5J60A

Structure of a thioredoxin reductase from gloeobacter violaceus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
316
Chain Sequence
b'GSHMEQFDFDVVIVGGGPAGCTCALYTARSELKTVILDKNPAAGALAITHKIANYPGVPGEMSGDHLLEVMRDQAVEFGTVYRRAQVYGLDLSEPVKKVYTPEGIFTGRALVLATGAMGRIASIPGEAEYLGRGVSYCATCDGAFYRNREVVVVGLNPEAVEEAQVLTKFASTVHWITPKDPHTGHADELLAHPSVKLWEKTRLIRIKGEEAGVTAVEVRHESDSQELLAEGVFVYLQGSKPITDFVAGQVEMKPDGGVWVDEMMQTSVPGVWGIGDIRNTPFKQAVVAAGDGCIAAMAIDRFLNSRKAIKPDWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title A New Member of the Thioredoxin Reductase Family from Early Oxygenic Photosynthetic Organisms.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Oxidoreductase
total genus 93
structure length 316
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5j60A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5j60A02
1IUUA 2CVJA 1M6IA 1D7YA 2YG7A 4A6NB 2C70A 3AECA 3CIRA 3LXDA 4GUVA 3UKHA 4A6NA 5KVIA 1FECA 2EQ8A 1IUWA 1S2YA 2CULA 1P2HA 1PJ6A 1PBCA 1V59A 5BVAA 5KXJA 1F8RA 2JBVA 1H83A 3AE8A 3VRBA 3RNMA 1O95A 3EANA 4CRTA 3Q6JA 1NG3A 4BV6A 4UP3A 4PAAA 2GR0A 2R0PA 4B69A 1KSUA 4U8MA 5JCMA 4YSZA 1ZKQA 5HXIA 1K0LA 3NN0X 2XFPA 3NH3X 3RP8A 2X8CA 1OJAA 2YG4A 3LADA 1M64A 1ZDLA 5J7XA 1F6MA 4O5UA 2OAMA 3II4A 3M12A 4H4VA 4UDPA 5LV9A 3DK8A 1W4XA 2BK5A 1BKWA 1TDKA 4J2WA 2NPXA 5KOWA 3AD7B 4CBQA 1DXLA 4BJYA 2YVJA 3FG2P 4NEVA 3AD8B 5IPYA 3GWDA 1JNRA 2ARDA 3T37A 2XFNA 2V60A 1VG0A 2WDQA 3F8PA 2FJAA 3CPHG 2FJEA 2TMDA 4A99A 2BXSA 3IHGA 5U1OA 1Y56B 2YR6A 3M13A 2YLSA 2GAGB 1XANA 3K7TA 3V3NA 3S61A 1D4EA 1X31B 3UKAA 4CY8A 3KKJA 1Y56A 3SQPA 1ZMCA 2R46A 1GTHA 3C4NA 2QA1A 2I0ZA 2R0GA 1PS9A 3Q9TA 1Z6LA 2VQ7A 3GDNA 2UZZA 1AOGA 3P9UA 4CY6A 2APGA 4Z43A 3ABVA 3URHA 2WP5A 4WCTA 3AEDA 4GDPA 4PABA 4J33A 1KNPA 1ELIA 3DJJA 4YWOA 4AT2A 2BYBA 2C7GA 3QVRA 2GQWA 4JY2A 1SEZA 3H8LA 5M0ZA 1GV4A 1GESA 1UKVG 4H4TA 1NPXA 4BK3A 5C2TA 1VDCA 3ICSA 3NYCA 1GPEA 2C64A 1OJDA 1E1KA 4OPTA 1EBDA 1H7WA 3NK1X 4ZN0A 2B7SA 4KPRA 2FBWA 1F8WA 2GMJA 4EIQA 4EIPA 3LZWA 4DGKA 4IA6A 5FS6A 4APNA 4OPCA 5KOXA 3K30A 2B76A 5CQFA 5M10A 2R45A 2YLXA 3UP5A 4C3YA 3AXBA 3CNJA 4UDRA 2WDRA 1COYA 1E7PA 1CC4A 2C3DA 2ZZ0A 2XVEA 3P4QA 3FMWA 1CJ3A 2VZ2A 2WPFA 2YLZA 1ZOYA 4FK1C 1XPQA 3CGBA 3COXA 2RGJA 4U2SA 3NTDA 3ALMA 1DOBA 1PHHA 2BC1A 2X8GA 2RGOA 4ADWA 1N4WA 4XWRA 3CGCA 4ECHA 4C74A 3CNSA 1HYUA 3B3RA 1JU2A 2JB2A 3DGHA 4H2QA 2BCGG 3AWIA 3ATRA 4AP3A 2WHDA 3ALLA 1GEUA 4RG4A 2YWLA 3UKFA 4OVIA 3G5RA 5IQ4A 4K5RA 2VRLA 1GRHA 2XVIA 2QA2A 1CL0A 1NEKA 2DKIA 3GD3A 1PBFA 5CKUA 2C66A 3KPFA 4HA6A 3GMBA 1NHQA 3NHOX 2WESA 5BUKA 2WOIA 2J3NA 2WPCA 2TPRA 2GQFA 2JAEA 3NGCX 4TM3A 2F5ZA 4H4YA 4Y4MA 2XLSA 2BXRA 1PN0A 2JB3A 2JB1A 4C5OA 4A7AA 4TM4A 1DJQA 2C76A 1VRQB 2X50A 2WP9A 5JCLA 3VR9A 2YM1A 3GRTA 4OPLA 2H89A 2XLRA 5HYMA 3CN8A 3REDA 4JY3A 3VRDB 4EMIA 4EMJA 2IVEA 1VG9A 2DKHA 4U8PA 2YR4A 3IWAA 1TDEA 4C77A 1YY5A 4B66A 1GRAA 3AE2A 4NTCA 2X99A 3ICRA 3FBSA 3QFBA 4AOXA 4TLZA 1H7XA 3SM8A 1H86A 3I3LA 3AYJA 2WBAA 1E1NA 5C3JA 3ADAB 5J60A 2C3CA 2BA9A 1EL7A 1PDHA 3GSIA 1FOHA 4H4RA 4J56A 4IVOB 5U25A 4H4XA 4OPDA 3QSSA 5U63A 3WE0A 4H2RA 1B8SA 2GR2A 4YSXA 1ONFA 3UP4A 4EQSA 1N1PA 4JNAA 3IC9A 2Q0KA 2YG5A 1YQZA 1D4CA 3P4RA 4U8NA 5EB5A 1PXBA 1LQUA 2OA1A 2YLTA 1BGJA 4H4WA 3P4SA 1JNZA 4B67A 2XFUA 4I59A 3DMEA 3AE9A 5FS9A 5EB4A 4YTNA 3JSKA 1JRZA 2QCUA 1ZX9A 2A8XA 1TDNA 4ZCDA 2FJBA 3ZYXA 2GVCA 4J57A 1KF6A 1GERA 1IUVA 1OJCA 2HQMA 4ZCCA 3R9UA 2JKCA 4U8OA 4AP1A 4K2XA 2XFOA 1NG4A 1YQ3A 3NG7X 3P1WA 4H4PA 3S5WA 4Z26A 3GRSA 4YTMA 3NNEA 1PBDA 3AE7A 3C4AA 2CDUA 4B1BA 4A79A 2EQ9A 3KLJA 1E39A 1VQWA 3B6DA 1KNRA 4C3XA 4CNJA 1N4VA 1ZK7A 3ICTA 3AYIA 1GRBA 4YXDA 4U8KA 1H84A 2WETA 4XXGA 1JOAA 2EQ7A 2OLOA 2YLRA 3AEAA 3SGLA 1FCDA 1L0VA 1TYPA 4JN9A 5BRTA 5L46A 3BI4A 3UTFA 2B9XA 1S3EA 2R9ZA 4K22A 3NN6X 3H8IA 1F3PA 4LIIA 2YQUA 5DBJA 1O94A 5GRTA 3RP7A 1IUSA 2E1MA 2XYOA 3DJEA 2VVLG 4USRA 4RSLA 2AR8A 4TLXA 3H4KA 3M0OA 2GAHB 2WU2A 3AE5A 4GR1A 1E1LA 2B7RA 3BNMA 2VVLA 5EOWA 4MJWA 4TM0A 4A65A 3D8XA 3AEFA 3NLCA 1LVLA 3AB1A 2YR5A 3KD9A 3AYLA 1MXTA 3E1TA 3AE6A 3UOXA 1B5QA 1DNCA 3NK2X 2E5VA 1E6EA 5HY5A 4H2NA 4IVMB 4NTDA 4B65A 4H4SA 5JCIA 4EM3A 3SFEA 4E0VA 3K7QX 1XDIA 1CHUA 1LQTA 4FDCB 4B68A 2Q0LA 1BF3A 2FJDA 1TDFA 1YQ4A 3ZDNA 1H6VA 4N9XA 4H4QA 3D1CA 1TDOA 4FK1A 4KX6A 2GR1A 3DJDA 4NEWA 2A89A 4UDQA 4YSHA 3HZLA 3RP6A 3SFDA 3GYIA 1XHCA 4REKA 4A5LA 4B63A 2BABA 4P9SA 2WS3A 4TM1A 1ZP0A 3UTEA 1KDGA 3G5QA 4RG3A 2C67A 1GNDA 1FL2A 4YKFA 5FS7A 4CCRA 2GF3A 1DODA 4LU6A 1GTEA 4O5QA 1GSNA 3UKKA 2BACA 4Z2RA 1GRGA 2AQJA 2YVFA 4M52A 3UOVA 2WQYA 4DSHA 3AD9B 2YM2A 3OZ2A 3NYEA 4J36A 4K7ZA 4JDRA 2WDVA 3PS9A 1PBBA 3NIXA 2Z5XA 4H7UA 1ZY8A 3PVCA 4H50A 2WOVA 4JNQA 4Z24A 4DSGA 2WEUA 2PHHA 4U8IA 1MOKA 3DK4A 5HHFA 2C72A 2GH5A 3L8KA 5FMHA 2V61A 3UKPA 1S3BA 3VRAA 2BS3A 3GMCA 2V3BA 1CBOA 2B9YA 2O9ZA 2YVGA 5EBKA 1QO8A 1BWCA 1S2QA 1NHPA 2H88A 3NKSA 3GWFA 2VVMA 3CTYA 2YAUA 4YTPA 1LV0A 1GALA 4EQRA 2Q7VA 4GCMA 1P2EA 2Z5YA 3NYFA 4EQXA 1L9CA 4EMWA 2ZZCA 5IQ1A 1PXCA 3CPIG 4H4ZA 1FEBA 3F8DA 2XFQA 5GSNA 1GRFA 3V3OA 5JCNA 2GB0A 4Z25A 2BK3A 4H4UA 5FS8A 1EL5A 4NTEA 1EL8A 2C73A 3LB8A 3CNDA 3KU9A 2V3AA 1PJ7A 4XWZA 1L9EA 1PJ5A 1D7LA 4EM4A 1PXAA 3GD4A 2GV8A 2PYXA 2JK6A 3BNUA 1KSSA 4D04A 5KVHA 1L9DA 1GOSA 3CGEA 4WX1A 1N4UA 4ICYA 3DA1A 1LJ1A 3AE4A 4CCQA 2BCPA 1Q9IA 3UKLA 3AEEA 3GDPA 1Y0PA 3DH9A 4K8DA 1DJNA 1KFYA 3AEBA 1D4DA 3UTHA 2GEWA 2R4EA 4Z44A 1Q1WA 2CFYA 1RP0A 2RGHA 4U2LA 3OC4A 3O0HA 3ALJA 3UOYA 1RSGA 1ZMDA 4DNAA 3UTGA 4YKGA 1JRYA 1Q1RA 1JRXA 1JEHA 4GRTA 1GXFA 3CNPA 4J34A 1GREA 4YT0A 4Z2UA 5KRQA 1D5TA 3C96A 2VQBA 3IHMA 4BURA 2ZBWA 1FEAA 1TYTA 2QAEA 3KVEA 4NZHA 4D03A 3RHAA 2V5ZA 1EL9A 3L1RA 1GT8A 1OJTA 1BGNA 3AE3A 3I6DA 4U8LA 3DGZA 4LA1A 2XVHA 3FIMB 4AOSA 3FPZA 2OLNA 2BK4A 1LTXR 3ITJA 3QFAA 3QSEA 1DOEA 2Q6UA 2X8HA 2YG3A 3G5SA 4YSYA 1CJCA 3VQRA 1YKJA 2X3NA 4GF7A 4EQWA 2C75A 2V6OA 