHLA 3WMEA 3SJZA 3GFTA 2Q3HA 1W0JA 1E9AA 4CDGA 3AKYA 1EFCA 1BYUA 1TADA 4GOJA 4BZQA 1XXHA 1TF7A 3LBHA 4MUAA 1QHHA 3B1ZA 1P2UA 1RRPA 3DVLA 4LC1A 4A36A 1OXVA 1UBCA 4HATA 3AH8A 5AUNB 5FOUA 1JEDA 1WF3A 4A6PA 5KU1A 3IO5A 2JGNA 3PITA 3TK1A 4TMXA 4LBZA 4Y0AA 2QPOA 1G5RA 2NZJA 4DCSA 1ZCAA 2FX3A 4CEHB 1SKQA 2BEJA 3UWKA 2VYFA 4PPGA 2JJ1A 4TWZA 4QC2A 1M7HA 1R5NA 2H1LA 5BYJA 2NO7A 1S1CA 3OF5A 3B1WA 1OIXA 1XEWX 1A5TA 4B33A 2VHQA 3KZ1E 2NOAA 1IXZA 2OG2A 4EJSB 1UEIA 1NSFA 4UNQA 3EXAA 3W9YA 2JLVA 1HTWA 4RFVA 4MUBA 1ZNYA 3GD7A 4R98A 4A82A 2NIPA 4AC9A 1NKTA 221PA 2FFHA 3KB2A 3W34A 1W0JD 2ZRFA 1E94E 4MGYR 5KPDA 4WZAE 4AYTA 2GEUA 4B2PA 4KFRA 3B82A 4QNRA 4DDWA 2FDCA 4TL8A 2ERXA 1BMFA 1E2GA 4BFUA 4DSUA 2ZJOA 3LVQE 2X2EA 5SZIA 5IF9A 1E0SA 3PFIA 3P1JA 3MD0A 3W8NA 4BRWA 5B30A 3THWB 1C9KA 2PZFA 4JJKA 2C98A 3THYA 5IK2A 5JWOA 1KZ7B 1E69A 2ODEA 4F91B 4V0LA 1RRCA 3R9WA 3SYLA 2OM2A 4QBFA 3A4LA 5D3QA 2JLRA 3CF2A 3B60A 1AQYA 4P4TA 1DADA 1WP9A 1A4RA 1L7VC 5FBWB 2KWIA 3MRSA 2BKEA 4YQFA 2BVNA 4RD0A 3PVSA 3T15A 4D25A 1E2PA 1L4UA 2RHMA 1K8RA 1LTQA 2XTMA 1A7JA 3EZFA 5LD2B 2P5SA 2VQSA 3QOFA 4IOKA 3VHXA 1AA9A 4Q19A 4BFWA 4E5UA 4NZYA 3T5GA 3CZPA 1KDTA 1N0UA 5FTJA 1TUIA 1XFAA 4HDQB 5FBRB 5JS8A 3GLGA 2V6IA 2ZRGA 1E98A 3FB4A 4P32A 3B1YA 1W36C 4B3BA 1G17A 1QBKC 4MDEA 4QFMA 4C4PA 2Q0HA 3CNLA 3K0FA 3THOA 2A9KA 4BUJA 1O3YA 4CF7A 3Q85A 3LQQA 5E3HA 2ZJBA 3TSWA 1HURA 1BMFD 2AL7A 4KYIB 3AP2A 1S9HA 4AKEA 4TMWA 1US8B 2FN4A 1KNQA 4EIWA 2J7KA 4HAUA 3GMTA 4NDZA 1MO3A 1U8YA 4OHZA 2OCBA 2BM1A 5IK2D 1LV7A 2BMFA 3GFOA 4R7ZA 2IS4A 4AWXA 3QXXA 4C3ZA 1ZMXA 1JPJA 1KO8A 3HYTA 4OYHA 4PHHA 4QGFA 3QXSA 3QF4A 4TYQA 4XVQA 3PXGA 4PQRA 2I1VB 3LXXA 1S1MA 2J0VA 4URZR 4QRHA 2ZUBA 2F9LA 3UMSA 4Q7MB 5EP4A 1G8HA 1GITA 2QSYA 2QN6A 2Z6VA 1KKLA 3LVRE 1PVOA 4AKHA 3BJIC 4KSCA 2ZU0C 2Q21A 3NVAA 4KVAA 1P3JA 3W3ZB 3KXIA 1Q3HA 4EUNA 2ZJZA 3SQXA 1DG3A 3NBYC 2QAGC 4L4UA 5DYIA 2ZSAA 2C95A 4QOSA 4M9QA 2V8OA 4OJKA 2Z83A 3LA6A 3IO3A 3UG6A 1R5OA 3KXLA 2IXGA 5CB8A 3GLIA 1VCMA 3NIBA 4PZZA 2P6RA 2D2EA 3R9XA 2XJ4A 3FGNA 1W5TA 3K0SA 1XTRA 3MAAC 3OZXA 3RC8A 4KJZA 4ZI2A 1OSNA 4OJQA 1MO5A 3J81k 4C0JA 2DFNA 1OT3A 1ZNWA 2PT7A 1QHNA 5GJCA 1YKSA 2DWPA 2QGNA 1XEXA 3PUWA 5JWHA 2JLWA 1V5WA 1IHUA 1XX6A 3BORA 2JCSA 1HT1E 4ERNA 4G5OA 1II8A 1GFIA 1JXOA 5DSZA 5BXQC 2I1QA 2RHDA 1W49A 2I4IA 2G0TA 3AUXA 3E5HA 2A2ZA 2MMCA 3R8FA 2A78A 2WKPA 2XTNA 4QL3A 4W5HA 5BW8A 4C7OB 2CHQA 3EA5A 4PHFA 4PC1A 4C9BA 2R6DA 5E95A 4DC9A 3ASYA 4IFBA 4ARZA 3AKDA 2WJYA 4V0MA 4LYFA 1MH1A 4TLAA 2ZANA 3NWJA 1OFIA 2F3RA 3VNUA 2C78A 1KSHA 1P61B 3OIUA 4H1VA 4OQNA 1F2TA 1UFQA 1GNPA 2HJVA 2JASA 2GZHA 3AV0B 1KIMA 1HV8A 4NYMR 2IS6A 4HI0E 1Z63A 1JECA 4Q4JB 1G3UA 1SHZA 3LY5A 4RZ2A 2VP4A 2W2XA 2IWHA 3N70A 3KXKA 4JYCA 1E2LA 