5J5CA

Crystal structure of arl1-gtp and dcb domain of big1 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
EMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGLTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for targeting BIG1 to Golgi apparatus through interaction of its DCB domain with Arl1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 1
total genus 52
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2016-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5j5cA00
2OG2A 2XJ9A 1Y63A 3SOPA 4H1UA 2CDNA 1N5LA 4PC3A 5J4KA 1YU9A 2CEAA 4A15A 2QBYA 2O8DB 4LUCA 3CWQA 3PUVA 1XD9A 2QSYA 3GEEA 2XSZA 2Q9CA 4I1VA 1GRRA 3AVPA 1KSJA 4WW0A 4BECA 3CNOA 2ZE6A 4KYIB 2VP5A 4HATA 4TLAA 2PT5A 4WZBE 2NPIA 2ORWA 1ZM4A 4LX0A 4C0LA 3I32A 2MMCA 1VCIA 2QAGC 4CDGA 4FWIB 2RGNC 4LBVA 2JLVA 5JEEA 1ZNWA 5GJWC 3SE0A 1XEFA 1XXHE 1TADA 3T34A 1ZCBA 3THXB 1NG9A 3K0SA 2QMHA 4CF7A 1X3SA 1Z8FA 1XCPA 2X2FA 3L0IB 3K0CA 5L3QA 4X8MA 5DE3A 2BCJQ 3QKRA 1IXSB 2BMFA 1JPNA 3AVOA 1UKYA 5FBRB 4IOLA 2GXQA 4Q66C 2YOGA 2CHGA 2JLUA 3ETLA 1LB1B 1F2TB 3QKUA 3UKDA 5KHOC 3E1SA 3T1QA 4PPQA 3W5JA 4QNRA 1RIFA 1T4GA 3CRW1 2EW1A 5JI3E 2QMEA 2GETA 5M04A 4UJ3A 5LBIA 4PO1A 2MMGA 5FUYA 2W83A 3VHXA 1G19A 3TUJC 4JSYA 4LCBA 4MYTA 3AB3A 3NG1A 3BOSA 1AZTA 2UZIR 4TMKA 5JZVA 3I92A 5E7IA 1YZTA 4G5SA 1VYTA 4IOJA 3CRQA 3FKSA 3ICQB 2N42A 1NMXA 1SQ5A 2KWIA 1DAEA 1KO7A 2G0TA 2F3RA 1MV5A 4IXMA 3RSOA 2F1HA 5BN3A 2A9KA 5GJBA 3BB3A 3D6TB 4C3ZA 1Z6TA 1ELOA 1MO6A 1H8HD 1YR8A 4Q1AA 2IXEA 1OXTA 3K09A 3OIWA 1KKMA 4R9UC 1XWIA 3TAHA 2D4HA 1Q44A 2LCFA 1OV4A 4IVRA 1KI1A 5B64A 2HUPA 4TLDA 1KY2A 2WBLC 3R7WB 4L16A 2GESA 2Q3HA 1DG3A 4MKIA 3ZH9B 4XIGS 2N46A 5JWHA 2ZROA 2F1IA 2W58A 4BWYA 3EIEA 3AM1A 3W5IA 4ZO4A 1KJYA 3AF3A 1ZC3A 2BMJA 5FTLA 1GNRA 4O25A 1W47A 3AP2A 4QOSA 3W8NA 3SJZA 4RFSB 4A0FA 2O8FB 2Q21A 4IDNA 1IBRA 4HZUB 4PO8A 3IPYA 4QBFA 3GQBA 3EIQA 4MRSA 2R6FA 3CX7A 1W4CA 2P65A 2ZYUX 1K8RA 1XZPA 2YNMA 3HU3A 1KYIA 2D06A 3HDTA 3X1YA 1XD8A 2VSXA 1ZD8A 2BHRA 1L8QA 4US2R 3NWJA 1AGRA 1E6CA 2JJ2A 2XNDA 5LPNA 4V03A 3H4MA 3WMFA 4PTLA 5LB2A 2FSGA 4EFMA 2YHSA 1NI3A 4UJ5A 1HE8B 2B6HA 1VKJA 3ZJYA 1AN0A 3N2IA 4CEJB 3OIVA 3B9QA 3WYFA 2C98A 1H8ED 2FE4A 3U3RA 4DCTA 1YZGA 1E2JA 2IYVA 3BFXA 4KV9A 4CRWB 2RHMA 4PAOA 3IEVA 2NO1A 4FINA 2IXFA 3KL4A 5EXTA 2MSEB 5HCNA 1QHGA 4E22A 2GCOB 1UJ2A 2HXSA 3R7WA 5L3VA 1G8FA 3GJ3A 4B43A 3ASYA 2D62A 1G4UR 3VX4A 1FP7A 4M9ZA 4B75A 4OL0A 1UKVY 1VG0B 5G3ZA 1GVNB 2HLDA 1UKEA 2BVNA 1IY1A 4LBZA 5B2ZA 1G3QA 1JB1A 3OF5A 1E79D 2FX3A 3T1TA 1JXMA 4RFSA 3KX2A 1W1WA 1XRJA 1P9NA 4QJ5A 3PV0A 1RW4A 2O0KA 3OIYA 4UKDA 2ZANA 3UMFA 5KSZA 1TU4A 1VG1A 2OM2A 1AKEA 1U99A 1N6OA 4QL3A 1JPJA 3OAAD 3TKLA 3C5HA 1KI6A 1QVRA 2XITA 2ATXA 3PEVA 5CB6A 1RPZA 5DGXA 2CJWB 3VX3A 4IFEA 4MITA 3C41J 1O3YA 1ANKA 4HB3A 1NMYA 5GJVC 2ZS8A 4L9WA 4Q47A 2ODBA 1W46A 2CHQA 2CL7X 2PL3A 1HE1C 3RLFA 2AWOA 5G53C 3DHWC 3TLXA 4XWOA 1R5BA 2ZSEA 2WKQA 2ZAMA 4IDQA 4JBYA 3GJ4A 2QTVB 2RMKA 3HWSA 3RS2A 3AVWA 1KMQA 2C99A 4PO9A 3JVUA 2FPKA 5FUXA 1PUJA 5BN5A 3RDPA 1G17A 2QL6A 5FPYA 5IK2D 1P2VA 2VP2A 4Q1BA 2F7SA 2V55B 4OHWA 2XAUA 1EWQA 5FOSA 5KPDA 3MGCA 4RVCA 2YOHA 1P9RA 4O2RA 2I1VB 5JHGB 1YJ5A 5GVSA 4LSGA 3W8RA 3WNBA 4ARZB 5KOYA 1VHTA 3EA5A 3PEUA 4TL7A 4U5XA 5JSZA 2FG5A 3KQKA 3U7FB 1WCV1 4OK6A 1TQ2A 4JBXA 4DT1A 1HQCA 1US8B 4KXFB 5IDVA 1DARA 4U7DA 2VHTA 1OXXK 4LYFA 4NYIQ 4QRHA 3UANA 3RC3A 3LQRA 1NVVQ 3CF0A 3TNFA 3I5XA 2X2EA 3R9XA 3AGPA 1GL7A 3L8YA 3MRSA 4N0EA 4A8JA 4BLRA 5TDHA 3CX6A 2O8DA 3GMTA 1NMZA 1N0UA 4Q9HA 4DCSA 1OPXA 2VPPA 4TN1A 1JI0A 3TW8B 2LKCA 2V3CC 3C5CA 4W7SA 2ZI7A 2IS6A 2JLXA 2A5FA 1W36B 2H16A 4URVR 2HJGA 1KO4A 1T91A 2WSMA 3K53A 4LYHA 4RD0A 2QA5A 4ZDWA 5C2JB 4OQMA 2P67A 4ESHA 3X1WA 1KO5A 1TPZA 1XJCA 2GA8A 4GMXA 4S2EA 1PVOA 4AWXA 2P5SA 2PT7A 3PITA 4MRPA 2J41A 4WA7A 4UXHA 2FF7A 5D3QA 2G1JA 2WZQA 1Y3AA 3O47A 1W7AA 3FHTA 1X1SA 1Q20A 4MQBA 3RNLA 3PJRA 1GL6A 2RGXA 2WPDD 4ARZA 1N6LA 1Q0UA 4LHVA 3LXXA 1G8HA 1HEIA 4M1YA 1T5IA 4KI0A 1TTTA 1T6NA 1D5CA 2YWGA 2ZJZA 4EPYA 5LD2B 1S4QA 1QHYA 3SHWA 3ZYCA 3NXSA 3SR0A 1LF0A 3VU9A 3QBTA 1D9XA 2V1UA 3BIFA 3B1XA 2O52A 1GOTA 1QHXA 1E2NA 3VR3A 1N3BA 4KFUA 4ASUD 5JCPA 4EIWA 1KDOA 3CBQA 1L4UA 4ZIRB 4OI4A 3AVUA 3EC1A 3JVVA 3FOZA 5EP2A 3BFKA 5IRCD 1OF1A 4C4PA 1E0AA 4Q03A 3B2EA 4CW7A 2ZRAA 2PZFA 3WHLA 5JWOA 1DAMA 3K0CC 4JLJA 5IF9A 4LPSA 1LFDB 4HSEA 5FR1A 4DCUA 4HDQB 3U4QA 1MRNA 4Q02A 5TV2A 1FL9A 3K9GA 5JHHB 1C1YA 2J45A 2CE2X 1N2CE 2QI9C 3B5JA 1P5ZB 2P2LA 3RS3A 5CLLA 4PR0A 3QI2A 4DSOA 3SI7A 2PEYA 4TMTA 4A2QA 3IIKA 1WA5A 1BMFD 1CS4C 4PZYA 5C1BA 4PHTA 4LC1A 2ZRPA 3BH6A 2J9RA 2OAP1 1KNQA 1E2DA 1GKIA 1UDXA 3F3YA 5EE9A 2JLYA 3RWOA 4PSKA 4DRZA 4ILEA 2ZRNA 2QT0A 1NLZA 2XOKA 3LLUA 2IYLD 1EK0A 4U00A 3P1JA 4JLAA 3U44B 1N5KA 2A30A 1JR3E 3GCGA 4D2IA 1QRAA 1AS2A 4EAQA 3ZIAA 2W2TA 4ZDIA 2B7CA 4BFUA 3TQCA 2ORIA 5EZ6B 4XVUA 4H9GA 3C16C 4M1WA 3SZRA 4DLXA 2H57A 4MKFA 4DIEA 5JFGA 2HCJB 2EU8A 2FFBA 1UDWA 1N5JA 4HEJA 2JIZD 4K8OA 2R44A 4RY2A 4LY6A 5CYPA 5K8LA 4TZ6A 4D4MA 3DEFA 4GL2A 3UMRA 4M1SA 2EFHB 2C8VA 1JNYA 2VP0A 4Z1MD 2IW3A 1Z0IA 