3NRNA 3EAOA 3EF6A 3F8RA 3AEGA 3IF9A 3LZXA 4AT0A 1TRBA 2ACZA 3DK9A 2R0CA 1K0JA 2XLPA 2Y6QA 4OCGA 3BHKA 1CJ4A 2R4JA 2IVDA 4IV9A 2IIDA 3BHFA 1DOCA 3UCLA 1LPFA 3QSMA 2E4GA 2YLWA 3AE1A 4U2TA 4USQA 4X9NA 3QJ4A 2VRMA 2ZZBA 1QJDA 1NHRA 2GRTA 2RABA 4X9MA 5ER0A 1K0IA 5KWFA 1IJHA 4FX9A 3BI5A 3UKQA 1F8SA 3EPTA 2WP6A 5BULA 3PO7A 1H81A 4Z2TA 4Y4NA 4JQ9A 3NTAA 3QVPA 2WU5A 1NAAA 1QLBA 3VR8A 1NHSA 1RYIA 2VOUA 3V76A 1REOA 5JCKA 4K5SA 4BK1A 2GR3A 4H2PA 4BJZA 4Y4LA 4OPIA 1H82A 4BK2A 2XDOA 1NDAA 4A9WA 3BI2A 4OPUA 4X4JA 1NENA 1OJ9A 3DJGX 1PBEA 2NVKX 1IUXA 5TR3A 1CC6A 2BC0A 2BS4A 4OPGA 2XLUA 2A87A 1O5WA 1GRTA 2XCGA 3GYJA 3ATQA 3NK0X 2GMHA 3K7MX 1CJ2A 1BZLA 3CNTA 4HB9A 1IUTA 2WPEA 3KA7A 1ZOVA 3LJPA 4IA5A 1B4VA 2BS2A 2WOWA 2W0HA 4U8JA 4CNKA 2C65A 3LOVA 4B64A 2XVJA 4GDEA 1E1MA 1B37A 3CPJG 4J31A 3NT6A 4I58A 2AAQA 1K4QA 3P4PA 1GETA 1CC2A 1MO9A 2EQ6A 2B9WA 2OALA 2XLTA 2XVFA 2Y6RA 2YG6A 3ISHA 3UOZA 1CF3A 3CGDA
chains in the Genus database with same CATH superfamily
1IUUA 2CVJA 1M6IA 1D7YA 2YG7A 4A6NB 2C70A 3AECA 3CIRA 3KPKA 3LXDA 4GUVA 3UKHA 4A6NA 5KVIA 1FECA 2EQ8A 1IUWA 1S2YA 2CULA 1P2HA 1PJ6A 1PBCA 3HYXA 1V59A 5BVAA 5KXJA 1F8RA 2JBVA 1H83A 3AE8A 3VRBA 3RNMA 1O95A 3EANA 4CRTA 3Q6JA 1NG3A 4BV6A 4UP3A 4PAAA 2GR0A 2R0PA 4B69A 1KSUA 4U8MA 5JCMA 4YSZA 1ZKQA 5HXIA 1K0LA 3NN0X 2XFPA 3NH3X 3T0KA 3RP8A 2X8CA 1OJAA 2YG4A 3LADA 1M64A 1ZDLA 5J7XA 1F6MA 4O5UA 2OAMA 3II4A 3M12A 4H4VA 4UDPA 5LV9A 3DK8A 1W4XA 2BK5A 1BKWA 1TDKA 4J2WA 2NPXA 5KOWA 3AD7B 4CBQA 1DXLA 4BJYA 2YVJA 3FG2P 4NEVA 3AD8B 5IPYA 3GWDA 1JNRA 2ARDA 3T37A 2XFNA 2V60A 1VG0A 3GYXA 2WDQA 3F8PA 2FJAA 3CPHG 2FJEA 2TMDA 4A99A 2BXSA 3IHGA 5U1OA 1Y56B 2YR6A 3M13A 2YLSA 2GAGB 1XANA 3K7TA 3V3NA 3S61A 1D4EA 1X31B 3UKAA 4CY8A 3KKJA 1Y56A 3SQPA 1ZMCA 2R46A 1GTHA 3C4NA 2QA1A 2I0ZA 2R0GA 1PS9A 3Q9TA 1Z6LA 2VQ7A 3GDNA 2UZZA 1AOGA 3P9UA 4CY6A 2APGA 4Z43A 3ABVA 3URHA 2WP5A 4WCTA 3AEDA 4GDPA 4PABA 4J33A 1KNPA 1ELIA 3DJJA 4YWOA 4AT2A 2BYBA 2C7GA 3QVRA 2GQWA 4JY2A 1SEZA 3H8LA 5M0ZA 1GV4A 1GESA 1UKVG 4H4TA 1NPXA 4BK3A 5C2TA 1VDCA 3ICSA 5KMRA 3NYCA 1GPEA 2C64A 1OJDA 1E1KA 4OPTA 1EBDA 1H7WA 3NK1X 4ZN0A 2B7SA 4KPRA 2FBWA 1F8WA 2GMJA 4EIQA 4EIPA 3LZWA 4DGKA 4IA6A 4G6GA 5FS6A 4APNA 4OPCA 5KOXA 3K30A 2B76A 5CQFA 5M10A 2R45A 2YLXA 3UP5A 4C3YA 3AXBA 3CNJA 4UDRA 2WDRA 1COYA 1E7PA 1CC4A 2C3DA 2ZZ0A 2XVEA 3P4QA 3FMWA 1CJ3A 2VZ2A 2WPFA 2YLZA 1ZOYA 4FK1C 1XPQA 3CGBA 3COXA 2RGJA 4U2SA 3NTDA 3ALMA 5KMQA 1DOBA 4NWZA 1PHHA 2BC1A 2X8GA 2RGOA 4ADWA 1N4WA 4XWRA 3CGCA 4ECHA 4C74A 3CNSA 1HYUA 3HYVA 3B3RA 1JU2A 2JB2A 3DGHA 4H2QA 2BCGG 3AWIA 3ATRA 4AP3A 2WHDA 3ALLA 1GEUA 4G9KA 4RG4A 2YWLA 3UKFA 4OVIA 3G5RA 5IQ4A 4GAVA 4K5RA 2VRLA 1GRHA 2XVIA 2QA2A 1CL0A 1NEKA 2DKIA 3GD3A 1PBFA 5CKUA 2C66A 3KPFA 4G6HA 4HA6A 3GMBA 1NHQA 3NHOX 2WESA 5BUKA 2WOIA 3SZWA 2J3NA 2BRAA 2WPCA 2TPRA 2GQFA 2JAEA 3NGCX 4TM3A 2F5ZA 4H4YA 4Y4MA 2XLSA 3CMMA 2BXRA 1PN0A 2JB3A 2JB1A 4C5OA 4A7AA 4TM4A 1DJQA 2C76A 3SZFA 1VRQB 2X50A 2WP9A 5JCLA 3VR9A 2YM1A 3GRTA 4OPLA 2H89A 2XLRA 5HYMA 3CN8A 3REDA 4JY3A 3VRDB 4EMIA 4EMJA 5KMSA 2IVEA 1VG9A 2DKHA 4U8PA 2YR4A 3IWAA 1TDEA 4C77A 1YY5A 4B66A 1GRAA 3AE2A 4NTCA 2X99A 3ICRA 3FBSA 3QFBA 4AOXA 4TLZA 1H7XA 3SM8A 1H86A 3I3LA 3AYJA 2WBAA 1E1NA 5C3JA 3ADAB 5J60A 2C3CA 2BA9A 1EL7A 1PDHA 3GSIA 1FOHA 4H4RA 4J56A 4IVOB 5U25A 4H4XA 4OPDA 3QSSA 5U63A 3WE0A 4H2RA 1B8SA 2GR2A 4YSXA 1ONFA 3UP4A 4EQSA 1N1PA 4II2A 4JNAA 3IC9A 2Q0KA 2YG5A 1YQZA 4NNJA 5KMPA 1D4CA 3P4RA 4U8NA 5EB5A 1PXBA 1LQUA 2OA1A 2YLTA 1BGJA 4H4WA 3P4SA 1JNZA 4B67A 2XFUA 4I59A 3DMEA 3AE9A 5FS9A 5EB4A 4YTNA 3JSKA 1JRZA 2QCUA 1ZX9A 2A8XA 1TDNA 4ZCDA 2FJBA 3ZYXA 2GVCA 4J57A 1KF6A 1GERA 1IUVA 1OJCA 2HQMA 4ZCCA 3R9UA 2JKCA 4U8OA 4AP1A 4K2XA 2XFOA 1NG4A 1YQ3A 3NG7X 3P1WA 4H4PA 3S5WA 4Z26A 3GRSA 4YTMA 3NNEA 1PBDA 3AE7A 3C4AA 2CDUA 4B1BA 4A79A 2EQ9A 3KLJA 1E39A 1VQWA 3B6DA 1KNRA 4C3XA 4CNJA 1N4VA 1ZK7A 3ICTA 3AYIA 1GRBA 4YXDA 4U8KA 1H84A 2WETA 4XXGA 1JOAA 2EQ7A 2OLOA 2YLRA 3AEAA 3SGLA 1FCDA 1L0VA 1TYPA 4JN9A 5BRTA 5L46A 3BI4A 3UTFA 2B9XA 1S3EA 2R9ZA 4K22A 3SX6A 3NN6X 3H8IA 1F3PA 4LIIA 2YQUA 5DBJA 1O94A 5GRTA 3RP7A 1IUSA 2E1MA 2XYOA 3DJEA 2VVLG 4USRA 4RSLA 2AR8A 4TLXA 3H4KA 3M0OA 2GAHB 2WU2A 3AE5A 4GR1A 1E1LA 2B7RA 3BNMA 2VVLA 5EOWA 4MJWA 4TM0A 4A65A 3D8XA 3AEFA 3NLCA 1LVLA 3AB1A 2YR5A 3KD9A 3AYLA 1MXTA 3E1TA 3AE6A 3UOXA 1B5QA 1DNCA 3NK2X 2E5VA 1E6EA 5HY5A 4H2NA 4IVMB 4NTDA 4B65A 4H4SA 5JCIA 4EM3A 3SFEA 4E0VA 3K7QX 4II3A 1XDIA 1CHUA 1LQTA 4FDCB 4B68A 2Q0LA 1BF3A 2FJDA 1TDFA 1YQ4A 3ZDNA 3SZ0A 1H6VA 4N9XA 4H4QA 3D1CA 1TDOA 4FK1A 4KX6A 2GR1A 3DJDA 4NEWA 2A89A 4UDQA 4YSHA 3HZLA 3RP6A 3SFDA 3GYIA 1XHCA 4REKA 4A5LA 4B63A 2BABA 4P9SA 2WS3A 4TM1A 1ZP0A 3UTEA 1KDGA 3G5QA 4RG3A 2C67A 1GNDA 1FL2A 4YKFA 5FS7A 4CCRA 2GF3A 1DODA 4LU6A 1GTEA 4O5QA 1GSNA 3UKKA 2BACA 4Z2RA 1GRGA 2AQJA 2YVFA 4M52A 3UOVA 2WQYA 4DSHA 3AD9B 2YM2A 3OZ2A 3NYEA 4J36A 4K7ZA 4JDRA 2WDVA 3PS9A 1PBBA 3NIXA 2Z5XA 4H7UA 1ZY8A 3PVCA 4H50A 2WOVA 4JNQA 4Z24A 4DSGA 2WEUA 2PHHA 4U8IA 1MOKA 3DK4A 3T2YA 5HHFA 2C72A 2GH5A 3L8KA 5FMHA 2V61A 3UKPA 1S3BA 3VRAA 2BS3A 3GMCA 2V3BA 3SXIA 1CBOA 2B9YA 2O9ZA 2YVGA 5EBKA 1QO8A 1BWCA 1S2QA 1NHPA 2H88A 3NKSA 3GWFA 2VVMA 3CTYA 2YAUA 4YTPA 1LV0A 1GALA 4EQRA 2Q7VA 4GCMA 1P2EA 3T14A 2Z5YA 3NYFA 4EQXA 1L9CA 4EMWA 2ZZCA 5IQ1A 1PXCA 3CPIG 4H4ZA 1FEBA 3F8DA 2XFQA 5GSNA 1GRFA 3V3OA 5JCNA 2GB0A 4Z25A 2BK3A 4H4UA 5FS8A 1EL5A 4NTEA 1EL8A 2C73A 3LB8A 3CNDA 3KU9A 2V3AA 1PJ7A 4XWZA 1L9EA 1PJ5A 1D7LA 4EM4A 1PXAA 3GD4A 2GV8A 2PYXA 2JK6A 3BNUA 1KSSA 4D04A 5KVHA 1L9DA 1GOSA 3CGEA 4WX1A 1N4UA 4ICYA 3SYIA 2C4CA 3DA1A 1LJ1A 3AE4A 4CCQA 2BCPA 1Q9IA 3UKLA 3AEEA 3GDPA 1Y0PA 3DH9A 4K8DA 1DJNA 1KFYA 4G74A 3AEBA 1D4DA 3UTHA 2GEWA 2R4EA 4Z44A 1Q1WA 3T2KA 2CFYA 1RP0A 2RGHA 4U2LA 3OC4A 3O0HA 3ALJA 3UOYA 1RSGA 1ZMDA 4DNAA 3UTGA 4YKGA 1JRYA 1Q1RA 1JRXA 1JEHA 4GRTA 1GXFA 3CNPA 4J34A 1GREA 4YT0A 