4LY6A 3BK7A 2QGZA 2VF7A 2ZE8A 3IILA 4URUR 2GVZC 3BD9A 1GRRA 3TSZA 1U90A 4WAUA 4N3NA 2F3TA 1ZUHA 2QTVB 3SJAA 3I62A 2GDJA 2WOJA 4YMUA 2YOFA 4H9GA 1G8FA 1RVDA 1DAFA 3EZ2A 1ZD8A 3DMNA 1KHTA 2QM7A 5G53C 5JI3E 4BFSA 1HQCA 1KI9A 3QPUA 1CR0A 3AVPA 4JT2A 2PEZA 4IEIA 5JCZA 3B78A 2GAAA 2ZETA 4FI3C 3U60B 2QNRA 3WHLA 2P6NA 4C30A 4DRZA 3F5FA 2BMEA 1M8PA 3QBVA 4LJ4A 1RRGA 2OFOA 1GWNA 1S3GA 2J3EA 2LKDA 4HLUC 1T8TA 4QJ5A 1JR3E 5DI3B 2WBLC 2ZPTX 1N6IA 1D2NA 3BXZA 4IXMA 2Y8EA 1JNYA 4MRNA 1OE0A 4US1R 2QPTA 4LV6A 5EZ6B 5CITA 4D4JA 2ZE6A 2FE4A 2NO1A 3L0SA 2D7DA 3A1TA 3IDQA 2IYWA 4H1UA 4Z8YA 2GZDA 5CB6A 4F92B 5FPTA 4NTZA 4X8HA 2DB3A 3TH5A 2FFAA 3E2IA 1HH4A 1W4RA 1FFHA 2L0XA 4B3GA 4TTPA 2ZJ5A 3AF0A 3K0CC 1Q44A 3GQBA 3RSLA 4E22A 1RZ3A 2ZSDA 4TZ6A 5FI1B 3SHWA 4ZCMA 2O8EB 4PC3A 3BE4A 3UIEA 1HUQA 1FQJA 2C5LA 4JKYA 5AUQA 2OE2A 1G9XA 4KBGA 4GSYA 2ZROA 3QE0A 1OIWA 2DYKA 2FSFA 1BKDR 3GPLA 1U0HC 3U3KA 3IIKA 3VR5A 2RKOA 2AN9A 4I4LA 2QP9X 2ZREA 1P6XA 1UKVY 3E70C 2E1RA 5KSOA 2IYQA 2DY1A 4PZYA 1PJRA 4I1UA 1XZPA 1M7BA 5DH9A 1XXHB 4HAXA 1QHHB 4IDPA 2V9PA 2IYTA 1E4VA 2D3WA 3TGPA 621PA 2H57A 4DLYA 1E1RA 4NKRA 3BS4A 1Y63A 2UKDA 3NC0C 3WXMA 1G4UR 1PUJA 4Q7KA 1S8FA 1YZLA 2C8VA 3REFA 4CT4B 4TYNA 3AVWA 2NGRA 1PZNA 1JBKA 3ADKA 5TV2A 4NL4H 2H8KA 5CM8B 3TLXA 1GL7A 1OH8A 1Q1ZA 2GESA 3U3OA 3Q3JB 3AP1A 4HB0A 3VX4A 1SXJB 2ZYWX 2YV5A 2RGNC 3BH6A 5JHHB 1Z6GA 2HLDA 3PEWA 4YONB 2OUKA 2BOVA 1XCMA 2C2HA
chains in the Genus database with same CATH superfamily
4CTNA 4PG5A 4RHEA 1M2KA 4TTTS 2GXQA 1RXEA 1RXCA 3WV4A 2UXCB 3IJ5A 3GAZA 4KHPB 3UYKA 4BCDA 3B2NA 1Y6FA 3UKJA 3HVHA 4GPEA 4N82A 2DHCA 5SICE 3IIIA 3OIYA 4ZT6A 2Y68A 2I78A 4A8JC 3BMOA 3GG9A 1PZMA 2GCNA 4XVRA 4F2PA 1PNTA 3HWSA 1JXMA 1SKAA 2J0UB 3MLBA 5CM2Z 2OYCA 3SC2B 4U6QA 1T15A 3ZK9A 2FMIA 1RBYA 3ZBTA 1EWRA 5BSFA 4S1PA 2AI3A 1Q77A 2QN2A 3I2GA 1NW3A 3QFFA 2AOTA 1N25A 4KRXA 1JLLB 3EUAA 3TQSA 4PN3A 4E14A 2JGRA 2XNDA 2GEBA 3L8MA 4DJ5X 3TZQA 2Q1SA 4ENSA 3BRWD 4GAEA 2CEAA 3KHUA 1RXYA 1G20B 1VE3A 1FK8A 2FSHA 2X7JA 2ZSFA 3D02A 3HB9A 3N8DA 4X1IA 4RTQA 2F8MA 1SQ5A 5BV7A 4URWR 3RS5A 4GLOA 4B6GA 1GRNA 2VNJA 1YR2A 2DBVO 2VIIA 4HB3A 4RHTA 5I8PA 1DWQA 4RCZA 1Z68A 4YRCA 3FYSA 2QX7A 3KFXA 2E4ZA 3M81A 1CP3A 1HTBA 3EXIA 1OFHA 1GGKA 5I9LA 4AUMA 4MKRA 3JVUA 4MUYA 5EINA 4F2HA 3ESZA 5AIBA 2V7TA 3F2IA 4JLPA 1ZC4A 2HLDD 2IVFA 1NVTA 3HB7A 3L1KA 4D9KA 5BUCA 3U7RA 3UCEA 4P8RA 3RC3A 4LOIA 1NOJA 3QLVA 4WBSA 1PWZA 3ZYCA 2EP8A 3D0QA 3ZWYA 2WUWE 1FVFA 3K0EA 3UHAA 3ZW9A 5ELXA 1YJBA 3OTHA 1OH7A 1SCJA 2BTQB 2HQOA 4UMEA 2VBFA 4ILKA 1W35A 2EKLA 4G86A 1Z6TA 2I3AA 3QUTA 1K97A 2R8XA 5JDIA 3JWHA 3Q1LA 1HORA 3WBJA 4HUTA 4C2AA 3FMOB 2QUBA 1FYXA 5HRCA 1G4AE 3ZQ6A 4JFRA 3QW4B 4PE5B 4UDXX 3T1TA 1C7RA 4PRLA 3DWGA 3GJXC 2VS1A 