5J60A

Structure of a thioredoxin reductase from gloeobacter violaceus
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
320
structure length
316
Chain Sequence
GSHMEQFDFDVVIVGGGPAGCTCALYTARSELKTVILDKNPAAGALAITHKIANYPGVPGEMSGDHLLEVMRDQAVEFGTVYRRAQVYGLDLSEPVKKVYTPEGIFTGRALVLATGAMGRIASIPGEAEYLGRGVSYCATCDGAFYRNREVVVVGLNPEAVEEAQVLTKFASTVHWITPKDPHTGHADELLAHPSVKLWEKTRLIRIKGEEAGVTAVEVRHESDSQELLAEGVFVYLQGSKPITDFVAGQVEMKPDGGVWVDEMMQTSVPGVWGIGDIRNTPFKQAVVAAGDGCIAAMAIDRFLNSRKAIKPDWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Member of the Thioredoxin Reductase Family from Early Oxygenic Photosynthetic Organisms.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 93
structure length 316
sequence length 320
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5j60A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5j60A02
2R4JA 4B63A 1DOBA 3B6DA 5JCNA 2EQ6A 4OPIA 4EQXA 2RGJA 4AP1A 3SQPA 3AE4A 3DK9A 3FBSA 1EL5A 4D04A 3BNUA 2WDRA 2C64A 3AEBA 3LB8A 1NDAA 3AE2A 3VRDB 1LQUA 1H81A 4CNJA 1NAAA 5IQ4A 5FMHA 1FOHA 1TDNA 2ZZBA 4YWOA 1DJNA 2EQ9A 3AXBA 1YY5A 2Z5XA 2APGA 3AYLA 2EQ8A 4CRTA 1TYPA 4H50A 2WP5A 3AEFA 4B67A 4U8IA 5BULA 1REOA 1ZY8A 5ER0A 2YQUA 3CGCA 4YT0A 3NHOX 3QVPA 3OZ2A 3K7TA 2BXSA 4UP3A 4LA1A 2GR3A 1F6MA 3NYCA 1CC2A 2XLRA 4I59A 2WP9A 3D1CA 1EL9A 2FJEA 4OVIA 4DSHA 4Z44A 3M0OA 4MJWA 1NENA 1V59A 4OPLA 1IUVA 3AYJA 1K4QA 2BS4A 2C75A 3D8XA 4USQA 5EB4A 4CY8A 4A6NB 1CHUA 2XVIA 4B1BA 2WOWA 5TR3A 4EIQA 3GDPA 1K0IA 4EM4A 3CNTA 3P4SA 4BK3A 4YXDA 2O9ZA 1GRTA 3QVRA 2FJDA 3UTEA 2X8CA 3CGBA 2AAQA 4OPTA 3FIMB 1ZMCA 3VRBA 2B9YA 1E1KA 2XLTA 1DXLA 2QA2A 4UDPA 4NEVA 1NG4A 2WDQA 2XFUA 2WETA 4J31A 4Z43A 2ZZ0A 3CNPA 1H7XA 3C4NA 1GRAA 2X50A 4AOXA 1P2HA 1VQWA 1TRBA 4EQRA 2WBAA 1S3EA 4K5SA 1H7WA 2C7GA 3LZWA 4Z24A 3UP5A 3IF9A 3NYFA 2XFNA 1ONFA 2XFPA 2QAEA 3QFAA 1E6EA 1XHCA 3CTYA 4CCQA 4NEWA 1Y56B 2ZBWA 3ADAB 4M52A 2OLOA 3AECA 3S61A 1SEZA 3E1TA 4H4QA 5HXIA 2GQFA 3UKKA 1OJCA 1S2QA 3RP6A 3BHFA 3NTDA 4J56A 5GSNA 4U8MA 2R0GA 3GYIA 5C2TA 4YSXA 5JCKA 2C73A 4CY6A 1EL7A 3AEAA 3ICSA 3QFBA 4U2LA 1ZMDA 4IA5A 4GDEA 4OCGA 1GV4A 3AWIA 3UOXA 1GXFA 4K8DA 3UP4A 3UKPA 4BURA 1NHRA 3DK8A 3URHA 4N9XA 2E4GA 3GD3A 3C4AA 1BF3A 4FX9A 1UKVG 2BCPA 3ALLA 3K7QX 3UOVA 3G5RA 1KNRA 4C5OA 5C3JA 1VG0A 3II4A 3VQRA 2BACA 1IUWA 1H82A 2JB1A 2YG7A 4B64A 1IUXA 3GMCA 1YKJA 2YVFA 1BKWA 1PJ5A 3NT6A 4U8KA 1NG3A 4A6NA 3NK0X 2R45A 1LTXR 2YLTA 3V3NA 3ITJA 1JRXA 2VQBA 4YTPA 2GV8A 5HY5A 4U8JA 3VR8A 4U2TA 2YLWA 3KA7A 3QSMA 4H4YA 4KX6A 2Q0KA 4Z2RA 3DA1A 2YR6A 2C3DA 1PXCA 3RHAA 2OA1A 1ZOYA 2VOUA 1FCDA 2UZZA 2CDUA 2WEUA 1PS9A 2WPEA 2R9ZA 4TM0A 1PXBA 3KLJA 1P2EA 1ZX9A 1GNDA 3CNSA 3S5WA 1GSNA 1GOSA 1GALA 4I58A 5HYMA 2FBWA 1IUTA 2BK4A 3UKQA 1M6IA 4EM3A 1FEBA 1N4UA 1MXTA 1DNCA 3K7MX 3IC9A 1Y0PA 2WPFA 3Q9TA 1B37A 1LQTA 1PJ6A 2V5ZA 2W0HA 2WU5A 3EF6A 4RG4A 4YSYA 3CGDA 2WU2A 2CVJA 5J60A 1RP0A 3H8LA 1FL2A 1NEKA 1GEUA 4GR1A 1FECA 1XDIA 2F5ZA 2X3NA 4A65A 1B4VA 4XXGA 3UKLA 4A9WA 3GYJA 3NG7X 4O5QA 4H4ZA 4H4UA 3OC4A 2YAUA 3NLCA 3O0HA 5KRQA 1OJTA 2V6OA 1DODA 2C70A 1YQ4A 1XANA 4JQ9A 2YR4A 2V60A 2C65A 3FMWA 2YLRA 4K5RA 4IVMB 1EBDA 2C66A 4OPGA 5JCLA 2JB3A 3FPZA 2C67A 3ISHA 5CQFA 1BWCA 3NYEA 5KXJA 1HYUA 2ARDA 5FS9A 3RP8A 4Z2TA 3G5QA 3ABVA 4OPUA 1RSGA 4C77A 4DNAA 3M13A 4HA6A 1PBBA 2Q0LA 4TM1A 2BYBA 3T37A 3ICTA 4C74A 4EQSA 2VQ7A 1ZKQA 3NGCX 4H2NA 4ECHA 4BV6A 2R4EA 1D4DA 3I6DA 1GRHA 2GEWA 2GAHB 3C96A 3GRTA 3NTAA 4GF7A 1KFYA 4TLXA 3CN8A 1CJ4A 1ZP0A 2CULA 1TDOA 3AE7A 1DOEA 2Q6UA 2VRLA 1DJQA 4U8NA 2CFYA 2B9WA 1F8SA 2WQYA 4WX1A 1BGJA 5KOXA 3AE8A 4RSLA 1F8RA 2E1MA 4K2XA 1RYIA 2A89A 2VVLG 3UTHA 1D7LA 3WE0A 2BA9A 3B3RA 5KVIA 4IVOB 4LIIA 3DJGX 4ZCCA 3LOVA 2IIDA 3AEDA 5U1OA 1F8WA 2IVDA 4A7AA 3L8KA 4BJYA 3DGZA 5U63A 2GR2A 2TMDA 4GDPA 4TM4A 1FEAA 1PDHA 2JB2A 1GTEA 1D7YA 2GVCA 3Q6JA 3UOYA 2TPRA 3K30A 1ZDLA 4AP3A 3VRAA 3AEEA 2J3NA 2RGHA 1AOGA 2YG4A 1PHHA 1O95A 2X99A 2YG5A 3F8RA 3PVCA 1PBEA 5LV9A 5EBKA 3ATQA 3SFEA 2YWLA 1KNPA 2Y6QA 3AB1A 3GWDA 3L1RA 2ZZCA 1GERA 3ATRA 4U8LA 2EQ7A 1GT8A 2V61A 3DJEA 3DMEA 3CPHG 3AYIA 1MO9A 3UCLA 4EMIA 1PBCA 3DJDA 1LVLA 4YTNA 4IV9A 2RABA 2YLZA 4REKA 1JNZA 3CNDA 5M0ZA 4BK1A 1LJ1A 3P4RA 2JK6A 2YVGA 4CNKA 4Z25A 1Q1RA 3UOZA 1GTHA 1X31B 3AD7B 2PHHA 1CJ2A 3NK2X 3AE9A 1L9EA 4J33A 4GRTA 2VRMA 3P4PA 1CC4A 2WESA 4EMWA 4LU6A 2BXRA 3GMBA 4NZHA 4USRA 4RG3A 1E1MA 2OAMA 1PBFA 4UDQA 2RGOA 4YSZA 4JY2A 5DBJA 2R0CA 3KU9A 3AE5A 2XCGA 1Q9IA 3GSIA 3KKJA 1JEHA 1DOCA 1PXAA 1S2YA 3QJ4A 4J2WA 2GMHA 4X9NA 3R9UA 1KSUA 1N4VA 2FJAA 4YTMA 5U25A 2B76A 4H4WA 3V76A 4BJZA 3GWFA 3EPTA 4Z26A 1Q1WA 1GRBA 4Y4MA 2BK3A 1CC6A 2GR1A 3DGHA 4HB9A 5HHFA 4C3XA 1EL8A 2XFQA 4PABA 2IVEA 3UKAA 4OPDA 5BRTA 3NRNA 2BS2A 1E7PA 4NTDA 3GRSA 3NN6X 1QO8A 1D4EA 3QSSA 4K22A 3VR9A 1TDEA 3NK1X 3UKHA 3ICRA 1S3BA 3AE6A 2WPCA 1NHQA 4YSHA 1COYA 3REDA 4H2RA 5KWFA 3NKSA 1E1NA 2E5VA 3F8DA 3NN0X 5IPYA 1IUSA 1OJ9A 3NIXA 4A99A 3AEGA 4AOSA 1QLBA 3EAOA 4C3YA 2WOIA 4FK1A 3GD4A 1W4XA 3SGLA 5KVHA 2PYXA 3LXDA 2VVMA 4TM3A 3G5SA 1B8SA 2WHDA 2JAEA 1TDFA 4JY3A 1CF3A 3SFDA 4ADWA 5M10A 1BGNA 2B7SA 1CJ3A 3EANA 4JNAA 3CNJA 4B66A 2H88A 5BVAA 2GF3A 4H4PA 4WCTA 5EB5A 3P9UA 4J36A 2A8XA 2FJBA 4CBQA 4YKGA 5BUKA 4B68A 4CCRA 1NHPA 1KF6A 5FS8A 2BABA 4H2PA 2WOVA 4Y4NA 4APNA 4P9SA 1O94A 1ZOVA 1H86A 4Z2UA 3AD8B 1BZLA 1MOKA 2X8GA 2VVLA 4H4XA 4UDRA 1YQ3A 3F8PA 1NHSA 2VZ2A 4FDCB 3IHMA 1H84A 4D03A 2XLPA 3RP7A 1JRYA 3SM8A 1D5TA 3V3OA 1K0JA 2YM1A 3COXA 4PAAA 2A87A 1OJDA 3IWAA 2V3AA 1GETA 1PBDA 2BC1A 4X4JA 1F3PA 4U8PA 4TLZA 1D4CA 1Y56A 2WP6A 2YG3A 4H2QA 1LV0A 4O5UA 5CKUA 1GESA 4A79A 1JRZA 3DH9A 1IJHA 4EIPA 4IA6A 2Q7VA 2X8HA 2Z5YA 3GDNA 3KPFA 5FS7A 3CIRA 4H7UA 4ICYA 3IHGA 2B9XA 2GQWA 1E1LA 1JU2A 2XFOA 3H8IA 4AT0A 1O5WA 3BI2A 4K7ZA 3M12A 5GRTA 2GMJA 1JOAA 3H4KA 3PS9A 2Y6RA 3CPIG 4GUVA 4OPCA 4AT2A 2NPXA 2I0ZA 3BNMA 2R0PA 1L9DA 1LPFA 2JBVA 1N1PA 1PN0A 2GB0A 