5J6HA

Recognition of the mhc class ib molecule h2-q10 by the natural killer cell receptor ly49c
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
276
structure length
275
Chain Sequence
GSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYGCKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQAGAAEYYRAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, Q10 alpha chain
publication title Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 70
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2016-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j6hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5j6hA01
3QDHA 1YNLL 4N1CA 4YDLB 5JPNB 2NTFA 3MSPA 4P49A 2F53D 3UTSA 3HC0B 3PWPB 1KGCE 1KJ2B 3GEWB 4DAGL 3TP4A 1ADQL 1NGWB 2XZAH 4F7EB 4IRSA 3C60C 4UT7L 2A38A 1FFNB 4KV5F 4OLVL 2YXFA 3GHEL 4N0UE 4FQIL 2A0LD 1M71B 3W39B 4JG1L 3UMTA 1XR9B 3FFDB 1AE6L 1PX3A 1FRGH 2CIIB 3DETC 5FKPB 2KQNA 1CT8B 2ADFH 5F70A 5CD5C 3I75B 3B9KA 1XGQB 2FRGP 4U0QB 1JYNA 4QHUB 4M7ZC 2JIXA 1KCGC 1AHWA 3AS3A 2IEPA 1CGWA 1WICA 4L4VE 3OAUL 1TJGH 4GT7A 5IHUH 1LMKA 4NNXB 5E2VL 3MFGB 3BPLB 4YHPA 1UKSA 4HQQL 5DK2A 3SO5A 5SWSB 3VD9A 1ZVYA 1RI8A 2PN5A 2AJSL 1F11B 1KCSL 3QZWA 2I9LB 2CK0L 3OAYK 4HC1H 3K74B 5KS9F 1ZLVH 4TPRL 3ARTA 3K3QA 3R1GH 5I71C 3QEGH 4BSWB 3QNXB 2H1PH 2XG4A 4NYLA 4OCLC 1SBSH 4I0CC 2X41A 3FO9B 2G9HB 4OF6A 4I2XE 5DJDB 4Z78A 3TV3L 3L3OA 3CUPB 1HHKB 3ARBB 1FO0L 4WUUB 1HQRA 3PXJA 3LQMA 4P59H 2PW1A 4PTTB 1N3NA 5HDOA 3LVEA 1AGDB 5DHYB 4PP8C 2VR5A 3EOTL 4XX1G 3CFDA 3W9EA 2CQVA 1UH2A 3GSWB 2FDBP 1NEZA 4QRQA 4LSVH 1HH9B 4IHOB 1AO7D 1BLNB 4PRHE 3VRLF 5F9JA 1LO4L 5B39A 2AEPL 5J1SC 5GGUA 1NUFA 2XV6B 5IQ7H 3WSQH 4QRSB 4RX4D 1J1OH 4JFZH 4K3GA 4Y16B 4RMTA 3MZTA 1G7HB 1Q9LA 2CMRL 4UIMA 5INCB 3LQZB 3DRQA 4E42B 4N1HB 4LLMA 2EYSA 3RIAF 4FXKA 5KVGL 1HSAB 4H26A 5HJ3B 3VFMB 3MLVL 4TQEL 3VU2A 3RY4A 4F8QA 5C7XH 2VXVL 4Y4KC 1A7RH 1MRCL 4Q9RL 1FVCA 3MLSH 1J7VR 2ZUWA 3E2HA 4OBRA 4KQ3H 3R8QA 1WFNA 2OCFD 1YNKL 1D5BA 3VFGH 1XR8A 3OB0H 3K0WA 4O2FA 2X7LA 4YHZL 3QIWA 1GCFA 3HAEG 1S7RA 4R8WL 4ZOAA 5D70H 3P0YH 3VXRE 2BOCB 2V2WB 1KC5H 1QBLL 2VISA 1BX2B 4GW4B 1AGCA 4K3DH 1Z9SA 3OR6B 4HS3A 2EC8A 4AT6B 3QDGE 2OJZL 5JHDA 2ZPKH 3O3AA 1KTRL 4V2CB 2OR9L 1IMHC 2DTMH 4S1RL 4CVXB 3O81A 4ODHH 1A6WH 4PGJA 2HN7A 3P4MB 4P2QE 3EDFA 2CUHA 4UTBL 1GZQB 1ZGLA 3O2WH 2YN5A 4F80A 1B0GB 3MLZL 1FNAA 3V52L 2VERN 2YD7A 4ALAL 3PHQB 2OYPA 2CO6B 4KZDH 3ZDZE 3WJJC 4Q58C 4LKXA 2HFEA 3MV9A 1QRKA 3KPSD 3H9HB 1FZOB 3OAZK 1RUML 5I30L 1VESA 1WC7A 2QADC 5FYKE 3NCCB 3PV7A 1HXYA 5I1KL 4NT6A 5DS8A 2X6MA 3MO1A 1AP2B 2J5LB 1KJ3L 5DRNB 1F2XK 4MNGB 3UROR 1JPFB 2APXA 2VAAA 4NKOA 4PJFB 2EO9A 4Z0BH 4TNVF 4Y19A 4KJQC 4P5MA 2R1YB 4XP9L 1NCUA 5I76B 2WSKA 4HUWA 3SKNB 2VN7A 3B2UD 4CMMB 3T2OA 3SE9H 3OGCA 3RWFB 1N6QL 2FYYB 2IFFL 3BQUD 3F12A 4GW1A 1QSED 4IJ3C 4U1LB 1ORQB 1YJDH 1QRNE 3SE4C 5IFAL 3T3ME 2ZNWA 3TWCL 2HFGL 5EU4B 2XQYK 1QYGH 3BW9A 3ULUC 2ITDB 2E9IA 1A6AA 4XRCB 4POYA 1LK2B 1IFHL 4ZYKA 5GHWL 1OP9A 3RGVB 1QBML 2EZ0D 4UIKL 3MRGA 1J9CT 3LKPB 3WD5H 3UBXG 3MODH 5D4QA 3VH8G 5A2JH 2YD8A 1PJ9A 1F8TH 1PW3A 1YUHA 4CRPA 5EU7C 5IT2H 1XIWC 5C92A 1DE4B 4OV6F 4Z8FH 1FC2D 3IETB 2FATL 4G6MH 1EMTH 1F6LL 4O5LH 4ISVA 2YKLL 2XICA 4OZGE 4EIGB 4KZEL 4JKWA 3SGEH 5CLWA 4R97B 2YPVH 4XVUD 5CBEB 2W60A 5FGCB 3W81A 4WFFD 4MJIE 2W9LA 43C9B 2NY2D 1S78C 1E4KC 4X7TA 3JV4B 5FYJL 4XCEB 1KPVB 5FOJA 3WLWC 2FX7L 3L7FB 3SGKC 4NQEB 1R5VB 3TGXA 4X6DA 4K07A 2VLKB 2NY5L 1AGFA 3NN8A 4DUXA 2CKBH 4JGJA 3RZCB 3W0WD 3ARUA 4NUGH 4WHDA 3O41A 3O6FC 1FCGA 4L9DA 2JELL 5KN5B 2DN7A 2HKFL 4LASL 5FDYA 5C09A 4FHBD 3OKLA 4PGBA 2VDQL 5HHQA 3QSKB 4PLJD 2W0KA 4R0LC 3QAZC 1T4KA 2P8MB 4NRYA 1V5JA 2DQEL 2XI9A 1O5DT 2J12B 5ESVB 4L4TB 2PO6C 4JO1H 5I9QB 3QH3A 2DLGA 3D2UB 2LU7A 1AD9B 5IB5B 2Y07L 1KTDA 3T65A 5IVNA 4U1MB 1T7YA 4AENA 3DV6A 5F44A 3E8UL 3RJQB 1D5MB 5D2NA 4G42B 2W65A 5KVDL 1K85A 1GSMA 4LVNB 2HTKD 4GXUM 4PJ7A 4YHLL 3CDGB 2FO1A 4OFYA 3O0RH 1BFSA 3MJ8A 2BX5A 1I3RA 1OAKL 2HTLD 2VDLL 3H42L 3NZHH 4HCRH 4NUJA 3QHFH 4PJGA 1AXTL 2GQHA 4GSDL 4OFKA 1EPFA 5TDPA 3UC0L 1RIUH 5IROA 4I0PD 2C1OA 5H8DA 2XN9A 4CDGC 1WFUA 2YUVA 3MYZA 4ZTPH 4JB9L 1KNOB 1AKJA 3ZKQD 3S36H 1HHJB 4WCYL 4X4YB 3MROA 4LLWB 2Y7QB 4G9FB 4H25B 4BELD 3CFKB 3LV3B 4WO4A 2ESVE 3ROOB 5F89B 3WS3A 1A6UH 2A6IA 2A6KA 2VLLB 3T2NH 4DVRL 4H20H 1Y6NR 5DD0H 5DC0A 4NQSB 5JOFA 2JJUA 4MA7H 5JOPD 1PYWB 3QXVA 3QQ4A 5TE7H 1UB5A 4H88L 4PY8I 4WW2C 1A2YB 1J12A 2A9ML 2YWZA 5ANMB 5EIIB 5ILTL 4CN4A 2PKDA 1TZGH 2FL5A 1P69B 2B8OT 3N1FC 1RZKL 2RCSH 1EO7A 4E5XB 3PP3K 1FSKC 2C3WA 3VFOA 4NZRL 1C5DB 1LWRA 4U1KB 1UZ8B 4GRWH 3SKMA 3JTTB 2EE2A 1BIIB 2V9TA 1T22A 4OB5H 3RY5A 4U7SA 3KDMB 3MV8E 4J4PC 3WFZA 4N9GB 4X0KA 3DTXA 4MWFB 2X40A 1KB9J 3DUSB 5CZXD 4KVCH 2W9DL 4KROC 3P9LB 3NIDF 4PV9B 3LPGA 4MAYB 5D7LD 2VTFA 1IM9A 3K8MA 2WWMC 3LRGA 1VADA 4PRPA 3QPXL 3G04A 4OTXH 1VB9A 1NCWH 3LHPL 3ZDYE 4G8IB 4M43L 4Y5VB 5FDWA 2B1HH 4QKXB 3GSUB 4XP4L 1XGTA 2JJTA 4F7PB 4I77H 4Y1AD 1QKZH 2XTJC 2NW3A 3VGFA 3O8XD 2NNAA 2VR9A 2F53E 1CFSB 5D2LB 2IAMD 3S8WA 1A1MA 1ZANH 1NAML 1XH3B 4GRWF 