4J0QA 821PA 4B2PA 1YKSA 3MJRA 2D2FA 3LRPA 1E1RD 1KZ7B 2IEZA 3NTUA 1ESNA 1EFUA 2A5DA 4MRNA 3WYGA 5K8UA 1UAAA 4V0NA 1XXHB 4NBSA 3ZS8A 4NYMR 2PJRA 3GLGA 3IIJA 3OZXA 4P33A 3UG6A 1W4AA 4HLCA 1ONBA 3AF1A 2VLIA 2QMOA 3Q7QA 1VMAA 2QP9X 3DM5A 2WJGA 3H84A 3QUSA 2H8KA 1E9SA 2ZE7A 3HPRA 4TT3D 2ODEA 2AD1A 4N3NA 2WJIA 421PA 3U60B 3QQ5A 2BBWA 4KJZA 1XFAA 1SVWA 2ZR9A 3WBJA 1EGAA 2ZSFA 2J0SA 1X1RA 1GILA 4OHZA 2WKRA 3NC0C 4IFBA 1KHTA 4M9QA 1G5TA 1FX0B 1W0KA 2JAQA 2UVQA 2QN6A 2WSSA 3QXCA 3NDBB 2Z4RA 1QG2A 1YR7A 4M8NE 4RZXA 2IX3A 2R6GA 1A7JA 4JKYA 1Q57A 3AQ4A 1JR6A 3AVYA 1U0LA 2GXSA 4JVLA 4JVNA 4KODA 3ZZ0A 3V9PA 3KZ1E 2G0NA 2YWFA 3B1WA 2WJYA 3P4XA 1LV7A 2FGJA 2REOA 1J2JA 2GJ9A 4LDJA 1SKYE 3ZVMA 2AK2A 1D2EA 3VAAA 2BKUA 4L15A 4BRWA 5CITA 1HQYE 1NJGA 3M1IA 4NYJR 2ANCA 3AUYA 3U3MA 4Q7JB 3B85A 5BYKA 4A82A 3K0EA 5A5GA 3BS4A 1CBUA 2FOLA 3BD9A 3TE6A 1A1VA 2FNAA 1IXZA 2ZUDA 2W6JD 5D3MA 1JQLB 3LBIA 4I4LA 2VHUA 2Q0HA 1GFIA 1VG8A 2DR3A 1RRCA 2FFHA 4JIMA 1WF3A 2OCPA 4DVGA 4PC1A 3DKPA 3GLFA 2IS4A 4AY2A 1C4OA 1P61B 4KLNA 4TSFA 3TSZA 2B8WA 1NVWQ 1GSIA 1XXHA 4WXRA 3I62A 5DO9A 1G9XA 1ZBDA 1W0JD 3T5GA 1OYWA 1FMJA 3MD0A 4L4UA 4LV6A 4Q4AB 1NNEA 2QG6A 5FUVA 3SNHA 1BIFA 2E1RA 3NBYC 4C30A 4TZ0A 4JS0A 3VR1A 4LI0A 4KBGA 5E7JA 5JECA 3ICEA 3S1AA 4B32A 5UKDA 2GZDA 3TUIC 1ZIOA 2V6JA 1CJVC 1Z6GA 5CYOA 3AUXA 5FI1B 1IN5A 3FWYA 3KFVA 1GG2A 1UBFA 1TF5A 4JYCA 4D80A 1Z0JA 1TF2A 1EX6A 3OIUA 4MGKR 3LBNA 2I3BA 2QBYB 3ADDA 3QY0A 1KOFA 1SVSA 3PIRA 2YC4C 4X8LA 2ZRHA 3IHLA 4C0BA 1I4TD 1YZLA 4ZKDA 3EPJA 4DEXA 4CEIA 3IPXA 3M4YA 3U3OA 3QG1A 2DB3A 1E3MA 5HKKD 4A8JC 2REBA 5CK4A 2F43A 4NYIR 3MFYA 5P21A 4NP6A 5FPKA 2XGJA 1G7RA 1SVOA 2PEZA 5FBWB 1NVVR 2J46A 3UMSA 1DG1G 1KTVA 3UWOA 2A2ZA 2QQEA 2LKDA 2ZRBA 2ZJAA 4ERNA 1E2LA 3K9HA 2CVHA 1FQKA 1OIWA 1G41A 1XMVA 4B3FX 1OKKD 1T0JB 4A9AA 1CULC 4FMBB 5KDLA 1OIVA 4A0RA 2WTUA 4FMCB 4PQYA 3CKLA 1NJFA 3OHMA 1DO2A 3AKCA 2ORVA 4DHEA 3BB4A 1F2UB 2OCAA 1T3HA 3BRWD 3L43A 4HYYA 3EAQA 2V8OA 2A5GA 2YINC 4BFSA 4M2LA 1RRPA 3LVQE 5SZKB 1OXVA 4OHVA 4XWAA 4B3GA 2FPLA 4ZI3A 4Q1FA 3FHCB 2YC2C 4DB4A 3BBPA 3ZD7A 4QJ4A 2MSCB 2D3WA 1Z28A 2HDNB 3CNNA 3THYA 1RFLA 3LW8A 3T06B 2G1KA 4HUQB 4DUGD 3BAFA 2FGKA 2FPMA 3T12A 1DS6A 5CIQA 1N6NA 1OFTA 1WP9A 3KJEA 5AJXA 2VIIA 3FMIA 4DDTA 1AIPA 4PC2A 2IYUA 1JECA 2HCBA 1GTVA 2JLRA 4URWR 4TYWA 2NO6A 2DFNA 1T0HB 2ODNA 3EIHA 3DPUA 1IAQA 4KBFA 4MKHA 4TTPA 4A8JB 4AG5A 4ZI2A 2RGEA 1W0KD 4LJ5A 2DCUA 4GP6A 2GVDC 3DMDA 1E9RA 2NG1A 3PEWA 3U5ZB 1AS0A 3MJHA 4V0OA 1CR0A 2CLCX 2MSDB 3U2QA 4A6PA 1KSFX 2PMDA 2W6IA 4ITRC 4HAWA 4QC2A 4WBSA 5DHAA 2BJWA 1KK2A 6Q21A 4NCKA 2WJJA 4R98A 4F4JA 4PPFA 4ZIRA 1BKDR 3HPQA 4PXAA 2CBZA 1LNZA 4L9SA 1SXJE 3KKQA 3QPWA 3NIBA 4P4TA 1GKUB 4TMZA 4X8HA 2NTYC 1NRJB 2FSIA 2BEKA 4NH0A 2RHDA 4D26A 2V6IA 3SYLA 4JKIA 1CJKC 4RD4A 4JT4A 2EYQA 3RRMA 4RFVA 1G8GA 2Z0MA 1YZUA 3HR8A 4C0QC 3SFVA 1S9HA 1IN7A 5JBQA 1WMSA 1R8SA 1RKBA 5IHPA 2VEDA 2VSFA 2W6JA 3BJIC 1SVLA 1R0XA 4OQFA 1R0WA 2XTMA 5D3MB 2ZR0A 2OFOA 3QPVA 3W90A 4BASA 2GXAA 1KMHA 1GAJA 2HXYA 4M0LA 3O8BA 1A5TA 4BLSA 3G5UA 4F4IA 5FOUA 3MWLA 5FH9A 2OSBA 3SN6A 1ZP6A 1YZNA 2ANBA 3DZ8A 3GJ7A 4RSGA 3OEHA 5KDDA 3LLMA 1MKYA 2ZRJA 5FOTA 5E3HA 3X2SA 1QDEA 1A2BA 2CJWA 3VMFA 1XPRA 4OHXA 1G64A 1XTRA 1AK2A 2OHFA 1BYIA 2ZJ2A 3AKEA 2CNWD 1DAGA 3QOFA 3PCRB 1ZU4A 2OCYC 3ADKA 3PR1A 1JR3A 2VQSA 4AYXA 2OAQ1 2QPOA 1B23P 2IUTA 4QJ3A 2WJHA 2OILA 4MDEA 2C77A 4BFWA 2JLWA 3IQXA 4WZAE 3KXIA 5L3RA 2IYRA 4US0R 4HAZA 4HI0E 3A58B 2P0EA 3A1UA 2QY9A 4C9BA 5KSPA 1U8AA 3WNCA 1G6OA 4FN5A 1JJVA 1VG9B 4E07A 1LS6A 5JI2E 2O5VA 4BZPA 3HP1A 1VTKA 5F9FA 2YWHA 4Q7LA 2UZ3A 2H92A 3MMPA 4YMVA 1EXMA 5EUMA 4TTRA 4XH9B 4QBGB 2QE7A 1NKTA 4UNPA 3K0AA 4URYR 2V54A 4LJ4A 4Q7MB 5L8VA 1OFHA 1KDRA 2QGZA 2R6AA 1Z0DA 3B9PA 1KJZA 3W9YA 4KITB 3A1SA 5E7MA 1XU4A 4KYUA 1JAIA 2A7QA 3EZ7A 1EFRA 1NN3A 2C03A 5CJPA 4LV8B 3SBEA 5TARA 2WVJA 3ZVRA 2DHRA 1KAOA 3CW2A 3I8XA 2W0MA 1JXOA 4DCVA 4WVFA 3R9WA 4Z54A 1LF5A 2FSFA 1XP8A 5KTYA 1J99A 3B7GA 1LVGA 2JEOA 1Z6XA 1VIYA 3EC2A 3KTAA 4PANA 5G41A 4LJYA 1KI6B 4EKDA 3A4LA 5CDFE 1O87A 4GOJA 5CIWA 1RYFA 1UPTA 3IGFA 2IHYA 3TSOA 1XD2B 2FV8A 2ZRIA 3GJ5A 4FIDA 3LNCA 3Q3JB 4CEJA 1E4YA 2YJTD 1YE8A 4IDPA 2RCNA 4PSVA 221PA 2BKEA 4AYTA 4QFMA 1DADA 4EPXA 2FU5C 2V4ZA 3BH0A 2AD5A 2ZJ8A 3BXZA 2IUSA 1ZM2A 5FR2A 1T3SA 4JLBA 2BEJA 5FBQB 2XX3A 2EYUA 1LS1A 3LDAA 4QGHA 3VKWA 4EDHA 2ZI9A 3NBXX 1Z47A 3U44A 5JLJA 5F98A 1IHUA 2RGDA 2GCOA 3IIMA 3G82C 5KPJA 5FTMA 4Q1CA 1SXJD 3AV0B 4R2IA 3U3KA 4C7OA 4DJTA 2CL6X 4V0LA 1CIPA 1CRQA 4Q9KA 2WWGA 1AQYA 1KDTA 4UNSA 2OUKA 3SDZA 4D82A 4OI0A 3ND8A 5DI3B 4LGMA 1R5OA 3AVVA 1YR6A 4Q48A 4DDVA 3P27A 4GFDA 4LHZA 5FBVB 3X1ZA 1S0UA 2O8BA 4XD7A 3CPHA 2IC5A 4TQAA 5C4GB 3MLEA 3QE0A 1CU1A 1BO6A 1OW3B 4GT1A 4RKEA 3KXKA 2O8EA 3W6NA 3T15A 4CZ2A 4YONB 5H70A 3I72A 4LYAA 1L7VC 5EXSA 2AKAB 4LHXA 1XEXB 2OV2A 3A4NA 2I1QA 3OFND 3EG5A 2NPFA 4HAYA 4V02A 4KU4A 3K9LA 2BMEA 3Q8XB 3T1VA 2F6RA 4RD6A 5JS8A 1KY3A 2XTZA 5G3YA 2W2XA 3NBZC 2EFGA 2IS1A 1RRFA 1W4BA 1U8YA 4PX9A 2ZSAA 5BYJA 4O0MA 1WRBA 1Z0KA 1B0UA 4LK2A 1JBKA 2BBOA 4DXAA 2NOAA 1W49A 