2DKIA 4DSGA 1VDCA 1Z6LA 4H4TA 5L46A 1QJDA 3ALJA 1CJCA 3DJJA 1GRFA 2V3BA 2AR8A 4KPRA 2C3CA 3CPJG 3KD9A 2WDVA 3AE1A 1H6VA 4ZN0A 2YLSA 2XVJA 2BC0A 2YLXA 2BS3A 5FS6A 2YM2A 3HZLA 4XWRA 1GRGA 2XVHA 4J57A 4H4VA 4JDRA 4XWZA 2GAGB 2DKHA 1IUUA 5JCIA 2ACZA 2JKCA 5EOWA 3BI5A 1OJAA 3QSEA 4U2SA 2BCGG 2WS3A 1NPXA 2XVEA 5JCMA 1E39A 3RNMA 1TDKA 3AE3A 3DK4A 3UTFA 1XPQA 3P1WA 4JN9A 2AQJA 1L0VA 2XYOA 2OLNA 2XDOA 3BI4A 5KOWA 2GRTA 2H89A 1M64A 4GCMA 3AD9B 1B5QA 1KSSA 3UTGA 1CL0A 1VRQB 2OALA 3ZYXA 4X9MA 3FG2P 1GREA 2YG6A 3ALMA 4B65A 2BK5A 1N4WA 1PJ7A 2XVFA 3LJPA 2GR0A 4YKFA 2QA1A 4J34A 1L9CA 5IQ1A 3PO7A 2QCUA 1ZK7A 3JSKA 3LZXA 3NNEA 4A5LA 2GH5A 2C72A 3KVEA 2NVKX 3P4QA 1TYTA 1K0LA 2XLSA 4FK1C 4EQWA 2R46A 1JNRA 4B69A 3LADA 1VG9A 3UKFA 4DGKA 1ELIA 5J7XA 2YVJA 4H4RA 3I3LA 4BK2A 2C76A 4NTEA 4Y4LA 3CGEA 3BHKA 2B7RA 3ZDNA 4EMJA 1KDGA 2HQMA 2YR5A 2XLUA 4H4SA 3NH3X 4JNQA 1H83A 1YQZA 4U8OA 4E0VA 4NTCA 4ZCDA 1CBOA 1GPEA
chains in the Genus database with same CATH superfamily
2R4JA 4B63A 1DOBA 3B6DA 5JCNA 2EQ6A 4OPIA 4EQXA 2RGJA 4AP1A 3SQPA 3AE4A 3DK9A 3FBSA 1EL5A 4D04A 3BNUA 2WDRA 2C64A 3AEBA 3LB8A 1NDAA 3AE2A 3VRDB 1LQUA 1H81A 4CNJA 1NAAA 5IQ4A 5FMHA 1FOHA 1TDNA 2ZZBA 4YWOA 1DJNA 4NWZA 2EQ9A 3SYIA 3AXBA 1YY5A 2Z5XA 2APGA 3AYLA 2EQ8A 4CRTA 1TYPA 4H50A 2WP5A 3AEFA 4B67A 4U8IA 5BULA 1REOA 1ZY8A 5ER0A 2YQUA 3CGCA 4YT0A 3NHOX 3QVPA 3OZ2A 3K7TA 2BXSA 4UP3A 4LA1A 2GR3A 1F6MA 4G73A 3NYCA 1CC2A 2XLRA 5KNLA 4I59A 2WP9A 3D1CA 1EL9A 3GYXA 2FJEA 4OVIA 4DSHA 4Z44A 3M0OA 4MJWA 1NENA 1V59A 4OPLA 1IUVA 3AYJA 1K4QA 2BS4A 2C75A 3D8XA 4USQA 5EB4A 4CY8A 4A6NB 1CHUA 2XVIA 4B1BA 2WOWA 5TR3A 4EIQA 3GDPA 1K0IA 4EM4A 3CNTA 3P4SA 4BK3A 4YXDA 2O9ZA 1GRTA 3QVRA 2FJDA 3UTEA 2X8CA 3CGBA 2AAQA 4OPTA 3FIMB 1ZMCA 3VRBA 2B9YA 1E1KA 2XLTA 1DXLA 2QA2A 4UDPA 4NEVA 5KMSA 1NG4A 2WDQA 2XFUA 2WETA 4J31A 4Z43A 2ZZ0A 3CNPA 1H7XA 3C4NA 1GRAA 2X50A 4AOXA 1P2HA 1VQWA 1TRBA 4GAPA 4EQRA 2WBAA 1S3EA 4K5SA 1H7WA 2C7GA 3LZWA 4Z24A 3UP5A 3IF9A 3NYFA 2XFNA 1ONFA 2XFPA 2QAEA 3QFAA 1E6EA 1XHCA 3CTYA 4CCQA 4NEWA 1Y56B 2ZBWA 3ADAB 4M52A 2OLOA 3AECA 3S61A 1SEZA 3E1TA 4H4QA 3T2ZA 5HXIA 2GQFA 3UKKA 1OJCA 1S2QA 3RP6A 3BHFA 3NTDA 4J56A 5GSNA 4U8MA 2R0GA 3GYIA 5C2TA 4YSXA 5JCKA 2C73A 4CY6A 1EL7A 3AEAA 3ICSA 3QFBA 4U2LA 1ZMDA 4IA5A 4GDEA 4OCGA 1GV4A 3AWIA 3UOXA 1GXFA 4K8DA 3UP4A 3UKPA 4BURA 1NHRA 3DK8A 3URHA 4II2A 4N9XA 2E4GA 3GD3A 3C4AA 1BF3A 4FX9A 1UKVG 2BCPA 3ALLA 3K7QX 3UOVA 3G5RA 1KNRA 4C5OA 5C3JA 1VG0A 3HYWA 3II4A 3VQRA 2BACA 1IUWA 1H82A 2JB1A 2YG7A 3HYXA 4G6GA 4B64A 1IUXA 3GMCA 1YKJA 2YVFA 1BKWA 1PJ5A 3NT6A 4U8KA 1NG3A 4A6NA 3NK0X 2R45A 1LTXR 2YLTA 3V3NA 3ITJA 1JRXA 2VQBA 4YTPA 2GV8A 4G6HA 5HY5A 4U8JA 3VR8A 4U2TA 2YLWA 3KA7A 3QSMA 4H4YA 4KX6A 2Q0KA 4Z2RA 5KMQA 3DA1A 2YR6A 2C3DA 1PXCA 3RHAA 2OA1A 1ZOYA 2VOUA 1FCDA 2UZZA 2CDUA 3SXIA 2WEUA 1PS9A 2WPEA 2R9ZA 4TM0A 1PXBA 3KLJA 1P2EA 1ZX9A 1GNDA 3CNSA 3S5WA 1GSNA 1GOSA 1GALA 4I58A 5HYMA 2FBWA 1IUTA 5KMRA 2BK4A 3UKQA 1M6IA 4EM3A 1FEBA 1N4UA 1MXTA 1DNCA 3K7MX 3IC9A 1Y0PA 2WPFA 3Q9TA 1B37A 1LQTA 1PJ6A 2V5ZA 2W0HA 2WU5A 3EF6A 4RG4A 4YSYA 3CGDA 2WU2A 2CVJA 5J60A 1RP0A 3H8LA 1FL2A 1NEKA 1GEUA 4GR1A 1FECA 1XDIA 2F5ZA 2X3NA 3SZWA 4A65A 1B4VA 4XXGA 3UKLA 4A9WA 3GYJA 3NG7X 4O5QA 4H4ZA 4H4UA 3OC4A 2YAUA 3NLCA 3O0HA 5KRQA 1OJTA 2V6OA 1DODA 2C70A 1YQ4A 1XANA 4JQ9A 3SZCA 2YR4A 3HYVA 2V60A 2C65A 3FMWA 2YLRA 4K5RA 4IVMB 1EBDA 2C66A 4OPGA 5JCLA 2JB3A 3FPZA 2C67A 3ISHA 5CQFA 1BWCA 3NYEA 5KXJA 1HYUA 2ARDA 5FS9A 3RP8A 4Z2TA 3G5QA 3ABVA 4OPUA 1RSGA 4C77A 4DNAA 3M13A 4HA6A 1PBBA 2Q0LA 4TM1A 2BYBA 3T37A 3ICTA 4C74A 4EQSA 2VQ7A 1ZKQA 3NGCX 4H2NA 4ECHA 4BV6A 2R4EA 1D4DA 3I6DA 1GRHA 2GEWA 2GAHB 3C96A 3GRTA 3NTAA 4GF7A 1KFYA 4TLXA 3CN8A 1CJ4A 1ZP0A 2CULA 1TDOA 3AE7A 1DOEA 2Q6UA 2VRLA 1DJQA 4U8NA 2CFYA 2B9WA 1F8SA 2WQYA 4WX1A 1BGJA 5KOXA 3AE8A 4RSLA 1F8RA 2E1MA 4K2XA 1RYIA 2A89A 2VVLG 3UTHA 1D7LA 3WE0A 2BA9A 3B3RA 5KVIA 4IVOB 4LIIA 3DJGX 4ZCCA 3LOVA 2IIDA 3AEDA 5U1OA 1F8WA 2IVDA 4A7AA 3L8KA 4BJYA 3DGZA 5U63A 2GR2A 2TMDA 4GDPA 4TM4A 1FEAA 3T0KA 1PDHA 2JB2A 1GTEA 2GVCA 1D7YA 3Q6JA 3UOYA 2C4CA 2TPRA 3K30A 1ZDLA 4AP3A 3SY4A 3VRAA 3AEEA 2J3NA 2RGHA 1AOGA 2YG4A 1PHHA 1O95A 2X99A 2YG5A 3F8RA 3PVCA 1PBEA 5LV9A 5EBKA 3ATQA 3SFEA 2YWLA 1KNPA 2Y6QA 3AB1A 3GWDA 3L1RA 2ZZCA 1GERA 3ATRA 4U8LA 2EQ7A 1GT8A 2V61A 3DJEA 3DMEA 3CPHG 3AYIA 1MO9A 3UCLA 4EMIA 1PBCA 3DJDA 1LVLA 4YTNA 4IV9A 2RABA 2YLZA 4REKA 1JNZA 3CNDA 4G9KA 5M0ZA 4BK1A 1LJ1A 3SZFA 3P4RA 2JK6A 2YVGA 4CNKA 4Z25A 1Q1RA 3T2KA 3UOZA 1GTHA 3T31A 1X31B 3AD7B 2PHHA 1CJ2A 3NK2X 3AE9A 1L9EA 4J33A 4GRTA 2VRMA 3P4PA 1CC4A 2WESA 4EMWA 4LU6A 2BXRA 3GMBA 3T2YA 4NZHA 4USRA 4RG3A 1E1MA 2OAMA 1PBFA 4UDQA 2RGOA 4YSZA 4JY2A 5DBJA 2R0CA 3KU9A 3AE5A 2XCGA 4GAVA 1Q9IA 3GSIA 3KKJA 1JEHA 1DOCA 1PXAA 1S2YA 3QJ4A 4J2WA 2GMHA 4X9NA 3R9UA 1KSUA 1N4VA 2FJAA 4YTMA 3CMMA 5U25A 2B76A 4H4WA 3V76A 4BJZA 3GWFA 3EPTA 4Z26A 1Q1WA 1GRBA 4Y4MA 2BK3A 1CC6A 2GR1A 3DGHA 4HB9A 5HHFA 4C3XA 1EL8A 2BRAA 2XFQA 4PABA 2IVEA 3UKAA 4OPDA 4G74A 5BRTA 3NRNA 2BS2A 1E7PA 4NTDA 3GRSA 3NN6X 1QO8A 1D4EA 3QSSA 4K22A 3VR9A 1TDEA 3NK1X 3UKHA 3ICRA 1S3BA 3AE6A 2WPCA 1NHQA 4YSHA 1COYA 3REDA 4H2RA 5KWFA 3NKSA 1E1NA 2E5VA 3F8DA 3NN0X 5IPYA 1IUSA 1OJ9A 3NIXA 4A99A 3AEGA 4AOSA 1QLBA 3EAOA 4C3YA 2WOIA 4FK1A 3GD4A 1W4XA 3SGLA 5KVHA 2PYXA 3LXDA 2VVMA 4TM3A 3G5SA 1B8SA 2WHDA 2JAEA 1TDFA 4JY3A 1CF3A 3SFDA 4ADWA 5M10A 1BGNA 3SX6A 2B7SA 1CJ3A 3EANA 4JNAA 3CNJA 4II3A 4B66A 2H88A 5BVAA 2GF3A 4H4PA 4WCTA 5EB5A 3P9UA 4J36A 2A8XA 2FJBA 4CBQA 4YKGA 5BUKA 4B68A 4CCRA 1NHPA 1KF6A 5FS8A 2BABA 4H2PA 2WOVA 4Y4NA 4APNA 4P9SA 1O94A 1ZOVA 1H86A 4Z2UA 3AD8B 1BZLA 1MOKA 2X8GA 3KPKA 2VVLA 4H4XA 4UDRA 1YQ3A 3F8PA 1NHSA 2VZ2A 4FDCB 3IHMA 1H84A 4D03A 2XLPA 3RP7A 1JRYA 3SM8A 1D5TA 3V3OA 1K0JA 2YM1A 3COXA 4PAAA 2A87A 1OJDA 3IWAA 2V3AA 1GETA 1PBDA 3T14A 2BC1A 4X4JA 1F3PA 4U8PA 4TLZA 1D4CA 1Y56A 