4OF8A 3QRGH 1I9JL 1T0NB 4QWWD 4UT6L 4A6YA 1MJUH 3DHMA 4XVJL 1S7TB 3MGTB 3UBXI 3QI9B 1MCQA 2B7DT 2QSCH 4LVOB 2IMNA 4CJ1A 4L4VB 1KB9K 3WYRA 4KC3B 2WAHA 4PLKD 4KRLB 4JZJC 3SGJC 1K6QH 1OAYL 2Q86A 4WEBH 3U7WH 3FMGL 3C08L 1D7FA 3QUXC 3VG0L 1J0JA 4EEEA 3SCMD 4NQDD 2VDKH 4P46B 1WBXA 5A2IH 1FVDB 4DGYH 2F5AH 1FZJA 1IQDA 1C5BL 2ICWA 1IGTA 5FF6A 1INDL 5DQ9A 5EWIL 4GO6B 1J0IA 2JK5A 2AJUL 2DI9A 2WBJC 2CK2A 5C70A 1ZAGA 4I2XB 1T1WA 2AV1A 1JI2A 4NN5B 4DN4H 4M1GH 1KTKE 1NFDE 1FAIH 1ZLUK 1AD0B 1AXSB 1T0MB 4JDVA 5KTEL 1LEKA 3ZDZF 3L5WB 4JM2F 1KIPB 1NC2D 3BZDA 3C9NB 3IDGB 1RHFA 3LRSB 4L9LB 2DWEA 4WW1A 4LMQI 4U1JB 1KCRL 3RNKB 5IK3A 4ONFL 3QPQD 1UXSB 1I7TB 3TYGH 1TJIL 5HVHC 1P4LA 1VCAA 2EE3A 5I1HH 3L5XH 4UB0H 3IDMA 1H3WM 2AJXL 4GAGL 4HLZH 4LQFL 4PJ9A 4QRTB 3AFLA 1FG2A 2ADIB 4Y5XB 1G9MC 3U82B 3TIEB 1N5YL 2O5XH 1I8KA 4OLUH 3OAYH 3D85A 4DGIL 5BZDA 2JCCE 5DJZB 3T3MF 4A2MA 1MCHA 4YHMH 5GSVB 3ZKSD 1C1EH 1YN6B 4KDTC 4GRWB 3DXAA 5LXGH 5KZCD 1TZIB 2N7AA 1KENL 1MF2H 2NCMA 3PABB 4WHYG 1OGAD 4XPAL 4G6JL 5E5UB 1FORH 3JUYA 5B21A 3P0VH 3TYFB 3GSNA 1YMHB 5ELIA 2VLRA 4HX1A 4GQPH 2NZ9D 1NLDH 4NCDA 5FGRA 4D0DB 5HY9A 3IAPA 3PL6A 5F1OB 3BKJH 3KPRD 4OZGF 4MMZC 2Q3AA 1XGYL 2DM7A 4M8QA 3L5HA 1EXUA 1IEBA 4MNHA 2MCG1 4MNQD 4UTAL 5GS0H 1IJ9A 1I1AA 2VJXA 2BVTA 1RJLA 4WUKH 3CH1A 1CLOH 4L8SB 4HIJA 3C6LA 3P4LA 2W59A 5JQ6L 4S0SD 3RY6A 3AGVA 2D7MA 4J6RL 3GJFH 1YNLH 3THMH 1D6VL 1BJ8A 5HYSB 4PBXA 2X4TA 1TMCB 5K9OA 2J2ZA 3V8CA 4DAGH 4RDQF 4JFOA 3HRZA 5GGRB 4H0GA 4PREB 3RX5A 2VL5B 4EN3A 2VNCA 4NZJA 3EGSA 3EYVB 5CKAA 4OLVH 2OX5A 2IG2H 3MJ9A 1ZK9A 3PP4L 2FHCA 2SEBB 3ILPA 5F1SA 2EKSA 2E9BA 3QIBA 5T3XL 3GHEH 3Q6GL 3H9SD 3UYRL 1RZIB 3MRKA 4LRIA 1AE6H 5DVMA 3N06B 4GRMA 1X5AA 3B3IB 3T8XB 3KPSE 3VA2C 4LSTH 4QOKA 2X4OA 2VDOH 1SJEA 1UQSA 4YEFA 2Y06L 1U3YA 2E7LC 5T5FH 4LEOA 1MHHA 3JXAA 4LOUC 4XI5C 4XX1E 5GXBB 4EUPB 1R3JB 5E2VH 1R3IL 3V6FB 3LKQB 4HQQH 3WBDA 4KPHH 4PG2C 5GJTL 5IFHL 3OF6D 1BOYA 1S7XB 1IGIH 1T80A 4DZ8A 2AJSH 5ECJE 2OLDA 3STLA 1KCSH 5F1KC 2CK0H 4YGAB 1GYAA 3VXQA 4X4MA 4X8XA 4TPRH 1U3JA 5C0FA 1WBYB 2EKJA 1WVZA 5GZOC 4QRPD 1IT9H 3VXRA 3GMLA 3OKOB 5LJYH 4H0HB 1I7UB 1WISA 3PF2A 1HDMB 3QDGA 3OAZH 4S1QL 3TV3H 2P24B 5I1AB 3L3DB 3QCVL 4K9EL 4KHXL 4OZGB 4K55A 1U41A 3ZSSA 5FA3A 1N2RA 4Q7DA 5DRZB 5L6YL 3QO0B 1V3MA 4JPIA 4HS6B 1YN7B 1NCDL 4YJZL 5J1AA 5E95B 4ZUWB 1JK8B 3GMMA 3TBVA 1FPTL 4XVTH 5GRVK 1D5ZA 4M1CC 1H3TA 1MLBB 2ICWJ 1TVHB 3O45A 3WUWA 3IFLL 2P5EB 2RHEA 1LO4H 4WFFE 5JUEL 5I73C 4MB3A 1KLUB 2DKSA 5EO9A 5DZLA 3TVMD 2CJUL 1JMZA 3FZUC 1MUJB 1KJMA 3G5XB 5I1DB 2CMRH 3JWOH 4R4NC 3V8OA 4S10A 5GGRY 3VXSD 3UPRB 4OIBA 2Z4QB 3EYQD 5C07D 4PJDE 1O0VA 5KVGH 2NY1D 5EU6D 4CVWA 1D6EB 3MLVH 1HSBB 2R2HA 1MCNA 2VITB 3QFJE 4TQEH 5F6HI 3KR3L 3SDAD 4NDMB 3W0WE 5I75C 4WIQA 1R3KA 4JLRA 1TQBB 3HE6C 3KAAA 2GUOB 4KI5D 4WHCA 3PDOB 4Q9RH 3SDCC 1FNEB 4HF5L 1QRNA 4UV7L 1UH4A 3WDIA 4MA3A 1I4FB 3D39D 4RQQB 3C5SB 4YHZH 1FC1A 1BBJB 4J3VA 25C8L 5KSVA 4HWBA 2QKIA 1YA5A 4K8RL 2N56A 3ZDYF 2ICEA 1PSKL 3GJFB 3TO4D 3V4VL 2JKXA 1T04B 2VUYA 1DQQA 4BUHA 4AM0A 5DD5L 4HD9A 3PJSB 5JXEC 2HFFB 3ZHKA 3MJ9L 5C71A 2VZSA 1R3HA 4I48B 3FT4A 4R7NA 4UTBH 3DBXA 3MA9H 4ZUUA 2Y23A 3ES6B 3MLZH 3CSBA 1EHLH 1KCLA 4KMTL 3FO1B 1RJZB 3OPZH 4BZYA 5DFVC 5C0RL 3LAFA 2PTUA 4OAWA 4ALAH 1OWWA 2D31A 4MJIA 1DVFA 2PYEB 2M2DA 1HI6B 3MBED 2R2EA 1VFAB 1ED3A 2HT2D 1RUMH 4MQ7B 2EEBA 3L3IB 4DVBB 5CEZL 5I30H 3W2DL 3MXWH 3QUZB 4LCUA 4JFQA 5GRUH 2E5EA 5C0NC 5I1KH 3LH2L 1KJ3H 1DLHA 1AIFB 1C12B 4D8PB 3FQNA 2P44B 4PJ8A 4XP9H 1NCBL 3O3DA 3BPOB 3B6SB 5FB8B 2GKIA 4XC3L 2DKUA 1NKRA 4FQXC 4LCCB 5JOPE 1N6QH 4P2OB 4LLQB 2IFFH 5DMJB 1I3GL 3V0WH 2OZ4L 4JANA 3AREA 3DPBA 3HN3A 2GK2A 1U3HD 3TN0C 1ZGLP 1GIGL 3OKKB 5IFAH 5KSBA 1NFDF 1X5JA 1LE5B 3TWCH 2HFGH 3MV8B 4CW1B 3HG1E 5D1ZD 1OAQL 4GBXA 4FRWA 5GZNC 1IFHH 1ONQA 4MMXC 2DMCA 3AMKA 4HUUA 3BZ4B 1CGSL 1J05B 2EDYA 2IBGA 4NJ9L 1QBMH 4UIKH 5C9JA 2XFXA 5ALCH 4YBLB 3DX9A 1VDGA 1B2WL 3INUL 1FO0B 1ZSDB 4XCNA 4OM0L 5EFIA 1U8KB 3RWDA 2G75A 1VEPA 2FATH 2XZZA 5TDOB 1ZWIA 1JPST 3NVQA 5EA0L 3LN5B 5ABDE 3GI8L 5JTWA 2VQUA 2YD4A 1MI5B 2HT4D 4ZPVA 2DJUA 4ZO9A 2D9CA 4HKXB 5D7LE 3CDFA 4BYHA 3GDBA 5CCKL 4C56A 4MSWB 1U2CA 4JFED 4S0UC 2JCCF 4OFVA 4DKEL 2Z91B 4KXZI 5I1LA 5FYJH 2C5DC 3PP3H 4X5WA 4KI1A 1PQZA 2E8ZA 4XXCC 3DX8A 3IB4A 1BAFL 4JRXD 5C0JB 4Y1AE 3AB0B 2PTTA 3LSOA 2NY5H 4OKVB 4YEEA 3I3EA 2FHBA 5EC2A 2NW2B 5LGJB 2IQ9L 5E6IA 1CXLA 2HJLB 2DQTL 4HWBL 2HKFH 1FJ1A 4LASH 4NJAL 5DDHA 3TEUA 1I7RA 3MGOB 3A6CL 1BPVA 4XTRD 2P8LB 4LSQL 3FQRA 2R9HD 4YHOL 2IADA 5CEXA 1R5WA 4OZFA 2FEEI 3RTQD 3D3VE 3UTSB 3EOBB 1AC0A 1DSFH 2VB5A 5L7XL 3ECBB 3VFWA 4Q0XL 4EQ2A 3CCHA 1W0WA 5J13B 3E8UH 4OI7A 4P23C 4QNPF 5KVDH 4IRSB 1IC5H 4WU7A 5A40E 3MRHA 4FZ8L 1NFDB 3RL2B 5D1XC 1BVLB 4FQJH 4OGZA 2VDLH 3H42H 1AXTH 1JPSH 1N26A 3QNZB 4GSDH 5H37H 3BZFA 2JIXB 5TFSL 1F58L 1SY6A 1AHWB 2UYLA 3KGRA 2YHGA 4JB9H 4QHNB 3DX6B 4H8WL 4ZAKD 1NC4A 5DT1L 4QHKI 1U8QA 5DJ2A 1CQKA 3TT3L 2X4NA 4IIQA 4F57H 2HWZH 3EYSL 4G6KL 3MFFA 4I4WB 4DVRH 1VGEL 1OAZL 1R6VA 4NYLB 4XPHH 5M7QA 4V1DA 7CGTA 1VACB 3D25A 3GMQB 5EBLB 5HHMD 