3NHBA 5FL7A 3GP8A 2OLKA 2NGRA 3EZ9A 2C9OA 4NMMA 1OFUX 1US8A 1E1QD 2FN4A 3TVTA 1KGDA 3NEYA 2BOVA 1W0JA 4JLVA 1T8UA 4DB2A 2LWIA 4LOAA 1AQUA 1T8TA 3WP1B 1WXQA 1Q22A 3DZDA 4E09A 1W2GA 3SQXA 2ERXA 3AVQA 4H1VA 4RD1A 4HAUA 1SVMA 4DEYA 3K70C 2VHCA 1JEEA 5GVRA 1KAGA 1G6HA 4QGGA 1E9AA 3RABA 2BWJA 1R8QA 3AKDA 1NIJA 4B6EA 2EWVA 2CK3D 4WAUA 1PLLA 1XEXA 4Q00A 4ZDJA 4C0KA 2ZS7A 2Z6VA 4MKGA 3NH6A 3HU2A 2JJ2D 2XNDD 1TL7C 4XVRA 2ZETA 3VFDA 2BBSA 3RAPR 3VNVA 2O8EB 3KKNA 2DYKA 1ZRHA 4HLUA 2V7QA 4IEEA 2KBEA 4B74A 1IM2A 4MYHA 2FH5B 2R2AA 3Q7PA 4P3YA 2BMDA 3LXRA 2D7CA 1R2QA 4YMSA 2IYWA 4M21A 4LJAA 1ZM7A 1ZVQA 3CRVA 4C0AC 2H18A 1XBTA 3EZFA 3RVBA 2DWQA 1WE2A 2WOJA 3P26A 1RJ9A 2NMVA 1YRBA 2RGBA 4TMXA 2CHVA 3ECCA 1V43A 5TMPA 2RGNA 4DKXA 4PC7A 4ZPXA 5FOVA 1XNJA 2OLJA 2WICA 3CF6R 4HB4A 1GUAA 3AGQA 3TGPA 1MT0A 4OKSA 721PA 3DL0A 2PBRA 3RS7A 4GNKA 1XX6A 2F1RA 5KNDA 4XOIA 3CUEF 4F4CA 4FMDB 3TRFA 1KI3A 3ASZA 3PUXA 4QBIA 4ZCIA 4IVPA 4QG7A 2WMOB 1TMKA 1IY0A 4JZKA 1Q1QA 1MABA 3AKYA 2QENA 1XDBA 1AS3A 4TLCA 3GLIE 1RVDA 2QEQA 4XTRA 1E99A 4B76A 4HUTA 3LY5A 1II8B 1TQDA 1Z29A 2WWHA 3B82A 3C7KA 4C2UA 4YLGA 2KBFA 1G3MA 2B92A 4M22A 1I2DA 4HDCA 2NO0A 1KZGB 4BFZA 3A8TA 3MSXA 3VKGA 4CYMA 1HT1E 1ZNXA 3PUZA 1PZNA 1DAHA 4G5GA 1YZQA 4CT5A 3FVQA 1KJWA 1E9DA 4DDWA 1AA9A 3TQFA 1Z2CA 2OXRA 5AJWA 3S1AB 2N1BA 521PA 2OCBA 1Q3TA 3Q72A 3CLVA 1JJ7A 3SEAA 4MRVA 1OLOA 2ONKA 4QHYA 4IEIA 2IBMA 3CF2A 3GFOA 1VCNA 1X6VA 1OT3A 2GKSA 2XEXA 2ZAOA 3REGA 1E9EA 4M4SA 3C4JA 4IHQA 1KO8A 4CEIB 5J4YA 4QM6A 2B21A 5JEDA 4MDFA 3D8BA 3VQTA 2WV9A 3OESA 3W6PA 1S96A 2B8TA 1SHZA 1XJ0A 1VECA 2H5EA 3PQCA 1VCOA 5J40A 1KSGA 2DWOA 3EZ2A 1R10A 4DSTA 3KTAB 4GOXA 4JBWA 3T35A 1JALA 2Z5FA 4XWKA 5AJYA 2GRJA 4LJ9A 2WMNB 4MGZR 1U9IC 1HY3A 1S3GA 1BYUA 1XB2A 2JDID 3IILA 3OFNA 5EP3A 2PZGA 2VRWA 3O8CA 1QZXA 4M1OA 3RRZA 1CXZA 1KNXA 3VTKA 1DTSA 2J5XA 2J7PA 3HR7A 4JLDA 4Q9IA 3U6KA 1TUEA 3AVXA 2GNOA 1DE0A 4FCVA 1UF9A 2DY1A 4Q1EA 3IBGA 1SKQA 2ZSDA 1GP2A 2WWFA 4AG6A 2SHKA 4A6XA 1D2MA 1U98A 5ELXA 3F8TA 1ZNZA 4JVMA 1DAIA 3TIFA 2G9NA 4F7WA 1G7TA 2G77B 2C9YA 4US1R 2IWHA 3U61B 1UADA 1D8TA 4BLQA 3HYTA 1BH2A 3DOFA 5AWFC 1YVDA 1QHSA 2J3EA 4KFSA 4ZCMA 3U7GA 1XTIA 3I1FA 1E2MA 3SFZA 3WNDA 3TH5A 4N0DA 1IN6A 3EPKA 4G5OA 3BK7A 3P4YA 2ZJ5A 5DI9A 3AH8A 5HCIA 4BFYA 5FFMA 4NKRA 1ZUHA 2GF0A 3AP1A 2C5LA 1A82A 4KHZA 3WY9A 1GITA 1P72A 4B6FA 3UPUA 2KSQA 1E2GA 2ZSBA 4PSAA 2NZJA 1WB9A 1ZNYA 4LHYA 2KJQA 2J1LA 621PA 3KXLA 5FI0B 1FMLA 1Z0FA 3RYTC 2XB4A 4L5BA 1NVUQ 3Q9LA 5F3WB 1G3RA 3RS5A 4AI6A 4BEJA 4G0NA 3OEEA 3N70A 3QKRB 5JCZA 4TYNA 3KJHA 4NZYA 3U7EB 3WMEA 2AFIE 3JZAA 4PPGA 4ACAA 2OBMA 2IXGA 1F6BA 2IF2A 3THXA 1N6IA 2G88A 3MWJA 4GOKA 2XB2A 2EFCB 4I99A 3OE7A 3PVSA 5BWMA 1XZQA 4FMDF 3SHFA 4Q1DA 1OH8A 3UATA 1P73A 4AC9A 3P20A 4B3DA 1KMHB 2ATVA 4D4LA 2J7KA 1HT2E 1PJRA 2QPAA 2XTNA 3E2IA 4PFSA 1EFCA 5C4MA 2XOKD 2VH5R 1G8PA 1SGWA 2OEPA 2FEOA 3CONA 3NH9A 4BFXA 3GFPA 1BMFA 3BC1A 3THOA 4AIIA 3QXHA 5JWRA 4MUBA 5EE1A 3DM9B 4MUAA 5EZ5A 2ZRGA 4DSUA 2IYZA 4HB2A 4Q4LA 3V00A 1KI4A 1IY2A 3RRNA 1LY1A 1UEIA 1S1MA 1DBSA 1IN8A 1G16A 1R6BX 2JJ1A 2PLRA 3K8YA 3E5HA 1HYQA 4URUR 2WSSD 2VF7A 3KKPA 2IEYA 5B57C 3X1XA 5JMTA 3IQWA 2PCLA 2J0VA 3X1DA 2GEDA 5H8WA 1SULA 2HT1A 4IDHA 2QRZA 4IJMA 4KVGA 4TL8A 1UBCA 2IS2A 4UXJA 1XTQA 3CPEA 3I73A 3RHFA 1MR3F 4Q21A 1JQJC 4RD2A 1FUUA 3WYAA 4TYQA 1MH1A 2H1LA 2QP4A 1NLFA 5KO2A 4OQXA 5J4VA 4IKEA 3B13B 4FI3C 3QF4B 4Q01A 4XTCS 2IYQA 1XCMA 3BE4A 3QPUA 4YXWA 1NLYA 4DDUA 4QM7A 2FA9A 5EP4A 4DSNA 4HAXA 1IONA 1Q3HA 4PQRA 4OI2A 1FNNA 2GJ8A 3CB4A 3U3JA 1NBMA 3N2EA 3EWSA 2NQ2C 3NVAA 4N1AA 1HA3A 3F5FA 2GCPA 3KDSE 4EJSB 2GCNA 3F0TA 4P0TA 5AUQA 1ZIPA 1DVRA 1QG4A 2QGNA 3EW9A 3VNUA 4ASUA 4C2TA 2CL0X 1GKYA 4D6PA 2ZR7A 1OH7A 1UFQA 3O8DA 1I2MA 4URZR 4I1UA 4OJKA 3CH4B 3QF4A 4HLUC 1XTJA 4UXIA 4Y0AA 4TT3A 4DLYA 3ADCA 1SVKA 1R5NA 2GEUA 2O0HA 3K09C 3SQWA 2C78A 3NBFA 4BE7B 2ZQ5A 3U4QB 5HR5A 1YZKA 4WZ6A 2OESA 1E94E 1COWD 2XXAA 5SZJA 4PHFA 1E2IA 4BRUA 3ZZTA 5JRZA 4G01B 1W5TA 2R62A 5SZIA 3MAAC 4TTQA 2AFHE 1GNPA 2QM8A 3AP3A 3CRRA 2PX3A 4A2WA 2W00A 1P4SA 1KKLA 1F60A 2ZITA 4AURA 1U0HC 2AL7A 2BV3A 3A1TA 5EQTA 3QIAA 4MH0R 2QSZA 2OT3B 2WWXA 1NSFA 4I1SA 1IXRC 3A36A 3SYKA 4GRAA 3PUWA 2AN9A 1QHHB 2AX4A 2ZJOA 3V4RA 1ZUIA 4ZKEA 4KVAA 2GF9A 1MRSA 2VO1A 2WWWA 4Z8XA 3RRYA 3H1TA 1R4AA 1NN5A 4B48A 1MO4A 2WWYA 1EESA 1VHLA 4QKQA 1TEVA 2NZ8A 1KI2A 1UKZA 1FTNA 1FNMA 2QQ0A 1Z0AA 3FE2A 1ZCAA 4LJ7A 1CJMA 4ON9A 1GIAA 1OJLA 4GPTA 4NTZA 2HT6A 3WBKA 4Q7KA 1RE0A 4MYUA 1YRAA 3FB4A 4M9SA 121PA 1II0A 2H17A 1SXJC 2WHXA 5EP1A 1XTSA 4KO8A 3I3SR 2ZYTX 4QXAA 4NCJA 3AF2A 4JL8A 1E0SA 1E2QA 2W2VA 5DISB 2L0XA 1VYUA 1ZD1A 2QM7A 5AUNB 1Z63A 4CEHA 1OIXA 3I8SA 3GLGB 4TQUS 3R8CA 4EUNA 3KKMA 3L2OB 4RKFA 4AK9A 4B3CA 1W48A 2X77A 4DLSA 3KQUA 1DELA 2WWIA 5AJVB 1RYHA 2IHBA 1QHNA 1OXSC 2QE7D 4JLPA 1LTQA 2GHIA 2WAYA 1GWNA 2J87A 3IUYA 3C14C 2J0QA 4BZXA 2Q3FA 1NY5A 4JL6A 4ZDKA 1NP6A 2QMUA 4NPHA 5FBLB 2GJKA 5DSZA 1RRGA 5KUTA 4G1UC 1K6MA 2P5TB 3FKQA 5LD2C 1D6JA 2P6UA 5HZKA 1GL9B 1KI7A 1CP2A 2JLQA 1WBBA 2PZEA 1OHHD 4EPRA 1N6HA 1F3OA 2ZJYA 5HKKA 