1WW3A 3FNBA 5H4HA 3KQQA 4FMPA 3V4RA 3MWYW 1DPFA 2IKSA 4GLBA 3V4LA 1T8YA 2CNLA 1RWBA 1Y5IA 4PSUA 5G1OA 1FW6A 3CPJB 4LF9B 2QD3A 4MUGA 1BHQ1 3GJ0A 4Q7QA 5A5DA 2GHRA 1HR0B 3KELA 1MU0A 3QKWA 4MLCA 4E7PA 1Y89A 5FO0A 1W9MA 5ALTA 4IF4A 7YASA 1N6PA 3N2EA 4C0BA 3AU9A 2GM4A 2VRNA 2FW0A 3L93A 5L3RA 2E5LB 4YX9A 2YWRA 3KLOA 4BYGA 4ZPXA 1H8HD 5DHAA 1ST3A 3DDOA 2XA1A 4RVHA 5GWXA 4YQZA 5JAPA 2OGTA 3PC2A 3FZYA 2ZIWB 1YZYA 4ZV7A 3UOWA 4CKWB 3KLPX 3OJWA 1X77A 2RGCA 5A02A 4LJAA 1DAKA 4V1CI 1QGUA 3I58A 3LT1A 4RXMA 2BCGY 4XEHA 5B4VA 3QNWA 3D4NA 3PJFA 1W2GA 4M1WA 1Y48E 3OU2A 2NSHA 1ILEA 4GPTA 3QFRA 1XI2A 4GOOD 5HGXA 2YWBA 4QU8A 1ZISA 4LYGA 3C3BA 4M38A 1MOZA 3GY0A 3OT1A 5CDHA 3BWXA 4R2WA 2NXNA 3A2NA 3W78A 2JDID 1NU6A 3ASVA 3BVPA 2P5TB 5JYCA 3EGCA 4MQ5A 3U7HB 2J3JA 5IC5A 3OHPA 1T34A 3EOZA 4QHTA 1NW4A 4GM1A 1XZJA 4MB2A 1T3SA 1GL6A 2V98A 1BVYF 2ZQZA 4UBOA 4ZVRA 4HT3B 1SUWA 1UANA 2QM0A 4HNTA 1SHJA 4PFQA 3WGKA 3O4HA 2W6NA 4B76A 4OI0A 2GSWA 4UHEA 4WQMA 5J9FA 3MJHA 2YXNA 1DDIA 1YBAA 3T34A 3QLTA 5J4HA 4MRVA 5LLSA 4A15A 4TKMA 3JAKA 3DLTA 5ICSA 4WKPA 3NHPA 1YL7A 2UYCA 1HT2E 1DINA 3DAPA 4GPBA 4LWZA 1FTNA 3E84A 1T4DA 4ND5A 2EKZA 2OO7A 4R8RA 1AIPA 1J8FA 1HGXA 1TKAA 1RAFA 4KNVA 4HNVA 1G38A 1M66A 2EJWA 1XAJA 2YV1A 1EFUA 5A03A 3QVKA 3HTXA 4RVGA 3CH5A 3SZLA 2CSXA 4YNBA 2YN2A 3BWVA 1XROA 3L6EA 3CH4B 1L8LA 2ZRPA 5KKNB 5IS2A 3LPDA 4C2TA 2XADA 1XEWY 4KK3A 3M6IA 5IP5A 4CMIA 5JMWA 3NXKA 3H65A 4FK8A 4YRGA 4GPD1 2YZGA 3K8YA 4LXQA 1WAMA 2W42A 2OBXA 2AKAB 4BRSA 1ZOLA 3RYHA 3JQ8A 6CHYA 2Z98A 3ENVA 4FYYA 4M6WB 3VTKA 3U1BA 3BFKA 3D0RA 3WWOA 1T24A 4MRAA 3RSGA 3FUWA 4JVSB 1RRMA 1Z13A 4L6CA 4WVFA 5EAIA 4ARZB 2QD2A 4BLPA 4I4TA 3A1SA 3ZHTA 4FR0A 3SU8A 2A9QA 2FX5A 1MTZA 2XUHA 3OWHA 4FXPA 2JHPA 1E5DA 1OX4B 3AQ4A 3R0XA 4Z7JA 4B45A 1QU2A 5A3VA 2O2XA 3PP8A 3CC8A 5BUQA 4GP7A 5ESWA 5A4DA 3H87A 3WWYA 3OA0A 4PRZA 4F72A 2DFPA 2MSDB 1IAQA 1NXWA 1RPNA 5EUCA 1QRAA 3EIHA 1W52X 5ENZA 5LZ8A 5AKIA 4BFZA 3LUPA 4ZYWA 3WMGA 2VJPA 1JMKC 3L4KA 1T9KA 3CPHA 4OJMX 4DQVA 2WWHA 2OG1A 2D00A 4EO7A 3OQMA 2ZUUA 1SOMA 2AD1A 2UZ3A 3SC6A 1SVOA 2XB8A 2IXDA 4GMGA 2C4WA 4LNUB 4RA9A 3O84A 1KTVA 5A4MS 2FHSA 3WDMA 2NYUA 2FFRA 4F56A 5FUVA 2OFFA 4AI6A 1XU4A 3GEEA 4P3XA 4HADA 1Z47A 4JBNA 2R0QC 4MKIA 1PEDA 5DTQA 1AURA 3ZEAA 4UAJA 4CF3A 5KCZA 3GFGA 4LQLA 2R751 2XWBF 4QSHA 3AIOA 3BHMA 1TVKA 4BFCA 5M34A 2KLBA 3UATA 4ZV4A 4QTTB 2Q6KA 1XB2A 2PV0A 1KORA 1XVIA 3EXHC 2GJAA 3QXJA 2JLXA 5A0TA 1JIJA 4TT3A 2GF9A 2QYOA 3BIWA 2VO1A 4CEIA 2OBFA 2I6FA 5EZ5A 3ILSA 3S2FA 3FWPA 5DYGA 4TWIA 4D3XA 2GPYA 5H5JA 5F52A 4G9GA 2QVCA 5AOVA 4Q9AA 1XWFA 1UPBA 2I9KA 3JWEA 5KAPA 4RC9A 5SY4A 4CR6A 4PGAA 4CZ2A 4YCCA 1ID8A 4RLHA 4YWJA 4CR8A 3S81A 1H5UA 4AFNA 3PFNA 3ZDZB 1ZIPA 4KNYA 2O2YA 1Z4MA 3QY9A 3USES 