1IGFH 3BYYA 3O4LB 1TTUA 1NPUA 5I74C 2A9MH 4FXGB 1JGDB 5D9SA 3V5DB 3LB6D 3SDDC 3GRWA 2K7PA 3F6LA 4K2UL 3S35L 4O2CA 1RZKH 1ZLUH 4FFWD 1RUPL 4UUJB 4U49A 2XNAA 3MCKA 3STZA 3ZYJA 1U6AL 4BK4A 3H9ZA 3BH9A 3BXNA 5DQJB 2HKHL 2PW1B 1N3NB 3UPAA 2VE6A 1UKQA 3SDCD 5DRXA 3JWDH 2DYPB 4P9HL 2ZG3A 3CFDB 5GRJL 3ZTJG 2H26A 3IRPX 1ZVSA 3HPJB 3R4DA 1DUZA 1OGAE 5HHXL 3S96B 5JIPA 3S9DB 1NEZB 2MWCA 3DVIA 3LS4L 5CP7A 3HC3H 1X5GA 35C8L 1Z5LA 2C7UA 1GL4B 3DROA 3BD3A 4Z6AT 2DQUL 5SX4H 5LGKA 2P4AB 1BVKB 2BSTA 5B39B 4U6XA 4I18A 2W9DH 3DRTA 5GGUB 4F7MA 2V5YA 2DLIA 3KPRE 1JV5A 2NX5A 4HKBA 1CLCA 1Q9LB 4YIQA 3W5MA 5EUKB 5FO8A 3QPXH 1J0HA 1XCTA 3IJYA 3RNQA 1IAMA 3IFOA 4N0CD 1JZ6A 3RUGA 3LHPH 1I1CA 5HHOE 2Z31D 4M43H 3QJFA 1FQ9C 5IB4A 2GITA 5TJWK 1GHFL 4XMLL 4Y0GA 1JGLH 4XP4H 5CJ5A 4KQ4L 2LVCA 2FWOA 3V6OE 2Q87A 2ZUTA 4KJWC 2R29H 1TXKA 3RDTC 4PJDF 1XR8B 4NHUE 4PJIA 4TUOA 4O2FB 3QIWB 1F4XH 1I9JH 5I8EA 4UT6H 1UXWA 4JR9L 2VISB 1AGCB 3OZ9L 5K33A 1WZMA 3T0ED 2X1OA 4U1GC 1AO7A 3ZDXE 5ITBL 4IS6A 3H9SE 2EDJA 1IKNA 4GMTL 3RX8A 2Z9TA 5DJ8A 3VD4A 1IRAY 3FMGH 4P5TA 3C08H 2W0PA 2NY6C 1EGJA 2VOTA 1MWAA 5SWZD 2MCPL 5HHPA 3QEQD 3T2PA 1QUNA 1QZ1A 4LRNH 1RUAL 4RAUA 1HK6A 4R4FL 1C5BH 5DD3L 1J0KA 1JZ8A 1INDH 5EWIH 5CWSA 1SY6L 2HFEB 3MV9B 2AJUH 3FB8A 1NGQL 1WC7B 4NM4H 3EBAA 1IAIH 3D6GA 5K9QG 2BHZA 1PX4A 3VWKC 5DS8B 3V0AC 1KUMA 1RZ7L 1SQ2N 5DMIL 4QRPE 4DQOL 3VDAA 3DVFA 4Y19B 4P5MB 1A6VL 4FNLL 5C2BL 4M62L 2CH8A 3VFSB 3VWJC 4QYOB 3VXNA 3OGCB 3EO9L 3BDYH 1KCRH 4S0TD 4NKIL 5DD1L 4K71C 5EN2B 4GW5A 3S34L 4GW1B 5CEZE 2MFNA 4M6NL 4L3EA 1K4CB 3BW9B 4GAFB 4LQFH 1A6AB 3LKRA 2I5YL 3HA0A 5F7WC 5GGVL 1QLFB 4BH7B 1JPGB 3MRGB 5BZWA 2GK0A 4NC1E 4DGIH 5KSUB 4QHLB 3HUJA 3KPSA 3V4UL 2CDFA 4PGEA 2ICES 2J6EA 3QFJB 4FTVD 4U3CA 3OKNA 4X9GA 5B38A 1BM3H 2FD6L 4U6TA 2ED8A 5FGBC 1JN6B 3QFDB 1CLZL 3MCLH 4HEPG 4M5ZL 5JDJA 5IMOB 1KENH 1QHPA 2FX9H 3HMXA 1E4XI 4HH9B 4WVRA 5CP3A 4XPAH 3JTSA 4G6JH 2X5PA 3IXTA 3VXSE 4TTGA 1VSCA 2LV4A 3VGAC 5C07E 1L4IA 4JFPA 2ZOKB 3H3PL 3QXTA 5EU6E 5DUBA 3RIFF 2Q7YA 5DEFB 2KKQA 4GKOA 3RVXC 2VXSL 3HNVL 4NWTL 5C8JA 2DWDB 2Y5TA 5HD8C 1ZA3A 2GSIA 4X7TB 1H3UA 4OD1L 3BQUA 4BH8B 4OCSL 2X1PA 1QSEA 2YPKA 5I6XC 3QWRD 3D39E 5D1XD 2XWJB 3SKOB 4YGVB 4AJ0A 4PJCE 3U0WL 1A8JH 1GGIL 2B1AL 2VDPL 4WDIA 4PFEA 2VDNL 1OD7A 2WLZA 1AI1L 5JQ6H 4N9OB 5IBLD 5CSBA 4J6RH 4J7RA 2CLZB 3HE7D 3DV4B 1CICC 4S1SL 5ESAA 4PRNB 3WNLA 3GJEA 5FYLD 1FE8L 3OKLB 3ARPA 4G7VH 3MLWL 4G9DA 4PRDA 4K23L 3QH3B 1A21A 2HJKB 4M00A 3PP4H 2QV2A 1IILE 3PWJB 3DV6B 5EH1A 5T3XH 4AENB 2GCYA 3Q6GH 1MWAL 4JFFA 3UYRH 4BA8A 4JPKH 4PJ7B 4MQTB 1MQ8A 1N0XH 4ZNEE 4OSUL 1LE9A 1I3RB 1WIUA 1UWGL 2YRZA 4OJFL 4JFDB 1RHHB 2X4SB 4LAJH 3HNSH 3BKCL 5KSAD 2OMNA 5IBTH 5IVXE 4KK5C 3ARFD 4WI2A 3QA3A 3KPPB 1R3IH 4KKBC 4I1NB 1NDMA 1RUKL 5GJTH 5IFHH 2XXCB 3GFUA 3HG1B 3CFEA 4ZPTB 5DJCB 1SMOA 1D9KC 4Z95L 5JLZA 1KTLA 5HDQH 4OLWL 5EBGA 4UV4L 2Q8AL 1IKFL 1I3UA 4OCXH 4K94H 5FK9A 3WNKA 5C6WH 4PJXA 5GQBA 3RWGA 4ERSL 4APQB 1T66D 4HBCL 5EB9A 2A6KB 2APWA 5DO2C 3HRPA 4KGLA 3DECA 1Q38A 3KJ4C 4PPTA 3UTQA 3QCVH 4K9EH 1S9YA 4KHXH 3TA3D 5C3LD 5HYJA 4H0IA 1A7PL 3CFJA 4X7DC 3OKMB 3GSQB 3IDJB 3HR5A 2AJYH 2FL5B 4Y2DC 4PG9A 1T03L 1NCDH 5L8LB 3ZT7A 5HI4C 4DKFH 4YAQA 3DGGA 1KBGL 4LAQH 1MSPA 1FPTH 4YZFE 1U8HB 3TNNA 15C8L 1RZFL 1SEBB 4UOW1 3MRCB 4KJWD 4R2GC 1FV1A 1P1ZB 3VH8A 5DUPL 5IHZB 3F7VB 4HJJL 4PJ5E 3RWHB 5F7MC 4JFEE 4EXKA 5JUEH 2VZ1A 4ZUTB 3AS0A 5HYQA 1I1YA 3MLTB 4QXWA 4WI8A 5DJYB 3GSNH 5F1NB 1UYWL 3ARDD 1YZZA 1NFIA 5FM5M 4PD4K 4OCWL 5I15L 4YBQD 4JRXE 5K9QI 5CIPA 3EDJA 3P2TA 2DIAA 4P3DA 3TFKC 3TPUE 1BF2A 3GSVB 1VADB 4EJ1C 3KR3H 1CGYA 3TCLA 3G04B 5F7LB 4RAVB 3UO1L 3D3VB 3E3QC 4HUNB 2Z0BA 2DLTA 4HF5H 3R06B 3QNYA 2MQ0A 5K9KA 1T1YA 4UV7H 3KPMA 1XGTB 2W1NA 1H15A 25C8H 4HAFA 1OSPL 5BS0B 1EEZA 1NMCC 4JY6B 5KVMC 5E08L 4HBQA 4U7KA 2PXYC 4TVPL 3KPQA 2NNAB 4K8RH 1GZPA 1I8MB 1N5AA 1T21A 3B9KC 2FSEA 1RMFH 2WWKT 1OQOA 1J11A 3ZT6A 1H8OA 1S7SA 3MLXH 3F8UB 4O2EA 1CL7I 5D93B 3IFPB 1E28B 5DD5H 1OSZB 3HB3C 2GSGA 3H2WA 2IQAB 3MJ9H 2ENYA 4HFWA 3H0TA 4CADA 4U1NA 1DFBH 4PTUA 3ZO0A 3C5ZC 3X11A 4ZUSB 5D7LA 1NBQA 1ZGLM 3T1FB 2HA1A 4E0RA 1JNHB 2ZCHH 4LNVA 3QEHA 3MUZ1 1IGJA 4ELMA 3KYNB 3ZDXF 1G7PA 5TF1L 5I1IL 1K5NB 5ID0B 1IQDB 5FA4A 1KT2A 3W2DH 4J1UA 4I8DA 5E4EC 2JK5B 4PRBA 3EFDL 5EBWA 1P7QB 3CVHL 2NY0B 3KYMA 4Y1AA 1EJOH 2C1PA 4M4RA 5T1DL 1TVBB 3U4EB 3LH2H 3O9WD 3WJJA 3T0XA 2EC9T 1RURH 4KRPB 3O8XA 4L8BA 3KYAA 3CZFA 1YEDB 5EBMA 2QTEA 3BRFA 2XOTA 4OGXL 2IAMA 3FO2B 2FNBA 3M1BA 4O51B 4U6YB 4TUJA 5DJ6B 5HHME 2FJHA 4LLVA 3U30B 2NXYB 1QA9A 3MV7D 2AJVL 1TVDA 2OZ4H 4KMLB 3RKDD 3NCBB 4GG8A 4WW1B 4XNYL 3RX7A 5DD6B 4MX7B 1NJ9A 1Q9WB 2A77L 1P4BL 5IK3B 4ZDHA 3LRHA 2GI7A 4F9LA 3NGBB 5TF0A 1LD9B 1CGSH 1P4LB 4NJ9H 4PGCA 3IDMB 3SCMA 4PY8J 4NQDA 4PJ9B 1U3ZA 3ETBF 3GIZL 1HOCB 4OKDA 1FG2B 3INUH 1JI1A 3MLYH 4MDIA 5GSRB 1JL8A 3QWOA 4OM0H 1I8KB 5H35B 3EJZC 4UQ3A 2EE9A 5C0AE 4JM4L 2X9WA 32C2B 5ICXA 3LQAC 1MHPH 4K3EL 1H3PL 5EA0H 5HHOB 2PCPA 4JFXA 3DVNA 2I07A 1M7IA 3DXAB 2AV7A 4YHNA 1BZQK 2FHFA 3IXAA 3EYOB 1GGYA 1MRDH 3E2HC 4S1DC 5CBAB 5CCKH 5DSCA 