2CLDX 2VTKA 1ESMA 2ZRMA 5JJLA 3LD9A 2AWNA 3T1OA 3PFIA 5J5CA 5LDDC 1CJTC 3FFAA 3K1JA 1I4DD 2GBLC 1Q1BA 3QVUA 4G5QA 4V0MA 2JA1A 2QORA 4BZQA 1QHHA 4D4KA 1ZJ6A 4B73A 5BQ5A 2WAXA 1CR4A 1V5WA 2IL1A 2WJVA 1AM4D 2ZI3A 4LJ6A 5DLQC 3WRXC 1W36C 4FCTA 4BEBA 1Q1ZA 1MABB 3DOEA 1I4LD 1QBKC 4TMWA 2PH1A 3L8ZA 4NYJQ 2RAPA 5KNCA 4B34A 1CR1A 4NL4H 4GZMA 3LX8A 1TQ6A 2JIZA 4AKEA 5HE8A 2QP3A 3CWZA 3FKSD 5EJEA 4Q9JA 4YMWA 4FCWA 2RGAA 3ZGXA 2ODWA 2GVZC 5DHFA 1AJEA 3SC3A 3E70C 1TF7A 1QHIA 1S1CA 3IEUA 1Z2AA 1VPLA 2ZJBA 1II9A 2QT1A 2G3YA 2WPDA 5KU1A 1H65A 1MO5A 1Q12A 2Q3MA 3THWA 1SXJA 1U0JA 1AZSC 4HLDA 4BFVA 1W44A 2VHJA 4I1OA 1E32A 4GMDA 3MUFA 3W34A 2NO7A 4MRRA 1G5PA 1CJUC 2F9LA 3BERA 3B6EA 5DYIA 4E03A 3B60A 2VHQA 1ZAKA 2YWEA 3M0EA 1HV8A 3SJAA 1XF9A 4UNRA 2QTHA 4D0LB 5KSOA 4NCIA 3MWKA 1Z22A 2CLSA 3NHAA 1IJFA 4DWJA 3PUYA 3AEZA 1M7HA 2QROA 5LB4A 4B2LA 5KNBA 1YQTA 4TWZA 1KIMA 1E0KA 2CXXA 3W6OA 2KI5A 3QXXA 5CDFA 1A4RA 3KKOA 1II8A 3ZQJA 1PLJA 3TUZC 4XVQA 4AKIA 4RCZA 4CVNA 4LPKA 5BXQC 2G83A 5EE5B 5K8IA 2VA8A 2IK8A 2VYFA 5G40A 3LFUA 2ECKA 3TR0A 1OH6A 4KCGA 4U02A 3ND9A 4XSGA 1KSHA 3TSWA 5A4JA 4D0NA 2JCSA 4EPTA 3VR6A 1W5SA 4G3XA 2P6RA 5EUQB 2P3SA 4QHSA 1YHNA 4RZ2A 2RB4A 4D4JA 4CT4B 1IJEA 3CRMA 4IOKA 3VHLB 1RZ3A 4W5WA 4PHGA 1BS1A 3W3ZB 1OSNA 4JT2A 2BJVA 4LJ8A 1ZMXA 4M1MA 1GRQA 1SHKA 3ZIAD 4YQFA 4W9MC 4NHOA 3BWDD 4QGAA 2B7BA 2TMKA 4EPWA 1SKYB 3QJYA 1OKKA 3MG9A 2F55A 2HLDD 1Z06A 4WXPA 5E4FA 5FL3A 5SZHB 2IF0A 1E79A 3KQLA 1E9CA 4QNMA 4AD8A 4JSTA 1CTQA 5FPSA 1X8LA 4DT1B 4IW3B 1UM8A 4R2HA 2C04A 1DO0A 3GLFE 1TAGA 3EX7C 1XJQA 1GDDA 3BGWA 2C96A 4OJQA 3CZQA 1JAHA 4B3XA 4PAMA 3ZDQA 2OFWA 1IN4A 1GNQA 1T5LA 3EWAA 3CPJB 3OE7D 1OXUA 1U90A 1VYVA 2ZI5A 4YC7A 1CR2A 1OFIA 3QEOA 4EQ6B 5L3SB 2UKDA 3EA0A 5CK5A 1M8PA 3RC8A 2QRNA 3KUCA 4KFTA 4RZUA 5IK2A 2D74A 1OB2A 3G0HA 3QNUA 4R7ZA 2GZHA 4BQSA 2GXUA 5TY0A 1OHHA 1GM5A 1Z3IX 1F2TA 2O8BB 2ZU0C 5JSZB 2CCJA 2IYYA 5AUOB 4AKGA 2IA5A 2X19A 4JYBA 4AKHA 2YZ2A 4LRWA 3QG5A 5L3SA 5DI3A 2JJ1D 4RCYA 4XJXA 1HH4A 4B35A 2ZVPX 3CR7A 5BW8A 4Z8YA 1M7BA 1P9WA 2GJAA 2OO7A 4KFRA 4TYYA 4IRUB 4DC9A 3AF0A 1TEXA 4JJZA 5BN4A 1RC8A 1K5DA 4JLNA 4A0HA 2BIFA 1KDPA 3MWYW 2HYIC 4A0GA 3BB1A 3VR5A 1G4AE 1NKSA 1IQPA 3H2YA 3LA6A 4OK5A 4OQLA 3GJ0A 1S3SA 2GK7A 4Q4JA 2NO9A 2WOOA 5K8TA 5DN6D 2Q6TA 5AJZA 3RWMB 4PPNA 2QTFA 1XEWX 1SZPA 3B1ZA 2FZ4A 1E2PA 2QUZA 5GJCA 2FWRA 1ZW6A 1N6PA 1T3LA 1HURA 1OE0A 1Z6AA 4P31A 1E2HA 2C2HA 4TQ9A 2CVFA 4WIAA 1H8HA 2ZUBA 2R8RA 2OXCA 2ZEJA 2ZE5A 1N6RA 3K70D 1NBME 1ZINA 4HDOB 1OYYA 4M1KA 4BFTA 2R6DA 3EXAA 4YDHB 1ZUNB 1N6KA 3A1WA 3KUDA 3T5DA 3GFTA 1FZQA 1E1QA 3GJXC 1ODFA 3KJGA 2GEVA 2GILA 1G8YA 2PLFA 3CX8A 3I4LA 4Q9LA 2BDTA 3LV8A 3GLHA 3L82B 1E69A 2ZIAA 3SYNA 5B58C 1XMJA 4KLZA 3LH5A 4NONA 2BM0A 2YYZA 2GAOA 1SXJB 4NCHA 1P2TA 4XD7D 3FMOB 4TMVA 2D7DA 4OQNA 4KAXA 3UXMA 3BFVA 3SU8A 2IYTA 1NY6A 4JMPA 3SS8A 4TLBA 4PHHA 1E0JA 2AHOA 3VR4A 3EASA 5FTNA 4C7OB 3U6BA 1ZM3A 1XD2A 5DNYB 4EFLA 3KQHA 2RH5A 2V7QD 3ZD6A 5KSYA 1LW7A 2PJZA 1M2OB 2CMKA 3NEJA 2A3RA 5C18A 5H68A 1E2FA 4FWTA 1NL3A 1NN1A 2FFQA 2ZI6A 2P6NA 3GLHB 4MGIR 1G5RA 2GBLA 3FYHA 4JJKA 5J47A 4DCNA 3K70B 1ZM9A 1J70A 2VP4A 5H1YA 3M6AA 4OYHA 1EFRD 5J4HA 4DBLC 4GI7A 2O8FA 1E98A 1P62B 4QGFA 5GADl 3H0KA 4JLKA 4EPVA 2R6CA 1J7KA 1FOEB 1NSTA 4Q19A 2WIAA 3CZPA 4B71A 1Q1EA 2YOFA 2IUUA 2AKYA 3B8HA 1E9BA 2FFAA 2JASA 3D31A 3GJ6A 4KSBA 5HTKA 3R9IA 1DEKA 2EWWA 3FDIA 3PEYA 1NF3A 4B33A 2F9MA 4MYCA 2GTPA 2XZLA 4O3MA 4W5HA 4F93B 5C46F 1FP6A 3LBHA 4FMCF 3GLGE 1EG7A 4Q4JB 2RKOA 1E2KA 4Q18A 3A37A 3GLIB 1E9FA 1KI9A 3FHOA 4I81A 1P2UA 4DLZA 1L4YA 3KB2A 4IOMA 4TL9A 2XSZD 2DFKB 5EE3A 2RGGA 2R9VA 5DYGA 4FXPA 8OHMA 4O2LA 2AK3A 2YVUA 2VP9A 1XMSA 2VL7A 4DLVA 2W0SA 1G1MA 2A5YB 5FOWA 2KB0A 1W4RA 1E1RA 3J81k 3TVDA 2DBYA 4LHWA 1FW6A 1R0YA 4A1FA 3U7HB 1S9DA 1XMIA 3Q85A 2OBLA 1L2TA 4GBMA 4GZLA 3FFBA 4JVSB 4X8OA 1Z83A 1J90A 5F2EA 3GJ8A 3D7MA 3VKHA 2F1JA 3THYB 4PQFA 4HB0A 1J8MF 1N25A 2O8CA 4R71A 1ETUA 3VR2A 3QSYA 2DPXA 4UNQA 1W2HA 1FFHA 1S2MA 2Z43A 2GDJA 2VBCA 5E95A 4LBYA 3KB1A 4IXNA 4RD3A 2GK6A 3Q5DA 1D9ZA 4EQ6A 5FUWA 4B3BA 4DLRA 1U81A 5L3QB 2OE2A 3DVLA 4MGYR 3TR5A 5A0FA 4TYPA 5CM9C 4F91B 4XSHA 5AR1A 2GAAA 2HV8A 2XJ4A 5DN6A 2OFXA 4C0JA 4P4UA 1HUQA 1U8ZA 1DPFA 1X8JA 1XTKA 2HF8A 2ZRKA 2ZREA 4OI1A 1KK3A 3RS0A 3SBDA 2ZYVX 4A4DA 5B30A 1YR9A 3AF4A 1M1YE 3T61A 1U94A 3DDCA 4YDSA 1R7RA 4YXWD 4NCNA 2EVWX 5FPTA 4CIDA 4ZV4A 2PX0A 4BGDA 4Q5IA 4MA4A 3KJIA 4V0ME 4ACBA 4HAVA 5FOXA 2ZPTX 1DAFA 4KSCA 2NIPA 3UK6A 4DIDA 4RZ3A 1TUIA 3WRYC 5JS7A 5ANRB 1G291 3D3QA 3K0FA 1F48A 3QKSA 3SJCA 1ZYUA 2QZ4A 4RJLA 3UIEA 1G20E 3BH7A 4FD2A 4OBEA 4DUGA 2V1XA 2QAJA 2QAGA 1K5GA 1WDTA 2FMXA 1MO3A 5CLQA 4HUQA 1X86B 5HZHA 3DO6A 2JLSA 3MCAA 4AYWA 1M74A 4Y0VA 3IDQA 2PCJA 3W3AA 2A78A 1E2EA 4JLOA 1TQ4A 2ZVQX 4IDOA 1D2NA 2GWHA 2F43B 4D25A 4C0SA 4D81A 4CGZA 2CK3A 2JDIA 4V0KA 2WM9B 1F2UA 2Y8EA 4DLTA 1ZD9A 3UG7A 2W6ID 2J7PD 3LW7A 4HZIA 1P7CA 3ZVLA 1N0VC 3CNLA 2OBNA 1A2KC 1T9HA 4NU0A 3KQNA 2ERYA 1BOFA 2JGNA 2ASEA 3ZS9A 1TU3A 2D2EA 3LWNA 4A2PA 4EJSA 3CM0A 3P32A 3O8RA 2PMKA 2ZXUA 3NDPA 1AKYA 1H8EA 