1PW5A 1UQRA 1YJCA 3DPIA 2X0DA 5JO9A 4LGCA 1V16B 5KNDD 5KJCA 1VECA 5HIAA 2JAHA 2GASA 5TPZD 2XYVA 1EI9A 3C3CA 4GX5A 4FCWA 5GOTA 4NABA 3TZKA 2UZ1A 1GTJ1 3QIAA 2WIAA 3IP5A 4YREA 3QBJA 1ADJA 2O2SA 3DF7A 3SLGA 3U80A 4EGCB 4CM6A 1JR6A 1ORWA 1PT7A 2QNBA 4B6FA 1KO7A 1TGVA 1UDCA 2OY0A 2EQBA 3BXHA 4U9HS 5HF9A 2CNBA 3RRFA 1B0AA 2V6MA 1Q0TA 1JNXX 1GN9A 1UBLS 3ZG6A 3HYLA 1ZHOA 2XGSA 3SYKA 1ZI6A 4LY9A 3CUKA 1OJLA 1RDFA 4QOEA 5BMVF 3NI2A 5DBFA 2QP3A 3YASA 2HY7A 2P9BA 4TS9A 2JVJA 3DDUA 5KX5F 3ELUA 5JZ9A 5DGXA 4JBYA 2J46A 4QUHA 1JBEA 2IU4A 3NHJA 2C3MA 5DYWA 2MIIA 1J8QA 1N92A 1PHPA 1M2OA 4PX5A 1P4AA 4MICA 3U09A 2O6LA 2P8SA 2BRUC 2B5VA 4QHYA 4UJ5A 1T1IA 2ZRKA 1B15A 3V2UA 5BVHB 1Q2UA 2PAFA 3HO1A 4EABA 2NTJA 5D86A 1XMXA 3BJZA 3KALA 1OFUA 1ZW6A 1O9GA 2EC5A 1RLOA 3C2QA 3HXOA 3DKKA 3F67A 3KPUA 1YQWA 4M9SA 2DU8A 4M3NA 4LSZA 1GYPA 1N4AA 4HH3C 2BC9A 1FP2A 3FYUC 3MEQA 5BPFA 4HTAA 3RS2A 2PR7A 4ARVA 1PNRA 5ALIA 3FZEA 1ZKDA 5EIEA 1V1JA 2YFQA 3EMKA 4QU5A 3IR5A 3AW9A 3ONVA 3DOEA 4LWOA 1CIVA 2VHJA 2R5WA 1OLUB 2W6MA 4OH7A 5JZSA 4GM0A 4XDYA 3FKQA 2I7VA 1GAXA 1XC7A 2CXOA 2W83A 1P9OA 3CXRA 3GZJA 3JATA 5C7OO 2A5GA 2ODNA 2OUIA 2ZTVA 3HA5A 1GDHA 1L5VA 1ULAA 2EW2A 2I4LA 3PE6A 4NMXB 4WMLA 2H7XA 2PAAA 1N5KA 2PGOA 3I9NA 1SG0A 3WLJA 5CH8A 1EB8A 4RD2A 2X0FA 4ND6A 4RK4A 4DEXA 2VDWB 2B3TA 1FSPA 2X0JA 1JDBB 4AYWA 3FF1A 4ZI5A 2A6PA 1BQ3A 5IDYA 1JQ5A 3OX2A 3KPVA 3PTLA 2H1RA 4Q5IA 3MYYA 4P7KA 4XWGA 3PFCA 4FEEA 5SYMA 1OI7A 4DQLA 5A5GA 4BKOA 2D1TA 4QUDA 4JGBA 3I83A 3LECA 1DQNA 4I3FA 4R3UC 3ZJ4A 2IP2A 2ZW9A 3KD2A 1KI2A 2YHSA 1OZHA 3UAVA 1R0KA 1L7AA 3V1NA 3M6AA 2DFDA 2BCJQ 4I8DA 3CLUD 4A91A 1S2GA 3FI0A 5CURA 1THTA 4YT5A 5LPNA 1YAJA 1CHDA 3BB4A 4KIUA 4Y6LA 3TW8B 2WYUA 2J7PA 1G21E 3O8BA 2IUTA 4Z99A 1X15A 1GPAA 1E2EA 2HDNB 3TQIA 5KYYA 1QCCA 1M76A 3R41A 1DNPA 4EEKA 1ORVA 1RABA 2FDRA 3I9V1 3O8LA 1G2IA 4HJRA 4IDNA 4K9PA 4LYHA 4AJEA 4N0PA 3OX1A 1P0CA 4JZKA 3TMKA 3L8DA 1ECBA 4LTMA 3RTCA 2IXBA 5A1JA 1KO4A 2Z4TA 3NONA 3VZCA 4UNPA 1GPKA 2QP4A 4WSOA 3T9FA 2ZWAA 3A4MA 3N2IA 3L7NA 4J2OA 4FGSA 3DMRA 4BTEA 2XMRA 3SSNA 8MHTA 1Q74A 3O73A 4CI9A 1G41A 5LB4A 5CFZA 2BBOA 1TMGE 1UBGA 5H1YA 4A3SA 3A2LA 1ZM2A 4CIXA 4FW8A 3H04A 3S40A 2BHRA 1ENOA 4BO9A 3VDRA 4YLYA 1IOZA 2PWAA 4WY8A 1UMBB 4FILA 1FDSA 3X44A 1U2DA 3DXYA 3W5SA 3RREA 5IVPA 4PXYA 4Z7OB 2X86A 1YQUA 3GDGA 4O1IA 4I0WB 1KAOA 4KX5A 4KV9A 1NVMB 1SB8A 1XAIA 2ZAOA 3O8OB 4GU5A 2J5QA 1JMYA 4HAZA 5B58T 1X1DA 2GILA 3RK0A 3U0VA 1KEPA 4U7JA 4A26A 2KPOA 1PCXA 3K15A 2WT8A 2AFIA 3FPCA 1CIPA 3P4UA 3F8WA 3L3BA 4G1BA 1BE0A 2RHGB 2VYVA 4H7KA 4BZZA 5D6NA 3VISA 3TR6A 4X20B 1L5GB 3U62A 4K05A 3ADDA 3V1UA 1LZKA 2ATXA 2IHJA 2DPHA 4BMZA 1EFDN 1KYIA 2DUMA 1Y37A 2B4KA 2G7MC 3GJ3A 4GPZA 5JV5A 2QIOA 4HBGA 1ZSYA 1RADA 1UKZA 