3RU8L 4NZTH 1Q9KA 2WBKA 4DKEH 3GM8A 1MIEL 1MY7A 3IAGC 4X80L 3GSNB 1QHOA 1MFEL 2AGJL 5A2LH 5BW7A 5AZ2L 1QG3A 3WJLA 2VWEE 4YHIB 1J8HD 1CXHA 4CDHA 1BAFH 5T1LD 3U4BL 1IGML 1E4KA 4ZTOH 2EDEA 1EXUB 1IEBB 4MNHB 2IQ9H 3SGKA 1I1AB 5HDBE 2BSSB 2DQTH 4HWBH 5IFJB 3F58H 3CH1B 2YD6A 4NJAH 4XNZB 4HIJB 3LD8C 1UM5L 2H3NA 3C6LB 5F9WB 3OJDA 3T0EE 3A6CH 4LSQH 5DHVA 4YHOH 4Z76A 4MD4B 5IVOA 1FN4A 3WLBB 3LKSA 3UJIL 3O6FA 4PJCF 2WUBL 4LCYB 4N5ED 2AKRB 2X4TB 4ZUVB 1NSNH 3CFIC 4LHQB 5L7XH 4MJ5A 1NGXA 1I8LA 4FG6D 4Q0XH 5SWZE 5JXAL 5F72S 1A7NL 5F88A 1OGAA 3QEQE 4P9ML 1P84K 4BZ1H 1XF1A 2P45B 3ILPB 3IDYB 2EKSB 3QIBB 3UPCA 2PO6A 4LIQL 2DQGL 4F58L 1ND0A 3MRKB 3C6SB 1HYRC 3CPLA 1RUQH 2BC4A 4PY7B 4AH2A 4HG4K 4JREB 5F7YC 1UQSB 1CDCA 3GMNA 3O2DA 3BIKB 3G6AA 3ZKMC 5ICZA 5B3NA 2ADJA 1Z2KA 1PY9A 4MNQA 4NZUH 3HC4L 5IMMA 4H8WH 5ACZA 5DT1H 1H0DA 5J7CC 3BISA 3TT3H 5CHNA 3GSRA 3IRZA 1DANU 4H1LG 2AXGA 3MRLA 4DZ8B 4RGND 3KWWA 4PBWD 4L4JA 1IAIM 3E6HB 3WNOA 5IVXF 2A6JB 4G6KH 3VXQB 3DI2B 3ULVD 1KCVL 4ZS7H 2AEQL 8FABA 2Q76B 4HLJA 4RMQA 1RK0A 5HDLA 5I16A 3FKUS 2G2RB 1A14H 4UBDD 3MXVH 2ZUQB 1ZKAA 1YDPB 4JHAL 5T1KD 5JW5B 1N8ZB 4POZD 4IMKA 1TCRA 4K2UH 3S35H 2QBWA 5D1QD 1RUPH 4ORGB 2APVA 5HGBA 1UJ3B 2NR6D 2W91A 5FA3B 3MRQA 1YY8A 1ZHLA 1BFVH 1U6AH 4FTVE 4P4KC 1IL1A 3ARYA 3ULUL 2HKHH 5JOEA 2VH5L 3FN9A 4IMLA 5L2KB 3V6ZA 3BE1L 1QVOA 4P9HH 3GMMB 5GRJH 3TBVB 4JZNA 3IS1X 4X7EC 5HHXH 3V5HA 3ARGC 3MNVB 1BJ1J 3LS4H 3W9DB 4JO4L 5GRZA 35C8H 3OF6A 5D7JC 5LCVL 1CDBA 4O00A 3MREA 4DEPC 4EI5D 1EEUA 3ZZ1A 8CGTA 2DLFL 4YZFF 4PB9L 2Z8VC 2ZJSL 4B7IA 3TF7C 1WWAX 2YRLA 3MRJA 4L5FL 4HWUA 1G7IB 4J4PA 4QRPA 5IF0A 3FQTA 5LWYL 1FP5A 1YNTA 3F5WB 1PD6A 4H5SA 1PKOA 1X5IA 3GHBH 3KPNA 3UJJH 4CMHB 5DZNA 1LEIA 2BNQE 2HT3C 1R3KB 5TPWH 1GHFH 4XMLH 3W11D 1AGEA 5ETUB 5C2UB 3CMOL 4HUMB 5D2NC 2NY4B 3NH7L 3X17A 5J89A 1F4WL 2IAND 4NFDA 4GAJL 2NMSA 1OAXH 3EDDA 5FYLE 1X6LA 1QFWI 3UTTA 1RZJC 5EZLA 2UWEA 4YXKL 3P4OA 1H3GA 4YBHA 1B0RB 4YHKL 5IROC 2ICEB 2DIBA 2IPKA 5IVXB 1KIRA 4J8RB 5CZVH 4LVEA 5HPOA 4WFHD 4ZD3L 3QULA 1DQQB 3RPIB 4AM0B 2AABL 1DUYA 3WEXA 3TVMA 4GMTH 4PLOB 1AGBA 1LEGA 1IVLA 3FT4B 2MCPH 4OFDA 3DBXB 4LPUA 4QGTA 4WO4C 1EHXA 5ICYA 4JO2L 4L8CA 2IF7A 1S9VA 1WBZA 4KJPD 5HBBA 4Q6IA 3SGJA 2P5WA 3PWPD 1TFHA 1RUAH 3FFCE 4GKSA 4OAWB 5EU6A 3SDAA 4R4FH 3O2DL 1GGTA 4NO3B 5DD3H 4OZ4A 5E99L 5B4MD 3FJTA 1SY6H 4Z77A 2BP3A 4HXBL 4KTYA 1NGQH 1ZTXL 4YO0B 3LIZL 1UWXH 5I18L 4U1IB 3D39A 3NFPA 2H41A 4UDTA 2Z35B 3L6FB 1S5IL 5DMIH 3G6DL 3X14A 1XF2B 3WFHB 4BQ6A 4DQOH 3BWUC 3VMPA 2IJ0C 4LKCA 1T7ZA 4PJ8B 4ZXBB 4FNLH 5C2BH 1GPOL 4Z7WE 1VGKB 3MMEB 5F9OH 1C7SA 2OI9B 3EO9H 4C59B 2COQA 1YQ2A 3PQYB 4NKIH 1K4DB 5DD1H 2H2PC 5SWSD 3S34H 3AREB 5DGRA 4PJ5B 5KSBB 2R23A 1X5FA 4KRNA 3C5JA 5E00A 3WE6A 3RVTC 4LHUB 4GBXB 4ZFFA 1FL3B 1J0YA 1I9EA 1ONQB 4M9OA 4DK6A 4EOWL 4GG6A 1X44A 3DX9B 3MBEA 2ZCKH 3VD7A 3V4UH 2DB8A 4PP1C 5MEQA 4Y5YC 2ARWA 3BUYA 5EFIB 3VRIA 5HGHA 4UNTA 2FD6H 3RWDB 1G7QA 2AQ2A 3E1F1 2UY6A 1YEEL 1YC7A 4M5ZH 3SBWA 1B88A 1Q94B 3ARBD 1S7VA 5I1EL 5I1JL 4WUUD 2AI0L 4X98A 4YR6B 3QDJB 4YNYB 1IAOA 3H3PH 5IQ9B 4KDTA 4RZCA 1MREL 2BY1A 2GJZA 3KHOA 5DYOA 2VXSH 4NWTH 3G5ZB 4ZMAT 5EULV 5D5MA 1MVFA 2IBZY 3DMMB 5I1LB 4FQHA 4OCSH 4X5WB 4XPGH 3GUTA 5BJTA 1B4RA 3KLHC 4XWOD 2BVPA 2FECL 5L2JB 5F6HJ 5FO7A 5F7HA 1GGIH 3T08A 3LSOB 2B1AH 3QCTL 4PRAB 2VDPH 1U8MA 4Y16D 4WI7A 3AXLA 2X4QB 3PWVA 5EC2B 1UCBL 3EUUA 2VDNH 1PY4A 1KB5A 3S37H 4P5KA 5E6IB 1QLRA 3T3PE 4MJ6A 3MUY1 3VDCA 5CGMA 5DDHB 2YZ1A 1VFBA 4RMVA 3AMLA 3UDWC 3FQRB 2IADB 5CEXB 4JY5L 5KVEH 3U6RB 4FQQB 4NO0A 4K23H 5T5NG 1IBGH 3D18B 3RA7L 5HDBF 3MLRL 2H9GA 1EV2E 5CJBA 3VFWB 1BQLH 2R69L 3CCHB 1W0WB 2AQ1A 1I9IL 5F1IB 4HDIA 1MWAH 2I27N 2OBGA 2BK8A 4N8VA 4O58L 12E8L 4Z7OE 4I3SL 4OSUH 1OGTA 3U0TA 2B0SH 4Y4FB 2Y36L 1KN2L 3MNWA 3EAKA 4OJFH 4K94C 1T5WA 2AJZB 4WGWB 4CN1A 3N0PB 3MRPA 3BKCH 3BKYL 4LLYA 1JYWA 3AROA 4KKNA 4FMKA 1I9RL 4U31A 4Z7UE 2BJMH 1JNNL 4IOFD 1OF2A 3TPUA 4HV8A 3BZFB 4X6CA 4U2ZA 1RUKH 5GJSL 4F7CB 1CDYA 2E7LA 4Z95H 2G60L 1U8QB 4QCIA 4W70A 4MDJA 5DJ2B 3W82A 4UV4H 5CS7A 2CDEA 3L3GB 1JVKA 1IKFH 1RULH 3MV7E 4P2RA 5L8KB 2EXYC 2XY1A 1P5VA 1Y18A 4ERSH 2EDWA 4PG2A 4HBCH 3PWLB 4WJ5B 1NCCH 1NMBL 4JFYA 5C0AB 4HIEA 2GAZA 5AAWA 4V1DB 5TE6L 1MJ8L 1IQWL 3NPSC 2NXZC 2V7HA 3S4SB 3LEXA 1INQA 4XP5H 5IG7B 4EDXB 5D9SB 2R15A 4W4NA 4M7LL 1OM3L 2XT1B 4WY7L 2E6QA 1CFTA 1QFPA 4U05A 2NYYD 3ILQD 1OARL 2V9RA 4PR5A 4AMKL 2XNAB 3MCKB 3FQWB 2H32A 5H94A 1KBGH 3KPTA 3STZB 4DCQB 4PJHE 3IJHB 3DVGB 5D7IA 2J6EH 3BXNB 4XGZA 1CWVA 4ELKA 2UUDK 4OZHE 15C8H 1RZFH 3PWUB 5EOCL 1LO5B 1JF6A 1G9ML 2ARJA 4CU6A 5DUPH 4HJJH 3WKML 4RA0C 2BVYA 2H26B 4CU8A 4F37K 3HMXH 3OX8B 4ZAKA 3RGVD 4G8EA 5D7KD 5CP3H 1R5IA 5GISL 2J8OA 4OUUA 1RJYB 1QR4A 1Z5LB 2C7UB 3QIUC 1CK0L 1UYWH 1YEKL 4NN5C 1KPUB 4RA3A 2V7NB 4U6XB 4I18B 1J8HE 4KGJA 3RY6C 2UZXB 5I15H 3WO4C 3X12A 4LDEB 2NX5B 4HKBB 4CUCA 3S7GA 4ORZC 3G6JA 5FO8B 4FZEH 2BVEA 5HHMA 3IFOB 2Z8RA 3UO1H 5F93C 1S3KL 3RUGB 3MR9A 1J88A 4G43A 3QJFB 1U2HA 5IB4B 1P7KB 5AG8A 3QQ3B 4OGAC 3TBTB 5IIEA 1B3JA 1KEML 1OSPH 2D9QB 2IALA 4LRIC 5J9PA 2X70A 3OTTA 