2WP6A 2YG3A 4H2QA 1LV0A 4O5UA 5CKUA 1GESA 4A79A 1JRZA 3DH9A 1IJHA 4EIPA 4IA6A 2Q7VA 2X8HA 2Z5YA 3GDNA 3KPFA 5FS7A 3CIRA 4H7UA 4ICYA 3IHGA 2B9XA 2GQWA 1E1LA 1JU2A 2XFOA 3H8IA 4AT0A 1O5WA 3BI2A 4K7ZA 3M12A 5GRTA 2GMJA 1JOAA 3H4KA 3PS9A 2Y6RA 3CPIG 4GUVA 4OPCA 4AT2A 2NPXA 2I0ZA 3BNMA 2R0PA 1L9DA 1LPFA 2JBVA 1N1PA 1PN0A 2GB0A 2DKIA 4DSGA 1VDCA 1Z6LA 4H4TA 5L46A 1QJDA 3ALJA 1CJCA 3DJJA 1GRFA 2V3BA 2AR8A 4KPRA 2C3CA 3CPJG 3KD9A 2WDVA 3AE1A 1H6VA 4ZN0A 2YLSA 2XVJA 4NNJA 2BC0A 2YLXA 2BS3A 5FS6A 2YM2A 3HZLA 4XWRA 1GRGA 2XVHA 4J57A 4H4VA 4JDRA 4XWZA 2GAGB 2DKHA 1IUUA 5JCIA 2ACZA 3SZ0A 2JKCA 5EOWA 3BI5A 1OJAA 3QSEA 4U2SA 2BCGG 2WS3A 1NPXA 2XVEA 5JCMA 1E39A 3RNMA 1TDKA 3AE3A 3DK4A 3UTFA 1XPQA 3P1WA 4JN9A 2AQJA 1L0VA 2XYOA 2OLNA 2XDOA 3BI4A 2BRYA 5KOWA 2GRTA 2H89A 1M64A 4GCMA 3AD9B 5KMPA 1B5QA 1KSSA 3UTGA 1CL0A 1VRQB 2OALA 3ZYXA 4X9MA 3FG2P 1GREA 2YG6A 3ALMA 4B65A 2BK5A 1N4WA 1PJ7A 2XVFA 3LJPA 2GR0A 4YKFA 2QA1A 4J34A 1L9CA 5IQ1A 3PO7A 2QCUA 1ZK7A 3JSKA 3LZXA 3NNEA 4A5LA 2GH5A 2C72A 3KVEA 2NVKX 3P4QA 1TYTA 1K0LA 2XLSA 4FK1C 4EQWA 2R46A 1JNRA 4B69A 3LADA 1VG9A 3UKFA 4DGKA 1ELIA 5J7XA 2YVJA 4H4RA 3I3LA 4BK2A 2C76A 4NTEA 4Y4LA 3CGEA 3BHKA 2B7RA 3ZDNA 4EMJA 1KDGA 2HQMA 2YR5A 2XLUA 4H4SA 3NH3X 4JNQA 1H83A 1YQZA 4U8OA 4E0VA 4NTCA 4ZCDA 1CBOA 1GPEA
chains in the Genus database with same CATH topology
2R4JA 4B63A 1DOBA 3B6DA 5JCNA 2EQ6A 4OPIA 4EQXA 2RGJA 4AP1A 3SQPA 3AE4A 3DK9A 3FBSA 1EL5A 4D04A 3BNUA 2WDRA 2C64A 3AEBA 3LB8A 1NDAA 3AE2A 3VRDB 1LQUA 1H81A 4CNJA 1NAAA 5IQ4A 5FMHA 1FOHA 1TDNA 2ZZBA 4YWOA 1DJNA 4NWZA 2EQ9A 3SYIA 3AXBA 1YY5A 2Z5XA 2APGA 3AYLA 2EQ8A 4CRTA 1TYPA 4H50A 2WP5A 3AEFA 4B67A 4U8IA 5BULA 1REOA 1ZY8A 5ER0A 2YQUA 3CGCA 4YT0A 3NHOX 3QVPA 3OZ2A 3K7TA 2BXSA 4UP3A 4LA1A 2GR3A 1F6MA 4G73A 3NYCA 1CC2A 2XLRA 5KNLA 4I59A 2WP9A 3D1CA 1EL9A 3GYXA 2FJEA 4OVIA 4DSHA 4Z44A 3M0OA 4MJWA 1NENA 1V59A 4OPLA 1IUVA 3AYJA 1K4QA 2BS4A 2C75A 3D8XA 4USQA 5EB4A 4CY8A 4A6NB 1CHUA 2XVIA 4B1BA 2WOWA 5TR3A 4EIQA 3GDPA 1K0IA 4EM4A 3CNTA 3P4SA 4BK3A 4YXDA 2O9ZA 1GRTA 3QVRA 2FJDA 3UTEA 2X8CA 3CGBA 2AAQA 4OPTA 3FIMB 1ZMCA 3VRBA 2B9YA 1E1KA 2XLTA 1DXLA 2QA2A 4UDPA 4NEVA 5KMSA 1NG4A 2WDQA 2XFUA 2WETA 4J31A 4Z43A 2ZZ0A 3CNPA 1H7XA 3C4NA 1GRAA 2X50A 4AOXA 1P2HA 1VQWA 1TRBA 4GAPA 4EQRA 2WBAA 1S3EA 4K5SA 1H7WA 2C7GA 3LZWA 4Z24A 3UP5A 3IF9A 3NYFA 2XFNA 1ONFA 2XFPA 2QAEA 3QFAA 1E6EA 1XHCA 3CTYA 4CCQA 4NEWA 1Y56B 2ZBWA 3ADAB 4M52A 2OLOA 3AECA 3S61A 1SEZA 3E1TA 4H4QA 3T2ZA 5HXIA 2GQFA 3UKKA 1OJCA 1S2QA 3RP6A 3BHFA 3NTDA 4J56A 5GSNA 4U8MA 2R0GA 3GYIA 5C2TA 4YSXA 5JCKA 2C73A 4CY6A 1EL7A 3AEAA 3ICSA 3QFBA 4U2LA 1ZMDA 4IA5A 4GDEA 4OCGA 1GV4A 3AWIA 3UOXA 1GXFA 4K8DA 3UP4A 3UKPA 4BURA 1NHRA 3DK8A 3URHA 4II2A 4N9XA 2E4GA 3GD3A 3C4AA 1BF3A 4FX9A 1UKVG 2BCPA 3ALLA 3K7QX 3UOVA 3G5RA 1KNRA 4C5OA 5C3JA 1VG0A 3HYWA 3II4A 3VQRA 2BACA 1IUWA 1H82A 2JB1A 2YG7A 3HYXA 4G6GA 4B64A 1IUXA 3GMCA 1YKJA 2YVFA 1BKWA 1PJ5A 3NT6A 4U8KA 1NG3A 4A6NA 3NK0X 2R45A 1LTXR 2YLTA 3V3NA 3ITJA 1JRXA 2VQBA 4YTPA 2GV8A 4G6HA 5HY5A 4U8JA 3VR8A 4U2TA 2YLWA 3KA7A 3QSMA 4H4YA 4KX6A 2Q0KA 4Z2RA 5KMQA 3DA1A 2YR6A 2C3DA 1PXCA 3RHAA 2OA1A 1ZOYA 2VOUA 1FCDA 2UZZA 2CDUA 3SXIA 2WEUA 1PS9A 2WPEA 2R9ZA 4TM0A 1PXBA 3KLJA 1P2EA 1ZX9A 1GNDA 3CNSA 3S5WA 1GSNA 1GOSA 1GALA 4I58A 5HYMA 2FBWA 1IUTA 5KMRA 2BK4A 3UKQA 1M6IA 4EM3A 1FEBA 1N4UA 1MXTA 1DNCA 3K7MX 3IC9A 1Y0PA 2WPFA 3Q9TA 1B37A 1LQTA 1PJ6A 2V5ZA 2W0HA 2WU5A 3EF6A 4RG4A 4YSYA 3CGDA 2WU2A 2CVJA 5J60A 1RP0A 3H8LA 1FL2A 1NEKA 1GEUA 4GR1A 1FECA 1XDIA 2F5ZA 2X3NA 3SZWA 4A65A 1B4VA 4XXGA 3UKLA 4A9WA 3GYJA 3NG7X 4O5QA 4H4ZA 4H4UA 3OC4A 2YAUA 3NLCA 3O0HA 5KRQA 1OJTA 2V6OA 1DODA 2C70A 1YQ4A 1XANA 4JQ9A 3SZCA 2YR4A 3HYVA 2V60A 2C65A 3FMWA 2YLRA 4K5RA 4IVMB 1EBDA 2C66A 4OPGA 5JCLA 2JB3A 3FPZA 2C67A 3ISHA 5CQFA 1BWCA 3NYEA 5KXJA 1HYUA 2ARDA 5FS9A 3RP8A 4Z2TA 3G5QA 3ABVA 4OPUA 1RSGA 4C77A 4DNAA 3M13A 4HA6A 1PBBA 2Q0LA 4TM1A 2BYBA 3T37A 3ICTA 4C74A 4EQSA 2VQ7A 1ZKQA 3NGCX 4H2NA 4ECHA 4BV6A 2R4EA 1D4DA 3I6DA 1GRHA 2GEWA 2GAHB 3C96A 3GRTA 3NTAA 4GF7A 1KFYA 4TLXA 3CN8A 1CJ4A 1ZP0A 2CULA 1TDOA 3AE7A 1DOEA 2Q6UA 2VRLA 1DJQA 4U8NA 2CFYA 2B9WA 1F8SA 2WQYA 4WX1A 1BGJA 5KOXA 3AE8A 4RSLA 1F8RA 2E1MA 4K2XA 1RYIA 2A89A 2VVLG 3UTHA 1D7LA 3WE0A 2BA9A 3B3RA 5KVIA 4IVOB 4LIIA 3DJGX 4ZCCA 3LOVA 2IIDA 3AEDA 5U1OA 1F8WA 2IVDA 4A7AA 3L8KA 4BJYA 3DGZA 5U63A 2GR2A 2TMDA 4GDPA 4TM4A 1FEAA 3T0KA 1PDHA 2JB2A 1GTEA 2GVCA 1D7YA 3Q6JA 3UOYA 2C4CA 2TPRA 3K30A 1ZDLA 4AP3A 3SY4A 3VRAA 3AEEA 2J3NA 2RGHA 1AOGA 2YG4A 1PHHA 1O95A 2X99A 2YG5A 3F8RA 3PVCA 1PBEA 5LV9A 5EBKA 3ATQA 3SFEA 2YWLA 1KNPA 2Y6QA 3AB1A 3GWDA 3L1RA 2ZZCA 1GERA 3ATRA 4U8LA 2EQ7A 1GT8A 2V61A 3DJEA 3DMEA 3CPHG 3AYIA 1MO9A 3UCLA 4EMIA 1PBCA 3DJDA 1LVLA 4YTNA 4IV9A 2RABA 2YLZA 4REKA 1JNZA 3CNDA 4G9KA 5M0ZA 4BK1A 1LJ1A 3SZFA 3P4RA 2JK6A 2YVGA 4CNKA 4Z25A 1Q1RA 3T2KA 3UOZA 1GTHA 3T31A 1X31B 3AD7B 2PHHA 1CJ2A 3NK2X 3AE9A 1L9EA 4J33A 4GRTA 2VRMA 3P4PA 1CC4A 2WESA 4EMWA 4LU6A 2BXRA 3GMBA 3T2YA 4NZHA 4USRA 4RG3A 1E1MA 2OAMA 1PBFA 4UDQA 2RGOA 4YSZA 4JY2A 5DBJA 2R0CA 3KU9A 3AE5A 2XCGA 4GAVA 1Q9IA 3GSIA 3KKJA 1JEHA 1DOCA 1PXAA 1S2YA 3QJ4A 4J2WA 2GMHA 4X9NA 3R9UA 1KSUA 1N4VA 2FJAA 4YTMA 3CMMA 5U25A 2B76A 4H4WA 3V76A 4BJZA 3GWFA 3EPTA 4Z26A 1Q1WA 1GRBA 4Y4MA 2BK3A 1CC6A 2GR1A 3DGHA 4HB9A 5HHFA 4C3XA 1EL8A 2BRAA 2XFQA 4PABA 2IVEA 3UKAA 4OPDA 4G74A 5BRTA 3NRNA 2BS2A 1E7PA 4NTDA 3GRSA 3NN6X 1QO8A 1D4EA 3QSSA 4K22A 3VR9A 1TDEA 3NK1X 3UKHA 3ICRA 1S3BA 3AE6A 2WPCA 1NHQA 4YSHA 1COYA 3REDA 4H2RA 5KWFA 3NKSA 1E1NA 2E5VA 3F8DA 3NN0X 5IPYA 1IUSA 1OJ9A 3NIXA 4A99A 3AEGA 4AOSA 1QLBA 3EAOA 4C3YA 2WOIA 4FK1A 3GD4A 1W4XA 3SGLA 5KVHA 2PYXA 3LXDA 2VVMA 4TM3A 3G5SA 1B8SA 2WHDA 2JAEA 1TDFA 4JY3A 1CF3A 3SFDA 4ADWA 5M10A 1BGNA 3SX6A 2B7SA 1CJ3A 3EANA 4JNAA 3CNJA 4II3A 4B66A 2H88A 5BVAA 2GF3A 4H4PA 4WCTA 5EB5A 3P9UA 4J36A 2A8XA 2FJBA 