4Z2UA 5KRQA 1D5TA 3C96A 2VQBA 3IHMA 4BURA 2ZBWA 1FEAA 1TYTA 2QAEA 3KVEA 4NZHA 4D03A 3RHAA 2V5ZA 1EL9A 3L1RA 1GT8A 1OJTA 1BGNA 3AE3A 3I6DA 4U8LA 3DGZA 4LA1A 2XVHA 3FIMB 4AOSA 3FPZA 2OLNA 2BK4A 1LTXR 3ITJA 3QFAA 3QSEA 1DOEA 2Q6UA 2X8HA 2YG3A 3G5SA 4YSYA 1CJCA 3VQRA 1YKJA 2X3NA 4GF7A 4EQWA 2C75A 2V6OA 3NRNA 3EAOA 3EF6A 3F8RA 3AEGA 3IF9A 3LZXA 4AT0A 1TRBA 2ACZA 3DK9A 2R0CA 1K0JA 2XLPA 2Y6QA 4OCGA 3BHKA 3HYWA 1CJ4A 2R4JA 2IVDA 4IV9A 2IIDA 3BHFA 1DOCA 3UCLA 1LPFA 3QSMA 2E4GA 2YLWA 3AE1A 4U2TA 4USQA 4X9NA 3QJ4A 2VRMA 2ZZBA 1QJDA 1NHRA 2GRTA 2RABA 4X9MA 5ER0A 1K0IA 3SZCA 5KWFA 1IJHA 4FX9A 3BI5A 3UKQA 1F8SA 3EPTA 3SY4A 2WP6A 5BULA 3PO7A 1H81A 4Z2TA 4Y4NA 4JQ9A 3NTAA 3QVPA 2WU5A 1NAAA 1QLBA 3VR8A 1NHSA 1RYIA 2VOUA 3V76A 1REOA 5JCKA 4K5SA 4BK1A 2GR3A 4H2PA 4BJZA 4Y4LA 4OPIA 1H82A 4BK2A 2XDOA 1NDAA 4A9WA 3BI2A 4G73A 4OPUA 4X4JA 1NENA 1OJ9A 3DJGX 1PBEA 2NVKX 1IUXA 5TR3A 1CC6A 2BC0A 2BS4A 4OPGA 2XLUA 2A87A 1O5WA 1GRTA 2XCGA 3GYJA 3ATQA 3NK0X 2GMHA 2BRYA 3K7MX 1CJ2A 1BZLA 5KNLA 3CNTA 4HB9A 4GAPA 1IUTA 2WPEA 3KA7A 3T2ZA 1ZOVA 3LJPA 4IA5A 1B4VA 2BS2A 2WOWA 2W0HA 4U8JA 4CNKA 2C65A 3LOVA 4B64A 2XVJA 4GDEA 1E1MA 1B37A 3CPJG 4J31A 3NT6A 4I58A 2AAQA 1K4QA 3P4PA 1GETA 1CC2A 1MO9A 2EQ6A 2B9WA 2OALA 2XLTA 2XVFA 2Y6RA 2YG6A 3ISHA 3UOZA 1CF3A 3CGDA 3T31A
chains in the Genus database with same CATH topology
1IUUA 2CVJA 1M6IA 1D7YA 2YG7A 4A6NB 2C70A 3AECA 3CIRA 3KPKA 3LXDA 4GUVA 3UKHA 4A6NA 5KVIA 1FECA 2EQ8A 1IUWA 1S2YA 2CULA 1P2HA 1PJ6A 1PBCA 3HYXA 1V59A 5BVAA 5KXJA 1F8RA 2JBVA 1H83A 3AE8A 3VRBA 3RNMA 1O95A 3EANA 4CRTA 3Q6JA 1NG3A 4BV6A 4UP3A 4PAAA 2GR0A 2R0PA 4B69A 1KSUA 4U8MA 5JCMA 4YSZA 1ZKQA 5HXIA 1K0LA 3NN0X 2XFPA 3NH3X 3T0KA 3RP8A 2X8CA 1OJAA 2YG4A 3LADA 1M64A 1ZDLA 5J7XA 1F6MA 4O5UA 2OAMA 3II4A 3M12A 4H4VA 4UDPA 5LV9A 3DK8A 1W4XA 2BK5A 1BKWA 1TDKA 4J2WA 2NPXA 5KOWA 3AD7B 4CBQA 1DXLA 4BJYA 2YVJA 3FG2P 4NEVA 3AD8B 5IPYA 3GWDA 1JNRA 2ARDA 3T37A 2XFNA 2V60A 1VG0A 3GYXA 2WDQA 3F8PA 2FJAA 3CPHG 2FJEA 2TMDA 4A99A 2BXSA 3IHGA 5U1OA 1Y56B 2YR6A 3M13A 2YLSA 2GAGB 1XANA 3K7TA 3V3NA 3S61A 1D4EA 1X31B 3UKAA 4CY8A 3KKJA 1Y56A 3SQPA 1ZMCA 2R46A 1GTHA 3C4NA 2QA1A 2I0ZA 2R0GA 1PS9A 3Q9TA 1Z6LA 2VQ7A 3GDNA 2UZZA 1AOGA 3P9UA 4CY6A 2APGA 4Z43A 3ABVA 3URHA 2WP5A 4WCTA 3AEDA 4GDPA 4PABA 4J33A 1KNPA 1ELIA 3DJJA 4YWOA 4AT2A 2BYBA 2C7GA 3QVRA 2GQWA 4JY2A 1SEZA 3H8LA 5M0ZA 1GV4A 1GESA 1UKVG 4H4TA 1NPXA 4BK3A 5C2TA 1VDCA 3ICSA 5KMRA 3NYCA 1GPEA 2C64A 1OJDA 1E1KA 4OPTA 1EBDA 1H7WA 3NK1X 4ZN0A 2B7SA 4KPRA 2FBWA 1F8WA 2GMJA 4EIQA 4EIPA 3LZWA 4DGKA 4IA6A 4G6GA 5FS6A 4APNA 4OPCA 5KOXA 3K30A 2B76A 5CQFA 5M10A 2R45A 2YLXA 3UP5A 4C3YA 3AXBA 3CNJA 4UDRA 2WDRA 1COYA 1E7PA 1CC4A 2C3DA 2ZZ0A 2XVEA 3P4QA 3FMWA 1CJ3A 2VZ2A 2WPFA 2YLZA 1ZOYA 4FK1C 1XPQA 3CGBA 3COXA 2RGJA 4U2SA 3NTDA 3ALMA 5KMQA 1DOBA 4NWZA 1PHHA 2BC1A 2X8GA 2RGOA 4ADWA 1N4WA 4XWRA 3CGCA 4ECHA 4C74A 3CNSA 1HYUA 3HYVA 3B3RA 1JU2A 2JB2A 3DGHA 4H2QA 2BCGG 3AWIA 3ATRA 4AP3A 2WHDA 3ALLA 1GEUA 4G9KA 4RG4A 2YWLA 3UKFA 4OVIA 3G5RA 5IQ4A 4GAVA 4K5RA 2VRLA 1GRHA 2XVIA 2QA2A 1CL0A 1NEKA 2DKIA 3GD3A 1PBFA 5CKUA 2C66A 3KPFA 4G6HA 4HA6A 3GMBA 1NHQA 3NHOX 2WESA 5BUKA 2WOIA 3SZWA 2J3NA 2BRAA 2WPCA 2TPRA 2GQFA 2JAEA 3NGCX 4TM3A 2F5ZA 4H4YA 4Y4MA 2XLSA 3CMMA 2BXRA 1PN0A 2JB3A 2JB1A 4C5OA 4A7AA 4TM4A 1DJQA 2C76A 3SZFA 1VRQB 2X50A 2WP9A 5JCLA 3VR9A 2YM1A 3GRTA 4OPLA 2H89A 2XLRA 5HYMA 3CN8A 3REDA 4JY3A 3VRDB 4EMIA 4EMJA 5KMSA 2IVEA 1VG9A 2DKHA 4U8PA 2YR4A 3IWAA 1TDEA 4C77A 1YY5A 4B66A 1GRAA 3AE2A 4NTCA 2X99A 3ICRA 3FBSA 3QFBA 4AOXA 4TLZA 1H7XA 3SM8A 1H86A 3I3LA 3AYJA 2WBAA 1E1NA 5C3JA 3ADAB 5J60A 2C3CA 2BA9A 1EL7A 1PDHA 3GSIA 1FOHA 4H4RA 4J56A 4IVOB 5U25A 4H4XA 4OPDA 3QSSA 5U63A 3WE0A 4H2RA 1B8SA 2GR2A 4YSXA 1ONFA 3UP4A 4EQSA 1N1PA 4II2A 4JNAA 3IC9A 2Q0KA 2YG5A 1YQZA 4NNJA 5KMPA 1D4CA 3P4RA 4U8NA 5EB5A 1PXBA 1LQUA 2OA1A 2YLTA 1BGJA 4H4WA 3P4SA 1JNZA 4B67A 2XFUA 4I59A 3DMEA 3AE9A 5FS9A 5EB4A 4YTNA 3JSKA 1JRZA 2QCUA 1ZX9A 2A8XA 1TDNA 4ZCDA 2FJBA 3ZYXA 2GVCA 4J57A 1KF6A 1GERA 1IUVA 1OJCA 2HQMA 4ZCCA 3R9UA 2JKCA 4U8OA 4AP1A 4K2XA 2XFOA 1NG4A 1YQ3A 3NG7X 3P1WA 4H4PA 3S5WA 4Z26A 3GRSA 4YTMA 3NNEA 1PBDA 3AE7A 3C4AA 2CDUA 4B1BA 4A79A 2EQ9A 3KLJA 1E39A 1VQWA 3B6DA 1KNRA 4C3XA 4CNJA 1N4VA 1ZK7A 3ICTA 3AYIA 1GRBA 4YXDA 4U8KA 1H84A 2WETA 4XXGA 1JOAA 2EQ7A 2OLOA 2YLRA 3AEAA 3SGLA 1FCDA 1L0VA 1TYPA 4JN9A 5BRTA 5L46A 3BI4A 3UTFA 2B9XA 1S3EA 2R9ZA 4K22A 3SX6A 3NN6X 3H8IA 1F3PA 4LIIA 2YQUA 5DBJA 1O94A 5GRTA 3RP7A 1IUSA 2E1MA 2XYOA 3DJEA 2VVLG 4USRA 4RSLA 2AR8A 4TLXA 3H4KA 3M0OA 2GAHB 2WU2A 3AE5A 4GR1A 1E1LA 2B7RA 3BNMA 2VVLA 5EOWA 4MJWA 4TM0A 4A65A 3D8XA 3AEFA 3NLCA 1LVLA 3AB1A 2YR5A 3KD9A 3AYLA 1MXTA 3E1TA 3AE6A 3UOXA 1B5QA 1DNCA 3NK2X 2E5VA 1E6EA 5HY5A 4H2NA 4IVMB 4NTDA 4B65A 4H4SA 5JCIA 4EM3A 3SFEA 4E0VA 3K7QX 4II3A 1XDIA 1CHUA 1LQTA 4FDCB 4B68A 2Q0LA 1BF3A 2FJDA 1TDFA 1YQ4A 3ZDNA 3SZ0A 1H6VA 4N9XA 4H4QA 3D1CA 1TDOA 4FK1A 4KX6A 2GR1A 3DJDA 4NEWA 2A89A 4UDQA 4YSHA 3HZLA 3RP6A 3SFDA 3GYIA 1XHCA 4REKA 4A5LA 4B63A 2BABA 4P9SA 2WS3A 4TM1A 1ZP0A 3UTEA 1KDGA 3G5QA 4RG3A 2C67A 1GNDA 1FL2A 4YKFA 5FS7A 4CCRA 2GF3A 1DODA 4LU6A 1GTEA 4O5QA 1GSNA 3UKKA 2BACA 4Z2RA 1GRGA 2AQJA 2YVFA 4M52A 3UOVA 2WQYA 4DSHA 3AD9B 2YM2A 3OZ2A 3NYEA 4J36A 4K7ZA 4JDRA 2WDVA 3PS9A 1PBBA 3NIXA 2Z5XA 4H7UA 1ZY8A 3PVCA 4H50A 2WOVA 4JNQA 4Z24A 4DSGA 2WEUA 2PHHA 4U8IA 1MOKA 3DK4A 3T2YA 5HHFA 2C72A 2GH5A 3L8KA 5FMHA 2V61A 3UKPA 1S3BA 3VRAA 2BS3A 3GMCA 2V3BA 3SXIA 1CBOA 2B9YA 2O9ZA 2YVGA 5EBKA 1QO8A 1BWCA 1S2QA 1NHPA 2H88A 3NKSA 3GWFA 2VVMA 3CTYA 2YAUA 4YTPA 1LV0A 1GALA 4EQRA 2Q7VA 4GCMA 1P2EA 3T14A 2Z5YA 3NYFA 4EQXA 1L9CA 4EMWA 2ZZCA 5IQ1A 1PXCA 3CPIG 4H4ZA 1FEBA 3F8DA 2XFQA 5GSNA 1GRFA 3V3OA 5JCNA 2GB0A 4Z25A 2BK3A 4H4UA 5FS8A 1EL5A 4NTEA 1EL8A 2C73A 3LB8A 3CNDA 3KU9A 2V3AA 1PJ7A 4XWZA 1L9EA 1PJ5A 1D7LA 4EM4A 1PXAA 3GD4A 2GV8A 2PYXA 2JK6A 