1T1ZA 1V05A 3D1MC 4TVPH 3BO8B 2MKWA 3QBTB 4ZOCA 3MRIA 4PJIB 4TUOB 2YOCA 4NQED 3SDCA 4OCMC 5CJXA 2BY3A 4DUVA 3ZYZA 1G6RA 1V3KA 4P2CG 4LFHG 1NKOA 2VLKD 5I8EB 2VC2L 4KJYA 3OHXA 3RZCD 2FZ3B 1G1YA 1R0AH 5A16B 1HNGA 2ADFL 3Q3GA 3BOVA 1BZ7A 5DI8A 1QFUL 1EA9C 3SDXB 5F6IC 4P5TB 1E6JL 3ULSB 4GRLB 3VFUA 3BSZH 3RI5K 1MWAB 1K2DB 4C58B 2DMKA 5IHUL 5HHPB 3STBA 4CNIA 4L4TD 5TF1H 3D2UD 5C1MB 3AC0A 4LNRA 4DJMA 4N0CA 5I1IH 2VL4A 2Z31A 4RAUB 3Q5OA 1JUFA 2X4RA 1XGRA 3QO1B 3N85L 1KCUH 4LLUA 1YEIH 2FJFA 1OB1B 2JB6B 4CN6A 2NQCA 4RGNE 5T1DH 4X6FA 3QEGL 4GS7B 1JHTB 4MA1C 3ULVE 4JPVL 4P4RA 3REWB 4OGXH 4QHKJ 4K7PL 5DQDL 3NMEA 2IBBA 5C0BA 2ZOLB 3RWIA 3BWAB 4CVZA 4U1SB 2OSLB 1A1NB 1AQDA 1P9MC 4WFED 5CKGA 3TH4T 3VXNB 4F7TA 4JM2C 2A77H 1FYHB 4P59L 3HZKA 4G9FD 3D0LA 1NDGB 5BXFA 4G80B 1B0WA 3S36X 5SWZA 1Q9OB 3QUYB 4L3EB 1T0PB 3MYJA 4Z7WF 5IB2B 4MXQD 1DEEB 3GIZH 1NGPL 3LKRB 4YWGL 3BGFC 4LSVL 4AEIL 1DCLA 5DRWA 2X42A 2E7BA 5BZWB 5TQ0L 1CD8A 3TZVC 3WN5A 2CIKA 2YR3A 3NCYP 4FQLH 4CAGA 2CDFB 4PGEB 1H3PH 2EDRA 4YX2L 4QY8B 1PGRB 3VFTA 2BNQB 2H8PB 3L3HB 4G8GE 1MFAL 4YDJB 1R24A 5GS1B 3AS1A 4JQXA 5TE4H 4Y88A 4JGUA 1RZGA 3IXTB 2NY7L 4AIOA 4PJEE 1MIEH 2CRYA 4X80H 4JFPB 3ARQA 4NKMB 5CIPH 1LNUB 3FOMA 3HZMA 2AGJH 5DUBB 2Q7YB 5C6TL 2DM2A 5AZ2H 1LP9E 1VKXA 3P73B 4QF1A 2BNRE 4KK9C 2GSIB 3ZSTA 2CR3A 2UVFA 4XZUA 2IANE 1IGMH 2G5BA 2GHWB 1ZHKB 2DBLH 1XAUA 4IDLA 5D70L 3P0YL 4WI9A 4XVSH 3EOAA 2E8YA 1KC5L 4BKLA 4GOSA 2OL3L 4MAYD 1PDKA 4XXCA 3GNMH 3MJ7A 4D0BA 4WDIB 1KLGB 2FR4A 3ROLB 1AR1D 3IU4H 1UM5H 2IMMA 5IW6B 1UGNA 3VFNB 2C3VA 4ODHL 4WWKC 3FFCB 3UJIH 2WUBH 4ONHA 4BSVB 1OTUD 3MRDA 4Y4HB 5JXAH 1HNFA 2PYFA 3DX7A 1UH3A 2FH8A 3T3PF 3O6MH 1R3LA 4DUWA 3VJ6B 2MSPA 3P9WB 3PWPE 5GS2H 4LIQH 5DR5H 2DQGH 1E27B 4JFFB 4OZIA 1FL5B 4F58H 1M6OB 3ZKNC 3EHBD 2JE8A 1FNSL 2PF6A 3BT2L 1V7NH 1PKQA 5HYFA 4JKLA 3QI9D 4FA8A 3C60B 1LE9B 4B5EA 4L4VD 4EBQH 1H8SA 1FYTA 2FO4A 5D1XA 2HVJA 2IH1A 4Z0BL 4GXUN 4P2YA 2ZKHL 3HC4H 1OWRM 4Z7OF 2AXJA 4G7YL 1J5OL 3G5YB 5E8OB 1BIHA 1G9EA 3SE9L 3I3BA 4XH2B 2ERJC 4LVHC 2WQ8A 3T4YB 4P46D 1KTLB 5C6PB 4M7ZB 4NQCE 1BP3B 1JWSB 3HE7A 4KK8D 4KK6D 5F9AC 4YPGB 4WENB 4C83B 4W81A 4Z7UF 3QP3A 5SWSE 2AEQH 3X3GL 3DARA 2IPUG 4PJXB 1BD2A 2V5SA 4GLRH 1JGVL 3VXPA 1G7LA 4X5XA 1JIBA 1UENA 1ZHNB 5F96L 3HHRB 4RMUA 5HGAA 1BWWA 4JHAH 4QO1A 4NN7C 2XA8L 1ZEAL 4N90D 2DQJL 3CFCH 3QISA 5IT2L 5I71B 4IOIA 4JDZB 5HYJB 3WFBL 4Z8FL 3IDNA 5EU3B 1DQML 3CFJB 3NFNA 4V3DB 3O11A 4O5LL 5D6DC 2HMIC 1P5UA 3ULUH 1IC7H 1U95B 3LKNA 4M93C 5ITFA 2VH5H 3FB5A 4PG9B 5KSAA 5E8EA 1YMMA 3IKCA 2ATPA 3MRFA 3ARFA 3DNKA 5FXCH 3RP1A 1HILB 5HI3C 3GSOB 2AXHA 4WUUE 1I85A 1EDQA 3ALPA 2ZUVA 3SGEI 1WWBX 4LP5A 4RFNC 4IRJC 3B9AA 2GJ6E 5LCVH 4EUPG 4NO5A 3VG9C 3RZWA 1ZT4B 3ZYOA 2DLFH 3B9VA 3IJSB 3BEWA 4PJHF 4XCCH 2ZJSH 3HKFA 4NQVA 4OZHF 5DURB 1NFIB 2FX8H 1YPZA 5LWYH 2CKBL 5CIPB 3P40A 4NUGL 2AK4B 4P3DB 4Y89A 1BBDH 1T1XB 5GGSA 4RFEB 1JGEB 4YQXL 4GKZB 3CMOH 3TA3A 4ZS6C 1F4WH 1ZMYA 2PTVA 3QNYB 2ZCLH 4GAJH 1T1YB 3MV01 5K9KB 4JN2A 4YFEA 1U58B 1MCWM 5FOBA 2VRAA 2AP2A 4YXKH 4BJLA 4TTDD 2BOBB 5DHVH 1F6AA 5HGDA 4Y4KB 4YBLC 4YHKH 3C09C 3PV6B 1X4ZA 1EHNA 3RVUC 4HLZG 2DS4A 1N5AB 1KF9B 2FSEB 1EFXB 4OM1L 4Z7UB 3U46A 2IC2A 4YDVA 3QHTC 2A83B 4ZD3H 4F2MA 3PHOA 2AABH 4HCRL 2ITCB 3QHFL 4ODWB 4OF5A 1DEDA 2IPTL 5CAYB 3PDGA 1J18A 3FHAA 4U1NB 4BFIB 1Z3GL 3ZKXC 3ARDA 3QUMA 5BVJA 4L3CA 2EDQA 4WTXA 1CFQA 1T3FB 2IGFL 4IIQC 4JO2H 2P1YA 2BCKA 1T2JA 3QEHB 3O2DH 3OXRA 5HTSA 3CC5B 4ELMB 3CSYA 5FYKD 3WNMA 5IEKB 1KT2B 4L3AA 2A6DA 4J1UB 5IB3A 4PRBB 3LN4A 4KUCD 5EBWB 1P53A 2C1PB 2WINA 2A0LC 1S5IH 3GBMH 3H3KA 3G6DH 4KUZH 4XNQB 1HWGB 1RZ8A 3PIQA 1Q0YL 4LLDA 5EBMB 3GMRA 3I2CL 1DLFL 1OTSD 2QADB 3DJ9A 3MBXH 4BUGA 5IMLA 3I02B 2FJHB 3VWKA 1QA9B 1IEHA 4OZHB 4MNGE 1NGZA 4JPWL 4PJFE 5BCAA 5J4MA 2JLLA 5JA8B 2AERT 5E8PB 3ULVF 2X1XR 2NZIA 5E94A 3D69A 5IMKA 3VWJA 3GK8L 4KHTL 3VFRA 4PGCB 3GBLA 4K7FA 3GIVA 4EOWH 2FIKB 3P3YA 4IJ3B 4OB5L 1T20B 3BYTA 4PGDA 2KZWA 1F90L 4OCNC 3RWEA 1MIMH 1NAKL 3B2VL 4DOHB 3UZVB 5D7KE 2DMBA 1G0XA 2YWYA 3S5LG 1MHCA 3DVNB 5I1EH 3O9WA 2I07B 5I1JH 4YHNB 3QHZL 3DURA 2AI0H 3TJHD 5I66B 1U91A 1XIWB 4XCYA 5JO5A 5DSCB 1MREH 1F13A 1A7OL 1HCVA 1P4IL 2ZSWB 4XWGH 5DMKA 1UVQA 3BHBB 2RR3A 2X44D 3BKML 3VXME 3WL9B 6FABH 4I77L 5B8CA 4R7DA 2P5ED 1EFQA 1XT5A 3H8NA 2UUDH 3DUUA 4BFGA 1OW0C 4LPTA 1TCMA 4ZQKB 1ZANL 3QCTH 4PJEF 1MVUA 3HZVA 3LEYL 5CEYA 1UCBH 1XFPA 4NQEE 5DVOA 1X5KA 1LP9F 4WW2F 1F3DH 3CXHJ 1FNHA 1A6TB 1HEZA 5C86A 3QUKA 4PJAE 2H3NB 3OJDB 5CFHA 2HJFA 5DHVB 3CFBB 5IB1A 1CD0A 4WEBL 1A4KA 4JY5H 1FFOA 3LKSB 3O6FB 2R1WA 5AYQA 1RIHH 3RA7H 4MJ5B 1JYXA 2VDKL 4LBEA 2R69H 5EO1B 1QSVA 1HH6B 1I9IH 4DGYL 4P57A 4Z7VF 1PG7L 1I3VA 4O58H 2XPGB 2GTZB 3VXTA 4L4TE 4R0LB 3QAZB 12E8H 4LF3B 4I3SH 5DEGB 2UZYB 2PO6B 3U1SH 1JNLL 1ND0B 2XQYG 5JW4R 5IP4A 1UEYA 4PIRF 3BZEA 3G5VB 1RU9L 3CPLB 3L7EA 5T1LA 1I9RH 3GMNB 3G6AB 3QXDB 5ICZB 3FB7A 3P30H 5CUSL 2OQJA 1NBYB 1VENA 5GJSH 3U7YL 1KYOJ 2ZSVA 4RWYL 3VI3E 1C16B 3T4AA 5EPMA 5IMMB 3VCLB 5ACZB 3E0GA 1HYSD 5EUOE 1H0DB 1MEXL 1IGCL 2P7TB 2PYED 2AXFA 1CIDA 4QTHA 3KWWB 3TYGL 