4CBQA 4YKGA 5BUKA 4B68A 4CCRA 1NHPA 1KF6A 5FS8A 2BABA 4H2PA 2WOVA 4Y4NA 4APNA 4P9SA 1O94A 1ZOVA 1H86A 4Z2UA 3AD8B 1BZLA 1MOKA 2X8GA 3KPKA 2VVLA 4H4XA 4UDRA 1YQ3A 3F8PA 1NHSA 2VZ2A 4FDCB 3IHMA 1H84A 4D03A 2XLPA 3RP7A 1JRYA 3SM8A 1D5TA 3V3OA 1K0JA 2YM1A 3COXA 4PAAA 2A87A 1OJDA 3IWAA 2V3AA 1GETA 1PBDA 3T14A 2BC1A 4X4JA 1F3PA 4U8PA 4TLZA 1D4CA 1Y56A 2WP6A 2YG3A 4H2QA 1LV0A 4O5UA 5CKUA 1GESA 4A79A 1JRZA 3DH9A 1IJHA 4EIPA 4IA6A 2Q7VA 2X8HA 2Z5YA 3GDNA 3KPFA 5FS7A 3CIRA 4H7UA 4ICYA 3IHGA 2B9XA 2GQWA 1E1LA 1JU2A 2XFOA 3H8IA 4AT0A 1O5WA 3BI2A 4K7ZA 3M12A 5GRTA 2GMJA 1JOAA 3H4KA 3PS9A 2Y6RA 3CPIG 4GUVA 4OPCA 4AT2A 2NPXA 2I0ZA 3BNMA 2R0PA 1L9DA 1LPFA 2JBVA 1N1PA 1PN0A 2GB0A 2DKIA 4DSGA 1VDCA 1Z6LA 4H4TA 5L46A 1QJDA 3ALJA 1CJCA 3DJJA 1GRFA 2V3BA 2AR8A 4KPRA 2C3CA 3CPJG 3KD9A 2WDVA 3AE1A 1H6VA 4ZN0A 2YLSA 2XVJA 4NNJA 2BC0A 2YLXA 2BS3A 5FS6A 2YM2A 3HZLA 4XWRA 1GRGA 2XVHA 4J57A 4H4VA 4JDRA 4XWZA 2GAGB 2DKHA 1IUUA 5JCIA 2ACZA 3SZ0A 2JKCA 5EOWA 3BI5A 1OJAA 3QSEA 4U2SA 2BCGG 2WS3A 1NPXA 2XVEA 5JCMA 1E39A 3RNMA 1TDKA 3AE3A 3DK4A 3UTFA 1XPQA 3P1WA 4JN9A 2AQJA 1L0VA 2XYOA 2OLNA 2XDOA 3BI4A 2BRYA 5KOWA 2GRTA 2H89A 1M64A 4GCMA 3AD9B 5KMPA 1B5QA 1KSSA 3UTGA 1CL0A 1VRQB 2OALA 3ZYXA 4X9MA 3FG2P 1GREA 2YG6A 3ALMA 4B65A 2BK5A 1N4WA 1PJ7A 2XVFA 3LJPA 2GR0A 4YKFA 2QA1A 4J34A 1L9CA 5IQ1A 3PO7A 2QCUA 1ZK7A 3JSKA 3LZXA 3NNEA 4A5LA 2GH5A 2C72A 3KVEA 2NVKX 3P4QA 1TYTA 1K0LA 2XLSA 4FK1C 4EQWA 2R46A 1JNRA 4B69A 3LADA 1VG9A 3UKFA 4DGKA 1ELIA 5J7XA 2YVJA 4H4RA 3I3LA 4BK2A 2C76A 4NTEA 4Y4LA 3CGEA 3BHKA 2B7RA 3ZDNA 4EMJA 1KDGA 2HQMA 2YR5A 2XLUA 4H4SA 3NH3X 4JNQA 1H83A 1YQZA 4U8OA 4E0VA 4NTCA 4ZCDA 1CBOA 1GPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4J A;  4B63 A;  1DOB A;  3B6D A;  5JCN A;  2EQ6 A;  4OPI A;  4EQX A;  2RGJ A;  4AP1 A;  3SQP A;  3AE4 A;  3DK9 A;  3FBS A;  1EL5 A;  4D04 A;  3BNU A;  2WDR A;  2C64 A;  3AEB A;  3LB8 A;  1NDA A;  3AE2 A;  3VRD B;  1LQU A;  1H81 A;  4CNJ A;  1NAA A;  5IQ4 A;  5FMH A;  1FOH A;  1TDN A;  2ZZB A;  4YWO A;  1DJN A;  2EQ9 A;  3AXB A;  1YY5 A;  2Z5X A;  2APG A;  3AYL A;  2EQ8 A;  4CRT A;  1TYP A;  4H50 A;  2WP5 A;  3AEF A;  4B67 A;  4U8I A;  5BUL A;  1REO A;  1ZY8 A;  5ER0 A;  2YQU A;  3CGC A;  4YT0 A;  3NHO X;  3QVP A;  3OZ2 A;  3K7T A;  2BXS A;  4UP3 A;  4LA1 A;  2GR3 A;  1F6M A;  3NYC A;  1CC2 A;  2XLR A;  4I59 A;  2WP9 A;  3D1C A;  1EL9 A;  2FJE A;  4OVI A;  4DSH A;  4Z44 A;  3M0O A;  4MJW A;  1NEN A;  1V59 A;  4OPL A;  1IUV A;  3AYJ A;  1K4Q A;  2BS4 A;  2C75 A;  3D8X A;  4USQ A;  5EB4 A;  4CY8 A;  4A6N B;  1CHU A;  2XVI A;  4B1B A;  2WOW A;  5TR3 A;  4EIQ A;  3GDP A;  1K0I A;  4EM4 A;  3CNT A;  3P4S A;  4BK3 A;  4YXD A;  2O9Z A;  1GRT A;  3QVR A;  2FJD A;  3UTE A;  2X8C A;  3CGB A;  2AAQ A;  4OPT A;  3FIM B;  1ZMC A;  3VRB A;  2B9Y A;  1E1K A;  2XLT A;  1DXL A;  2QA2 A;  4UDP A;  4NEV A;  1NG4 A;  2WDQ A;  2XFU A;  2WET A;  4J31 A;  4Z43 A;  2ZZ0 A;  3CNP A;  1H7X A;  3C4N A;  1GRA A;  2X50 A;  4AOX A;  1P2H A;  1VQW A;  1TRB A;  4EQR A;  2WBA A;  1S3E A;  4K5S A;  1H7W A;  2C7G A;  3LZW A;  4Z24 A;  3UP5 A;  3IF9 A;  3NYF A;  2XFN A;  1ONF A;  2XFP A;  2QAE A;  3QFA A;  1E6E A;  1XHC A;  3CTY A;  4CCQ A;  4NEW A;  1Y56 B;  2ZBW A;  3ADA B;  4M52 A;  2OLO A;  3AEC A;  3S61 A;  1SEZ A;  3E1T A;  4H4Q A;  5HXI A;  2GQF A;  3UKK A;  1OJC A;  1S2Q A;  3RP6 A;  3BHF A;  3NTD A;  4J56 A;  5GSN A;  4U8M A;  2R0G A;  3GYI A;  5C2T A;  4YSX A;  5JCK A;  2C73 A;  4CY6 A;  1EL7 A;  3AEA A;  3ICS A;  3QFB A;  4U2L A;  1ZMD A;  4IA5 A;  4GDE A;  4OCG A;  1GV4 A;  3AWI A;  3UOX A;  1GXF A;  4K8D A;  3UP4 A;  3UKP A;  4BUR A;  1NHR A;  3DK8 A;  3URH A;  4N9X A;  2E4G A;  3GD3 A;  3C4A A;  1BF3 A;  4FX9 A;  1UKV G;  2BCP A;  3ALL A;  3K7Q X;  3UOV A;  3G5R A;  1KNR A;  4C5O A;  5C3J A;  1VG0 A;  3II4 A;  3VQR A;  2BAC A;  1IUW A;  1H82 A;  2JB1 A;  2YG7 A;  4B64 A;  1IUX A;  3GMC A;  1YKJ A;  2YVF A;  1BKW A;  1PJ5 A;  3NT6 A;  4U8K A;  1NG3 A;  4A6N A;  3NK0 X;  2R45 A;  1LTX R;  2YLT A;  3V3N A;  3ITJ A;  1JRX A;  2VQB A;  4YTP A;  2GV8 A;  5HY5 A;  4U8J A;  3VR8 A;  4U2T A;  2YLW A;  3KA7 A;  3QSM A;  4H4Y A;  4KX6 A;  2Q0K A;  4Z2R A;  3DA1 A;  2YR6 A;  2C3D A;  1PXC A;  3RHA A;  2OA1 A;  1ZOY A;  2VOU A;  1FCD A;  2UZZ A;  2CDU A;  2WEU A;  1PS9 A;  2WPE A;  2R9Z A;  4TM0 A;  1PXB A;  3KLJ A;  1P2E A;  1ZX9 A;  1GND A;  3CNS A;  3S5W A;  1GSN A;  1GOS A;  1GAL A;  4I58 A;  5HYM A;  2FBW A;  1IUT A;  2BK4 A;  3UKQ A;  1M6I A;  4EM3 A;  1FEB A;  1N4U A;  1MXT A;  1DNC A;  3K7M X;  3IC9 A;  1Y0P A;  2WPF A;  3Q9T A;  1B37 A;  1LQT A;  1PJ6 A;  2V5Z A;  2W0H A;  2WU5 A;  3EF6 A;  4RG4 A;  4YSY A;  3CGD A;  2WU2 A;  2CVJ A;  5J60 A;  1RP0 A;  3H8L A;  1FL2 A;  1NEK A;  1GEU A;  4GR1 A;  1FEC A;  1XDI A;  2F5Z A;  2X3N A;  4A65 A;  1B4V A;  4XXG A;  3UKL A;  4A9W A;  3GYJ A;  3NG7 X;  4O5Q A;  4H4Z A;  4H4U A;  3OC4 A;  2YAU A;  3NLC A;  3O0H A;  5KRQ A;  1OJT A;  2V6O A;  1DOD A;  2C70 A;  1YQ4 A;  1XAN A;  4JQ9 A;  2YR4 A;  2V60 A;  2C65 A;  3FMW A;  2YLR A;  4K5R A;  4IVM B;  1EBD A;  2C66 A;  4OPG A;  5JCL A;  2JB3 A;  3FPZ A;  2C67 A;  3ISH A;  5CQF A;  1BWC A;  3NYE A;  5KXJ A;  1HYU A;  2ARD A;  5FS9 A;  3RP8 A;  4Z2T A;  3G5Q A;  3ABV A;  4OPU A;  1RSG A;  4C77 A;  4DNA A;  3M13 A;  4HA6 A;  1PBB A;  2Q0L A;  4TM1 A;  2BYB A;  3T37 A;  3ICT A;  4C74 A;  4EQS A;  2VQ7 A;  1ZKQ A;  3NGC X;  4H2N A;  4ECH A;  4BV6 A;  2R4E A;  1D4D A;  3I6D A;  1GRH A;  2GEW A;  2GAH B;  3C96 A;  3GRT A;  3NTA A;  4GF7 A;  1KFY A;  4TLX A;  3CN8 A;  1CJ4 A;  1ZP0 A;  2CUL A;  1TDO A;  3AE7 A;  1DOE A;  2Q6U A;  2VRL A;  1DJQ A;  4U8N A;  2CFY A;  2B9W A;  1F8S A;  2WQY A;  4WX1 A;  1BGJ A;  5KOX A;  3AE8 A;  4RSL A;  1F8R A;  2E1M A;  4K2X A;  1RYI A;  2A89 A;  2VVL G;  3UTH A;  