4BBJA 5IAAA 5BV1A 5I7OA 2ECOA 3DL7A 3EBLA 3ESRA 3EVAA 5EJEA 1UDXA 3L7MA 4JLNA 1KQPA 2EL9A 2XNHA 4AKSA 2PD6A 4UULA 4Q37A 4RFSA 3KIPA 4V2UA 5DF1A 1E2HA 2CXUA 4ZCPA 8OHMA 3ICQB 4MVJI 2NNWB 2J9FA 5FLKA 1X94A 2PH3A 4HRYA 1HFWA 1N5JA 1TJ5A 5AM4A 1L5QA 2C0CA 1Y5RA 2GPSA 1EK0A 3OE1A 2AQHA 3LDHA 1IBRA 3M1AA 1JHYA 4K2AA 4DKJA 5L8VA 1PVVA 4Z49A 5BVGB 5J4VA 5LLTA 2B4RO 3FVQA 5CA1A 1CUSA 3UFXA 1F1JA 1LVUA 4K6CA 2W4IA 1NW6A 1LW6E 1UH5A 3AF4A 3AM3A 3EGIA 3I1FA 4P81A 3WK5A 5GTDA 1VJRA 4LBYA 3VKVA 2AE2A 2YX1A 1RHQA 1Z36A 3QE3A 4H17A 3LFHA 3MGAA 1JDSA 1SZDA 1GZSA 3MMZA 5CVCA 3PKJA 2V4ZA 2QJFA 2XKBA 1DQRA 4R9VA 3AM4A 2UYYA 3UB4A 2X9VA 3ZVNA 5K8LA 5C46F 4UZEA 3TLCA 2YBEA 4C0XA 2PGIA 2IYUA 5HE8A 5AJYA 5A62A 4K9MA 2CJWA 5CBPB 4HUQB 5SZHB 1XLVA 4YO8A 1T9DA 3DXZA 3G7NA 4C1NA 2HT1A 4M36A 3WK8A 3H2BA 1BTOA 1NF8A 3Q5EA 1GZ7A 4J16A 5M2QA 5FTLA 4TVSA 3FYDA 5JXIA 2IYVA 3GVCA 3V00A 3WLQA 1OYVA 1S6YA 3EFEA 2WKQA 2VSYA 2GFHA 3C4JA 3HC7A 1TA0A 1UM9A 3QKSA 4H0CA 5BNZA 4HEHA 3GLSA 3BREA 4XD7A 4BWFB 2GQ0A 1M34B 1NRJB 2NU7A 2Y99A 3SYRA 5BW4A 3QPCA 4DJJA 2F7SA 3FCUB 2GWHA 2PLAA 1FDRA 3K4HA 4RELA 5JMPA 3VPFA 1JDVA 1OZFA 1T8PA 2JVIA 4L6AA 4PYJA 2XY4A 1KARA 3DYIA 3IBFA 4R9UC 4OL0A 2OAP1 1G6KA 1QE5A 4NE9A 1NUPA 2Q27A 4AIIA 1NATA 1UZAA 3HB5X 1FMTA 1SQFA 1I4LD 2H51A 4IZ6A 4C3OB 3NDBB 2FY8A 4CMHA 1M6HA 3P20A 4R51A 5EWJB 4F6RB 4XYGA 1QWOA 4DW8A 4EP1A 2ZS9A 2ZJ1A 3OEED 1T2AA 3C4VA 4WXYB 4E21A 1BQ4A 2X2OA 4MRRA 4J1QA 5L4LA 4KU4A 4YJHB 1EU1A 1QDLB 2BF7A 2FPSA 3O1JC 2GJ8A 4IUCS 5CHEA 3ZJYA 4BUCA 4YXFA 4AUKA 4F6CA 1XU9A 4AWAA 5EHQA 3O4VA 2WPDD 4B5LA 2BFDB 2FEMA 2FOLA 1GFWA 3EZ7A 1U3VA 2YVQA 3E7XA 1M1YA 4HFRA 2J0EA 3CX8A 5PNTA 4WKNA 1RI5A 4DUPA 5KDOA 1RRVA 1T0PA 1W96A 1ZUIA 4QSMA 4R2JA 3TNLA 3V1KA 3VR2A 4CDNA 4KO3S 1Z5UA 1B0PA 3BZBA 4DCMA 1R8JA 4A0QA 3PXUA 1GHTA 1QYIA 4FBMA 1F0YA 2Q5LA 3TBKA 3UB3A 3EFOB 5F4BA 4BC0A 3CLTC 4U2EA 1U81A 1HG1A 2UZIR 5TGDA 2YVLA 3KS9A 4EVIA 2J32A 4D9FA 4LKOA 3NUZA 2Q45A 1IN5A 4TKVB 4DB4A 2WFZA 1RNLA 5HWSA 4P83A 1K8XB 1GV1A 3UJHA 5JH7B 4BVGA 3C8HA 3LF1A 5T4EA 2PJUA 1CBUA 4OGLA 2Q9CA 2BI4A 5CCDA 7ABPA 2HR1A 1E9BA 2CL5A 4PQEA 1FP4A 2GK4A 5U9CA 4QYMA 3GYGA 1WXGA 5CDGA 3TJRA 1IG3A 1BEZA 2FUCA 3OTWA 1PBTA 2AW5A 2E4VA 1VE1A 4BVHA 3ASZA 4B32A 1AO0A 3ZWBA 3G0HA 1P60A 4PYRA 1N2HA 3RAJA 2FEXA 3H11A 4MPDA 3B1JA 3FE2A 4KFCA 4PO9A 1N78A 4FWIB 3EUWA 1CQZA 3IKJA 3DZDA 1ICIA 4RD1A 1K7SN 3IMKA 2EFGA 4MS3A 1E9EA 3U7EB 1L5OA 3RK1A 5JR3A 1WA5A 2E5WA 3RSHA 2CDNA 2JAQA 2G8LA 3M4ZA 3BXEA 4J9UE 2GN1A 4MQLA 1CYEA 1XBTA 1ZJ4A 4AJKA 3DO6A 4ROTA 1VL2A 2ZSHA 3DOFA 3Q0TA 3BL8A 4F11A 4HAOA 7MDHA 1AA6A 1Y7TA 1YRLA 1EBFA 2ZRNA 3HGMA 3KKOA 2GN6A 4GQIA 1CS0A 1HLDA 1L0BA 2AW3A 3UT0A 2VDQB 1QC5A 3R0JA 2G9ZA 1SIOA 2JCBA 2PJZA 3LWDA 