3BNUA 1KSSA 4D04A 5KVHA 1L9DA 1GOSA 3CGEA 4WX1A 1N4UA 4ICYA 3SYIA 2C4CA 3DA1A 1LJ1A 3AE4A 4CCQA 2BCPA 1Q9IA 3UKLA 3AEEA 3GDPA 1Y0PA 3DH9A 4K8DA 1DJNA 1KFYA 4G74A 3AEBA 1D4DA 3UTHA 2GEWA 2R4EA 4Z44A 1Q1WA 3T2KA 2CFYA 1RP0A 2RGHA 4U2LA 3OC4A 3O0HA 3ALJA 3UOYA 1RSGA 1ZMDA 4DNAA 3UTGA 4YKGA 1JRYA 1Q1RA 1JRXA 1JEHA 4GRTA 1GXFA 3CNPA 4J34A 1GREA 4YT0A 4Z2UA 5KRQA 1D5TA 3C96A 2VQBA 3IHMA 4BURA 2ZBWA 1FEAA 1TYTA 2QAEA 3KVEA 4NZHA 4D03A 3RHAA 2V5ZA 1EL9A 3L1RA 1GT8A 1OJTA 1BGNA 3AE3A 3I6DA 4U8LA 3DGZA 4LA1A 2XVHA 3FIMB 4AOSA 3FPZA 2OLNA 2BK4A 1LTXR 3ITJA 3QFAA 3QSEA 1DOEA 2Q6UA 2X8HA 2YG3A 3G5SA 4YSYA 1CJCA 3VQRA 1YKJA 2X3NA 4GF7A 4EQWA 2C75A 2V6OA 3NRNA 3EAOA 3EF6A 3F8RA 3AEGA 3IF9A 3LZXA 4AT0A 1TRBA 2ACZA 3DK9A 2R0CA 1K0JA 2XLPA 2Y6QA 4OCGA 3BHKA 3HYWA 1CJ4A 2R4JA 2IVDA 4IV9A 2IIDA 3BHFA 1DOCA 3UCLA 1LPFA 3QSMA 2E4GA 2YLWA 3AE1A 4U2TA 4USQA 4X9NA 3QJ4A 2VRMA 2ZZBA 1QJDA 1NHRA 2GRTA 2RABA 4X9MA 5ER0A 1K0IA 3SZCA 5KWFA 1IJHA 4FX9A 3BI5A 3UKQA 1F8SA 3EPTA 3SY4A 2WP6A 5BULA 3PO7A 1H81A 4Z2TA 4Y4NA 4JQ9A 3NTAA 3QVPA 2WU5A 1NAAA 1QLBA 3VR8A 1NHSA 1RYIA 2VOUA 3V76A 1REOA 5JCKA 4K5SA 4BK1A 2GR3A 4H2PA 4BJZA 4Y4LA 4OPIA 1H82A 4BK2A 2XDOA 1NDAA 4A9WA 3BI2A 4G73A 4OPUA 4X4JA 1NENA 1OJ9A 3DJGX 1PBEA 2NVKX 1IUXA 5TR3A 1CC6A 2BC0A 2BS4A 4OPGA 2XLUA 2A87A 1O5WA 1GRTA 2XCGA 3GYJA 3ATQA 3NK0X 2GMHA 2BRYA 3K7MX 1CJ2A 1BZLA 5KNLA 3CNTA 4HB9A 4GAPA 1IUTA 2WPEA 3KA7A 3T2ZA 1ZOVA 3LJPA 4IA5A 1B4VA 2BS2A 2WOWA 2W0HA 4U8JA 4CNKA 2C65A 3LOVA 4B64A 2XVJA 4GDEA 1E1MA 1B37A 3CPJG 4J31A 3NT6A 4I58A 2AAQA 1K4QA 3P4PA 1GETA 1CC2A 1MO9A 2EQ6A 2B9WA 2OALA 2XLTA 2XVFA 2Y6RA 2YG6A 3ISHA 3UOZA 1CF3A 3CGDA 3T31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUU A;  2CVJ A;  1M6I A;  1D7Y A;  2YG7 A;  4A6N B;  2C70 A;  3AEC A;  3CIR A;  3LXD A;  4GUV A;  3UKH A;  4A6N A;  5KVI A;  1FEC A;  2EQ8 A;  1IUW A;  1S2Y A;  2CUL A;  1P2H A;  1PJ6 A;  1PBC A;  1V59 A;  5BVA A;  5KXJ A;  1F8R A;  2JBV A;  1H83 A;  3AE8 A;  3VRB A;  3RNM A;  1O95 A;  3EAN A;  4CRT A;  3Q6J A;  1NG3 A;  4BV6 A;  4UP3 A;  4PAA A;  2GR0 A;  2R0P A;  4B69 A;  1KSU A;  4U8M A;  5JCM A;  4YSZ A;  1ZKQ A;  5HXI A;  1K0L A;  3NN0 X;  2XFP A;  3NH3 X;  3RP8 A;  2X8C A;  1OJA A;  2YG4 A;  3LAD A;  1M64 A;  1ZDL A;  5J7X A;  1F6M A;  4O5U A;  2OAM A;  3II4 A;  3M12 A;  4H4V A;  4UDP A;  5LV9 A;  3DK8 A;  1W4X A;  2BK5 A;  1BKW A;  1TDK A;  4J2W A;  2NPX A;  5KOW A;  3AD7 B;  4CBQ A;  1DXL A;  4BJY A;  2YVJ A;  3FG2 P;  4NEV A;  3AD8 B;  5IPY A;  3GWD A;  1JNR A;  2ARD A;  3T37 A;  2XFN A;  2V60 A;  1VG0 A;  2WDQ A;  3F8P A;  2FJA A;  3CPH G;  2FJE A;  2TMD A;  4A99 A;  2BXS A;  3IHG A;  5U1O A;  1Y56 B;  2YR6 A;  3M13 A;  2YLS A;  2GAG B;  1XAN A;  3K7T A;  3V3N A;  3S61 A;  1D4E A;  1X31 B;  3UKA A;  4CY8 A;  3KKJ A;  1Y56 A;  3SQP A;  1ZMC A;  2R46 A;  1GTH A;  3C4N A;  2QA1 A;  2I0Z A;  2R0G A;  1PS9 A;  3Q9T A;  1Z6L A;  2VQ7 A;  3GDN A;  2UZZ A;  1AOG A;  3P9U A;  4CY6 A;  2APG A;  4Z43 A;  3ABV A;  3URH A;  2WP5 A;  4WCT A;  3AED A;  4GDP A;  4PAB A;  4J33 A;  1KNP A;  1ELI A;  3DJJ A;  4YWO A;  4AT2 A;  2BYB A;  2C7G A;  3QVR A;  2GQW A;  4JY2 A;  1SEZ A;  3H8L A;  5M0Z A;  1GV4 A;  1GES A;  1UKV G;  4H4T A;  1NPX A;  4BK3 A;  5C2T A;  1VDC A;  3ICS A;  3NYC A;  1GPE A;  2C64 A;  1OJD A;  1E1K A;  4OPT A;  1EBD A;  1H7W A;  3NK1 X;  4ZN0 A;  2B7S A;  4KPR A;  2FBW A;  1F8W A;  2GMJ A;  4EIQ A;  4EIP A;  3LZW A;  4DGK A;  4IA6 A;  5FS6 A;  4APN A;  4OPC A;  5KOX A;  3K30 A;  2B76 A;  5CQF A;  5M10 A;  2R45 A;  2YLX A;  3UP5 A;  4C3Y A;  3AXB A;  3CNJ A;  4UDR A;  2WDR A;  1COY A;  1E7P A;  1CC4 A;  2C3D A;  2ZZ0 A;  2XVE A;  3P4Q A;  3FMW A;  1CJ3 A;  2VZ2 A;  2WPF A;  2YLZ A;  1ZOY A;  4FK1 C;  1XPQ A;  3CGB A;  3COX A;  2RGJ A;  4U2S A;  3NTD A;  3ALM A;  1DOB A;  1PHH A;  2BC1 A;  2X8G A;  2RGO A;  4ADW A;  1N4W A;  4XWR A;  3CGC A;  4ECH A;  4C74 A;  3CNS A;  1HYU A;  3B3R A;  1JU2 A;  2JB2 A;  3DGH A;  4H2Q A;  2BCG G;  3AWI A;  3ATR A;  4AP3 A;  2WHD A;  3ALL A;  1GEU A;  4RG4 A;  2YWL A;  3UKF A;  4OVI A;  3G5R A;  5IQ4 A;  4K5R A;  2VRL A;  1GRH A;  2XVI A;  2QA2 A;  1CL0 A;  1NEK A;  2DKI A;  3GD3 A;  1PBF A;  5CKU A;  2C66 A;  3KPF A;  4HA6 A;  3GMB A;  1NHQ A;  3NHO X;  2WES A;  5BUK A;  2WOI A;  2J3N A;  2WPC A;  2TPR A;  2GQF A;  2JAE A;  3NGC X;  4TM3 A;  2F5Z A;  4H4Y A;  4Y4M A;  2XLS A;  2BXR A;  1PN0 A;  2JB3 A;  2JB1 A;  4C5O A;  4A7A A;  4TM4 A;  1DJQ A;  2C76 A;  1VRQ B;  2X50 A;  2WP9 A;  5JCL A;  3VR9 A;  2YM1 A;  3GRT A;  4OPL A;  2H89 A;  2XLR A;  5HYM A;  3CN8 A;  3RED A;  4JY3 A;  3VRD B;  4EMI A;  4EMJ A;  2IVE A;  1VG9 A;  2DKH A;  4U8P A;  2YR4 A;  3IWA A;  1TDE A;  4C77 A;  1YY5 A;  4B66 A;  1GRA A;  3AE2 A;  4NTC A;  2X99 A;  3ICR A;  3FBS A;  3QFB A;  4AOX A;  4TLZ A;  1H7X A;  3SM8 A;  1H86 A;  3I3L A;  3AYJ A;  2WBA A;  1E1N A;  5C3J A;  3ADA B;  5J60 A;  2C3C A;  2BA9 A;  1EL7 A;  1PDH A;  3GSI A;  1FOH A;  4H4R A;  4J56 A;  4IVO B;  5U25 A;  4H4X A;  4OPD A;  3QSS A;  5U63 A;  3WE0 A;  4H2R A;  1B8S A;  2GR2 A;  4YSX A;  1ONF A;  3UP4 A;  4EQS A;  1N1P A;  4JNA A;  3IC9 A;  2Q0K A;  2YG5 A;  1YQZ A;  1D4C A;  3P4R A;  4U8N A;  5EB5 A;  1PXB A;  1LQU A;  2OA1 A;  2YLT A;  1BGJ A;  4H4W A;  3P4S A;  1JNZ A;  4B67 A;  2XFU A;  4I59 A;  3DME A;  3AE9 A;  5FS9 A;  5EB4 A;  4YTN A;  3JSK A;  1JRZ A;  2QCU A;  1ZX9 A;  2A8X A;  1TDN A;  4ZCD A;  2FJB A;  3ZYX A;  2GVC A;  4J57 A;  1KF6 A;  1GER A;  1IUV A;  1OJC A;  2HQM A;  4ZCC A;  3R9U A;  2JKC A;  4U8O A;  4AP1 A;  4K2X A;  2XFO A;  1NG4 A;  1YQ3 A;  3NG7 X;  3P1W A;  4H4P A;  3S5W A;  4Z26 A;  3GRS A;  4YTM A;  3NNE A;  1PBD A;  3AE7 A;  3C4A A;  2CDU A;  4B1B A;  4A79 A;  2EQ9 A;  3KLJ A;  1E39 A;  1VQW A;  3B6D A;  1KNR A;  4C3X A;  4CNJ A;  1N4V A;  