1D7L A;  3WE0 A;  2BA9 A;  3B3R A;  5KVI A;  4IVO B;  4LII A;  3DJG X;  4ZCC A;  3LOV A;  2IID A;  3AED A;  5U1O A;  1F8W A;  2IVD A;  4A7A A;  3L8K A;  4BJY A;  3DGZ A;  5U63 A;  2GR2 A;  2TMD A;  4GDP A;  4TM4 A;  1FEA A;  1PDH A;  2JB2 A;  1GTE A;  1D7Y A;  2GVC A;  3Q6J A;  3UOY A;  2TPR A;  3K30 A;  1ZDL A;  4AP3 A;  3VRA A;  3AEE A;  2J3N A;  2RGH A;  1AOG A;  2YG4 A;  1PHH A;  1O95 A;  2X99 A;  2YG5 A;  3F8R A;  3PVC A;  1PBE A;  5LV9 A;  5EBK A;  3ATQ A;  3SFE A;  2YWL A;  1KNP A;  2Y6Q A;  3AB1 A;  3GWD A;  3L1R A;  2ZZC A;  1GER A;  3ATR A;  4U8L A;  2EQ7 A;  1GT8 A;  2V61 A;  3DJE A;  3DME A;  3CPH G;  3AYI A;  1MO9 A;  3UCL A;  4EMI A;  1PBC A;  3DJD A;  1LVL A;  4YTN A;  4IV9 A;  2RAB A;  2YLZ A;  4REK A;  1JNZ A;  3CND A;  5M0Z A;  4BK1 A;  1LJ1 A;  3P4R A;  2JK6 A;  2YVG A;  4CNK A;  4Z25 A;  1Q1R A;  3UOZ A;  1GTH A;  1X31 B;  3AD7 B;  2PHH A;  1CJ2 A;  3NK2 X;  3AE9 A;  1L9E A;  4J33 A;  4GRT A;  2VRM A;  3P4P A;  1CC4 A;  2WES A;  4EMW A;  4LU6 A;  2BXR A;  3GMB A;  4NZH A;  4USR A;  4RG3 A;  1E1M A;  2OAM A;  1PBF A;  4UDQ A;  2RGO A;  4YSZ A;  4JY2 A;  5DBJ A;  2R0C A;  3KU9 A;  3AE5 A;  2XCG A;  1Q9I A;  3GSI A;  3KKJ A;  1JEH A;  1DOC A;  1PXA A;  1S2Y A;  3QJ4 A;  4J2W A;  2GMH A;  4X9N A;  3R9U A;  1KSU A;  1N4V A;  2FJA A;  4YTM A;  5U25 A;  2B76 A;  4H4W A;  3V76 A;  4BJZ A;  3GWF A;  3EPT A;  4Z26 A;  1Q1W A;  1GRB A;  4Y4M A;  2BK3 A;  1CC6 A;  2GR1 A;  3DGH A;  4HB9 A;  5HHF A;  4C3X A;  1EL8 A;  2XFQ A;  4PAB A;  2IVE A;  3UKA A;  4OPD A;  5BRT A;  3NRN A;  2BS2 A;  1E7P A;  4NTD A;  3GRS A;  3NN6 X;  1QO8 A;  1D4E A;  3QSS A;  4K22 A;  3VR9 A;  1TDE A;  3NK1 X;  3UKH A;  3ICR A;  1S3B A;  3AE6 A;  2WPC A;  1NHQ A;  4YSH A;  1COY A;  3RED A;  4H2R A;  5KWF A;  3NKS A;  1E1N A;  2E5V A;  3F8D A;  3NN0 X;  5IPY A;  1IUS A;  1OJ9 A;  3NIX A;  4A99 A;  3AEG A;  4AOS A;  1QLB A;  3EAO A;  4C3Y A;  2WOI A;  4FK1 A;  3GD4 A;  1W4X A;  3SGL A;  5KVH A;  2PYX A;  3LXD A;  2VVM A;  4TM3 A;  3G5S A;  1B8S A;  2WHD A;  2JAE A;  1TDF A;  4JY3 A;  1CF3 A;  3SFD A;  4ADW A;  5M10 A;  1BGN A;  2B7S A;  1CJ3 A;  3EAN A;  4JNA A;  3CNJ A;  4B66 A;  2H88 A;  5BVA A;  2GF3 A;  4H4P A;  4WCT A;  5EB5 A;  3P9U A;  4J36 A;  2A8X A;  2FJB A;  4CBQ A;  4YKG A;  5BUK A;  4B68 A;  4CCR A;  1NHP A;  1KF6 A;  5FS8 A;  2BAB A;  4H2P A;  2WOV A;  4Y4N A;  4APN A;  4P9S A;  1O94 A;  1ZOV A;  1H86 A;  4Z2U A;  3AD8 B;  1BZL A;  1MOK A;  2X8G A;  2VVL A;  4H4X A;  4UDR A;  1YQ3 A;  3F8P A;  1NHS A;  2VZ2 A;  4FDC B;  3IHM A;  1H84 A;  4D03 A;  2XLP A;  3RP7 A;  1JRY A;  3SM8 A;  1D5T A;  3V3O A;  1K0J A;  2YM1 A;  3COX A;  4PAA A;  2A87 A;  1OJD A;  3IWA A;  2V3A A;  1GET A;  1PBD A;  2BC1 A;  4X4J A;  1F3P A;  4U8P A;  4TLZ A;  1D4C A;  1Y56 A;  2WP6 A;  2YG3 A;  4H2Q A;  1LV0 A;  4O5U A;  5CKU A;  1GES A;  4A79 A;  1JRZ A;  3DH9 A;  1IJH A;  4EIP A;  4IA6 A;  2Q7V A;  2X8H A;  2Z5Y A;  3GDN A;  3KPF A;  5FS7 A;  3CIR A;  4H7U A;  4ICY A;  3IHG A;  2B9X A;  2GQW A;  1E1L A;  1JU2 A;  2XFO A;  3H8I A;  4AT0 A;  1O5W A;  3BI2 A;  4K7Z A;  3M12 A;  5GRT A;  2GMJ A;  1JOA A;  3H4K A;  3PS9 A;  2Y6R A;  3CPI G;  4GUV A;  4OPC A;  4AT2 A;  2NPX A;  2I0Z A;  3BNM A;  2R0P A;  1L9D A;  1LPF A;  2JBV A;  1N1P A;  1PN0 A;  2GB0 A;  2DKI A;  4DSG A;  1VDC A;  1Z6L A;  4H4T A;  5L46 A;  1QJD A;  3ALJ A;  1CJC A;  3DJJ A;  1GRF A;  2V3B A;  2AR8 A;  4KPR A;  2C3C A;  3CPJ G;  3KD9 A;  2WDV A;  3AE1 A;  1H6V A;  4ZN0 A;  2YLS A;  2XVJ A;  2BC0 A;  2YLX A;  2BS3 A;  5FS6 A;  2YM2 A;  3HZL A;  4XWR A;  1GRG A;  2XVH A;  4J57 A;  4H4V A;  4JDR A;  4XWZ A;  2GAG B;  2DKH A;  1IUU A;  5JCI A;  2ACZ A;  2JKC A;  5EOW A;  3BI5 A;  1OJA A;  3QSE A;  4U2S A;  2BCG G;  2WS3 A;  1NPX A;  2XVE A;  5JCM A;  1E39 A;  3RNM A;  1TDK A;  3AE3 A;  3DK4 A;  3UTF A;  1XPQ A;  3P1W A;  4JN9 A;  2AQJ A;  1L0V A;  2XYO A;  2OLN A;  2XDO A;  3BI4 A;  5KOW A;  2GRT A;  2H89 A;  1M64 A;  4GCM A;  3AD9 B;  1B5Q A;  1KSS A;  3UTG A;  1CL0 A;  1VRQ B;  2OAL A;  3ZYX A;  4X9M A;  3FG2 P;  1GRE A;  2YG6 A;  3ALM A;  4B65 A;  2BK5 A;  1N4W A;  1PJ7 A;  2XVF A;  3LJP A;  2GR0 A;  4YKF A;  2QA1 A;  4J34 A;  1L9C A;  5IQ1 A;  3PO7 A;  2QCU A;  1ZK7 A;  3JSK A;  3LZX A;  3NNE A;  4A5L A;  2GH5 A;  2C72 A;  3KVE A;  2NVK X;  3P4Q A;  1TYT A;  1K0L A;  2XLS A;  4FK1 C;  4EQW A;  2R46 A;  1JNR A;  4B69 A;  3LAD A;  1VG9 A;  3UKF A;  4DGK A;  1ELI A;  5J7X A;  2YVJ A;  4H4R A;  3I3L A;  4BK2 A;  2C76 A;  4NTE A;  4Y4L A;  3CGE A;  3BHK A;  2B7R A;  3ZDN A;  4EMJ A;  1KDG A;  2HQM A;  2YR5 A;  2XLU A;  4H4S A;  3NH3 X;  4JNQ A;  1H83 A;  1YQZ A;  4U8O A;  4E0V A;  4NTC A;  4ZCD A;  1CBO A;  1GPE A; 
#chains in the Genus database with same CATH topology
 2R4J A;  4B63 A;  1DOB A;  3B6D A;  5JCN A;  2EQ6 A;  4OPI A;  4EQX A;  2RGJ A;  4AP1 A;  3SQP A;  3AE4 A;  3DK9 A;  3FBS A;  1EL5 A;  4D04 A;  3BNU A;  2WDR A;  2C64 A;  3AEB A;  3LB8 A;  1NDA A;  3AE2 A;  3VRD B;  1LQU A;  1H81 A;  4CNJ A;  1NAA A;  5IQ4 A;  5FMH A;  1FOH A;  1TDN A;  2ZZB A;  4YWO A;  1DJN A;  4NWZ A;  2EQ9 A;  3SYI A;  3AXB A;  1YY5 A;  2Z5X A;  2APG A;  3AYL A;  2EQ8 A;  4CRT A;  1TYP A;  4H50 A;  2WP5 A;  3AEF A;  4B67 A;  4U8I A;  5BUL A;  1REO A;  1ZY8 A;  5ER0 A;  2YQU A;  3CGC A;  4YT0 A;  3NHO X;  3QVP A;  3OZ2 A;  3K7T A;  2BXS A;  4UP3 A;  4LA1 A;  2GR3 A;  1F6M A;  4G73 A;  3NYC A;  1CC2 A;  2XLR A;  5KNL A;  4I59 A;  2WP9 A;  3D1C A;  1EL9 A;  3GYX A;  2FJE A;  4OVI A;  4DSH A;  4Z44 A;  3M0O A;  4MJW A;  1NEN A;  1V59 A;  4OPL A;  1IUV A;  3AYJ A;  1K4Q A;  2BS4 A;  2C75 A;  3D8X A;  4USQ A;  5EB4 A;  4CY8 A;  4A6N B;  1CHU A;  2XVI A;  4B1B A;  2WOW A;  5TR3 A;  4EIQ A;  3GDP A;  1K0I A;  4EM4 A;  3CNT A;  3P4S A;  4BK3 A;  4YXD A;  2O9Z A;  