1EFTA 1ZC4A 2QNRA 3DKVA 3HJNA 4WOPA 4BPBA 2XZOA 1MOZA 4IVQA 1VCMA 4B2IA 1NVXQ 2ZYWX 3NC1C 2IYSA 1DAKA 1FPMA 2GJSA 2QPTA 4BLTA 3THWB 1PV4A 4Q4AA 5CJ2A 4C0HA 5HE9A 2FSHA 3QBVA 4P4SA 3K0FB 1PLKA 2F3TA 2FEMA 2FJUA 3LQQA 3VU9B 3Q5EA 3IHWA 3QXJA 4K81B 2WKPA 3NKVA 5KDOA 4Q4HA 3OEHD 2FDCA 1P2SA 2ONJA 4POAA 1F5NA 3AVTA 1SVIA 3CH5A 1XPUA 3K0AB 2EFDB 5EE0A 4JLMA 2X1VA 3A1VA 2VF8A 3JZMA 3C15C 1IOZA 4TSFD 2A5JA 4DLUA 1WBDA 2DWPA 2H7VA 2J0UA 3BORA 5FTJA 1E96A 2FZLA 3H86A 4NE2A 3B78A 3TMKA 5DIFA 2RGCA 5EXXA 3GPLA 4JL5A 4LYJA 2ZU6A 3I61A 3OAAA 1C9KA 3REFA 4HLQB 5EXPA 4PZLA 4F92B 3IO3A 3ZVNA 2BM1A 4LV5B 5J4LA 4BLOA 3SJBA 1R0ZA 1Z07A 2CCKA 1UBEA 1N0WA 4ESVA 4URXR 4M53A 1DOAA 1VDZA 3GLHE 3EARA 4YMUA 4M9XA 4OK3A 3FMFA 3QXSA 4Z1MA 4DZZA 3GLFB 4LZZA 2BCGY 3PG5A 4G5RA 3R8FA 3PENA 1FQJA 1KK1A 1W36D 3LO5A 3TW4A 2IYXA 2DFLA 3EPHA 2QU8A 4A36A 4ZCLA 3TBKA 4BLPA 4Z51A 2V9PA 4DLWA 2O8CB 2Q9AA 3IKJA 4D0GA 4EFNA 1ZU5A 1NG1A 2CCGA 2VP6A 1FX0A 1G7CA 3DMNA 3L0OA 3PXGA 5HPYB 1G3IA 2AR7A 5TXGA 2WIBA 3A4MA 1S8FA 3CR8A 3EZ6A 3A6PC 4K46A 1G21E 1M34E 2J0UB 2BC9A 4LWZA 3WHKA 4LC0A 4UNNA 2EFEB 3QENA 4GP7A 2J59A 3LVRE 3IBYA 2BBTA 2ZS9A 1NIPA 4EJSC 1Z08A 2HJVA 3RS4A 2KE5A 4CEHB 4A92A 4ABYA 2OZEA 3LX5A 1CF4A 4W5JA 4OHYA 3TJZA 1G7SA 2XNSA 1M6NA 3GLIA 2IWRA 2HYDA 4YMTA 4FW9A 5JJKA 1EWRA 2I4IA 3ZQ6A 1OH5A 1KO1A 2JLZA 5F9HA 1P6XA 1AGPA 1CEEA 3ADBA 1FUKA 4NDZA 3QVVA 1GRNA 3FGNA 3I5YA 4GDFA 2REXB 1TNDA 3GEHA 3HYRA 4PZZA 4QBHA 1QVAA 2HF9A 1UEJA 2Z83A 2ZE8A 1KK0A 3TAUA 3UWKA 2JATA 1CRPA 3CO5A 5AK0A 2K5UA 3C8UA 1CLUA 1NN0A 2ZI4A 1U9IA 2ZRLA 2JJ8A 2Q9BA 1EX7A 2AXPA 1TX4B 2G6BA 2AXNA 2YKGA 2C95A 1KI8A 2GZAA 3V4FA 1P75A 5CM8B 1NBMD 1OB5A 2HEIA 2CNWA 1QF9A 1VIAA 2X8AA 3B1VA 1FTSA 4LBWA 5AUPB 1M7GA 3RANA 4BUJA 1G3UA 3QEJA 4B44A 1JEDA 4UQOA 4NYMQ 1J8YF 1E4VA 4PAQA 1UBGA 2VSOA 1Q21A 5DH9A 3RSLA 4F38A 5JJIA 3OEED 5JRJA 2ZM5A 4E5UA 1COWA 1X8KA 5TB5A 1JR3D 1Z6YA 2EQBA 3QKTA 4II7A 4TL6A 2XXAB 3R20A 4GSYA 4L8GA 4S35A 1EFHA 2ZRCA 2IT1A 5IT5A 2ZRDA 1P60A 3K9NA 3L0SA 1U2RA 3N5CA 2C9CA 3ZZUA 2O0JA 4Q4HB 3QKSB 3FPAA 1RJ9B 3ONWA 3FMPB 4PC6A 4P4SB 3TK1A 1N5IA 3GD7A 2ZUCA 3CIOA 4TLEA 5FTKA 4QHTA 3B1YA 4B47A 2Z4SA 1Z5ZA 3WXMA 3LAWA 2ZRFA 1XPOA 2CE7A 3WP0A 3WMGA 2E87A 1XEWY 5FPHA 5KYKA 4P32A 3ZLJA 1PUIA 3FTQA 4M1TA 3IO5A 1P3JA 1GZSA 4HZUA 3GEIA 1WQ1R 2YV5A 1XCGB 2ZTSA 3KFXA 3EPLA 2R65A 5TVKA 2XZPA 2E9SA 3L0PA 3QF7A 3HU1A 2DFTA 1G18A 2QAGB 5CB8A 5FL7D 1HTWA 1CKEA
chains in the Genus database with same CATH superfamily
1REQA 2IV7A 2N3ZA 1OAOC 1XZIA 1Y63A 2R7AA 2ATCA 3SOPA 3I9MA 3BMCB 2HMVA 3L3BA 4W9NC 3IVRA 4QICA 3Q8KA 4RAQA 3RLIA 5IJWA 1GEEA 5EPEA 1YU9A 2CEAA 1VJTA 4ER6A 3PEFA 3R24A 5KVAA 2WQ7A 1TM3E 1MMFB 1UJ6A 1V9SA 1W87A 2QSYA 3GEEA 4KMMA 2Q9CA 4I5DA 4I1VA 4IVNA 5JMPA 1Z4MA 3A27A 3LKZA 5F1KA 3CNOA 3NOQA 1H5UA 2ZE6A 4KYIB 4P84A 4I1RA 5M04A 5DYWA 3N07A 4AMUA 2NPIA 4YCNA 4Z5XA 2DUWA 4WZZA 1SC3A 3I32A 2GEJA 2FF5A 5FT9A 2JLVA 1GUBA 3V8VA 4DR3B 5JEEA 1ZNWA 4NARA 3R7DA 4MUGA 2DT5A 2HZBA 5DHTA 3THXB 3T34A 1IAVA 4E5KA 4M46A 3LU1A 2RHGB 1SWWA 5G4LA 1QE0A 1UK9A 3HL0A 1LLDA 2D4AA 1XCPA 5IJ9B 4IZOA 4R8KA 5DE3A 4DV1B 2BCJQ 1XC7A 3E8SA 5LQCA 2XVXA 5EY5B 5IBCA 5K05A 5FBRB 2I65A 1VSUA 4FDTA 1D1PA 3GFBA 1QIHA 5LNK6 1T5TA 2CLKB 3A04A 1PFGA 3E9YA 3ETLA 1LB1B 3HKCB 3KT6A 2B78A 1LBSA 4W1RA 3V4LA 2GRUA 4FIZA 3QEBZ 3RAFC 4KUHA 2REQB 5IJXA 1U28C 1K9VF 1F0KA 3EMKA 5JI3E 3C6QA 2VT2A 2BFFB 3KTDA 4UJ3A 4CKBA 1ICEA 2LP4Y 3N53A 2C61A 4G8CA 3UMGA 3FGOA 3HY6A 1O57A 3R5XA 3RFCA 1G19A 1FIUA 1SIOA 4LCBA 3R40A 4KLCA 3CUYA 4HXGA 3SKVA 4DG5A 1T10A 1B8PA 3NG1A 3MGAA 2O3QA 4FU0A 4MB6A 3BOSA 1TKAA 1HDOA 1OTYA 2NYVA 5JZVA 3I92A 1YL7A 4KZPA 1YZTA 3FJ1A 4IV5A 3DHNA 2Q1XA 2AC7A 4HDKA 2PUCA 5AKGA 4RHTA 1X0XA 4HNSA 3NMUF 2PGDA 1MV5A 4IXMA 3AY3A 1JEQB 1OWPA 1N2CB 2A9KA 5GJBA 3D6TB 1SD2A 1MO6A 2VK1A 3L6DA 3R0QA 5H3HA 4BLUA 2O1SA 4HNGA 1GD1O 2E2WA 3EVBA 2AX3A 4FOOA 4HEHA 4L0DA 1QHEA 1NFRA 4L72A 4IINA 4Q1AA 4FFNA 4F5WA 1V4VA 4DG8A 3AUJB 4R9UC 4RHYA 1MEEA 4FNOA 3INTA 3IB6A 2TMDA 5NULA 1Q44A 1QB8A 2LCFA 1M0WA 5CXQA 5B64A 2HUPA 1KY2A 2XECA 4FS8A 3U4HA 3V55A 4ONEA 2VLBA 3CF4A 4QECA 4L16A 5AI8A 1QIFA 1Z35A 3PXXA 3GR6A 4OLAA 4XEHA 5ARDA 2Q3HA 3LOUA 3QI7A 3IBSA 2XODA 3H11B 4XIGS 4FEAA 3OZGA 1KORA 1UWVA 4DJJA 1Q19A 2W58A 1ZICA 4FOSA 4FSDA 5KBYA 1WG8A 2QSJA 4BIIA 4TT8A 2OOSA 3F9IA 2B34A 2JI4A 4ZO4A 2HCTA 5B7GA 1IOVA 3IXQA 2DLDA 4MR8B 4H4EA 3G1TA 2O8FB 2XUPA 3F90A 4IDNA 4HZUB 3PF8A 2CFIA 3H5AA 3AJAA 5JQGF 2OK8A 3RG2A 1MOQA 3KRTA 2D2IA 4KOAA 2WP8J 2P65A 2ZYUX 4DR4B 1R9JA 4ZGBA 1UMDB 4TVOA 1F8XA 2D06A 4KIJA 3I28A 5ELMA 4B45A 4IWNA 3SGLA 4JYAB 4G23A 3CH7A 2ATEA 3DV0B 2AW5A 2DQZA 4DN6A 1SXPA 2B9VA 2R1TB 1M9NA 4G2NA 5KNBD 3QA9A 1NE7A 2QVXX 3AHGA 1QYRA 3GFVA 4R01A 3D2LA 4EHAA 4HYTA 1CZKA 1V7PC 2NU7A 3QTLA 1TOAA 2PXAA 2B6HA 3ZJYA 1QAOA 3B9QA 3A4VA 4WXHA 2CXSA 2B99A 3U3RA 1YZGA 5JI2E 3BFXA 3IEVA 1L7XA 4Y7CA 4PAOA 4Q37A 2GFHA 2NO1A 2IXFA 2DPLA 4JQSA 2MSEB 3MW8A 3O5AA 4F56A 1QHGA 2GCOB 1UJ2A 1T43A 2VOEA 1GQQA 3SLGA 1G8FA 1SO8A 2XHZA 3UQZA 4RIIA 4JELA 4EMTA 3S44A 1Z7YA 2D62A 