1ZK7 A;  3ICT A;  3AYI A;  1GRB A;  4YXD A;  4U8K A;  1H84 A;  2WET A;  4XXG A;  1JOA A;  2EQ7 A;  2OLO A;  2YLR A;  3AEA A;  3SGL A;  1FCD A;  1L0V A;  1TYP A;  4JN9 A;  5BRT A;  5L46 A;  3BI4 A;  3UTF A;  2B9X A;  1S3E A;  2R9Z A;  4K22 A;  3NN6 X;  3H8I A;  1F3P A;  4LII A;  2YQU A;  5DBJ A;  1O94 A;  5GRT A;  3RP7 A;  1IUS A;  2E1M A;  2XYO A;  3DJE A;  2VVL G;  4USR A;  4RSL A;  2AR8 A;  4TLX A;  3H4K A;  3M0O A;  2GAH B;  2WU2 A;  3AE5 A;  4GR1 A;  1E1L A;  2B7R A;  3BNM A;  2VVL A;  5EOW A;  4MJW A;  4TM0 A;  4A65 A;  3D8X A;  3AEF A;  3NLC A;  1LVL A;  3AB1 A;  2YR5 A;  3KD9 A;  3AYL A;  1MXT A;  3E1T A;  3AE6 A;  3UOX A;  1B5Q A;  1DNC A;  3NK2 X;  2E5V A;  1E6E A;  5HY5 A;  4H2N A;  4IVM B;  4NTD A;  4B65 A;  4H4S A;  5JCI A;  4EM3 A;  3SFE A;  4E0V A;  3K7Q X;  1XDI A;  1CHU A;  1LQT A;  4FDC B;  4B68 A;  2Q0L A;  1BF3 A;  2FJD A;  1TDF A;  1YQ4 A;  3ZDN A;  1H6V A;  4N9X A;  4H4Q A;  3D1C A;  1TDO A;  4FK1 A;  4KX6 A;  2GR1 A;  3DJD A;  4NEW A;  2A89 A;  4UDQ A;  4YSH A;  3HZL A;  3RP6 A;  3SFD A;  3GYI A;  1XHC A;  4REK A;  4A5L A;  4B63 A;  2BAB A;  4P9S A;  2WS3 A;  4TM1 A;  1ZP0 A;  3UTE A;  1KDG A;  3G5Q A;  4RG3 A;  2C67 A;  1GND A;  1FL2 A;  4YKF A;  5FS7 A;  4CCR A;  2GF3 A;  1DOD A;  4LU6 A;  1GTE A;  4O5Q A;  1GSN A;  3UKK A;  2BAC A;  4Z2R A;  1GRG A;  2AQJ A;  2YVF A;  4M52 A;  3UOV A;  2WQY A;  4DSH A;  3AD9 B;  2YM2 A;  3OZ2 A;  3NYE A;  4J36 A;  4K7Z A;  4JDR A;  2WDV A;  3PS9 A;  1PBB A;  3NIX A;  2Z5X A;  4H7U A;  1ZY8 A;  3PVC A;  4H50 A;  2WOV A;  4JNQ A;  4Z24 A;  4DSG A;  2WEU A;  2PHH A;  4U8I A;  1MOK A;  3DK4 A;  5HHF A;  2C72 A;  2GH5 A;  3L8K A;  5FMH A;  2V61 A;  3UKP A;  1S3B A;  3VRA A;  2BS3 A;  3GMC A;  2V3B A;  1CBO A;  2B9Y A;  2O9Z A;  2YVG A;  5EBK A;  1QO8 A;  1BWC A;  1S2Q A;  1NHP A;  2H88 A;  3NKS A;  3GWF A;  2VVM A;  3CTY A;  2YAU A;  4YTP A;  1LV0 A;  1GAL A;  4EQR A;  2Q7V A;  4GCM A;  1P2E A;  2Z5Y A;  3NYF A;  4EQX A;  1L9C A;  4EMW A;  2ZZC A;  5IQ1 A;  1PXC A;  3CPI G;  4H4Z A;  1FEB A;  3F8D A;  2XFQ A;  5GSN A;  1GRF A;  3V3O A;  5JCN A;  2GB0 A;  4Z25 A;  2BK3 A;  4H4U A;  5FS8 A;  1EL5 A;  4NTE A;  1EL8 A;  2C73 A;  3LB8 A;  3CND A;  3KU9 A;  2V3A A;  1PJ7 A;  4XWZ A;  1L9E A;  1PJ5 A;  1D7L A;  4EM4 A;  1PXA A;  3GD4 A;  2GV8 A;  2PYX A;  2JK6 A;  3BNU A;  1KSS A;  4D04 A;  5KVH A;  1L9D A;  1GOS A;  3CGE A;  4WX1 A;  1N4U A;  4ICY A;  3DA1 A;  1LJ1 A;  3AE4 A;  4CCQ A;  2BCP A;  1Q9I A;  3UKL A;  3AEE A;  3GDP A;  1Y0P A;  3DH9 A;  4K8D A;  1DJN A;  1KFY A;  3AEB A;  1D4D A;  3UTH A;  2GEW A;  2R4E A;  4Z44 A;  1Q1W A;  2CFY A;  1RP0 A;  2RGH A;  4U2L A;  3OC4 A;  3O0H A;  3ALJ A;  3UOY A;  1RSG A;  1ZMD A;  4DNA A;  3UTG A;  4YKG A;  1JRY A;  1Q1R A;  1JRX A;  1JEH A;  4GRT A;  1GXF A;  3CNP A;  4J34 A;  1GRE A;  4YT0 A;  4Z2U A;  5KRQ A;  1D5T A;  3C96 A;  2VQB A;  3IHM A;  4BUR A;  2ZBW A;  1FEA A;  1TYT A;  2QAE A;  3KVE A;  4NZH A;  4D03 A;  3RHA A;  2V5Z A;  1EL9 A;  3L1R A;  1GT8 A;  1OJT A;  1BGN A;  3AE3 A;  3I6D A;  4U8L A;  3DGZ A;  4LA1 A;  2XVH A;  3FIM B;  4AOS A;  3FPZ A;  2OLN A;  2BK4 A;  1LTX R;  3ITJ A;  3QFA A;  3QSE A;  1DOE A;  2Q6U A;  2X8H A;  2YG3 A;  3G5S A;  4YSY A;  1CJC A;  3VQR A;  1YKJ A;  2X3N A;  4GF7 A;  4EQW A;  2C75 A;  2V6O A;  3NRN A;  3EAO A;  3EF6 A;  3F8R A;  3AEG A;  3IF9 A;  3LZX A;  4AT0 A;  1TRB A;  2ACZ A;  3DK9 A;  2R0C A;  1K0J A;  2XLP A;  2Y6Q A;  4OCG A;  3BHK A;  1CJ4 A;  2R4J A;  2IVD A;  4IV9 A;  2IID A;  3BHF A;  1DOC A;  3UCL A;  1LPF A;  3QSM A;  2E4G A;  2YLW A;  3AE1 A;  4U2T A;  4USQ A;  4X9N A;  3QJ4 A;  2VRM A;  2ZZB A;  1QJD A;  1NHR A;  2GRT A;  2RAB A;  4X9M A;  5ER0 A;  1K0I A;  5KWF A;  1IJH A;  4FX9 A;  3BI5 A;  3UKQ A;  1F8S A;  3EPT A;  2WP6 A;  5BUL A;  3PO7 A;  1H81 A;  4Z2T A;  4Y4N A;  4JQ9 A;  3NTA A;  3QVP A;  2WU5 A;  1NAA A;  1QLB A;  3VR8 A;  1NHS A;  1RYI A;  2VOU A;  3V76 A;  1REO A;  5JCK A;  4K5S A;  4BK1 A;  2GR3 A;  4H2P A;  4BJZ A;  4Y4L A;  4OPI A;  1H82 A;  4BK2 A;  2XDO A;  1NDA A;  4A9W A;  3BI2 A;  4OPU A;  4X4J A;  1NEN A;  1OJ9 A;  3DJG X;  1PBE A;  2NVK X;  1IUX A;  5TR3 A;  1CC6 A;  2BC0 A;  2BS4 A;  4OPG A;  2XLU A;  2A87 A;  1O5W A;  1GRT A;  2XCG A;  3GYJ A;  3ATQ A;  3NK0 X;  2GMH A;  3K7M X;  1CJ2 A;  1BZL A;  3CNT A;  4HB9 A;  1IUT A;  2WPE A;  3KA7 A;  1ZOV A;  3LJP A;  4IA5 A;  1B4V A;  2BS2 A;  2WOW A;  2W0H A;  4U8J A;  4CNK A;  2C65 A;  3LOV A;  4B64 A;  2XVJ A;  4GDE A;  1E1M A;  1B37 A;  3CPJ G;  4J31 A;  3NT6 A;  4I58 A;  2AAQ A;  1K4Q A;  3P4P A;  1GET A;  1CC2 A;  1MO9 A;  2EQ6 A;  2B9W A;  2OAL A;  2XLT A;  2XVF A;  2Y6R A;  2YG6 A;  3ISH A;  3UOZ A;  1CF3 A;  3CGD A; 
#chains in the Genus database with same CATH topology
 1IUU A;  2CVJ A;  1M6I A;  1D7Y A;  2YG7 A;  4A6N B;  2C70 A;  3AEC A;  3CIR A;  3KPK A;  3LXD A;  4GUV A;  3UKH A;  4A6N A;  5KVI A;  1FEC A;  2EQ8 A;  1IUW A;  1S2Y A;  2CUL A;  1P2H A;  1PJ6 A;  1PBC A;  3HYX A;  1V59 A;  5BVA A;  5KXJ A;  1F8R A;  2JBV A;  1H83 A;  3AE8 A;  3VRB A;  3RNM A;  1O95 A;  3EAN A;  4CRT A;  3Q6J A;  1NG3 A;  4BV6 A;  4UP3 A;  4PAA A;  2GR0 A;  2R0P A;  4B69 A;  1KSU A;  4U8M A;  5JCM A;  4YSZ A;  1ZKQ A;  5HXI A;  1K0L A;  3NN0 X;  2XFP A;  3NH3 X;  3T0K A;  3RP8 A;  2X8C A;  1OJA A;  2YG4 A;  3LAD A;  1M64 A;  1ZDL A;  5J7X A;  1F6M A;  4O5U A;  2OAM A;  3II4 A;  3M12 A;  4H4V A;  4UDP A;  5LV9 A;  3DK8 A;  1W4X A;  2BK5 A;  1BKW A;  1TDK A;  4J2W A;  2NPX A;  5KOW A;  3AD7 B;  4CBQ A;  1DXL A;  4BJY A;  2YVJ A;  3FG2 P;  4NEV A;  3AD8 B;  5IPY A;  3GWD A;  1JNR A;  2ARD A;  3T37 A;  2XFN A;  2V60 A;  1VG0 A;  3GYX A;  2WDQ A;  3F8P A;  2FJA A;  3CPH G;  2FJE A;  2TMD A;  4A99 A;  2BXS A;  3IHG A;  5U1O A;  1Y56 B;  2YR6 A;  3M13 A;  2YLS A;  2GAG