4KKAD 4D3CH 5EU5B 3LDBC 1CU4L 5DJXA 3B8SA 3QUZD 1X3DA 4UB0L 1QEWA 3P4NA 1RK0B 5I16B 4P3WA 4OLUL 1JWMA 2EDBA 4G8GB 4MD5A 4NO2B 1JZ3A 2BVQA 3VE0B 2DQFA 4JCLA 4M7LH 2PW2A 1OM3H 2VZUA 4WY7H 4YHML 3U9PL 4NRXA 1BQHA 4NCC2 2RBLA 4AMKH 4P2OD 1U92A 2HG5B 2UY7A 3B2UC 3MRQB 1YY8B 1ZHLB 1JRHI 1W0YT 1IL1B 3PGFL 5ANME 1MF2L 3FO0L 4WW2B 2DIJA 1LDPH 1M7DA 4IMLB 3BQUC 5CGYD 5EOCH 2BNRB 3V6ZB 1G9MH 1U9KA 3JV6B 3MV8D 1FORL 3OKEA 3P0VL 3WKMH 2F74A 4JZNB 2AJ3A 4JVUA 3RFZC 2D7QA 5SWQA 2PNDA 3JSSA 4FN0A 1FSKB 1CK0H 3BN9D 3AS2A 1ZT7B 2EZ0C 4AQOA 1YEKH 3BGAA 3U9UA 3QDMB 4DKAA 3KYOA 2BVOA 4Z7VB 3RWCB 3CNKA 5CINL 1HHIB 2WW8A 3MRJB 4ODSH 1QO3B 3QZWG 5GS0L 1YNTB 1TZHB 1MI5D 4A2LA 4JAMA 1S3KH 2OTWB 3KPNB 3TBWA 1JP5A 4KROB 3VXUE 1IZJA 5T1KA 5IOPB 1LEIB 3HMWH 4KAQH 1AGEB 2EH8H 1J10A 3THML 4HHAA 4XVUC 3TFKA 1KB5H 1KEMH 5D1QA 4E9LA 5CJOL 4NCC1 2NY2C 3G08A 1A9EA 1X6NA 4L1HA 5FYKU 3IAQA 3UTTB 3E3QA 5EZLB 2ZUUA 5C9KA 3UTPE 3FCTA 3O3BB 3KNBA 1HHGA 2IG2L 4MA8L 1MJJA 4HUVA 5I8CA 2VC2H 1OP5K 1JYVA 1RK1A 2IPKB 2XTJB 1KIRB 2ARJQ 5D2LE 3EOYG 2PXYA 5KOMC 3SEPA 5ISZE 4ODVL 4LSTL 4LCIL 2VDOL 4EI5A 1V3JA 4Z7NE 2EC9U 1QFUH 3WEXB 1NEZG 2Y72A 5T5FL 1AGBB 3MRBB 2VZTA 1E6JH 1I7ZA 2J8UE 4NQCB 4OQTL 5EZJA 4R4BA 5B39G 3DYOA 3HTLX 5LAXB 2YD1A 4PLJC 2FJGB 1EIBA 1S9VB 4MD0A 4KPHL 3UTSD 3AM8C 4JZJB 5C0IA 5AUMA 2P5WB 1HE7A 4GKSB 4CJ0A 3C5ZA 1IGIL 1OHQA 2R4SH 3N85H 3QUXB 5F7EH 4IRSD 4Z77B 4AQ1B 2OJEA 2IANA 1IC4L 2HTKC 4F3FA 1IT9L 3MA7A 4JPVH 3MV11 3NABL 4UDTB 2HTLC 4K7PH 4ODXB 5DQDH 3X14B 5T1MA 5MENB 4J3TA 2XIDA 2WBJB 1W0VA 1PZ5B 4YLQT 2JIXD 1XF3A 3KS0J 1HZHL 4I0PC 3AU1B 5FUCE 1DQDL 2Z93B 4N90E 4ETQA 3K4DA 1TPXC 4OLZL 2YC1A 3PXHA 5A2FA 1QLEH 3FB6A 3BX7C 4HMDA 5FUZL 4UOW0 3KPOA 4M02A 2GJ6B 3NIDE 3UTZB 3DSFL 5EOQL 4XVTL 4MCZB 3C5JB 4JG0L 4UAOC 3WE6B 2C3GA 1NGPH 4YWGH 5MP6H 1QPPA 4AEIH 2YD9A 4XNMA 1T2XA 2H32H 2HAZA 3VFVB 3PWPA 4PJFF 5TQ0H 4M7JH 1KJ2A 3LPFA 4M5YH 5HVHB 3IGAB 4F7EA 1ITBB 3PDDA 4G3YL 3O4LD 3RHWF 5MEQB 1FFNA 4YX2H 2MKLC 4YXLL 3MOAL 3JWOL 3FTGB 5I8KH 1MFAH 2B39A 3W39A 1XR9A 5H37G 5I17B 5KANG 2E9WA 2CIIA 3WS6A 1M4KA 1CT8A 4M1DL 1CG9B 3I75A 5IJVB 1XGQA 2NY7H 2A1WL 4X98B 4GRWE 4XB7A 5MEOB 5EOTA 3GB7A 1VFMA 1DBJH 3H7LA 2DYPD 4RZCB 5C6TH 1XGPB 3IFNL 1DBBH 4HWNA 1UG9A 5D5MB 4HZLA 4OLYL 5JIHA 4APQC 5T5NF 1Y6MR 4BQ9A 3CXDL 1F11A 2BVPB 1UFUA 3AY4A 5IV2B 1OQXA 1F6FB 2OL3H 9CGTA 5CZXC 2GT9B 1F00I 5EDXA 4NOBA 4BSWA 1MAML 4MQXD 4FS0A 5JPMB 1P2CB 1QLRB 1S8DA 4QT5B 5FYJD 3KLAA 1G6RH 4PJBA 3NACL 2I24N 3FL7A 4JY4A 2OK0L 4QRRA 5I0ZA 3MA9L 1NBVL 4U1HB 4UZGA 1EHLL 1HHKA 3ARBA 4NO0B 3OPZL 2NY3B 3EZJB 1IAKA 2KUTA 4CU7A 4F33A 2FGZA 3CMGA 4Z5RA 1ZE3C 3QIWD 4NPYB 3O8XC 4PJAF 1Q0XH 4N8VB 2DL9A 1FNSH 3BT2H 2IAMC 3S88L 3MXWL 4EXPX 2MJWA 3GSWA 2D0GA 1OGTB 3U0TB 3QB7C 1KJVB 4M7KH 4QWWC 5GRUL 4CBPA 5IM7A 5E2UL 4I5BB 1T5WB 3P0GB 1IM3B 3N1GC 5CJ8A 3N1PC 4PLKC 2ZKHH 3M8OL 4QRSA 4HV8B 1O7SA 1PLGL 4G7YH 4Y16A 2AEWA 4F9LC 1J5OH 3DO7B 5INCA 5D8JL 3CK0H 3SCMC 4QXGL 4E42A 3V0WL 2B5IC 3VFMA 4PUBL 4P2RB 2R0KL 4UMGA 3NPZB 4NN6C 4PRIE 3NCJH 3X3GH 3MV9D 1Y18B 1U8OB 4LDOB 5J11C 1JGVH 4MHHG 1P6FA 2PETA 3VI3F 3KXFE 2XWBB 4F15C 3U7AA 3VRJB 5LBSH 5F96H 3DO3A 3GMOA 2ORBL 3ARRA 2A73B 5ALCL 2F15A 5EUOF 5MEPA 1MCCA 3BDBA 2XA8H 1ZEAH 2DQJH 3CIQA 3BH8A 3WNNA 3F7QA 3V9FA 2BOCA 3WFBH 2V2WA 3LEXB 1INQB 1DQMH 1ZXQA 4Y19D 3OR6A 2B4CH 3HPLA 5C0CB 5KS9A 5J12C 4M9PA 5BW7C 3VXMB 3WJLC 1KPRB 4CVXA 5L0QC 3WHXA 1QSFE 5D7IB 1XGUB 4ELKB 1MLCB 3QPQC 4U6HA 3P4MA 3GMPB 4U4BA 2ARJB 1GZQA 4G8FA 3OR7B 4P4KA 1CXKA 3ALWA 1B0GA 1FDLH 1CVSC 4LPXA 1U8IB 1R5IB 4OUUB 3PHQA 4EI6B 3LQAL 4HKZA 4HUXB 3TNMB 3QG7L 2YBRB 1DR9A 4E41B 5IESL 3QQ9D 2DRUA 3ARGA 4AIXA 2P5EE 5JW4M 3H9HA 1FZOA 4AEHL 3QFJD 1FZMB 5D7JA 4GUPB 3C8KB 1I8IB 4PJAB 3X12B 1A9BA 2VR4A 3UJTL 1TDQA 4DN3L 5I73B 5DZOA 3U30C 1AP2A 4YQXH 5DRNA 1I8LC 3TF7A 2B20A 4MNGA 4G43B 1HIMH 5DHXB 1QD0A 5T3ZL 1TETL 3KLDA 1LO0L 4LSPH 1PG7W 1WFOA 3SKNA 1X4XA 4CMMA 4X9IA 2OL3B 4N68A 3RWFA 2NZ9C 4GMSH 2VABA 1CFNB 1U8PB 1BECA 4JQVA 4DKDC 5I75B 2IALB 1DSFL 1NBZB 2DM3A 3PWNB 4QLRA 2AAVA 1ULVA 4XAKD 3HE6B 4CGTA 1ORQA 4LCWE 1IC5L 4HSQA 5EU4A 5FM8A 4OM1H 2ITDA 5MERA 4XRCA 1A3LH 5E5RB 1LK2A 1VFOA 4FQJL 2YUWA 3RGVA 1JPSL 2IPTH 3LKPA 4K7PY 5E4IA 4R96B 4JZOB 2O5YH 3Q3GB 1Z3GH 4IEFB 2V2TB 5DI8B 5F97E 5DVLA 2HLAA 5EUOB 3TT1L 2IGFH 1BOGB 1MHEA 2BSRA 2NLJA 3IF1B 5FEBA 2JJVA 4HIXL 1DE4A 3V6OC 5KANI 3IETA 3VFUB 4TNWF 4JFHD 5AWNL 5D2LF 4CNIB 3EJYD 1DQLH 4NNYA 4LNRB 4LARL 4Z7NF 1FFPA 3WFEH 2X4RB 3KYKL 1WWWX 1X7QA 2O5ZL 3DGCR 4F57L 5BRZB 5J6HB 2HWZL 3SJVB 1QR1B 4P48A 2PYEE 5IW1A 2J8UF 43C9A 4IMKC 1JZ7A 4TUKH 4X6FB 3JV4A 4ZNCD 1ETZB 1ORSB 4JFDD 4XPHL 1UM6H 1Q0YH 3L7FA 4N0FB 1IGFL 2G5RA 4BZ2L 4NQEA 3I2CH 1DLFH 1R5VA 5E70A 1WCQA 3FT3B 2VLKA 1ZHBB 3FONB 5IW3A 5C0BB 1G9NH 1WF5A 1A3QA 4JPWH 4UILH 2V17H 4KKCD 2W9EH 1DANT 3HG1D 5JW3H 4OV5B 4YDKL 4F7TB 5KN5A 3UX9B 4M3KB 4RCAA 1TIUA 2X10A 3HZKB 3D0LB 5BXFB 3MTRA 1Y0LB 3JWDL 2EO1A 4FQXB 3GK8H 4KHTH 1NANI 5FV2A 1PFCA 2EYRB 4PV8A 4APQD 5ADOL 3MYJB 2APTA 5ESVA 3TN0B 1O7VA 5I19L 1F90H 5MI0C 3D2UA 5E1AB 3JTCA 