3P0IA 4EPWA 4ARSA 4UPEA 3W9BA 4DM3A 1E3IA 1I3KA 4HPJB 1JHVA 1TTHA 4IM7A 4ESHA 1VSBA 3CNOA 1R0WA 2IBSA 1J0EA 1HKHA 3K32A 3JRWA 4TWAA 2AG1A 2BRUA 2OHIA 1ELOA 3NBFA 4FQ8A 4BY9E 3N58A 4OB7A 3U49A 1WSDA 1N9KA 4JT4A 3DEZA 3TQQA 2XPCA 1QLHA 2XTAA 3O4JA 2GH1A 2QTNA 3LAWA 1LPOA 1HWYA 2RH5A 2H7YA 2VQDA 5FR2A 3I3SR 5KHLB 4AULA 3BSSA 1X8JA 5ALRA 4B75A 2PUFA 4B8WA 4PYNA 1I1HA 3CX4A 1LFAA 4LNHA 4B3SB 5K4GA 5KWEA 2V3CC 3SHOA 1Z56C 3CLVA 4TGLA 2GZAA 2P9JA 3EZGA 1DE0A 2R79A 4EUKA 4X6LA 1IC6A 2FH5B 2J08A 3LX5A 3HJHA 5C5CA 5C5EA 5LP6F 3QJGA 3G7UA 2ALJA 3I09A 3M0EA 4JB2A 2DPYA 4O4JB 3QVUA 1KK1A 5F2EA 1PL8A 4IJ6A 1XYGA 3TDMA 5ALJA 3CX3A 5I7WA 2IQIA 1Y1SA 3LHIA 1L5KA 3CZ9A 3OKFA 2YXPX 4L50A 1XTJA 3FWHA 3Q3EA 4UBIA 2P5YA 4DWWA 1XO1A 1TW3A 5CIQA 4C0KA 2OBNA 3EFHA 1EK1A 1DKLA 3NAGA 3SJCA 3GJ5A 1JU4A 3AERB 3ETLA 3T7RA 1QGED 1VLMA 5L7TA 3CB2A 2VL7A 1FBTA 5AJVB 5TB5A 1WSBA 3EIWA 3W9SA 4P0PB 4BP3A 2D0OB 3L1VA 1AOXA 5DVZA 3TKYA 2ES4A 1GSIA 1WKBA 4HSEA 4NV1A 3B9PA 3OTQA 4ES6A 1YZHA 2K5UA 4M7RA 3CR7A 1W5BA 4A5OA 1X9GA 4EARA 2ZE7A 4KQMA 4IR7A 3E27A 2ZAGA 4RKFA 3ODPA 5K8VA 4QUJA 3CRMA 4GZ3A 2B69A 3C97A 3WISA 1AS0A 1WB9A 1E8MA 1XLTC 4NU8X 4FCTA 3LPLA 1EDEA 3OU6A 4LW8A 2OKCA 3NVDA 1FF9A 4PXAA 4XWAA 1MAUA 2R6JA 2C2WA 2ASEA 3GR6A 1UEJA 1JUDA 2J3DA 3CKYA 4X93A 3URMA 4TLDA 2FW9A 2WQ6A 1GUDA 1SCQA 2WTMA 4LRSB 3F73A 1Q7TA 1C4KA 4H6PA 1E3TA 1FPMA 4PBRA 3QVGB 2PZEA 4Z7NB 1FFEA 1YB6A 4LRYA 5GVRA 1NLFA 5JPDA 4IVQA 2FZVA 3L8EA 3RVQA 5BUZA 3TYXA 4IIJA 1FYDA 5FBQB 1ZD1A 2BUCA 1BFUA 1XZEA 3E03A 1RCUA 3EAQA 2RGXA 2QKYA 3R3VA 4O1HA 3LKDA 1E2UA 2BDUA 1SOVA 4N4AA 1Q5PA 3G5MA 3LW8A 5DLDA 5AW2A 1O96A 1QRRA 1E1DA 3QU9A 3AVVA 2MSEB 1XDSA 2RHBA 1U98A 3ZWQA 5J40A 3A0UA 2PLNA 4AS3A 2JG3A 3Q9SA 3O26A 1YR6A 2G5TA 3DE4X 3CZCA 5BN5B 4R83A 1XDDA 4PX2A 4YV7A 4CQMB 4XWWA 3Q8MA 3DTVD 4OREX 4FSHA 4H1WA 2BFPA 1E3JA 4O4IF 3DDHA 4EPYA 5I48A 4P2GA 3W2TA 3UAZA 2WB2A 2TYSB 4P3PA 3NORA 4DR4B 3X0DA 1UFOA 2VA9A 4U5QA 4N41A 4NCHA 2YASA 1LLDA 3U3DA 4OQPA 2C61A 2PLRA 3K4QA 1E0DA 4P54A 5FA5A 1G8SA 1HQKA 4PC2A 4CG3A 4EY6A 3HLYA 2FMUA 5AHOA 5DLYA 2E48A 1Z3IX 1UBUS 3N3AC 2JIQA 8ABPA 1E4OA 1AK1A 1ZH4A 2O06A 3EEYA 3HPRA 4ZN6A 3ZLBA 3T94A 5CLJA 2Z04A 2BH2A 1T29A 3OZTA 3TAHA 1ENPA 3IXMA 3UQZA 1AKNA 3VU3A 1PJ8A 4CM3A 5DNCA 1KYQA 3OP4A 3MT8A 3SQNA 3GLQA 1Y5LA 1UFVA 2CHEA 4GLJA 3TRDA 1FFXA 1KK2A 2P67A 5J43A 4KB5A 5J5CA 4UUNA 4KWIA 4F2GA 1XRJA 5BR4A 2OZLB 3VVMA 4IXNA 2VLBA 1Z2DA 1K5DA 3NM5A 4B44A 3CPEA 4KSBA 2QRQA 1VPEA 1COWA 2H7CA 3CCFA 5EXXA 3OLCX 2SKEA 5AVOA 2AVDA 1B3RA 1ZH8A 5HW0A 1K0UA 4EK9A 3KYIB 1SBCA 2FFQA 5FBLB 3STVA 1GNVA 2VPQA 3WMXA 4Z9FA 5G0TA 4JSRA 5CDUA 1E79D 2ZRLA 3WIEA 1PIWA 1W4AA 1R0LA 3OLVA 3PRJA 4X00A 5CPBA 3ZZ1A 5CAEB 5KYWB 3L4JA 2CXSA 3ZJ5A 