B;  1XAN A;  3K7T A;  3V3N A;  3S61 A;  1D4E A;  1X31 B;  3UKA A;  4CY8 A;  3KKJ A;  1Y56 A;  3SQP A;  1ZMC A;  2R46 A;  1GTH A;  3C4N A;  2QA1 A;  2I0Z A;  2R0G A;  1PS9 A;  3Q9T A;  1Z6L A;  2VQ7 A;  3GDN A;  2UZZ A;  1AOG A;  3P9U A;  4CY6 A;  2APG A;  4Z43 A;  3ABV A;  3URH A;  2WP5 A;  4WCT A;  3AED A;  4GDP A;  4PAB A;  4J33 A;  1KNP A;  1ELI A;  3DJJ A;  4YWO A;  4AT2 A;  2BYB A;  2C7G A;  3QVR A;  2GQW A;  4JY2 A;  1SEZ A;  3H8L A;  5M0Z A;  1GV4 A;  1GES A;  1UKV G;  4H4T A;  1NPX A;  4BK3 A;  5C2T A;  1VDC A;  3ICS A;  5KMR A;  3NYC A;  1GPE A;  2C64 A;  1OJD A;  1E1K A;  4OPT A;  1EBD A;  1H7W A;  3NK1 X;  4ZN0 A;  2B7S A;  4KPR A;  2FBW A;  1F8W A;  2GMJ A;  4EIQ A;  4EIP A;  3LZW A;  4DGK A;  4IA6 A;  4G6G A;  5FS6 A;  4APN A;  4OPC A;  5KOX A;  3K30 A;  2B76 A;  5CQF A;  5M10 A;  2R45 A;  2YLX A;  3UP5 A;  4C3Y A;  3AXB A;  3CNJ A;  4UDR A;  2WDR A;  1COY A;  1E7P A;  1CC4 A;  2C3D A;  2ZZ0 A;  2XVE A;  3P4Q A;  3FMW A;  1CJ3 A;  2VZ2 A;  2WPF A;  2YLZ A;  1ZOY A;  4FK1 C;  1XPQ A;  3CGB A;  3COX A;  2RGJ A;  4U2S A;  3NTD A;  3ALM A;  5KMQ A;  1DOB A;  4NWZ A;  1PHH A;  2BC1 A;  2X8G A;  2RGO A;  4ADW A;  1N4W A;  4XWR A;  3CGC A;  4ECH A;  4C74 A;  3CNS A;  1HYU A;  3HYV A;  3B3R A;  1JU2 A;  2JB2 A;  3DGH A;  4H2Q A;  2BCG G;  3AWI A;  3ATR A;  4AP3 A;  2WHD A;  3ALL A;  1GEU A;  4G9K A;  4RG4 A;  2YWL A;  3UKF A;  4OVI A;  3G5R A;  5IQ4 A;  4GAV A;  4K5R A;  2VRL A;  1GRH A;  2XVI A;  2QA2 A;  1CL0 A;  1NEK A;  2DKI A;  3GD3 A;  1PBF A;  5CKU A;  2C66 A;  3KPF A;  4G6H A;  4HA6 A;  3GMB A;  1NHQ A;  3NHO X;  2WES A;  5BUK A;  2WOI A;  3SZW A;  2J3N A;  2BRA A;  2WPC A;  2TPR A;  2GQF A;  2JAE A;  3NGC X;  4TM3 A;  2F5Z A;  4H4Y A;  4Y4M A;  2XLS A;  3CMM A;  2BXR A;  1PN0 A;  2JB3 A;  2JB1 A;  4C5O A;  4A7A A;  4TM4 A;  1DJQ A;  2C76 A;  3SZF A;  1VRQ B;  2X50 A;  2WP9 A;  5JCL A;  3VR9 A;  2YM1 A;  3GRT A;  4OPL A;  2H89 A;  2XLR A;  5HYM A;  3CN8 A;  3RED A;  4JY3 A;  3VRD B;  4EMI A;  4EMJ A;  5KMS A;  2IVE A;  1VG9 A;  2DKH A;  4U8P A;  2YR4 A;  3IWA A;  1TDE A;  4C77 A;  1YY5 A;  4B66 A;  1GRA A;  3AE2 A;  4NTC A;  2X99 A;  3ICR A;  3FBS A;  3QFB A;  4AOX A;  4TLZ A;  1H7X A;  3SM8 A;  1H86 A;  3I3L A;  3AYJ A;  2WBA A;  1E1N A;  5C3J A;  3ADA B;  5J60 A;  2C3C A;  2BA9 A;  1EL7 A;  1PDH A;  3GSI A;  1FOH A;  4H4R A;  4J56 A;  4IVO B;  5U25 A;  4H4X A;  4OPD A;  3QSS A;  5U63 A;  3WE0 A;  4H2R A;  1B8S A;  2GR2 A;  4YSX A;  1ONF A;  3UP4 A;  4EQS A;  1N1P A;  4II2 A;  4JNA A;  3IC9 A;  2Q0K A;  2YG5 A;  1YQZ A;  4NNJ A;  5KMP A;  1D4C A;  3P4R A;  4U8N A;  5EB5 A;  1PXB A;  1LQU A;  2OA1 A;  2YLT A;  1BGJ A;  4H4W A;  3P4S A;  1JNZ A;  4B67 A;  2XFU A;  4I59 A;  3DME A;  3AE9 A;  5FS9 A;  5EB4 A;  4YTN A;  3JSK A;  1JRZ A;  2QCU A;  1ZX9 A;  2A8X A;  1TDN A;  4ZCD A;  2FJB A;  3ZYX A;  2GVC A;  4J57 A;  1KF6 A;  1GER A;  1IUV A;  1OJC A;  2HQM A;  4ZCC A;  3R9U A;  2JKC A;  4U8O A;  4AP1 A;  4K2X A;  2XFO A;  1NG4 A;  1YQ3 A;  3NG7 X;  3P1W A;  4H4P A;  3S5W A;  4Z26 A;  3GRS A;  4YTM A;  3NNE A;  1PBD A;  3AE7 A;  3C4A A;  2CDU A;  4B1B A;  4A79 A;  2EQ9 A;  3KLJ A;  1E39 A;  1VQW A;  3B6D A;  1KNR A;  4C3X A;  4CNJ A;  1N4V A;  1ZK7 A;  3ICT A;  3AYI A;  1GRB A;  4YXD A;  4U8K A;  1H84 A;  2WET A;  4XXG A;  1JOA A;  2EQ7 A;  2OLO A;  2YLR A;  3AEA A;  3SGL A;  1FCD A;  1L0V A;  1TYP A;  4JN9 A;  5BRT A;  5L46 A;  3BI4 A;  3UTF A;  2B9X A;  1S3E A;  2R9Z A;  4K22 A;  3SX6 A;  3NN6 X;  3H8I A;  1F3P A;  4LII A;  2YQU A;  5DBJ A;  1O94 A;  5GRT A;  3RP7 A;  1IUS A;  2E1M A;  2XYO A;  3DJE A;  2VVL G;  4USR A;  4RSL A;  2AR8 A;  4TLX A;  3H4K A;  3M0O A;  2GAH B;  2WU2 A;  3AE5 A;  4GR1 A;  1E1L A;  2B7R A;  3BNM A;  2VVL A;  5EOW A;  4MJW A;  4TM0 A;  4A65 A;  3D8X A;  3AEF A;  3NLC A;  1LVL A;  3AB1 A;  2YR5 A;  3KD9 A;  3AYL A;  1MXT A;  3E1T A;  3AE6 A;  3UOX A;  1B5Q A;  1DNC A;  3NK2 X;  2E5V A;  1E6E A;  5HY5 A;  4H2N A;  4IVM B;  4NTD A;  4B65 A;  4H4S A;  5JCI A;  4EM3 A;  3SFE A;  4E0V A;  3K7Q X;  4II3 A;  1XDI A;  1CHU A;  1LQT A;  4FDC B;  4B68 A;  2Q0L A;  1BF3 A;  2FJD A;  1TDF A;  1YQ4 A;  3ZDN A;  3SZ0 A;  1H6V A;  4N9X A;  4H4Q A;  3D1C A;  1TDO A;  4FK1 A;  4KX6 A;  2GR1 A;  3DJD A;  4NEW A;  2A89 A;  4UDQ A;  4YSH A;  3HZL A;  3RP6 A;  3SFD A;  3GYI A;  1XHC A;  4REK A;  4A5L A;  4B63 A;  2BAB A;  4P9S A;  2WS3 A;  4TM1 A;  1ZP0 A;  3UTE A;  1KDG A;  3G5Q A;  4RG3 A;  2C67 A;  1GND A;  1FL2 A;  4YKF A;  5FS7 A;  4CCR A;  2GF3 A;  1DOD A;  4LU6 A;  1GTE A;  4O5Q A;  1GSN A;  3UKK A;  2BAC A;  4Z2R A;  1GRG A;  2AQJ A;  2YVF A;  4M52 A;  3UOV A;  2WQY A;  4DSH A;  3AD9 B;  2YM2 A;  3OZ2 A;  3NYE A;  4J36 A;  4K7Z A;  4JDR A;  2WDV A;  3PS9 A;  1PBB A;  3NIX A;  2Z5X A;  4H7U A;  1ZY8 A;  3PVC A;  4H50 A;  2WOV A;  4JNQ A;  4Z24 A;  4DSG A;  2WEU A;  2PHH A;  4U8I A;  1MOK A;  3DK4 A;  3T2Y A;  5HHF A;  2C72 A;  2GH5 A;  3L8K A;  5FMH A;  2V61 A;  3UKP A;  1S3B A;  3VRA A;  2BS3 A;  3GMC A;  2V3B A;  3SXI A;  1CBO A;  2B9Y A;  2O9Z A;  2YVG A;  5EBK A;  1QO8 A;  1BWC A;  1S2Q A;  1NHP A;  2H88 A;  3NKS A;  3GWF A;  2VVM A;  3CTY A;  2YAU A;  4YTP A;  1LV0 A;  1GAL A;  4EQR A;  2Q7V A;  4GCM A;  1P2E A;  3T14 A;  2Z5Y A;  3NYF A;  4EQX A;  1L9C A;  4EMW A;  2ZZC A;  5IQ1 A;  1PXC A;  3CPI G;  4H4Z A;  1FEB A;  3F8D A;  2XFQ A;  5GSN A;  1GRF A;  3V3O A;  5JCN A;  2GB0 A;  4Z25 A;  2BK3 A;  4H4U A;  5FS8 A;  1EL5 A;  4NTE A;  1EL8 A;  2C73 A;  3LB8 A;  3CND A;  3KU9 A;  2V3A A;  1PJ7 A;  4XWZ A;  1L9E A;  1PJ5 A;  1D7L A;  4EM4 A;  1PXA A;  3GD4 A;  2GV8 A;  2PYX A;  2JK6 A;  3BNU A;  1KSS A;  4D04 A;  5KVH A;  1L9D A;  1GOS A;  3CGE A;  4WX1 A;  1N4U A;  4ICY A;  3SYI A;  2C4C A;  3DA1 A;  1LJ1 A;  3AE4 A;  4CCQ A;  2BCP A;  1Q9I