1GRT A;  3QVR A;  2FJD A;  3UTE A;  2X8C A;  3CGB A;  2AAQ A;  4OPT A;  3FIM B;  1ZMC A;  3VRB A;  2B9Y A;  1E1K A;  2XLT A;  1DXL A;  2QA2 A;  4UDP A;  4NEV A;  5KMS A;  1NG4 A;  2WDQ A;  2XFU A;  2WET A;  4J31 A;  4Z43 A;  2ZZ0 A;  3CNP A;  1H7X A;  3C4N A;  1GRA A;  2X50 A;  4AOX A;  1P2H A;  1VQW A;  1TRB A;  4GAP A;  4EQR A;  2WBA A;  1S3E A;  4K5S A;  1H7W A;  2C7G A;  3LZW A;  4Z24 A;  3UP5 A;  3IF9 A;  3NYF A;  2XFN A;  1ONF A;  2XFP A;  2QAE A;  3QFA A;  1E6E A;  1XHC A;  3CTY A;  4CCQ A;  4NEW A;  1Y56 B;  2ZBW A;  3ADA B;  4M52 A;  2OLO A;  3AEC A;  3S61 A;  1SEZ A;  3E1T A;  4H4Q A;  3T2Z A;  5HXI A;  2GQF A;  3UKK A;  1OJC A;  1S2Q A;  3RP6 A;  3BHF A;  3NTD A;  4J56 A;  5GSN A;  4U8M A;  2R0G A;  3GYI A;  5C2T A;  4YSX A;  5JCK A;  2C73 A;  4CY6 A;  1EL7 A;  3AEA A;  3ICS A;  3QFB A;  4U2L A;  1ZMD A;  4IA5 A;  4GDE A;  4OCG A;  1GV4 A;  3AWI A;  3UOX A;  1GXF A;  4K8D A;  3UP4 A;  3UKP A;  4BUR A;  1NHR A;  3DK8 A;  3URH A;  4II2 A;  4N9X A;  2E4G A;  3GD3 A;  3C4A A;  1BF3 A;  4FX9 A;  1UKV G;  2BCP A;  3ALL A;  3K7Q X;  3UOV A;  3G5R A;  1KNR A;  4C5O A;  5C3J A;  1VG0 A;  3HYW A;  3II4 A;  3VQR A;  2BAC A;  1IUW A;  1H82 A;  2JB1 A;  2YG7 A;  3HYX A;  4G6G A;  4B64 A;  1IUX A;  3GMC A;  1YKJ A;  2YVF A;  1BKW A;  1PJ5 A;  3NT6 A;  4U8K A;  1NG3 A;  4A6N A;  3NK0 X;  2R45 A;  1LTX R;  2YLT A;  3V3N A;  3ITJ A;  1JRX A;  2VQB A;  4YTP A;  2GV8 A;  4G6H A;  5HY5 A;  4U8J A;  3VR8 A;  4U2T A;  2YLW A;  3KA7 A;  3QSM A;  4H4Y A;  4KX6 A;  2Q0K A;  4Z2R A;  5KMQ A;  3DA1 A;  2YR6 A;  2C3D A;  1PXC A;  3RHA A;  2OA1 A;  1ZOY A;  2VOU A;  1FCD A;  2UZZ A;  2CDU A;  3SXI A;  2WEU A;  1PS9 A;  2WPE A;  2R9Z A;  4TM0 A;  1PXB A;  3KLJ A;  1P2E A;  1ZX9 A;  1GND A;  3CNS A;  3S5W A;  1GSN A;  1GOS A;  1GAL A;  4I58 A;  5HYM A;  2FBW A;  1IUT A;  5KMR A;  2BK4 A;  3UKQ A;  1M6I A;  4EM3 A;  1FEB A;  1N4U A;  1MXT A;  1DNC A;  3K7M X;  3IC9 A;  1Y0P A;  2WPF A;  3Q9T A;  1B37 A;  1LQT A;  1PJ6 A;  2V5Z A;  2W0H A;  2WU5 A;  3EF6 A;  4RG4 A;  4YSY A;  3CGD A;  2WU2 A;  2CVJ A;  5J60 A;  1RP0 A;  3H8L A;  1FL2 A;  1NEK A;  1GEU A;  4GR1 A;  1FEC A;  1XDI A;  2F5Z A;  2X3N A;  3SZW A;  4A65 A;  1B4V A;  4XXG A;  3UKL A;  4A9W A;  3GYJ A;  3NG7 X;  4O5Q A;  4H4Z A;  4H4U A;  3OC4 A;  2YAU A;  3NLC A;  3O0H A;  5KRQ A;  1OJT A;  2V6O A;  1DOD A;  2C70 A;  1YQ4 A;  1XAN A;  4JQ9 A;  3SZC A;  2YR4 A;  3HYV A;  2V60 A;  2C65 A;  3FMW A;  2YLR A;  4K5R A;  4IVM B;  1EBD A;  2C66 A;  4OPG A;  5JCL A;  2JB3 A;  3FPZ A;  2C67 A;  3ISH A;  5CQF A;  1BWC A;  3NYE A;  5KXJ A;  1HYU A;  2ARD A;  5FS9 A;  3RP8 A;  4Z2T A;  3G5Q A;  3ABV A;  4OPU A;  1RSG A;  4C77 A;  4DNA A;  3M13 A;  4HA6 A;  1PBB A;  2Q0L A;  4TM1 A;  2BYB A;  3T37 A;  3ICT A;  4C74 A;  4EQS A;  2VQ7 A;  1ZKQ A;  3NGC X;  4H2N A;  4ECH A;  4BV6 A;  2R4E A;  1D4D A;  3I6D A;  1GRH A;  2GEW A;  2GAH B;  3C96 A;  3GRT A;  3NTA A;  4GF7 A;  1KFY A;  4TLX A;  3CN8 A;  1CJ4 A;  1ZP0 A;  2CUL A;  1TDO A;  3AE7 A;  1DOE A;  2Q6U A;  2VRL A;  1DJQ A;  4U8N A;  2CFY A;  2B9W A;  1F8S A;  2WQY A;  4WX1 A;  1BGJ A;  5KOX A;  3AE8 A;  4RSL A;  1F8R A;  2E1M A;  4K2X A;  1RYI A;  2A89 A;  2VVL G;  3UTH A;  1D7L A;  3WE0 A;  2BA9 A;  3B3R A;  5KVI A;  4IVO B;  4LII A;  3DJG X;  4ZCC A;  3LOV A;  2IID A;  3AED A;  5U1O A;  1F8W A;  2IVD A;  4A7A A;  3L8K A;  4BJY A;  3DGZ A;  5U63 A;  2GR2 A;  2TMD A;  4GDP A;  4TM4 A;  1FEA A;  3T0K A;  1PDH A;  2JB2 A;  1GTE A;  2GVC A;  1D7Y A;  3Q6J A;  3UOY A;  2C4C A;  2TPR A;  3K30 A;  1ZDL A;  4AP3 A;  3SY4 A;  3VRA A;  3AEE A;  2J3N A;  2RGH A;  1AOG A;  2YG4 A;  1PHH A;  1O95 A;  2X99 A;  2YG5 A;  3F8R A;  3PVC A;  1PBE A;  5LV9 A;  5EBK A;  3ATQ A;  3SFE A;  2YWL A;  1KNP A;  2Y6Q A;  3AB1 A;  3GWD A;  3L1R A;  2ZZC A;  1GER A;  3ATR A;  4U8L A;  2EQ7 A;  1GT8 A;  2V61 A;  3DJE A;  3DME A;  3CPH G;  3AYI A;  1MO9 A;  3UCL A;  4EMI A;  1PBC A;  3DJD A;  1LVL A;  4YTN A;  4IV9 A;  2RAB A;  2YLZ A;  4REK A;  1JNZ A;  3CND A;  4G9K A;  5M0Z A;  4BK1 A;  1LJ1 A;  3SZF A;  3P4R A;  2JK6 A;  2YVG A;  4CNK A;  4Z25 A;  1Q1R A;  3T2K A;  3UOZ A;  1GTH A;  3T31 A;  1X31 B;  3AD7 B;  2PHH A;  1CJ2 A;  3NK2 X;  3AE9 A;  1L9E A;  4J33 A;  4GRT A;  2VRM A;  3P4P A;  1CC4 A;  2WES A;  4EMW A;  4LU6 A;  2BXR A;  3GMB A;  3T2Y A;  4NZH A;  4USR A;  4RG3 A;  1E1M A;  2OAM A;  1PBF A;  4UDQ A;  2RGO A;  4YSZ A;  4JY2 A;  5DBJ A;  2R0C A;  3KU9 A;  3AE5 A;  2XCG A;  4GAV A;  1Q9I A;  3GSI A;  3KKJ A;  1JEH A;  1DOC A;  1PXA A;  1S2Y A;  3QJ4 A;  4J2W A;  2GMH A;  4X9N A;  3R9U A;  1KSU A;  1N4V A;  2FJA A;  4YTM A;  3CMM A;  5U25 A;  2B76 A;  4H4W A;  3V76 A;  4BJZ A;  3GWF A;  3EPT A;  4Z26 A;  1Q1W A;  1GRB A;  4Y4M A;  2BK3 A;  1CC6 A;  2GR1 A;  3DGH A;  4HB9 A;  5HHF A;  4C3X A;  1EL8 A;  2BRA A;  2XFQ A;  4PAB A;  2IVE A;  3UKA A;  4OPD A;  4G74 A;  5BRT A;  3NRN A;  2BS2 A;  1E7P A;  4NTD A;  3GRS A;  3NN6 X;  1QO8 A;  1D4E A;  3QSS A;  4K22 A;  3VR9 A;  1TDE A;  3NK1 X;  3UKH A;  3ICR A;  1S3B A;  3AE6 A;  2WPC A;  1NHQ A;  4YSH A;  1COY A;  3RED A;  4H2R A;  5KWF A;  3NKS A;  1E1N A;  2E5V A;  3F8D A;  3NN0 X;  5IPY A;  1IUS A;  1OJ9 A;  3NIX A;  4A99 A;  3AEG A;  4AOS A;  1QLB A;  3EAO A;  4C3Y A;  2WOI A;  4FK1 A;  3GD4 A;  1W4X A;  3SGL A;  5KVH A;  2PYX A;  3LXD A;  2VVM A;  4TM3 A;  3G5S A;  1B8S A;  2WHD A;  2JAE A;  1TDF A;  4JY3 A;  1CF3 A;  3SFD A;  4ADW A;  5M10 A;  1BGN A;  3SX6 A;  2B7S A;  1CJ3 A;  3EAN A;  4JNA A;  3CNJ A;  4II3 A;  4B66 A;  2H88 A;  5BVA A;  2GF3 A;  4H4P A;  4WCT A;  5EB5 A;  3P9U A;  4J36 A;  2A8X A;  2FJB A;  4CBQ A;  4YKG A;  5BUK A;  4B68 A;  4CCR A;  1NHP A;  1KF6 A;  5FS8 A;  2BAB A;  4H2P A;  2WOV A;  4Y4N A;  4APN A;  4P9S A;  1O94 A;  1ZOV A;  1H86 A;  4Z2U