3HC3L 5DRWB 5IB5A 1NAKH 3B2VH 1CL7H 3DHJA 5ENWB 4QTIH 1DQJB 4S2SB 5L9DL 2BRQA 5JNYB 2QSVA 3CDGA 3VXUB 3VFTB 5A3ID 5F3BB 3QHZH 4Y5YA 3BIAX 2H2SD 5C08B 1S7WB 2F54A 1OPGL 1A7OH 4YUEL 1XF5B 5TQ2L 3Q0HA 1F5WA 3CLEH 1P4IH 5CD3B 1MI5E 5SX5K 2DJSA 3BKMH 1JGLL 43CAA 3FOMB 1EVTC 2Z92B 1A3RL 1MFNA 3MUHL 4IRZH 2CKBB 2R29L 4QF1B 4NC1C 1HHJA 3OSKA 1X5ZA 3I6KB 4POUB 4G9FA 3BPNB 3CFKA 5FECB 1U42A 5ISZB 2HP4A 3TH3T 3TVMC 4MHHI 3LEYH 1F4XL 5F89A 2XACC 3EOAB 2BY2A 4K3JH 4BKLB 4MXQA 3ESUF 3T77B 4JRYB 3MJ7B 4D0BB 2J8UB 2FR4B 3EYQC 2X9YA 4ZFZB 3WXWH 4NQSA 3MOBL 4Q6IC 2NY1C 3SDAC 2C3VB 1PYWA 2D7TL 3D3VD 1WCBB 1CD9B 5ANMA 1F2QA 3NCMA 2EH7H 4KI5C 4ONHB 1GVIA 4MZ2A 4X99B 4JKKA 5E9DA 5HI5D 1D5IH 1SJVA 3UYPA 4MCYA 3PGDB 4LRNL 1QTYT 5BS0D 1PG7H 2RAMA 3DX7B 3VDBA 3GZKA 3UDWA 4HK0A 3UTSE 1C5DA 4OZIB 1JNLH 3IYLW 1BIIA 4S11A 5IR1B 1RU9H 3JBG7 4NM4L 3TO4C 4ETYA 3KDMA 1IAIL 4P23B 4X6BB 5E2WH 3CD4A 1OP5H 4MWFA 4OCRH 1FYTB 5CUSH 3U2SB 2WIIB 5FV1L 3U7YH 3DUSA 4RWYH 3P9LA 1CF8L 4PV9A 2H45A 4MAYA 5T3XD 2CD0A 4UI2A 2VLJB 2E3VA 2QLVB 1MEXH 2ADGB 4C4KO 1IGCH 3TJEL 3BDYL 3PGCB 1SM3H 5BO1L 4JE4B 4UNVA 5HHNB 5I1GH 4KUCF 4HJGA 4G8IA 1G0DA 4UDUB 3MBEC 1CU4H 4Y5VA 1QACA 3BMVA 3GSUA 3Q5YA 2HT2C 3P11L 4YC2C 5DC9B 1P7QD 2NY0D 1BD2B 3WHE1 2I9TB 6CGTA 4X5XB 2MHAA 4N0UA 4GKNA 3SBWC 3ZE2F 5IHLB 4KRPD 1EEQA 4U3HA 3DWTA 4Q97A 1CFSA 5D2LA 4DTGL 4HKJA 4L29A 2LFGA 1XH3A 3U0PA 3U9PH 4WHTB 2EIZB 1T0NA 4IOIB 1BM3L 2NXYD 2YEZB 3O4LE 3MGTA 1JE6A 3O11B 3MCLL 5JHLH 3PGFH 4NFCA 2FX9L 1NQBA 2V5TA 4L4VA 3FO0H 2FH6A 3CAFA 5ITFB 5I74B 3FB5B 5E8EB 1YMMB 3IKCB 3MRFB 1U3HC 4NP4L 3SDDB 5D1ZC 3QDAA 4PJ9D 4RRPA 2YD5A 5D7SL 3CH8A 3HCVB 3RKPA 2DF3A 4C4KT 1WIOA 4P46A 1GJIA 1G6VK 5GRVL 3BIBX 3IDIA 5DMGD 4RNRB 5CINH 3RIAK 5EC1A 3V6BR 4HGWB 1FIGL 1VPOL 1X4YA 3REVA 5HHOD 3QIUA 2YD2A 1PEWA 3MNZB 4I2XA 1FVEA 3DXAD 4NQXB 4HJ0D 2VSDA 4XNUL 4QNPE 2HT4C 1AD0A 5EG6C 1H3XA 3L5WA 3BP6A 3NTCH 1A4JA 1CR9H 2FCBA 4A6YL 5IEHA 1L9NA 5FYJE 2VZVA 3IDGA 5CJOH 4G7VL 4EDWH 3S3PA 2LU4A 1FL6B 1MH5B 2OTPA 1QBAA 3KS0H 4LSDA 3RNKA 2AW2A 2XY2A 1UADC 1I7TA 1UXSA 4MA8H 2X4UA 4MS8D 5D6CA 3SKJH 4PRHA 4JPKL 5HSFA 5FKAA 3RDTB 2P8PB 5E5MB 1N0XL 4ODVH 4YDVB 4QRTA 4LCIH 2ADIA 4Y5XA 1I1AD 3TIEA 4MVBD 1N7MH 4AZ8A 3CSGA 1CS6A 1WAAF 1OCWH 3HNSL 2W0LA 1JZ5A 3C6LD 5IBTL 4PGZA 2YMXH 2E7MA 4OQTH 4FOMA 1JF1B 5DJZA 5ALBH 4QRUA 4K8RD 4U1GB 4XTRC 4B50A 2R9HC 1YN6A 5E2TL 4NBXB 5FUOL 4PS4L 4PRIB 2DD8L 3RTQC 5HDQL 3KXFB 3RQ3A 3PABA 2NY6B 4OFPA 2IBZX 4OCXL 1OTTD 4K94L 3T09A 3TYFA 3QIBD 1YMHA 1IC4H 3FRUA 4J3SA 1BEYH 4M61B 4D0DA 4TNVK 3NABH 3MV9E 1U8LB 5E0QA 3PIQB 1GGCH 1JFQL 2ATKA 5JZ7D 3GO1H 1HZHH 3PE9A 1DQDH 5CEZD 1QSFB 3VWKB 4OLZH 4P2QA 1WT5A 2AJYL 5FUZH 4ZAKC 4L8SA 2K1MA 4Y19E 5HHVL 1MCEA 2UV3A 5SV4A 1SEQH 4DKFL 3DSFH 4LAQL 3TM6A 5EOQH 1IGYB 3QJHA 5E94B 4JG0H 2QQNL 4FQ1H 4XBEH 3SPVB 1P9MA 3JV0A 3BD4A 3D69B 4YDIL 1QFWH 3VWJB 4JM2A 5HYSA 4RGOL 1TMCA 4ZSOB 2CRIA 2EXWD 3AUVA 4K71B 2FB4H 5DJAA 5GGRA 4PREA 1D3CA 2VL5A 4G3YH 3BPCB 3C87A 3H6JA 1MFDL 2WIMA 2SEBA 3GSNL 3SO3C 4YXLH 3MOAH 5DJ0A 4ESKA 1RZIA 3LB6C 2UZIH 3B3IA 3T8XA 3TZVA 4M1DH 5FM5O 5E7BA 4FFWC 3S3SA 2A1WH 3DURB 3S35X 1MCSA 2YSSB 5L2KD 1KG0A 3IFNH 5CJXC 5DMKB 2F19H 1UVQB 4EUPA 3V6FA 3EO1A 3LKQA 4LCWB 4Y2OA 2MQ3A 1AJ7H 4OLYH 5IWLA 4Z9KB 1S7XA 4DZBB 3CXDH 3VGAB 2L4OA 3BMWA 3IDXH 1RMFL 5KW9L 3MLXL 4XAKE 2LU3A 1MVUB 3TPKA 2BFVL 1WBYA 4U0RC 1SJHA 4XHQA 1MAMH 4HGKC 4B0MM 1K8DB 4LHUG 1NUNB 3LS5H 4X6DE 3OKOA 3FAXA 5I6XB 3EW3B 3NACH 3GSXA 3PUCA 1HDMA 4N0CC 2OK0H 1DFBL 2P24A 2Z31C 2HJFB 5CMAA 5I1AA 1NBVH 3ARVA 3L3DA 4NRZB 4OZGA 4X4XB 3IDUA 1A4KB 2DQDH 3UAJD 2VWEC 1FFOB 2NY4D 4NGHH 4I3RL 2ZCHL 3N50A 1QFHA 3QO0A 5DRZA 5C09E 1CICB 4HS6A 4WWKA 1J8KA 1S9XA 2X89A 4M48H 5BQ7A 5IUSA 4ZUWA 3U48A 4JFHE 3S5LB 4XPFL 3S88H 3RBSA 1MLBA 4Y7MA 1TVHA 1EHAA 1U8JB 4OT1L 5E2UH 1EJOL 2HVKB 1T7WA 3BZEB 3T0EC 3L7EB 2N1KA 3MRNA 2D4DA 4PJ7E 1RURL 1KLUA 4FFVD 3CGTA 3DIFB 3M8OH 3IU3A 1FIEA 4QXTB 3NCFB 5JMOC 1PLGH 1S9WB 1XZ0B 4JFDE 2OQJB 2DL2A 5D8JH 3UPRA 2Z4QA 4QXGH 2VKXA 2XZCH 1D6EA 4X7SL 1HSBA 4PUBH 4NKDA 2XN9E 2N4IA 2VXQH 2B4CC 2R0KH 4IOSD 4YHYC 1JNJA 3M17A 4QTHB 2Q6WB 2DI8A 5JIKA 3T0DA 2GUOA 5CZKA 3WN5C 3R0NA 4I9WD 2FLRT 5H2BA 1FNEA 1ES0B 5JIIA 1D9KB 4WTZA 5F7FA 1S7QB 4XP6H 1T5XB 1C08A 2ORBH 1MFCH 1DZBA 4UU9B 1AH1A 3C5SA 1FGNL 1BBJA 3MLYL 1EO8H 2R56L 7FABH 4JQXC 2R1XB 3SE3C 4BM7A 5IVZA 1EAPA 3E6FB 4MD5B 1FHGA 2BVQB 4XMKH 4ZXBD 4PJ8D 2W92A 1ERNA 1J1PL 1MHPL 2VDRH 3GJFA 4NRXB 5BVPL 1T04A 5E2JA 3MOQA 1BHGA 1BQHB 3PQYD 2IH3B 2D03L 3KJ4B 1MRDL 3ARED 1BJMA 4PJ5D 1ADQA 2JB5L 4I48A 4NZTL 1YQVL 4XHJD 3CLFH 3GGWA 3OKEB 4LHUD 4GBXD 3FRPA 5D6DA 4Q9BA 2AJ3B 4Y2DB 2R39A 3FQUB 2YPLB 3FO1A 2ESVA 2LVEA 5J0BA 1CN4A 3LQAH 4OF3A 3QG7H 2PYEA 5IESH 1HI6A 3I50H 4XBPA 4HAGA 3ZTNL 2XQBH 1L8JA 3ISWA 4R2GB 4AEHH 2VXTH 4DVBA 2GFBA 3L3IA 4IRJA 2BVOB 3L5IA 3MCG1 1DBML 3QUZA 4YFLF 4ZTOL 3F7RA 4RGMC 1KEGL 3UJTH 4DN3H 3RBGA 3QEUB 4JAMB 3F58L 5T33H 4D8PA 3QDJD 5T3ZH 1TETH 4JN1L 3QG6A 4MGXA 1S5HB 1LO0H 4BK5A 4PRPE 3B6SA 5FB8A 4KKLD 3S4SG 2NTFB 4LCCA 4P2OA 4LLQA 3DMMD 1NSNL 1ACYL 