3EEFA 1O0SA 4JV5B 1FP7A 1S2IA 3IKLA 5A9TA 2O23A 4ZJYA 1JL3A 1ONPA 5KNBH 4PGFA 1T9ZA 1Y6QA 1VG0B 3W4JA 1UKEA 2BVNA 2JW5A 1FFYA 4MV7A 2QIPA 2R6HA 1DHRA 1E79D 4O8CA 1Q7RA 3C3YA 1AKTA 2IYOA 4RFSA 1T36A 3IAAA 4G24A 4MZXA 1YDEA 2DPGA 3DOCA 4R1QA 5KSZA 3PV0A 3OIYA 4BNHA 1TM1E 3HA7A 3QU7A 2FQQA 2OM2A 1SBHA 1U04A 3AY7A 1DKPA 3AM4A 4MWGA 4NENB 3WL8A 1S4MA 2VPIA 1OAKA 3VAZA 1KI6A 2ATXA 1NVDA 3HFRA 1DXHA 1L6IA 4HXYA 4RA9B 5KSWB 5ILQA 5LMUB 1QV9A 2QQFA 2GN0A 3R1IA 1XNHA 9ABPA 1NMYA 2G63A 2BFFA 3QUTA 4CUJA 1L4BA 3F6CA 2A0UA 3N2GB 4H60A 4LMPA 1JPUA 2HDHA 2R8OA 4GKAA 10MHA 1W46A 4Z9YA 2PL3A 1YR2A 2OD7A 3C3DA 2AWOA 1MXFA 3QLJA 5G53C 3RLFA 3RTEA 3TLXA 3BICA 2CW5A 3VYRB 5DLPA 4IDQA 3CNHA 3FJOA 2X6TA 2HREA 3QVOA 7MDHA 5TLSA 2XCTB 4HWOA 3S99A 3AVWA 4AF8A 2OOKA 2C99A 2HPHA 2WTXA 1YDMA 4PO9A 2WWVD 2VKQA 3QHPA 3SMVA 2HWUA 5BN5A 1QYVA 1AUXA 5K20A 4N48A 5FYDA 3ZDYB 1N34B 3FTDA 1A8HA 1HDEA 4GIBA 4Q1BA 3TEMA 1N7GA 4OHWA 3FMGA 4MWCA 5K3FA 1GCAA 4GP9A 4RVCA 3DP9A 3LK7A 3PNQA 2ECFA 4CWAA 1OBFO 4CM6A 2FQXA 4LSGA 3WNBA 5GVSA 4JR2A 5KOYA 3EA5A 1I7SB 2O5CA 2IHTA 1T1IA 3VPGA 4X20B 4R3UC 2H1WA 2N47A 1WCV1 3B9BA 4OK6A 3IXMA 1QDUA 1HO3A 4DT1A 2YHIB 1NMEA 5CLFA 1N2CA 1HF3A 1OGYA 4DIBA 5A2QA 1YMUA 4QRHA 5CHEA 5GZ1A 3TNFA 3LQRA 3GY0A 3R9XA 2OFFA 2X2EA 2XYRA 3UNXA 2GBIA 3SS7X 4K9DA 4RADA 3FCCA 4BLRA 5TDHA 3GMTA 1N0UA 1MA3A 3JPWA 4Q9HA 4N6NA 3DZJA 3UY4A 5IG2A 1ZIYA 1NURA 2WJ3A 1M2HA 4TN1A 1MN6A 4OXNA 2LKCA 4R05A 5K51A 3DF9A 1CUSA 5HHTA 1J1ZA 5BVGA 3RF7A 3KBBA 1QIGA 1VI5A 2JBWA 5DCYA 2H16A 3TLMA 1KO4A 1PTJC 1T91A 2WSMA 3OF2A 4D8XA 4E5DA 5K99A 4N7MA 2NAFA 3PR2B 2A14A 1SKUA 5JSUA 4LZPA 1RC1A 3HCEA 4JC4A 4AWXA 4EJ6A 2PFKA 2PT7A 3PITA 4GX0A 4LOIA 2J41A 2EATA 4BTEA 1ZL2A 4C4ZA 3FWKA 3CFYA 1GYRA 1T13A 2AZDA 2WZQA 3O47A 5CMLA 4TRNA 1WB5A 4WJZA 3I1YA 3LUKA 4EG3A 3KAJA 2OKGA 1TEHA 3DWIA 4D5EA 1H23A 1UOOA 3AJRA 1EKXA 2F3PA 4XGRA 3DP7A 1VZ2A 3ZI7A 4AP5A 4KI0A 1TTTA 8GPBA 4PNEA 4NESA 1I3LA 1YK0A 1PL7A 2Z9DA 3SIRA 2F8LA 2GKOA 2Q2QA 3CPSA 2WB2A 3BIFA 3JQRA 2V1UA 1TA4A 1W85B 5T3YA 4I6EA 1G20B 3CZAA 3KT0A 3VR3A 3IESA 2P8SA 2QTTA 1LPSA 1L4UA 2NW6A 2I6SA 4BNDA 4CKBB 1U2GC 2RBGA 3EC1A 1I7DA 2HRDA 1PFQA 4F72A 3IR5A 1N7JA 4JA2A 2GHTA 2IVZA 3FRJA 1RLOA 3ZGNA 5K6TA 2WU0A 1E0AA 2X3UA 3MAJA 5I3ZA 1TK3A 2ZRAA 1QK4A 4CW7A 2PZFA 1DAMA 1MPTA 1Z8NA 2NSDA 2RONA 3K0CC 4X0EA 2FMIA 4H77A 4YA6A 3IP9A 5FFNA 2Y77A 2XT9A 1GU0A 1PBNA 3RS9A 4U8GA 4LPSA 4QVGA 4BMVA 1KP3A 3FETA 2CLHB 3IR6A 2C5EA 4U3JB 3ZY4A 1RYYA 1CUGA 1U9CA 4CR7A 3MGKA 3W1VA 5H82A 2CE2X 1N2CE 2CD9A 3NATA 4ENWA 5CT9A 3TIIA 1S01A 2P5YA 5IS2A 1DXYA 4GWGA 5F76A 1XVLA 4MICA 1VDMA 2LIPA 1K63A 3CJTA 1RWWA 4MW0A 2VYVD 2PEYA 4B8YA 4A2QA 4DSOA 4EWLA 2Z56A 3WWEA 4RPCA 1FSZA 3LQYA 1WA5A 1BMFD 3ABRB 1Q14A 3FHJA 3AIMA 3RIXA 3D4IA 3TDMA 4A5OA 2Q4OA 1KNQA 2OAP1 4FLEA 1VMKA 2JLYA 3L8FA 3RWOA 4DRZA 3G0DA 1MORA 1ZMOA 2P7IA 4MVJH 2X0RA 4XQ9A 2IYLD 4RTRA 3P1JA 1N5KA 3CEMA 3HHPA 1AQJA 3ANNA 4YCAA 3QWHA 1RKVA 1ZRMA 1F9AA 5TNXA 3TX6A 2R79A 1GPWB 3HYCA 3JQPA 3T6KA 1S6YA 2IE8A 4F1JA 2B7CA 5KVCA 4L75A 4XVUA 4J1NA 1AA6A 3B51X 4UUOA 2WK1A 4YJ2B 4E1BA 4P82A 4U9IS 3SZRA 3UCFA 4DW8A 4ZN6A 2AKEA 5MGBA 1D4OA 3DFKA 1H94A 2UUBB 4TV8B 2O7VA 4MX8A 3RGWS 4FM9A 2EU8A 1UIRA 3R44A 4LSMA 2GNAA 3LY7A 1S8AA 3L0CA 1VE5A 1ZVJA 3EJ6A 1E1YA 3TF5A 4FNAA 1R9MA 3DOOA 2ZB4A 2R44A 1JEOA 2VHYA 1XNGA 4RDXA 2RHHA 4LY6A 4UTOA 1U3CA 5CYPA 2PO5A 1KERA 4HGYA 2IPLA 2NV0A 2V5UA 3OKAA 3MUEA 3OTWA 1ECFA 1V39A 1AQNA 2QWXA 1BFKA 2DFDA 4D44A 2JIQA 2C8VA 1Q0LA 2VP0A 4WDQA 1D4ZA 3I9KA 1Z0IA 4Q1VA 1E3WB 5E0OA 3HV2A 3STYA 2HBYA 4IWXA 4B2PA 2VWGA 3IJRA 4A7PA 2D2FA 4QULA 5JISA 1QV6A 4LX8A 3WC4A 5KYTA 4N01A 3UAOA 4OQEA 1OI4A 1O95A 2I2AA 2P5UA 5CCBA 1MQ9A 3GDGA 3QTTA 3W9SA 2ABWA 2MOKA 3P0IA 3UFXA 4NYMR 3ZS8A 5B1EA 2PJRA 3GLGA 1E7YA 5ESDA 1YVUA 3IIJA 3OZXA 4H3SA 2AFRA 1VB5A 2OV4A 4IUYA 3MTJA 1GPUA 1ENZA 3Q7QA 1P2DA 3H84A 3KOMA 2H8KA 4M0PA 5EXEA 5C5IA 2OGSA 4DSAA 3KQSA 1ENOA 2PHZA 3CLRC 2WJIA 3RCBA 4COOA 3U60B 2IHVA 1YB6A 1ZCJA 3HN7A 1MDFA 4MUKA 1DZ3A 2ZSFA 4NNPA 4XARA 5D00A 1FS6A 4IFBA 1KHTA 2P40A 1CY4A 3MXOA 3Q7RA 5E1OA 4FP9A 4ZRNA 2A9VA 3ANXA 1YR7A 2GPBA 3OBBA 1AKUA 1JJAA 2NVUB 2JZCA 4ZI7A 3C3XA 3EXG2 2GXSA 2XE4A 4JWTA 1MX3A 2O0MA 5CCEA 1WAMA 4XGQA 3WWPA 2QRHA 2YWFA 3H4IA 3BFJA 2BFEB 3I01M 2WJYA 3P4XA 4J2TA 4YLEA 4HWGA 2EZTA 4CLOA 2EQ5A 2Q8QA 3WKDA 1SKYE 2CMDA 2CJFA 2J0EA 3FVVA 3TM4A 1H4SA 3TQSA 3Q3EA 1LQUA 4NQRA 4X24A 5ALGA 2AN3A 3KWJA 2ANCA 5AO9A 3L7BA 5D6NA 2RHRA 4UCFA 2IY7A 1JA0A 1VBNA 4MKZA 1Q7GA 2I7XA 3K0EA 1RQLA 3ZU2A 5AW7A 4IS2A 3C7AA 4L51A 4RDCA 1P5FA 4DV4B 4RTNA 2V96A 2QOEA 2ZTHA 4KNYA 5FX2A 7YASA 2PV7A 3IOYA 4HGZA 1RQPA 2W6JD 2ZUEA 1Z5NA 2VHUA 1NVBA 4GKVA 3D1LA 2FFHA 2H1CA 4JIMA 5PNTA 1OZHA 3P19A 1RYNA 5ICFA 3GLFA 4MV5A 2IS4A 3O74A 2MYTA 1BDBA 4YIKA 2WV7A 3C3MA 1P61B 2PNFA 2WZBA 5IEJA 3IEMA 4TWBA 2B8WA 1CZLA 5NLLA 4WXRA 2PRJA 3BDVA 1COZA 2XNCA 3E35A 1W0JD 5LJIA 3DFUA 4DV6B 3C3AA 1EDEA 1OXMA 3MD0A 4Q4AB 3G68A 4GGOA 4YDRA 5SY4A 4FB4A 1N57A 2QG6A 5FUVA 3TEJA 4C3UA 1BIFA 4Y8VA 1ADJA 4JS0A 4KGZA 2VNJA 3SBXA 1UPBA 