A;  3UKL A;  3AEE A;  3GDP A;  1Y0P A;  3DH9 A;  4K8D A;  1DJN A;  1KFY A;  4G74 A;  3AEB A;  1D4D A;  3UTH A;  2GEW A;  2R4E A;  4Z44 A;  1Q1W A;  3T2K A;  2CFY A;  1RP0 A;  2RGH A;  4U2L A;  3OC4 A;  3O0H A;  3ALJ A;  3UOY A;  1RSG A;  1ZMD A;  4DNA A;  3UTG A;  4YKG A;  1JRY A;  1Q1R A;  1JRX A;  1JEH A;  4GRT A;  1GXF A;  3CNP A;  4J34 A;  1GRE A;  4YT0 A;  4Z2U A;  5KRQ A;  1D5T A;  3C96 A;  2VQB A;  3IHM A;  4BUR A;  2ZBW A;  1FEA A;  1TYT A;  2QAE A;  3KVE A;  4NZH A;  4D03 A;  3RHA A;  2V5Z A;  1EL9 A;  3L1R A;  1GT8 A;  1OJT A;  1BGN A;  3AE3 A;  3I6D A;  4U8L A;  3DGZ A;  4LA1 A;  2XVH A;  3FIM B;  4AOS A;  3FPZ A;  2OLN A;  2BK4 A;  1LTX R;  3ITJ A;  3QFA A;  3QSE A;  1DOE A;  2Q6U A;  2X8H A;  2YG3 A;  3G5S A;  4YSY A;  1CJC A;  3VQR A;  1YKJ A;  2X3N A;  4GF7 A;  4EQW A;  2C75 A;  2V6O A;  3NRN A;  3EAO A;  3EF6 A;  3F8R A;  3AEG A;  3IF9 A;  3LZX A;  4AT0 A;  1TRB A;  2ACZ A;  3DK9 A;  2R0C A;  1K0J A;  2XLP A;  2Y6Q A;  4OCG A;  3BHK A;  3HYW A;  1CJ4 A;  2R4J A;  2IVD A;  4IV9 A;  2IID A;  3BHF A;  1DOC A;  3UCL A;  1LPF A;  3QSM A;  2E4G A;  2YLW A;  3AE1 A;  4U2T A;  4USQ A;  4X9N A;  3QJ4 A;  2VRM A;  2ZZB A;  1QJD A;  1NHR A;  2GRT A;  2RAB A;  4X9M A;  5ER0 A;  1K0I A;  3SZC A;  5KWF A;  1IJH A;  4FX9 A;  3BI5 A;  3UKQ A;  1F8S A;  3EPT A;  3SY4 A;  2WP6 A;  5BUL A;  3PO7 A;  1H81 A;  4Z2T A;  4Y4N A;  4JQ9 A;  3NTA A;  3QVP A;  2WU5 A;  1NAA A;  1QLB A;  3VR8 A;  1NHS A;  1RYI A;  2VOU A;  3V76 A;  1REO A;  5JCK A;  4K5S A;  4BK1 A;  2GR3 A;  4H2P A;  4BJZ A;  4Y4L A;  4OPI A;  1H82 A;  4BK2 A;  2XDO A;  1NDA A;  4A9W A;  3BI2 A;  4G73 A;  4OPU A;  4X4J A;  1NEN A;  1OJ9 A;  3DJG X;  1PBE A;  2NVK X;  1IUX A;  5TR3 A;  1CC6 A;  2BC0 A;  2BS4 A;  4OPG A;  2XLU A;  2A87 A;  1O5W A;  1GRT A;  2XCG A;  3GYJ A;  3ATQ A;  3NK0 X;  2GMH A;  2BRY A;  3K7M X;  1CJ2 A;  1BZL A;  5KNL A;  3CNT A;  4HB9 A;  4GAP A;  1IUT A;  2WPE A;  3KA7 A;  3T2Z A;  1ZOV A;  3LJP A;  4IA5 A;  1B4V A;  2BS2 A;  2WOW A;  2W0H A;  4U8J A;  4CNK A;  2C65 A;  3LOV A;  4B64 A;  2XVJ A;  4GDE A;  1E1M A;  1B37 A;  3CPJ G;  4J31 A;  3NT6 A;  4I58 A;  2AAQ A;  1K4Q A;  3P4P A;  1GET A;  1CC2 A;  1MO9 A;  2EQ6 A;  2B9W A;  2OAL A;  2XLT A;  2XVF A;  2Y6R A;  2YG6 A;  3ISH A;  3UOZ A;  1CF3 A;  3CGD A;  3T31 A; 
#chains in the Genus database with same CATH homology
 1IUU A;  2CVJ A;  1M6I A;  1D7Y A;  2YG7 A;  4A6N B;  2C70 A;  3AEC A;  3CIR A;  3KPK A;  3LXD A;  4GUV A;  3UKH A;  4A6N A;  5KVI A;  1FEC A;  2EQ8 A;  1IUW A;  1S2Y A;  2CUL A;  1P2H A;  1PJ6 A;  1PBC A;  3HYX A;  1V59 A;  5BVA A;  5KXJ A;  1F8R A;  2JBV A;  1H83 A;  3AE8 A;  3VRB A;  3RNM A;  1O95 A;  3EAN A;  4CRT A;  3Q6J A;  1NG3 A;  4BV6 A;  4UP3 A;  4PAA A;  2GR0 A;  2R0P A;  4B69 A;  1KSU A;  4U8M A;  5JCM A;  4YSZ A;  1ZKQ A;  5HXI A;  1K0L A;  3NN0 X;  2XFP A;  3NH3 X;  3T0K A;  3RP8 A;  2X8C A;  1OJA A;  2YG4 A;  3LAD A;  1M64 A;  1ZDL A;  5J7X A;  1F6M A;  4O5U A;  2OAM A;  3II4 A;  3M12 A;  4H4V A;  4UDP A;  5LV9 A;  3DK8 A;  1W4X A;  2BK5 A;  1BKW A;  1TDK A;  4J2W A;  2NPX A;  5KOW A;  3AD7 B;  4CBQ A;  1DXL A;  4BJY A;  2YVJ A;  3FG2 P;  4NEV A;  3AD8 B;  5IPY A;  3GWD A;  1JNR A;  2ARD A;  3T37 A;  2XFN A;  2V60 A;  1VG0 A;  3GYX A;  2WDQ A;  3F8P A;  2FJA A;  3CPH G;  2FJE A;  2TMD A;  4A99 A;  2BXS A;  3IHG A;  5U1O A;  1Y56 B;  2YR6 A;  3M13 A;  2YLS A;  2GAG B;  1XAN A;  3K7T A;  3V3N A;  3S61 A;  1D4E A;  1X31 B;  3UKA A;  4CY8 A;  3KKJ A;  1Y56 A;  3SQP A;  1ZMC A;  2R46 A;  1GTH A;  3C4N A;  2QA1 A;  2I0Z A;  2R0G A;  1PS9 A;  3Q9T A;  1Z6L A;  2VQ7 A;  3GDN A;  2UZZ A;  1AOG A;  3P9U A;  4CY6 A;  2APG A;  4Z43 A;  3ABV A;  3URH A;  2WP5 A;  4WCT A;  3AED A;  4GDP A;  4PAB A;  4J33 A;  1KNP A;  1ELI A;  3DJJ A;  4YWO A;  4AT2 A;  2BYB A;  2C7G A;  3QVR A;  2GQW A;  4JY2 A;  1SEZ A;  3H8L A;  5M0Z A;  1GV4 A;  1GES A;  1UKV G;  4H4T A;  1NPX A;  4BK3 A;  5C2T A;  1VDC A;  3ICS A;  5KMR A;  3NYC A;  1GPE A;  2C64 A;  1OJD A;  1E1K A;  4OPT A;  1EBD A;  1H7W A;  3NK1 X;  4ZN0 A;  2B7S A;  4KPR A;  2FBW A;  1F8W A;  2GMJ A;  4EIQ A;  4EIP A;  3LZW A;  4DGK A;  4IA6 A;  4G6G A;  5FS6 A;  4APN A;  4OPC A;  5KOX A;  3K30 A;  2B76 A;  5CQF A;  5M10 A;  2R45 A;  2YLX A;  3UP5 A;  4C3Y A;  3AXB A;  3CNJ A;  4UDR A;  2WDR A;  1COY A;  1E7P A;  1CC4 A;  2C3D A;  2ZZ0 A;  2XVE A;  3P4Q A;  3FMW A;  1CJ3 A;  2VZ2 A;  2WPF A;  2YLZ A;  1ZOY A;  4FK1 C;  1XPQ A;  3CGB A;  3COX A;  2RGJ A;  4U2S A;  3NTD A;  3ALM A;  5KMQ A;  1DOB A;  4NWZ A;  1PHH A;  2BC1 A;  2X8G A;  2RGO A;  4ADW A;  1N4W A;  4XWR A;  3CGC A;  4ECH A;  4C74 A;  3CNS A;  1HYU A;  3HYV A;  3B3R A;  1JU2 A;  2JB2 A;  3DGH A;  4H2Q A;  2BCG G;  3AWI A;  3ATR A;  4AP3 A;  2WHD A;  3ALL A;  1GEU A;  4G9K A;  4RG4 A;  2YWL A;  3UKF A;  4OVI A;  3G5R A;  5IQ4 A;  4GAV A;  4K5R A;  2VRL A;  1GRH A;  2XVI A;  2QA2 A;  1CL0 A;  1NEK A;  2DKI A;  3GD3 A;  1PBF A;  5CKU A;  2C66 A;  3KPF A;  4G6H A;  4HA6 A;  3GMB A;  1NHQ A;  3NHO X;  2WES A;  5BUK A;  2WOI A;  3SZW A;  2J3N A;  2BRA A;  2WPC A;  2TPR A;  2GQF A;  2JAE A;  3NGC X;  4TM3 A;  2F5Z A;  4H4Y A;  4Y4M A;  2XLS A;  3CMM A;  2BXR A;  1PN0 A;  2JB3 A;  2JB1 A;  4C5O A;  4A7A A;  4TM4 A;  1DJQ A;  2C76 A;  3SZF A;  1VRQ B;  2X50 A;  2WP9 A;  5JCL A;  3VR9 A;  2YM1 A;  3GRT A;  4OPL A;  2H89 A;  2XLR A;  5HYM A;  3CN8 A;  3RED A;  4JY3 A;  3VRD B;  4EMI A;  4EMJ A;  5KMS A;  2IVE A;  1VG9 A;  2DKH A;  4U8P A;  2YR4 A;  3IWA A;  1TDE A;  4C77 A;  1YY5 A;  4B66 A;  1GRA A;  3AE2 A;  4NTC A;  2X99 A;  3ICR A;  3FBS A;  3QFB A;  4AOX A;  4TLZ A;  1H7X A;  3SM8 A;  1H86 A;  3I3L A;  3AYJ A;  2WBA A;  1E1N A;  5C3J A;  3ADA B;  5J60 A;  2C3C A;  2BA9 A;  1EL7 A;  1PDH A;  3GSI A;  1FOH A;  4H4R A;  4J56 