A;  3AD8 B;  1BZL A;  1MOK A;  2X8G A;  3KPK A;  2VVL A;  4H4X A;  4UDR A;  1YQ3 A;  3F8P A;  1NHS A;  2VZ2 A;  4FDC B;  3IHM A;  1H84 A;  4D03 A;  2XLP A;  3RP7 A;  1JRY A;  3SM8 A;  1D5T A;  3V3O A;  1K0J A;  2YM1 A;  3COX A;  4PAA A;  2A87 A;  1OJD A;  3IWA A;  2V3A A;  1GET A;  1PBD A;  3T14 A;  2BC1 A;  4X4J A;  1F3P A;  4U8P A;  4TLZ A;  1D4C A;  1Y56 A;  2WP6 A;  2YG3 A;  4H2Q A;  1LV0 A;  4O5U A;  5CKU A;  1GES A;  4A79 A;  1JRZ A;  3DH9 A;  1IJH A;  4EIP A;  4IA6 A;  2Q7V A;  2X8H A;  2Z5Y A;  3GDN A;  3KPF A;  5FS7 A;  3CIR A;  4H7U A;  4ICY A;  3IHG A;  2B9X A;  2GQW A;  1E1L A;  1JU2 A;  2XFO A;  3H8I A;  4AT0 A;  1O5W A;  3BI2 A;  4K7Z A;  3M12 A;  5GRT A;  2GMJ A;  1JOA A;  3H4K A;  3PS9 A;  2Y6R A;  3CPI G;  4GUV A;  4OPC A;  4AT2 A;  2NPX A;  2I0Z A;  3BNM A;  2R0P A;  1L9D A;  1LPF A;  2JBV A;  1N1P A;  1PN0 A;  2GB0 A;  2DKI A;  4DSG A;  1VDC A;  1Z6L A;  4H4T A;  5L46 A;  1QJD A;  3ALJ A;  1CJC A;  3DJJ A;  1GRF A;  2V3B A;  2AR8 A;  4KPR A;  2C3C A;  3CPJ G;  3KD9 A;  2WDV A;  3AE1 A;  1H6V A;  4ZN0 A;  2YLS A;  2XVJ A;  4NNJ A;  2BC0 A;  2YLX A;  2BS3 A;  5FS6 A;  2YM2 A;  3HZL A;  4XWR A;  1GRG A;  2XVH A;  4J57 A;  4H4V A;  4JDR A;  4XWZ A;  2GAG B;  2DKH A;  1IUU A;  5JCI A;  2ACZ A;  3SZ0 A;  2JKC A;  5EOW A;  3BI5 A;  1OJA A;  3QSE A;  4U2S A;  2BCG G;  2WS3 A;  1NPX A;  2XVE A;  5JCM A;  1E39 A;  3RNM A;  1TDK A;  3AE3 A;  3DK4 A;  3UTF A;  1XPQ A;  3P1W A;  4JN9 A;  2AQJ A;  1L0V A;  2XYO A;  2OLN A;  2XDO A;  3BI4 A;  2BRY A;  5KOW A;  2GRT A;  2H89 A;  1M64 A;  4GCM A;  3AD9 B;  5KMP A;  1B5Q A;  1KSS A;  3UTG A;  1CL0 A;  1VRQ B;  2OAL A;  3ZYX A;  4X9M A;  3FG2 P;  1GRE A;  2YG6 A;  3ALM A;  4B65 A;  2BK5 A;  1N4W A;  1PJ7 A;  2XVF A;  3LJP A;  2GR0 A;  4YKF A;  2QA1 A;  4J34 A;  1L9C A;  5IQ1 A;  3PO7 A;  2QCU A;  1ZK7 A;  3JSK A;  3LZX A;  3NNE A;  4A5L A;  2GH5 A;  2C72 A;  3KVE A;  2NVK X;  3P4Q A;  1TYT A;  1K0L A;  2XLS A;  4FK1 C;  4EQW A;  2R46 A;  1JNR A;  4B69 A;  3LAD A;  1VG9 A;  3UKF A;  4DGK A;  1ELI A;  5J7X A;  2YVJ A;  4H4R A;  3I3L A;  4BK2 A;  2C76 A;  4NTE A;  4Y4L A;  3CGE A;  3BHK A;  2B7R A;  3ZDN A;  4EMJ A;  1KDG A;  2HQM A;  2YR5 A;  2XLU A;  4H4S A;  3NH3 X;  4JNQ A;  1H83 A;  1YQZ A;  4U8O A;  4E0V A;  4NTC A;  4ZCD A;  1CBO A;  1GPE A; 
#chains in the Genus database with same CATH homology
 2R4J A;  4B63 A;  1DOB A;  3B6D A;  5JCN A;  2EQ6 A;  4OPI A;  4EQX A;  2RGJ A;  4AP1 A;  3SQP A;  3AE4 A;  3DK9 A;  3FBS A;  1EL5 A;  4D04 A;  3BNU A;  2WDR A;  2C64 A;  3AEB A;  3LB8 A;  1NDA A;  3AE2 A;  3VRD B;  1LQU A;  1H81 A;  4CNJ A;  1NAA A;  5IQ4 A;  5FMH A;  1FOH A;  1TDN A;  2ZZB A;  4YWO A;  1DJN A;  4NWZ A;  2EQ9 A;  3SYI A;  3AXB A;  1YY5 A;  2Z5X A;  2APG A;  3AYL A;  2EQ8 A;  4CRT A;  1TYP A;  4H50 A;  2WP5 A;  3AEF A;  4B67 A;  4U8I A;  5BUL A;  1REO A;  1ZY8 A;  5ER0 A;  2YQU A;  3CGC A;  4YT0 A;  3NHO X;  3QVP A;  3OZ2 A;  3K7T A;  2BXS A;  4UP3 A;  4LA1 A;  2GR3 A;  1F6M A;  4G73 A;  3NYC A;  1CC2 A;  2XLR A;  5KNL A;  4I59 A;  2WP9 A;  3D1C A;  1EL9 A;  3GYX A;  2FJE A;  4OVI A;  4DSH A;  4Z44 A;  3M0O A;  4MJW A;  1NEN A;  1V59 A;  4OPL A;  1IUV A;  3AYJ A;  1K4Q A;  2BS4 A;  2C75 A;  3D8X A;  4USQ A;  5EB4 A;  4CY8 A;  4A6N B;  1CHU A;  2XVI A;  4B1B A;  2WOW A;  5TR3 A;  4EIQ A;  3GDP A;  1K0I A;  4EM4 A;  3CNT A;  3P4S A;  4BK3 A;  4YXD A;  2O9Z A;  1GRT A;  3QVR A;  2FJD A;  3UTE A;  2X8C A;  3CGB A;  2AAQ A;  4OPT A;  3FIM B;  1ZMC A;  3VRB A;  2B9Y A;  1E1K A;  2XLT A;  1DXL A;  2QA2 A;  4UDP A;  4NEV A;  5KMS A;  1NG4 A;  2WDQ A;  2XFU A;  2WET A;  4J31 A;  4Z43 A;  2ZZ0 A;  3CNP A;  1H7X A;  3C4N A;  1GRA A;  2X50 A;  4AOX A;  1P2H A;  1VQW A;  1TRB A;  4GAP A;  4EQR A;  2WBA A;  1S3E A;  4K5S A;  1H7W A;  2C7G A;  3LZW A;  4Z24 A;  3UP5 A;  3IF9 A;  3NYF A;  2XFN A;  1ONF A;  2XFP A;  2QAE A;  3QFA A;  1E6E A;  1XHC A;  3CTY A;  4CCQ A;  4NEW A;  1Y56 B;  2ZBW A;  3ADA B;  4M52 A;  2OLO A;  3AEC A;  3S61 A;  1SEZ A;  3E1T A;  4H4Q A;  3T2Z A;  5HXI A;  2GQF A;  3UKK A;  1OJC A;  1S2Q A;  3RP6 A;  3BHF A;  3NTD A;  4J56 A;  5GSN A;  4U8M A;  2R0G A;  3GYI A;  5C2T A;  4YSX A;  5JCK A;  2C73 A;  4CY6 A;  1EL7 A;  3AEA A;  3ICS A;  3QFB A;  4U2L A;  1ZMD A;  4IA5 A;  4GDE A;  4OCG A;  1GV4 A;  3AWI A;  3UOX A;  1GXF A;  4K8D A;  3UP4 A;  3UKP A;  4BUR A;  1NHR A;  3DK8 A;  3URH A;  4II2 A;  4N9X A;  2E4G A;  3GD3 A;  3C4A A;  1BF3 A;  4FX9 A;  1UKV G;  2BCP A;  3ALL A;  3K7Q X;  3UOV A;  3G5R A;  1KNR A;  4C5O A;  5C3J A;  1VG0 A;  3HYW A;  3II4 A;  3VQR A;  2BAC A;  1IUW A;  1H82 A;  2JB1 A;  2YG7 A;  3HYX A;  4G6G A;  4B64 A;  1IUX A;  3GMC A;  1YKJ A;  2YVF A;  1BKW A;  1PJ5 A;  3NT6 A;  4U8K A;  1NG3 A;  4A6N A;  3NK0 X;  2R45 A;  1LTX R;  2YLT A;  3V3N A;  3ITJ A;  1JRX A;  2VQB A;  4YTP A;  2GV8 A;  4G6H A;  5HY5 A;  4U8J A;  3VR8 A;  4U2T A;  2YLW A;  3KA7 A;  3QSM A;  4H4Y A;  4KX6 A;  2Q0K A;  4Z2R A;  5KMQ A;  3DA1 A;  2YR6 A;  2C3D A;  1PXC A;  3RHA A;  2OA1 A;  1ZOY A;  2VOU A;  1FCD A;  2UZZ A;  2CDU A;  3SXI A;  2WEU A;  1PS9 A;  2WPE A;  2R9Z A;  4TM0 A;  1PXB A;  3KLJ A;  1P2E A;  1ZX9 A;  1GND A;  3CNS A;  3S5W A;  1GSN A;  1GOS A;  1GAL A;  4I58 A;  5HYM A;  2FBW A;  1IUT A;  5KMR A;  2BK4 A;  3UKQ A;  1M6I A;  4EM3 A;  1FEB A;  1N4U A;  1MXT A;  1DNC A;  3K7M X;  3IC9 A;  1Y0P A;  2WPF A;  3Q9T A;  1B37 A;  1LQT A;  1PJ6 A;  2V5Z A;  2W0H A;  2WU5 A;  3EF6 A;  4RG4 A;  4YSY A;  3CGD A;  2WU2 A;  2CVJ A;  5J60 A;  1RP0 A;  3H8L A;  1FL2 A;  1NEK A;  1GEU A;  4GR1 A;  1FEC A;  1XDI A;  2F5Z A;  2X3N A;  3SZW A;  4A65 A;  1B4V A;  4XXG A;  3UKL A;  4A9W A;  3GYJ A;  3NG7 X;  4O5Q A;  4H4Z A;  4H4U A;  3OC4 A;  2YAU A;  3NLC A;  3O0H A;  5KRQ A;  1OJT A;  2V6O A;  1DOD A;  2C70 