2IDJA 3GDWA 4D9MA 2OYSA 1TMOA 1RD4A 1P4AA 2XNHA 3MJEA 1Y1QA 4L5AA 2FUG1 2W9XA 3BF7A 3ICEA 4B32A 3W04A 1E1CA 3ZE6A 2V6JA 4RQTA 3PXCX 1Z6GA 3NHFA 4HQOA 5FI1B 3ELUA 2X7JA 5HIKA 3HP4A 1NYLA 1UBFA 3JQAB 1BXRA 4JYCA 4D80A 3RYFA 1GTSA 4BVJA 2VNIA 4YREA 2NUTB 2GM5A 3ETJA 2RSLA 3PYXA 4FQ7A 3V7YA 3OQNA 4UZEA 4LKOA 1ADGA 2FZEA 1GKKA 4PCUA 3H2ZA 5HKAA 3PIRA 1JI3A 2ZRHA 3IHLA 3N5KA 4MIEA 3CMMA 4NU6A 2HK9A 4IIYA 3T7JA 4ZKDA 3EPJA 1GVHA 4PHCA 5DGCA 4YJ2A 4E4TA 1W52X 1KYVA 1ZLYA 2AJLI 4A8JC 5EJ8A 4R54A 2FCRA 4EHLA 2F43A 5DK4A 1X13A 1MB0A 2GTIA 3UJ6A 5LQDA 2XGJA 1SVOA 5FBWB 3OQOA 3H17A 4X94A 3PX7A 2BGGA 1HRKA 2UV8A 1PZXA 1DBQA 5FWDA 2LKDA 4ERNA 2C2OA 1E2LA 4B3RB 4KX3A 3VU0A 2CVHA 1FVHA 1G41A 5LMZA 4PG7A 3AY6A 1Y3IA 3IR7A 1FMCA 1NBWB 3WGVA 4XYGA 3T0GA 1NR5A 4HK4A 4X7BA 4L7VA 5E4TA 1U7XA 2QW8A 2WD7A 5E7QA 2YQZA 2WTUA 4FMCB 3JAKA 4PQYA 5F12A 4HWRA 1EVIA 4FXOA 2UU9B 4RW0A 2GRAA 4GX1A 4NZZA 4DGSA 2VDLB 1DO2A 3EK2A 3AKCA 2ORVA 3E7XA 4NBLA 4DHEA 2P1DA 3FOCA 3KE8A 4PLZA 1F2UB 1L4FA 1U0SY 2OCAA 5KVQA 2X0EA 5CXXA 4DQDA 2PD3A 1SCDA 2OBFA 2P8JA 3EODA 1G0NA 3ITDA 4PCAA 2PGJA 5DIZA 4KZKA 3F98A 1UMBB 2A5GA 1P81A 4NCBA 4HT3B 1QP7A 1R6UA 1TIPA 4INOA 3GX1A 4OHFA 1BMTA 1ZH4A 2CKMA 3LVQE 3LIPA 4RAOA 5SZKB 1OXVA 3R3JA 1HE5A 4I4TB 3KPVA 2OWDA 3TQTA 1J2YA 1JFLA 2X5OA 1M2KA 4JGBA 3VC1A 1LH0A 3CNNA 4H4CA 2E4VA 1I3MA 3F4LA 3THYA 1TJNA 1J5EB 1HNWB 3K6RA 2RHWA 2G1KA 3DO8A 1ZD2P 2V7WA 2ZP1A 1A9YA 1DS6A 1N6NA 1ADYA 2CDBA 4BBPA 1NM5C 3AHCA 1JG6A 2VIIA 3R7FA 4DDTA 1AIPA 2P6PA 4MWDA 2VNSA 4G09A 5EJMA 4CI9A 1JECA 3OCCA 1A88A 1YULA 2FPXA 1RE1A 2DFNA 1T0HB 1U80A 2UVDA 4N7JA 3DPUA 3QX9A 4PM4A 3KV3O 1IAQA 3KV1A 5F5NA 5FWAA 3PQ7A 2ZSUA 4TTPA 3PD7A 4ZI2A 2RGEA 3ZXYA 4P22A 1T26A 4B3JA 2IPMA 3R6TA 3U5ZB 3BYZA 3MJHA 2Y1XA 3I8OA 4V0OA 5CBKA 2CLCX 4V38A 1BDMA 1KYYA 4YYEA 4CXMA 3WAJA 4DR1B 2CVOA 4FYHA 1XZLA 2AFVA 4P0PB 2W6IA 4ITRC 4WBSA 2Q46A 3UZUA 2BJWA 3TOCA 4NCKA 3HVJA 4R98A 1AKRA 4ZIRA 3HPQA 1LNZA 2VF2A 4HN2A 2DM6A 1SXJE 3KKQA 3PUIA 3R5KA 4QRIA 1K27A 4ROSA 3NVDA 2AN4A 3R3XA 1LRLA 4ZV7A 2C7QA 3W2GA 1ZONA 3JTMA 1C9YA 1RYZA 1ZRNA 4NH0A 4CV3A 2Y4NA 3D3EA 3PUHA 2IDZA 1CD5A 2EYQA 3RRMA 4EMBA 1P0MA 4AMZA 2Z0MA 2DXIA 2W4MA 4PAWA 1KVSA 1MJ5A 1C7IA 3M6LA 1S9HA 3VDNB 1B8NA 4ND3A 1WMSA 5KCZA 5KYXB 2ACEA 2QUJA 2ZUVA 2C82A 2CD7A 1V7QA 1R0WA 3HWWA 2XTMA 3WZLA 1KIFA 2HRQA 4MUMA 3W90A 4A91A 4BASA 2XUOA 2GXAA 3O8BA 1A5TA 2J67A 4C6HA 4MUXA 1D03A 1PG2A 2Z5VA 3SN6A 3UENA 9LDTA 3H3JA 2B36A 3D3WA 2CB9A 3ABZA 3F67A 4L0QA 3HWX1 1A2BA 1U3UA 1DI0A 2CJWA 2F8SA 3VMFA 3Q9UA 4R8VA 1XPRA 2CF6A 3Q3IA 1G64A 4YY3B 4GKBA 3QOFA 1BYIA 3WGJA 2CNWD 2UVPB 2PUAA 3BT7A 3PR1A 4YUWA 4UU7A 3KYBA 4IZHA 4AUNA 4MYRA 3UK0A 1B23P 4R3WA 1W1IA 2R8ZA 2WJHA 3H8WA 4EY6A 1LSJA 2ERCA 4MDEA 2JLWA 1IWOA 4US0R 4TV9B 1PE0A 4XXHA 4HAZA 5L3ZA 2P0EA 3PLNA 2OAGA 1NHWA 2QVBA 4FOTA 1PDWA 2XMGA 1AHHA 5FADA 4Q9DA 4MW2A 4YP0A 2YFQA 4BJHB 1L4GA 1YI1A 3CLUD 2H4HA 4Y2TA 4BS9A 3ZCPA 3DLTA 4BZPA 1H4QA 5IARA 4Q7LA 4MV8A 3P2EA 5KQGA 2H92A 4NEGA 2J4FA 4IBOA 4MQEA 3PI7A 3V46A 3OQMA 1O94A 2NUAA 1WMFA 3F47A 3HA3A 4PYIA 3E3MA 3JASB 5CNIA 2E7ZA 4QBGB 3TBHA 3R74A 2ZYDA 3NUGA 1TGVA 2AEFA 3TWOA 5B6JA 2B37A 3GFFA 4HP8A 2PPVA 5J2UA 1NGSA 3WV4A 1T4CA 4FK8A 1JXAA 2HOQA 2C59A 3R23A 3M9XA 1IQ0A 5E7MA 1XU4A 3EXFB 3AF6A 5GV7A 1UPCA 2X8LA 1LBEA 2C03A 4G1BA 5CJPA 5F7OA 1QIJA 3MMZA 2BF7A 4ECAA 4N8SA 3SBEA 1UBNA 4UEWA 1ABFA 3KZXA 3SJ7A 2W0MA 5CDUA 3RD5A 3ZV7A 4WVFA 3A26A 4RKRA 4AF7A 1PQYA 2HADA 4Z54A 3R9WA 1M2VB 5KTYA 1J99A 3B7GA 3O2NA 3BXGA 2I2WA 2GASA 1QQTA 1VIYA 5BSGA 3R3YA 4YJ3F 5CDFE 1O87A 1UQRA 5CIWA 3VRHA 4F04A 4JXKA 1K8XB 1NNI1 2VCYA 3IGFA 4HTAA 4DR5B 2FV8A 2ZRIA 1QH1A 1IUPA 1I8TA 2GK4A 1XMPA 2QRKA 2ZXFA 2B25A 3E7PA 4GYJA 4ERXA 5IZCA 4K1XA 2A67A 3EVZA 4E3ZA 4BP3A 2NO4A 1TI7A 3G7UA 5E8JA 4CEJA 1B73A 1E1NA 1BN6A 2I99A 2SBTA 1HFWA 4FGLA 1EM6A 2Q7DA 1SU7A 3QU2A 1GA4A 3E61A 3IULA 5F23A 4AJLA 3P0RA 1GCIA 4OX9B 3GZJA 3BXZA 5FR2A 1M2NA 1J0BA 1MA0A 2Q29A 5JMWA 2BMVA 2NVWA 2PU5A 5HG0A 4V1CB 4CQMA 3VKWA 5ED4A 2O8NA 3NBXX 2OAEA 3HGQA 4XUDA 5FI3A 3QHQA 3U44A 4LNAA 3ZE7A 5C4IA 4FBGA 1WSAA 4TTIA 3BHIA 5HS6A 4PZEA 2QTZA 1LTHR 2DTEA 3G82C 2E6UX 3ZBTA 1UK6A 3P9PA 4WERA 4MDYA 4JEMA 1SXJD 5EJ5A 3ILYA 5KYUB 3AV0B 4R2IA 4C7OA 3I2YX 1L8AA 3PTZA 2EERA 4ZP1A 3WWOA 1SELA 2VAPA 4O08A 4BBJA 1NJ5A 2NNLD 2YV1A 3ZQ4A 1E64A 3F5MA 4RL6A 2VDVE 2IP2A 4D9GA 3ND8A 5YASA 2C4NA 4G1CA 3IDZA 1Z6QA 2V7TA 4B4KA 4HPXB 3DV0A 1MVOA 3O94A 4P5PA 5FP0A 3JS5A 1IPHA 3AVVA 4FFBB 4DDVA 2ZPUA 3VR4D 4AKSA 4TV8F 1AUVA 1S0UA 3F5QA 2B4QA 3CPHA 4IM7A 1DTWA 3O91A 4OBWA 4UUNA 3A10A 5DBEX 4WKGA 5C4GB 3MLEA 3RVNA 3VTAA 4FI3F 1PNOA 1L5OA 4RKEA 4ZAFA 2GAJA 2FSVC 2VHVA 3GVHA 1FP2A 3EEIA 3WGZA 5H70A 4LYAA 2E4XA 1J8DA 3K5IA 5T67A 1WEHA 4LHXA 3U48A 3A4NA 1DWPA 1FS5A 3OCWA 4S04A 1PNRA 3OFND 1Q7TA 2V0GA 4JLSA 1VKNA 3EG5A 3CJRA 1RYMA 3V3KA 4D3ZA 4V02A 4KU4A 4TMFA 3CVOA 5BQXA 2WPNA 3K9LA 1PS9A 5LXTB 5FQNA 3Q8XB 3RB8A 4RD6A 1SUWA 2QRUA 1JE0A 4RVGA 5G3YA 2W2XA 2Y0BA 3NBZC 4CKEB 2EFGA 1KQOA 1AD2A 5G0UA 2IS1A 1XU9A 5EWLA 5AI5A 4X1YB 3EXHA 3UGQA 2OO5A 