A;  4IVO B;  5U25 A;  4H4X A;  4OPD A;  3QSS A;  5U63 A;  3WE0 A;  4H2R A;  1B8S A;  2GR2 A;  4YSX A;  1ONF A;  3UP4 A;  4EQS A;  1N1P A;  4II2 A;  4JNA A;  3IC9 A;  2Q0K A;  2YG5 A;  1YQZ A;  4NNJ A;  5KMP A;  1D4C A;  3P4R A;  4U8N A;  5EB5 A;  1PXB A;  1LQU A;  2OA1 A;  2YLT A;  1BGJ A;  4H4W A;  3P4S A;  1JNZ A;  4B67 A;  2XFU A;  4I59 A;  3DME A;  3AE9 A;  5FS9 A;  5EB4 A;  4YTN A;  3JSK A;  1JRZ A;  2QCU A;  1ZX9 A;  2A8X A;  1TDN A;  4ZCD A;  2FJB A;  3ZYX A;  2GVC A;  4J57 A;  1KF6 A;  1GER A;  1IUV A;  1OJC A;  2HQM A;  4ZCC A;  3R9U A;  2JKC A;  4U8O A;  4AP1 A;  4K2X A;  2XFO A;  1NG4 A;  1YQ3 A;  3NG7 X;  3P1W A;  4H4P A;  3S5W A;  4Z26 A;  3GRS A;  4YTM A;  3NNE A;  1PBD A;  3AE7 A;  3C4A A;  2CDU A;  4B1B A;  4A79 A;  2EQ9 A;  3KLJ A;  1E39 A;  1VQW A;  3B6D A;  1KNR A;  4C3X A;  4CNJ A;  1N4V A;  1ZK7 A;  3ICT A;  3AYI A;  1GRB A;  4YXD A;  4U8K A;  1H84 A;  2WET A;  4XXG A;  1JOA A;  2EQ7 A;  2OLO A;  2YLR A;  3AEA A;  3SGL A;  1FCD A;  1L0V A;  1TYP A;  4JN9 A;  5BRT A;  5L46 A;  3BI4 A;  3UTF A;  2B9X A;  1S3E A;  2R9Z A;  4K22 A;  3SX6 A;  3NN6 X;  3H8I A;  1F3P A;  4LII A;  2YQU A;  5DBJ A;  1O94 A;  5GRT A;  3RP7 A;  1IUS A;  2E1M A;  2XYO A;  3DJE A;  2VVL G;  4USR A;  4RSL A;  2AR8 A;  4TLX A;  3H4K A;  3M0O A;  2GAH B;  2WU2 A;  3AE5 A;  4GR1 A;  1E1L A;  2B7R A;  3BNM A;  2VVL A;  5EOW A;  4MJW A;  4TM0 A;  4A65 A;  3D8X A;  3AEF A;  3NLC A;  1LVL A;  3AB1 A;  2YR5 A;  3KD9 A;  3AYL A;  1MXT A;  3E1T A;  3AE6 A;  3UOX A;  1B5Q A;  1DNC A;  3NK2 X;  2E5V A;  1E6E A;  5HY5 A;  4H2N A;  4IVM B;  4NTD A;  4B65 A;  4H4S A;  5JCI A;  4EM3 A;  3SFE A;  4E0V A;  3K7Q X;  4II3 A;  1XDI A;  1CHU A;  1LQT A;  4FDC B;  4B68 A;  2Q0L A;  1BF3 A;  2FJD A;  1TDF A;  1YQ4 A;  3ZDN A;  3SZ0 A;  1H6V A;  4N9X A;  4H4Q A;  3D1C A;  1TDO A;  4FK1 A;  4KX6 A;  2GR1 A;  3DJD A;  4NEW A;  2A89 A;  4UDQ A;  4YSH A;  3HZL A;  3RP6 A;  3SFD A;  3GYI A;  1XHC A;  4REK A;  4A5L A;  4B63 A;  2BAB A;  4P9S A;  2WS3 A;  4TM1 A;  1ZP0 A;  3UTE A;  1KDG A;  3G5Q A;  4RG3 A;  2C67 A;  1GND A;  1FL2 A;  4YKF A;  5FS7 A;  4CCR A;  2GF3 A;  1DOD A;  4LU6 A;  1GTE A;  4O5Q A;  1GSN A;  3UKK A;  2BAC A;  4Z2R A;  1GRG A;  2AQJ A;  2YVF A;  4M52 A;  3UOV A;  2WQY A;  4DSH A;  3AD9 B;  2YM2 A;  3OZ2 A;  3NYE A;  4J36 A;  4K7Z A;  4JDR A;  2WDV A;  3PS9 A;  1PBB A;  3NIX A;  2Z5X A;  4H7U A;  1ZY8 A;  3PVC A;  4H50 A;  2WOV A;  4JNQ A;  4Z24 A;  4DSG A;  2WEU A;  2PHH A;  4U8I A;  1MOK A;  3DK4 A;  3T2Y A;  5HHF A;  2C72 A;  2GH5 A;  3L8K A;  5FMH A;  2V61 A;  3UKP A;  1S3B A;  3VRA A;  2BS3 A;  3GMC A;  2V3B A;  3SXI A;  1CBO A;  2B9Y A;  2O9Z A;  2YVG A;  5EBK A;  1QO8 A;  1BWC A;  1S2Q A;  1NHP A;  2H88 A;  3NKS A;  3GWF A;  2VVM A;  3CTY A;  2YAU A;  4YTP A;  1LV0 A;  1GAL A;  4EQR A;  2Q7V A;  4GCM A;  1P2E A;  3T14 A;  2Z5Y A;  3NYF A;  4EQX A;  1L9C A;  4EMW A;  2ZZC A;  5IQ1 A;  1PXC A;  3CPI G;  4H4Z A;  1FEB A;  3F8D A;  2XFQ A;  5GSN A;  1GRF A;  3V3O A;  5JCN A;  2GB0 A;  4Z25 A;  2BK3 A;  4H4U A;  5FS8 A;  1EL5 A;  4NTE A;  1EL8 A;  2C73 A;  3LB8 A;  3CND A;  3KU9 A;  2V3A A;  1PJ7 A;  4XWZ A;  1L9E A;  1PJ5 A;  1D7L A;  4EM4 A;  1PXA A;  3GD4 A;  2GV8 A;  2PYX A;  2JK6 A;  3BNU A;  1KSS A;  4D04 A;  5KVH A;  1L9D A;  1GOS A;  3CGE A;  4WX1 A;  1N4U A;  4ICY A;  3SYI A;  2C4C A;  3DA1 A;  1LJ1 A;  3AE4 A;  4CCQ A;  2BCP A;  1Q9I A;  3UKL A;  3AEE A;  3GDP A;  1Y0P A;  3DH9 A;  4K8D A;  1DJN A;  1KFY A;  4G74 A;  3AEB A;  1D4D A;  3UTH A;  2GEW A;  2R4E A;  4Z44 A;  1Q1W A;  3T2K A;  2CFY A;  1RP0 A;  2RGH A;  4U2L A;  3OC4 A;  3O0H A;  3ALJ A;  3UOY A;  1RSG A;  1ZMD A;  4DNA A;  3UTG A;  4YKG A;  1JRY A;  1Q1R A;  1JRX A;  1JEH A;  4GRT A;  1GXF A;  3CNP A;  4J34 A;  1GRE A;  4YT0 A;  4Z2U A;  5KRQ A;  1D5T A;  3C96 A;  2VQB A;  3IHM A;  4BUR A;  2ZBW A;  1FEA A;  1TYT A;  2QAE A;  3KVE A;  4NZH A;  4D03 A;  3RHA A;  2V5Z A;  1EL9 A;  3L1R A;  1GT8 A;  1OJT A;  1BGN A;  3AE3 A;  3I6D A;  4U8L A;  3DGZ A;  4LA1 A;  2XVH A;  3FIM B;  4AOS A;  3FPZ A;  2OLN A;  2BK4 A;  1LTX R;  3ITJ A;  3QFA A;  3QSE A;  1DOE A;  2Q6U A;  2X8H A;  2YG3 A;  3G5S A;  4YSY A;  1CJC A;  3VQR A;  1YKJ A;  2X3N A;  4GF7 A;  4EQW A;  2C75 A;  2V6O A;  3NRN A;  3EAO A;  3EF6 A;  3F8R A;  3AEG A;  3IF9 A;  3LZX A;  4AT0 A;  1TRB A;  2ACZ A;  3DK9 A;  2R0C A;  1K0J A;  2XLP A;  2Y6Q A;  4OCG A;  3BHK A;  3HYW A;  1CJ4 A;  2R4J A;  2IVD A;  4IV9 A;  2IID A;  3BHF A;  1DOC A;  3UCL A;  1LPF A;  3QSM A;  2E4G A;  2YLW A;  3AE1 A;  4U2T A;  4USQ A;  4X9N A;  3QJ4 A;  2VRM A;  2ZZB A;  1QJD A;  1NHR A;  2GRT A;  2RAB A;  4X9M A;  5ER0 A;  1K0I A;  3SZC A;  5KWF A;  1IJH A;  4FX9 A;  3BI5 A;  3UKQ A;  1F8S A;  3EPT A;  3SY4 A;  2WP6 A;  5BUL A;  3PO7 A;  1H81 A;  4Z2T A;  4Y4N A;  4JQ9 A;  3NTA A;  3QVP A;  2WU5 A;  1NAA A;  1QLB A;  3VR8 A;  1NHS A;  1RYI A;  2VOU A;  3V76 A;  1REO A;  5JCK A;  4K5S A;  4BK1 A;  2GR3 A;  4H2P A;  4BJZ A;  4Y4L A;  4OPI A;  1H82 A;  4BK2 A;  2XDO A;  1NDA A;  4A9W A;  3BI2 A;  4G73 A;  4OPU A;  4X4J A;  1NEN A;  1OJ9 A;  3DJG X;  1PBE A;  2NVK X;  1IUX A;  5TR3 A;  1CC6 A;  2BC0 A;  2BS4 A;  4OPG A;  2XLU A;  2A87 A;  1O5W A;  1GRT A;  2XCG A;  3GYJ A;  3ATQ A;  3NK0 X;  2GMH A;  2BRY A;  3K7M X;  1CJ2 A;  1BZL A;  5KNL A;  3CNT A;  4HB9 A;  4GAP A;  1IUT A;  2WPE A;  3KA7 A;  3T2Z A;  1ZOV A;  3LJP A;  4IA5 A;  1B4V A;  2BS2 A;  2WOW A;  2W0H A;  4U8J A;  4CNK A;  2C65 A;  3LOV A;  4B64 A;  2XVJ A;  4GDE A;  1E1M A;  1B37 A;  3CPJ G;  4J31 A;  3NT6 A;  4I58 A;  2AAQ A;  1K4Q A;  3P4P A;  1GET A;  1CC2 A;  1MO9 A;  2EQ6 A;  2B9W A;  2OAL A;  2XLT A;  2XVF A;  2Y6R A;  2YG6 A;  3ISH A;  3UOZ A;  1CF3 A;  3CGD A;  3T31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...