1E9VA 4LIPD 1V0JA 4CV0A 2A86A 4XQEA 4HV4A 1Z6ZA 1XPUA 2G25A 4EUFA 3ZS8A 1P39A 1T25A 5DIZA 3ACDA 1VBNA 5G4KA 3OQ1A 4JXKA 1WW2A 3I28A 2CKMA 3ZGOA 2G0AA 5JAMA 4MJLA 3LO8A 3G8CA 1OWLA 5F7XA 4DJEC 5CA0F 5FLXA 1XP8A 3IYLW 3LT5A 2CL6X 2CHUA 3CJRA 4KSYA 4MR7B 3IPLA 4XPIB 1N9GA 3R7SA 1GUYA 3UV3A 3W8FA 5A06A 4OMCA 2INGX 3K9CA 1LS1A 1OC4A 2YUIA 4X71A 4S24A 1PNQA 1CVRA 5JZOA 2XCOA 4QATA 3RRZA 1VRCA 1EM6A 1QYVA 1F3LA 1KA9H 2C88A 4BDSA 3A27A 1DIGA 4GECA 3JD4A 4PHTA 1WZIA 1Z08A 2WFMA 4G5HA 4OK6A 5IJWA 3BICA 2P9TA 3NOOA 1IN8A 1O4VA 2AXNA 1YNSA 2MT9A 5GONA 5LP1A 4DMLA 1J06A 3RSFA 5KIAA 3PC4A 1Z33A 4C7JA 2YJTD 4HSGA 3PLNA 5KYKA 1GVNB 5C8YF 4ZOAA 4P36A 1L7OA 1M2WA 1SUEA 2PQMA 4V2IA 2ZI4A 3P9ZA 4N54A 3DT6A 1C30A 1WBDA 3HJFA 4GP6A 4NXNB 4ZVTA 4AXXA 4N6NA 4Q3CA 1BVRA 1RYZA 3T7TA 3W2IA 3T5MA 1SC4A 3REQA 2G5GX 4IKEA 4RA6A 3FYTA 2WIKA 4M9RA 3RIEA 1CK4A 4LJKA 3SC4A 4F06A 2CDCA 4L4XA 1RZRA 1LX6A 3R3UA 2H6EA 2DGDA 2ZRDA 3UO8B 1P6QA 4D9NA 3ZVKA 4JI1B 1NJ5A 2C3OA 3QKTA 3V2GA 4WKBA 5F2NA 1T9CA 4NIMA 3NWOA 3SVLA 2GPWA 2PUJA 2UYGA 3M70A 1KO1A 4L2IA 4GRIA 3T3GA 1AKTA 3IOYA 3QVMA 3DUFB 4TTJA 2O0JA 1TIPA 2A0KA 3LTEA 2JFOA 1JEQB 2VTDA 2BFAA 3DMHA 2Y1CA 3KQKA 3KB6A 3KWFA 3LRPA 4XQ0A 4LJ9A 4DMCA 1DC6A 2WWVD 2HQRA 2P79A 4MUHA 3EYWA 1CR1A 1R6AA 4FFSA 3A6KA 3VKGA 4NCJA 4DA4A 1JKXA 3ZY3A 1K3FA 1U9JA 4RGQA 3TCKA 4ESVA 4MV7A 5JAHA 1NIJA 2VPIA 3P0JA 4A4DA 5AUPB 4AP9A 2NU6B 3OETA 4LZJA 1H69A 2OBYA 2WKWA 4ZYUA 3KOUA 3UMMA 1W6UA 3EDCA 3LIIA 3OJXA 4O3FA 3L7JA 5SY9A 3ILVA 3PGXA 1PNVA 4IWYA 1XZNA 4QGHA 5KVCA 4O4HA 1NBMA 1G7RA 4UUBA 3B89A 5BSKA 4ETNA 2R2AA 3T0IA 2MOKA 3VSDA 4V39A 1XRRA 3D6AA 3FR8A 4I55B 3CE6A 2ZU6A 3D6MA 3J81A 2ZLBA 1VLQA 3ESYA 2XUPA 1YQ9A 3MUNA 5EXPA 4BWVA 2PWPA 3ADBA 1TYCA 2HJ9A 1DO0A 1EWKA 3RG2A 4B7UA 4LGVA 3MJRA 3OZFA 1K63A 4M46A 3HB1A 2G3YA 3L84A 1A4UA 3E3LA 5IEBA 5JFTA 1F5NA 4B3MB 3VR4A 3KLMX 4LDPA 4EBFA 5FCDA 3G1TA 4R84A 3HR8A 3QMPA 2XF8A 4MDHA 4X3CA 5JQGB 4TZ0A 2B99A 3FLBA 2Q6LA 4D6YA 3AX6A 3MINB 5K6RA 2HLPA 4B4UA 1GPUA 2P6OA 1XZAA 2Q6TA 1RBZA 3M5CA 1KK0A 2QVLA 1ETHA 2QB5A 4LXHA 4PG6A 3L77A 4IQ0A 1EFVA 5E4TA 1OI2A 1WW8A 1NF2A 2OAEA 4N65A 3ZIDA 1PF7E 4FTWA 5AVVA 2CXQA 3ENNA 3KPYA 3NFYA 1IJFA 3EEIA 3M33A 4UUMA 4PZPA 2F8LA 2WTBA 3FPHA 1D9XA 5A6SA 1JYFA 2Q3CA 1P5JA 4ZT2A 2G07A 4B6OA 2YYAA 1XRNA 3BG5A 2NUTB 4BJ1A 4DCNA 1F60A 4TRMA 5SYAA 5IT5A 2V54A 1PLLA 1Z7EA 4JOCA 4U5XA 3UW1A 2Q1XA 4AU1A 5KNCD 1I9CA 1NZDA 1RI2A 1MX5A 2ZS8A 3EMBA 4KBFA 4B48A 4AY5A 3QKRB 3P2OA 4HBZA 4IIHA 1K6JA 3I92A 1NXOA 3IT3A 2EBUA 5KTPA 3CLSC 4H1HA 3ROEA 3ZIAA 1VL1A 1U8AA 1E0KA 3AR3A 5F3RA 3RTAA 4DRXA 4XX0B 4DR2B 3L9XA 5BQPA 3VO2A 1NM5C 1O03A 4IYJA 5EJ8A 2MINB 4RV5A 5I4IA 3QXGA 3PDHA 5A2QA 3AFHA 1E92A 1QK4A 2J1LA 1SULA 4PSAA 4IIUA 