2R8XA 3FBGA 4M8IA 5BYJA 4EH1A 4O0MA 1QUFA 1WRBA 1UXHA 1B0UA 3IOMA 3LQFA 4G9BA 5CDHA 2BGNA 4DXAA 2HY7A 1W49A 5FL7A 3RVSA 2OLKA 4GX2A 3HUDA 3COYA 1TKRA 1CG6A 4IHJA 5J2TB 4M3NA 1E1QD 4LF5B 4KV7A 3W8DA 4RQUA 3TVTA 4DMLA 1SOVA 3MSCA 3ETDA 3X1KA 4EDFA 5IANA 1Z88A 4JLVA 1XZNA 1DFHA 2WDZA 4QE3A 1AQUA 1G6Q1 1TUBB 3Q1KA 4JBNA 3WP1B 3EXHB 4DIOA 4EJ2A 1GUFA 4E09A 1W2GA 1MAWA 3VJKA 1CIVA 1X2BA 1K9SA 3SQXA 1VJRA 2VFAA 3E22B 4HAUA 4DEYA 1QRSA 2GGSA 4DMKA 4KNWA 4OQPA 4TUYF 1T1RA 1JEEA 3AFIA 5GVRA 3UAXA 3WQQA 4YUAA 2DT8A 1G6HA 1KZ1A 1E9AA 1TJYA 3SP1A 5JSHA 3RT9A 1F51E 2Q4RA 2BWJA 3UGKA 4B6EA 5C8YA 2BCEA 2YNMD 5FNZA 2CK3D 4WAUA 4C2BA 4RVFA 3L79A 4WESB 2Q2OA 3WLTA 1MZPA 4MKGA 1PFVA 3ZCSA 1VMIA 2R68A 2JJ2D 2E4ZA 4OYLA 1JNXX 1WDLA 4V3BA 3RAPR 4IHJB 3COWA 5J2TF 3TQHA 1P1BA 1ZOSA 3VKUA 2KBEA 3LDHA 1SU4A 2FH5B 2R2AA 4XD2A 3RAJA 5TEWA 3C6ZA 3N9IA 3QBEA 1CUFA 1YDHA 3KSMA 4R1MA 4XX0A 1UKAA 3KVOA 4YRJA 2IYWA 1VRWA 3CXRA 2PZBA 4LJAA 4M21A 1NI5A 3CRVA 4XB2A 2V3VA 4MS4B 3UUGA 2H18A 4UTZA 1F9EA 4C2AA 4F8YA 2X5NA 3RVBA 1HFKA 2VPWA 4M38A 2OCDA 3P26A 4YACA 4YRKA 3SM3A 4P38A 2AVNA 3MTAA 4RK4A 1J06A 4BU0A 5BNZA 4CR8A 2FWAA 4M99A 5FUQA 4DKXA 1KWKA 1UZUA 4PC7A 4MV4A 3DBOB 1BCSB 3EUWA 3JZIA 2JIDA 2QTVA 4DRXB 1FF9A 4OKSA 3OX1A 3DL0A 4RBNA 4KACA 5LXTF 2Z3WA 2F1RA 3OCJA 4XOIA 3CUEF 5K8VA 3TRFA 1IUNA 1KI3A 3PUXA 5ENDA 4EL0A 1EIWA 2WMOB 2VTDA 5JH7A 1I7NA 4IP0A 4JZKA 4TLMB 3UHPA 5JY1A 3LF2A 2IQ5A 1MABA 3DLCA 3IVXA 3UJ8A 2QENA 3PJGA 5KQMA 3GLIE 5K03A 1MNQA 1RVDA 2C7PA 4K8RB 4B76A 1ULHA 2YW9A 1R0CA 3PXUA 3L9WA 3ZE8A 3H5IA 5JSFA 1EVQA 4YRPA 4DQ0A 2VI5A 3RYHB 3EVCA 2RH9B 3CKKA 4BFZA 4C7BA 4UE3S 3V80A 4DMRA 4U7FA 2OORA 4R1PA 3VKGA 1K7CA 1RPAA 1ZNXA 2Y2VA 2CXRA 2ORED 3VA7A 1PZNA 1VIVA 1U8UA 4EYOA 2FRDC 3FVQA 1KJWA 3ADPA 1U31A 5IPFA 5JZSA 4PQEA 1ZD3A 1A5ZA 2Q3LA 4U0KA 3GMSA 4FLMA 4FMPA 2I3AA 5G0TA 3ZDAA 4WWHA 3SF8B 4ZO9A 1JJBA 3SR4A 4C4XA 4ZYUA 4OIMA 2N1BA 2XGSA 2VK4A 521PA 2PUHA 4P5DA 3U26A 4DLKA 1JJ7A 3CW9A 4Q9AA 1TLFA 2QYTA 2EX0A 3GFOA 3U1VA 3REGA 2ZAOA 1E9EA 8ATCA 1J2UA 4WEQA 5KNLA 2O7SA 4A2CA 3EIWA 4GD3Q 4H1TA 1YU6A 2BYTA 1EX9A 1PSZA 3D8BA 3JARB 1F4VA 3C6KA 2K2QB 1BE6A 2B8TA 4LXYA 4G8BA 4NPAA 4B0OA 2DKFA 1XJ0A 2DUNA 2H5EA 1M73E 2ODQA 3KQVA 3RM3A 4PN3A 3U31A 5DF1A 3NXKA 4HDSA 2ID7A 4TX1A 4UVEA 1OI7A 1XZEA 1U8TA 1OGJA 1Y9ZA 3QJGA 1RABA 4B8WA 1G5QA 3W3AH 4ABTA 4JBWA 5HOQA 4FWBA 4BB0A 1CE8B 1FX1A 3LPDA 3BCSA 2DHDA 2EGUA 5EVCA 3USZA 3DBLA 4KR9A 3WRYA 2BH2A 1YT5A 1Z4IA 2R1VA 2WMNB 4GU5A 4ZCRA 1S3GA 1XB2A 2JDID 3IILA 5JASA 3K71B 1GPNA 3OFNA 3KQMA 4H1WA 4M1OA 1VPVA 1Z12A 4Q93A 3RRZA 3RRJA 4ARVA 2Y0DA 1I6WA 2VJBA 3AVXA 4JLDA 3U6KA 4HDRB 2YYSA 2R87A 1Q0SA 5JC1A 2DY1A 4LZJA 3IBGA 2XMSA 3LCJA 1U4SA 4AG6A 3AINA 3HSKA 5I9LA 5DWVA 1U0OC 1A97A 3NHRA 5EEGA 1ZNZA 2AI2A 3O82A 4MI9A 3TZLA 5REQB 2V7BA 2G9NA 2FQWA 4F7WA 5CU7A 5GM2A 3D4OA 1JLHA 2G77B 3IRUA 2H9AA 4P53A 1PG5A 4XYEA 3HYTA 3GRVA 3NT5A 5AWFC 2GCEA 2J3EA 3W8FA 4ZCMA 3ZHVA 3SFZA 3LZCA 4MHSA 2OCXA 4K9MA 2IOQA 3K1AB 1IN6A 5L53A 4G5OA 4G1EB 2HQBA 2PT6A 3R9KA 1DGQA 3C85A 1PZMA 3MF4A 1I3KA 3F9RA 4R9NA 2WHQA 5F51A 5FFMA 3TOZA 3WK6A 4BFYA 5L45A 5L4LA 3SSOA 4KHZA 2QQ5A 3QOWA 1GITA 1P72A 5EVJA 1ZY2A 2HO4A 4PSAA 1WB9A 4BNWA 5KNDH 5ALTA 4KQHA 1DX6A 3AFMA 3PFFA 2DQYA 1FP1D 2QYSA 5B1DA 1HR0B 5ESRA 4WOJA 3VR3D 1CP3A 3PE3A 2I7VA 3LQ2A 2J31A 2EQAA 1BHQ1 4BNMA 3Q9LA 5BSTA 4N39A 4AI6A 4G0NA 3N70A 4Y2UA 1FSPA 3FGPA 1O97C 2LV8A 3NP9A 4NZYA 4ZQCB 4CTKA 4YV2A 3WMEA 3WZMA 7AT1A 1FDIA 4LXIA 3RHTA 3LK6A 1OC4A 5IYZB 1J20A 4PPGA 1XRLA 1I9GA 5FI5A 4DAEA 2AI1A 1N6IA 1O94D 3MWJA 4GOKA 2JAUA 1XQVA 2EFCB 4I99A 1T1SA 3USCS 5BWMA 3PVSA 2KPOA 5EJ2A 1A2OA 1NLUA 5FD8A 3QXGA 4QXQA 1OH8A 4W8OA 5FEMA 3UTDA 4MMXB 1C9JA 2IYNA 1ZN2A 1OAAA 4COKA 3NNNA 4D4LA 1NHGA 5B3AA 1A8UA 2QPAA 4O29A 3NOVA 2PMWB 1BN7A 1CUVA 1W25A 3RODA 3ZHOA 4CMEA 3D0QA 4ZZ1A 2OEPA 3CONA 3OFVA 1XAIA 1BMFA 1MJNA 4YUVA 2PYDA 3QXHA 1JW9B 4MUBA 2AOTA 3DM9B 4MUAA 2YJ5A 3DQPA 3FI9A 2HPVA 2PX6A 2X13A 3FSGA 4NJEB 4PFJA 4HB2A 4MA0A 4YASA 1JH9A 4EATA 4ZO8A 2BEUA 3UXYA 3FUTA 5LA6A 3H16A 3OEYA 4LQCA 3M6UA 1SQ6A 1DBSA 4GI1A 5E9WA 2V5AA 3K8YA 3EFHA 1PS0A 2VF7A 2OG1A 5B4UA 1V71A 3EZNA 5B57C 5D5HA 4PG6A 1Z74A 3KAKA 1L1QA 4C7KA 2PCLA 4ZT6A 2QX4A 4JXZA 2J0VA 3X1DA 1O4WA 4AKTA 2JEZA 1HXHA 1TYBE 2VSQA 2ZTUA 3OMXA 4GDMA 3Q40A 1SULA 4HQFA 1UBCA 2YICA 4UXJA 1MLDA 4J0HA 4B4DA 4JI2B 4TYQA 4WPGA 4I55F 4DY4A 2H1LA 1YUNA 4PNPA 5J4VA 2XB9A 1AQ6A 4Q3KA 3K5WA 4XTCS 1CRLA 4FJ0A 3UYLA 1SC9A 3WYBA 1P7PA 5LA6F 5BWCA 1J56A 4E30A 1XCMA 1QONA 3BE4A 1B2LA 3WSVA 4YXWA 4DDUA 3OWHA 4QM7A 2BFAA 3IV6A 3UT0A 3BJEA 1TCUA 4P3OA 1J2RA 2JB9A 4HAXA 5JTUA 3LY8A 4GM0A 4JI5B 4JP8A 1L5MA 3HA5A 3MLBA 5CFZA 1KEEB 3IUEA 3KD2A 4K6CA 5JRDS 3OLVA 3D8SA 1C7QA 1MG5A 3IDFA 3NPAA 2NQ2C 3QUAA 4GX5A 4QDUA 4ZU6X 1HA3A 2GCPA 5IYZF 5U4XA 2VJQA 3VDRA 1UR5A 1W6UA 2WJWA 2XUQA 1NUAA 3H18A 3KJQA 1CY1A 3QE2A 1XJWA 3NWBA 5JAZA 2ZWIA 4QX6A 1A2QA 4D6PA 3ML1A 2AXEA 4P2BA 2V7PA 3HI6A 3TD6A 3AILA 3G5AA 1KU6A 4OJKA 3U17A 4DR2B 1GGVA 2AEMA 1XTJA 4GXNA 4Y0AA 4PLFA 3PFCA 3W5SA 4LYGA 4QJBA 2O0HA