2XXMB 3BVNA 4AL8L 1J0ZA 1INEH 1KELH 4LGSB 3MV8A 2R2CA 4CW1A 4BZ1L 4PBVC 3HI5H 4HUVB 5I8CB 5BS0E 2VN4A 5DGQA 3BZ4A 2ID5A 1NMCB 2C3XA 2PXYB 5I2IA 1RUQL 1SHMA 5E6ID 3H9YA 2EDNA 1FO0A 3B9KB 3OV6A 1ZSDA 3J8F7 4OIIL 3TT1H 5IBLC 4HIXH 3HE7C 2OXHA 4LEXL 1KN4H 4NZUL 1I75A 4GFTB 4MLSA 4B7LA 5AWNH 1MCOH 4YHPB 3ARSA 1MI5A 5DK2B 2I26N 1G9NC 4LARH 1Z9OA 2QHRL 5T3XE 4HKXA 5C0GA 3C5ZB 5ERWA 3KYKH 2P42B 2O5ZH 3QZWB 2IPUK 4U3XA 1FFQA 4MXVE 2ZZUT 4D9RD 3BN3B 4OF0A 2Z91A 2F53A 4ZS7L 3RGHA 4Y4FD 2LTQC 3NIGE 5JQHC 1RIVL 1WSST 4BZ2H 1A14L 5E4EB 5C0JA 3MXVL 5T1MB 5KSAC 2C3HA 3WKNA 4Z78B 3ARFC 3L3OB 1XF3B 2NW2A 4KRMB 5LGJA 1I85C 1NL0L 4YDKH 2DDQL 2HJLA 3BDXA 1BFVL 1FGVH 1HQRB 2YC1B 4LSUH 5F3HA 3SKUD 3KPOB 2C4FU 5FFLA 2P8LA 3JUZA 3W9EB 4XP1H 4D9QD 3QWQB 2XA3A 5ADOH 1KXQE 5I19H 4QRQB 4BFEA 2JJWA 5C0AD 1T66C 3EOBA 4XNMB 2C9AA 2YXMA 1JHKH 3ECBA 5F9JB 4V1DD 5L9DH 1GH7A 5D96C 4AIZA 1NFDA 3RL2A 4JKPH 3TA3C 1BVLA 4UIMB 3S3JA 2YA1A 1Z9MA 3QNZA 3DRQB 1OPGH 4LLMB 2EYSB 4FXKB 3GHBL 4H26B 4YUEH 1F4AA 5TQ2H 3UJJL 2Q8BH 3OQ3B 2CKNA 4UINL 5TPWL 1E4WH 3DXAE 3DI3B 5EO0A 5EOTB 3GB7B 3T04D 1A3RH 3RWJA 4XC1H 4QHNA 1FVCB 1YY9D 3DX6A 3E2HB 4TSBH 1OAXL 4HZLB 1D5BB 5JA9A 3EO0A 2JJSA 2APBA 4LK4A 1YEHL 2X7LB 3SY0A 2VLRE 3VGEA 1S7RB 3A67H 2GTWA 1FBIL 3A0OA 3ARDC 2OTUA 3NFSH 3B4NA 1Q1JH 4HS3B 4HS8H 4I4WA 2NX5D 5JHDB 2A9NL 4XMPH 4YBQC 3SHSA 5CZVL 2JCCA 3O3AB 1OW0A 3ZE0E 3MOBH 2VIRA 1VACA 3C2AL 2FEDD 3HI1A 3GMQA 1M7XA 5E7FA 5EBLA 3NIFF 1NCTA 1S8DB 2D7TH 3O4LA 3KLAB 4PJBB 2W0FA 4LL9A 1L6XA 4RX4A 5EZIL 4FXGA 2HN7B 1JGDA 3FOLA 1RZJH 4JY4B 4JKMA 3V5DA 2LQRA 4QRRB 1ZGLB 2R8SH 2R0LH 2YUXA 5EZOL 1YYMH 3V7MA 2V9QA 1JZ4A 3LD8B 1JFMA 4UUJA 4D0CA 1IAKB 3OJVC 4F33B 5B38G 2VYRE 4X6DF 3TH2T 2V5RA 5F8RC 5DQJA 5BV7C 4Z5RB 4LKXB 2CGRH 1WUNT 2ENSA 2IFGA 2DYPA 5AD0A 4J2XA 5J3HD 3NAAH 3VMOA 3BUTA 2GY5A 3HPJA 3S96A 5A43C 4LP4A 1HXYB 5IM7B 2D7PA 2VLMD 4NT6B 5F7DA 3MO1B 2LE9A 5JR1H 2QR0A 3GKWL 1BVKA 2VAAB 4NKOB 1CF8H 4QOKE 4P5TD 4IDJL 2CO7B 4GRLD 4HUWB 5F9OL 1TNNA 1HXMA 3GJFK 5EUKA 3TJEH 3O3EA 2BZDA 5BO1H 3WDHA 3F12B 3K46A 4PJ7F 3GRWL 5E8DL 3P11H 1X5HA 4MQSB 1CE6A 4PJGF 4ZFGL 4ZYKB 5FHAH 1AQKL 4RMRA 4X4ME 3GMOB 3O9WC 5MEPB 4DTGH 2ZCKL 2FLBT 1YUHB 4EIZC 3BH8B 3VGHA 3DLQR 1G7JA 3BP5A 1ZS8A 2L7JA 3U36A 1B4JH 3HPLB 4ISVB 1MY5A 2YA2A 1QFWM 5KS9B 1ROWA 5B8CC 2X4PA 3RKDC 4NP4H 3WHXB 2W60B 4U6HB 3BAEH 4NOFA 2BDNH 4RFOL 3QUYD 4L3ED 4G8FB 4P4KB 1JPTL 3O4OC 5D7SH 5L2KE 3N9GH 5AZEL 4XPGL 3BP7A 3NCEB 4HKZB 4U6VH 5K59F 1LK3L 4HPYL 1KFAL 4X6DB 5IHBA 1FIGH 3ARGB 1VPOH 3BEVA 5D7JB 1AGFB 3NN8B 1MCDA 2ZUYA 2BNQD 4G6AD 1A9BB 4DEPB 5FM4A 3O41B 4XNUH 3HS0A 1BGXL 3S37L 1M05A 1J86A 1URLA 4XNXH 4A6YH 5C09B 1MCFA 2EIEA 4PGBB 5HHQB 1W8OA 1T4KB 2V6HA 4NRYB 5L88L 5KVEL 2HLFD 5JDSA 4HGMA 3HAEA 3VFSA 4QYOA 1IBGL 2VABB 5EN2A 1KTDB 3T65B 2EDXA 1F02I 5DUML 1BQLL 5D2NB 3SQOL 1GOHA 1EGJL 2W65B 4FABL 5DEZA 5ACMA 3ZYIA 1DBAH 1EAJA 1JTTA 1K4CA 1EBPA 1PEZA 1CDUA 5MERB 1P7HL 1T89A 1N6UA 2B0SL 3MJ8B 4NUJB 1QLFA 4BH7A 4TULL 1JPGA 4PJGB 5DTFA 5TDPB 2D0FA 2MQCA 4YK4C 1PZUB 1ACZA 1N64L 5KSUA 2BJML 4PJDA 4QHLA 5KJRL 2HLAB 4TVPD 1N6VA 3FFCD 1MHEB 2BSRB 2C1OB 2NLJB 2XN9B 3QFJA 3ZE1E 3W0WA 5E2TH 3GBNH 5FUOH 1A47A 4PS4H 1JN6A 2DD8H 3QFDA 2Y6SD 4M3JA 1AKJB 1WFTA 1CDHA 4N5EC 5IMOA 4Y4HD 4NNYB 3MROB 4HH9A 4FG6C 1CD1A 1RULL 1FFPB 3ARZA 1WEJL 4WO4B 1F3RB 3WFCH 2ZOKA 1X7QB 2J4WL 4JFFD 1HKLH 3WS3B 5DEFA 3AM8A 2A6IB 5CSGA 5IW1B 2DWDA 1NCCL 2LABA 4G6FB 3C60D 4I9WE 1T83C 4BH8A 4QEGA 2Q3ZA 3EKCA 1JFQH 5JOFB 1JGUL 2XWJA 3QQ4B 1UB5B 3SKOA 4YGVA 4XP5L 5HPMA 4MXVF 3B5HA 3DETD 3WDJA 4LGRB 4RMSA 5CD5D 3LMJH 4PYHA 5HHVH 3NIGF 3V2AR 1F45A 1J1XH 3V7AG 2CLZA 3DV4A 2QQNH 3VFOB 2J6EL 4I0PA 4KVNH 4PRNA 4RGNC 3PQYE 2WWKO 4YDIH 3WIHA 3R8BB 1NAMA 4RGOH 3UBXA 3SKMB 1GAFL 5KSBE 3ULVC 3HMXL 3QXUA 3R0MA 1T22B 2DQCL 4PV8B 2ICCA 4HK3N 1MFDH 2HJKA 4WV1C 3NA9H 4X0KB 3DTXB 3PWJA 5J06A 1C7TA 4UBDC 2DKMA 5HYJD 4POZC 1TQCC 5JORA 1IM9B 1OAUH 3D5OF 4IBLT 4ONGL 4TOYL 2D0HA 5D1QC 3N1MC 4JFDA 4PRPB 1RHHA 2KL6A 2X4SA 4Y5YB 5TDNA 1XF4A 4FZEL 2NR6C 2F54B 2HRPH 3KPPA 3RAJH 2QQKL 2HH0L 5FDWB 1OD9A 1MPAH 1X9QA 43CAB 3QDJE 1OLLA 3ARXA 3HG1A 4ZPTA 4C56E 1WZ1H 5DJCA 4G5ZH 2NW3B 4AEFA 4HMEA 2VSCA 4MLIA 4EI5C 4RSVA 4F8TA 5KW9H 1A1MB 4BFBD 2BRRH 2BFVH 2YK1H 5DURD 2EIDA 3S98A 4A6YB 1SJXA 4APQA 2AK4D 1R0AL 3ORJA 5I8OL 2EDHA 1OOAA 5FCUL 3VFPA 1DL7H 2Q86B 1MCKA 3W11C 5C0DA 3BSZL 5ADPL 5DK3A 1A7QH 1FNGA 4TSAL 2ILLA 3GI9L 3OKMA 4I3RH 1ZLSL 3GSQA 5E9DB 4D94A 3IDJA 1LHZA 1WBXB 4MCYB 4W6XB 3ZE0F 2A2QT 3OKYA 5INDA 4Y4KD 1FZJB 4KDVA 3T0BA 2ICWB 4XPFH 1IGTB 5FF6B 1U8HA 3BJLA 4HK0B 5DQ9B 1EBAA 1GC1C 1KCUL 5E1HB 3OL2A 1SEBA 1YEIL 1HCFX 3MRCA 1EFXD 4OT1H 4O4YH 5HGGS 5ID1A 1P1ZA 5IHZA 3F7VA 3RWHA 1T2QH 1LGVA 1T1WB 1L9MA 3L3KA 2AV1B 1A1OA 1SYVA 2EECA 4D9RE 2I25N 4ZUTA 2R2BA 3OXSA 3MLTA 4JDVB 1MNUH 5DJYA 1LEKB 5F1NA 2B2XL 1H5BC 4JO3L 5GRYA 5GS2D 2OS7A 4YDLC 2DWEB 1DBKH 4X7SH 3GSVA 1BFOA 4KJPC 1GGBL 1IEAA 1X5XA 2BXYA 3DYPA 3D3VA 4RAVA 4HJGB 5B4MC 1RFDH 3R06A 1DP0A 1YECH 2KQMA 2PR4H 4NSKA 1HINH 2XTLA 2O61A 1FGNH 4D9QE 3GKZA 2R56H