A;  1YQ4 A;  1XAN A;  4JQ9 A;  3SZC A;  2YR4 A;  3HYV A;  2V60 A;  2C65 A;  3FMW A;  2YLR A;  4K5R A;  4IVM B;  1EBD A;  2C66 A;  4OPG A;  5JCL A;  2JB3 A;  3FPZ A;  2C67 A;  3ISH A;  5CQF A;  1BWC A;  3NYE A;  5KXJ A;  1HYU A;  2ARD A;  5FS9 A;  3RP8 A;  4Z2T A;  3G5Q A;  3ABV A;  4OPU A;  1RSG A;  4C77 A;  4DNA A;  3M13 A;  4HA6 A;  1PBB A;  2Q0L A;  4TM1 A;  2BYB A;  3T37 A;  3ICT A;  4C74 A;  4EQS A;  2VQ7 A;  1ZKQ A;  3NGC X;  4H2N A;  4ECH A;  4BV6 A;  2R4E A;  1D4D A;  3I6D A;  1GRH A;  2GEW A;  2GAH B;  3C96 A;  3GRT A;  3NTA A;  4GF7 A;  1KFY A;  4TLX A;  3CN8 A;  1CJ4 A;  1ZP0 A;  2CUL A;  1TDO A;  3AE7 A;  1DOE A;  2Q6U A;  2VRL A;  1DJQ A;  4U8N A;  2CFY A;  2B9W A;  1F8S A;  2WQY A;  4WX1 A;  1BGJ A;  5KOX A;  3AE8 A;  4RSL A;  1F8R A;  2E1M A;  4K2X A;  1RYI A;  2A89 A;  2VVL G;  3UTH A;  1D7L A;  3WE0 A;  2BA9 A;  3B3R A;  5KVI A;  4IVO B;  4LII A;  3DJG X;  4ZCC A;  3LOV A;  2IID A;  3AED A;  5U1O A;  1F8W A;  2IVD A;  4A7A A;  3L8K A;  4BJY A;  3DGZ A;  5U63 A;  2GR2 A;  2TMD A;  4GDP A;  4TM4 A;  1FEA A;  3T0K A;  1PDH A;  2JB2 A;  1GTE A;  2GVC A;  1D7Y A;  3Q6J A;  3UOY A;  2C4C A;  2TPR A;  3K30 A;  1ZDL A;  4AP3 A;  3SY4 A;  3VRA A;  3AEE A;  2J3N A;  2RGH A;  1AOG A;  2YG4 A;  1PHH A;  1O95 A;  2X99 A;  2YG5 A;  3F8R A;  3PVC A;  1PBE A;  5LV9 A;  5EBK A;  3ATQ A;  3SFE A;  2YWL A;  1KNP A;  2Y6Q A;  3AB1 A;  3GWD A;  3L1R A;  2ZZC A;  1GER A;  3ATR A;  4U8L A;  2EQ7 A;  1GT8 A;  2V61 A;  3DJE A;  3DME A;  3CPH G;  3AYI A;  1MO9 A;  3UCL A;  4EMI A;  1PBC A;  3DJD A;  1LVL A;  4YTN A;  4IV9 A;  2RAB A;  2YLZ A;  4REK A;  1JNZ A;  3CND A;  4G9K A;  5M0Z A;  4BK1 A;  1LJ1 A;  3SZF A;  3P4R A;  2JK6 A;  2YVG A;  4CNK A;  4Z25 A;  1Q1R A;  3T2K A;  3UOZ A;  1GTH A;  3T31 A;  1X31 B;  3AD7 B;  2PHH A;  1CJ2 A;  3NK2 X;  3AE9 A;  1L9E A;  4J33 A;  4GRT A;  2VRM A;  3P4P A;  1CC4 A;  2WES A;  4EMW A;  4LU6 A;  2BXR A;  3GMB A;  3T2Y A;  4NZH A;  4USR A;  4RG3 A;  1E1M A;  2OAM A;  1PBF A;  4UDQ A;  2RGO A;  4YSZ A;  4JY2 A;  5DBJ A;  2R0C A;  3KU9 A;  3AE5 A;  2XCG A;  4GAV A;  1Q9I A;  3GSI A;  3KKJ A;  1JEH A;  1DOC A;  1PXA A;  1S2Y A;  3QJ4 A;  4J2W A;  2GMH A;  4X9N A;  3R9U A;  1KSU A;  1N4V A;  2FJA A;  4YTM A;  3CMM A;  5U25 A;  2B76 A;  4H4W A;  3V76 A;  4BJZ A;  3GWF A;  3EPT A;  4Z26 A;  1Q1W A;  1GRB A;  4Y4M A;  2BK3 A;  1CC6 A;  2GR1 A;  3DGH A;  4HB9 A;  5HHF A;  4C3X A;  1EL8 A;  2BRA A;  2XFQ A;  4PAB A;  2IVE A;  3UKA A;  4OPD A;  4G74 A;  5BRT A;  3NRN A;  2BS2 A;  1E7P A;  4NTD A;  3GRS A;  3NN6 X;  1QO8 A;  1D4E A;  3QSS A;  4K22 A;  3VR9 A;  1TDE A;  3NK1 X;  3UKH A;  3ICR A;  1S3B A;  3AE6 A;  2WPC A;  1NHQ A;  4YSH A;  1COY A;  3RED A;  4H2R A;  5KWF A;  3NKS A;  1E1N A;  2E5V A;  3F8D A;  3NN0 X;  5IPY A;  1IUS A;  1OJ9 A;  3NIX A;  4A99 A;  3AEG A;  4AOS A;  1QLB A;  3EAO A;  4C3Y A;  2WOI A;  4FK1 A;  3GD4 A;  1W4X A;  3SGL A;  5KVH A;  2PYX A;  3LXD A;  2VVM A;  4TM3 A;  3G5S A;  1B8S A;  2WHD A;  2JAE A;  1TDF A;  4JY3 A;  1CF3 A;  3SFD A;  4ADW A;  5M10 A;  1BGN A;  3SX6 A;  2B7S A;  1CJ3 A;  3EAN A;  4JNA A;  3CNJ A;  4II3 A;  4B66 A;  2H88 A;  5BVA A;  2GF3 A;  4H4P A;  4WCT A;  5EB5 A;  3P9U A;  4J36 A;  2A8X A;  2FJB A;  4CBQ A;  4YKG A;  5BUK A;  4B68 A;  4CCR A;  1NHP A;  1KF6 A;  5FS8 A;  2BAB A;  4H2P A;  2WOV A;  4Y4N A;  4APN A;  4P9S A;  1O94 A;  1ZOV A;  1H86 A;  4Z2U A;  3AD8 B;  1BZL A;  1MOK A;  2X8G A;  3KPK A;  2VVL A;  4H4X A;  4UDR A;  1YQ3 A;  3F8P A;  1NHS A;  2VZ2 A;  4FDC B;  3IHM A;  1H84 A;  4D03 A;  2XLP A;  3RP7 A;  1JRY A;  3SM8 A;  1D5T A;  3V3O A;  1K0J A;  2YM1 A;  3COX A;  4PAA A;  2A87 A;  1OJD A;  3IWA A;  2V3A A;  1GET A;  1PBD A;  3T14 A;  2BC1 A;  4X4J A;  1F3P A;  4U8P A;  4TLZ A;  1D4C A;  1Y56 A;  2WP6 A;  2YG3 A;  4H2Q A;  1LV0 A;  4O5U A;  5CKU A;  1GES A;  4A79 A;  1JRZ A;  3DH9 A;  1IJH A;  4EIP A;  4IA6 A;  2Q7V A;  2X8H A;  2Z5Y A;  3GDN A;  3KPF A;  5FS7 A;  3CIR A;  4H7U A;  4ICY A;  3IHG A;  2B9X A;  2GQW A;  1E1L A;  1JU2 A;  2XFO A;  3H8I A;  4AT0 A;  1O5W A;  3BI2 A;  4K7Z A;  3M12 A;  5GRT A;  2GMJ A;  1JOA A;  3H4K A;  3PS9 A;  2Y6R A;  3CPI G;  4GUV A;  4OPC A;  4AT2 A;  2NPX A;  2I0Z A;  3BNM A;  2R0P A;  1L9D A;  1LPF A;  2JBV A;  1N1P A;  1PN0 A;  2GB0 A;  2DKI A;  4DSG A;  1VDC A;  1Z6L A;  4H4T A;  5L46 A;  1QJD A;  3ALJ A;  1CJC A;  3DJJ A;  1GRF A;  2V3B A;  2AR8 A;  4KPR A;  2C3C A;  3CPJ G;  3KD9 A;  2WDV A;  3AE1 A;  1H6V A;  4ZN0 A;  2YLS A;  2XVJ A;  4NNJ A;  2BC0 A;  2YLX A;  2BS3 A;  5FS6 A;  2YM2 A;  3HZL A;  4XWR A;  1GRG A;  2XVH A;  4J57 A;  4H4V A;  4JDR A;  4XWZ A;  2GAG B;  2DKH A;  1IUU A;  5JCI A;  2ACZ A;  3SZ0 A;  2JKC A;  5EOW A;  3BI5 A;  1OJA A;  3QSE A;  4U2S A;  2BCG G;  2WS3 A;  1NPX A;  2XVE A;  5JCM A;  1E39 A;  3RNM A;  1TDK A;  3AE3 A;  3DK4 A;  3UTF A;  1XPQ A;  3P1W A;  4JN9 A;  2AQJ A;  1L0V A;  2XYO A;  2OLN A;  2XDO A;  3BI4 A;  2BRY A;  5KOW A;  2GRT A;  2H89 A;  1M64 A;  4GCM A;  3AD9 B;  5KMP A;  1B5Q A;  1KSS A;  3UTG A;  1CL0 A;  1VRQ B;  2OAL A;  3ZYX A;  4X9M A;  3FG2 P;  1GRE A;  2YG6 A;  3ALM A;  4B65 A;  2BK5 A;  1N4W A;  1PJ7 A;  2XVF A;  3LJP A;  2GR0 A;  4YKF A;  2QA1 A;  4J34 A;  1L9C A;  5IQ1 A;  3PO7 A;  2QCU A;  1ZK7 A;  3JSK A;  3LZX A;  3NNE A;  4A5L A;  2GH5 A;  2C72 A;  3KVE A;  2NVK X;  3P4Q A;  1TYT A;  1K0L A;  2XLS A;  4FK1 C;  4EQW A;  2R46 A;  1JNR A;  4B69 A;  3LAD A;  1VG9 A;  3UKF A;  4DGK A;  1ELI A;  5J7X A;  2YVJ A;  4H4R A;  3I3L A;  4BK2 A;  2C76 A;  4NTE A;  4Y4L A;  3CGE A;  3BHK A;  2B7R A;  3ZDN A;  4EMJ A;  1KDG A;  2HQM A;  2YR5 A;  2XLU A;  4H4S A;  3NH3 X;  4JNQ A;  1H83 A;  1YQZ A;  4U8O A;  4E0V A;  4NTC A;  4ZCD A;  1CBO A;  1GPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...