4DNOA 3LDGA 3W7BA 2GNOA 2OK7A 2RGAA 1SXHA 3C3XA 2FZWA 1T3GA 1N5DA 3OHMA 2XGGA 1CRPA 4JI8B 3PYXA 5KC9A 4Q16A 4EJSC 4NHEA 3JWGA 4WNAA 2HA2A 2XXJA 1Y9EA 1TC1A 2D8MA 4P9NA 1CPYA 4C0AC 1G6OA 1A7UA 1P4RA 3H5OA 2IYEA 4FXOA 3WYDA 5KJFA 2Y0BA 2IX9A 2X8BA 4DPMA 5GPBA 1FFYA 1XFDA 5ECWA 5J58A 4IF6A 2RGBA 2BHNA 3LVFO 1M10A 3D8RA 5KPJA 2P1DA 1T2NA 4QD3A 1C0PA 1TAGA 2JIZD 4KEAA 5CRIA 2O9JA 2ZAMA 2GLXA 3K0AA 4KLRA 4P38A 3SZGA 1ZC3A 1Q7GA 2C9BA 1NJGA 3E22A 2D2FA 3HUUA 3JYHA 3M1IA 3N87A 4JBXA 1GQOA 4Z3KA 5CD1A 1YUBA 3EPHA 3EGXB 1XLTA 4D79A 4D9IA 2EDCA 1ZRHA 1GGHA 3BULA 1G18A 2GS9A 2VA8A 3LQ4A 4NZ9A 4UFNA 1R2QA 2C84A 3VNVA 1I4OA 2JLUA 1YKFA 1H22A 4BNFA 1PU2A 1Q0HA 1JEAA 2IF0A 3FNFA 4TTRA 4JOSA 3RS0A 1E5XA 1JVBA 2EX4A 1VGQA 3AESB 3HKDA 4FCVA 4QDJA 1EIZA 3TLJA 3TVYA 3A3NA 4ZZIA 4HLQB 3U7IA 3UT5A 5TS3A 4R6XA 1P3DA 1FLAA 2WM9B 5H68A 2FN9A 4LOHA 1WUJS 5ED0A 4BFTA 1M33A 1QBGA 3I5MA 3Q1KA 2VWQA 3AF5A 2FSVA 3WYFA 1H0RA 1WU8A 1GKIA 3RI3A 1TTPB 3C3JA 4DXDA 1KEEA 3BSWA 4AL4A 3UW3A 1O08A 4FHZA 1P0MA 3FX2A 4OLAA 5BO5A 1FXWA 4MWCA 1RP7A 3ZZNA 5HKKD 1YBFA 4DLWA 2PZLA 4JC5A 2FLWA 4JU8A 4ADSG 2CVQA 4FFLA 3QVSA 1D0SA 3BXFA 4C4TA 3LKBA 1YJAA 3ICPA 2OHVA 2H5LA 4HP8A 4LMPA 2XUGA 3MWKA 3VSEA 2V1UA 4YQYA 5FI0B 4ENVA 4JI4B 4ML3A 4R71A 3OZVA 1OXTA 4TTIA 2P65A 4RHCA 3SEZA 2GM9A 1TKBA 3ZI7A 2VRBA 5I8WA 3W5AA 3OOYA 4FX2A 4KACA 4KI0A 1J90A 2BKVA 1T36B 1ONBA 2BEWB 2NZXA 2GYWA 4TTAA 1DU4A 1QH8B 2WWTA 3HVIA 2SECE 3OUTA 4JB8A 4UZSA 3P0HA 1XVUA 2WWGA 3KE9A 4FYPA 1XTVA 2VJMA 4R40A 2PMCA 3X1YA 4DIOA 4TMKA 3DM9B 1X9HA 3UK0A 2NV6A 3VC1A 1ZUNA 1EGQA 3FHOA 2ODTX 4QEKA 5JBIA 2PPLA 1URPA 2Q3LA 4I9HA 4UVEA 3RFUA 3SZRA 3OPYA 3JAWA 4RTMA 4ZRNA 4L5BA 2P2LA 3V6MA 1QF6A 2WMYA 3ANTA 1KGDA 1GPLA 2WINI 3R23A 1FUEA 4XB6B 3FNEA 4P1ZA 5JSYA 3VR1A 4B7CA 1VIMA 2J30A 4CQJA 1E7SA 4UW9A 1JHOA 4S1WA 3SJBA 1UOPA 1SBZA 3KE8A 4QTZA 2Q3JA 4PYQA 4NE2A 1JJVA 2VSOA 4EH1A 2O8FA 1FJ2A 4KQWA 1D1SA 3NT4A 1SK9A 1UJ2A 2ISQA 3MC1A 1JJAA 3JW8A 5CDTA 3N28A 4XDZA 4BNKA 2K7ZA 4YT8A 4K9KA 3ZWMA 4Q9LA 3AXTA 3REGA 4QULA 2BGRA 1ML3A 3KQMA 2ATCA 3GLHA 4JUAA 5FFMA 3WAJA 2ZSKA 3ANXA 4M1SA 4QEDA 4ZQGA 1J7JA 1KZYC 3DZFA 3WTCA 5K0GA 2J6HA 1PJ3A 4GVLA 4GMKA 3FJYA 4MYCA 5H8WA 4ZMSA 2NUAB 3QUAA 1Y3CE 3QVWA 4J0CA 2JAOA 5CYOA 3HR7A 2Z56A 3K09C 1MQ8B 2C5GA 4ZYYA 1AHIA 1YZVA 3TFOA 3S1AB 5IBCA 1U6KA 3C4QA 3OCVA 4G5QA 4LK2A 1TU4A 1WMSA 2OV2A 5AVQA 1C0EA 1PS0A 1V8BA 2ADFA 2JCGA 4WZZA 3LQ2A 5K51A 4Y1FA 4DANA 1QIGA 2AF4C 2V7UA 3WZLA 4DQDA 5FT9A 2CJFA 4BQSA 3BXOA 3C8ZA 1IIRA 4WN3A 5BQ3A 2VC2B 4W5OA 2ZB4A 3PNVA 4YMIA 3JQ6A 3DOCA 4LC0A 1M1NB 2JZOA 4EAQA 3WGNA 5JY6A 3IQXA 4I7EA 3T3NA 4F96A 3RS9A 5FR1A 1SOUA 2Z2KA 1J42A 3PNMA 3GWZA 4RHXA 1WUIS 2GLTA 2V9CA 2H85A 1W7AA 2XCRB 3EIEA 4DT1A 4TZKA