5J6HA

Recognition of the mhc class ib molecule h2-q10 by the natural killer cell receptor ly49c
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
276
structure length
275
Chain Sequence
b'GSHSMRYFETSVSRPGLGEPRFIIVGYVDDTQFVRFDSDAETPRMEPRAPWMEQEGPEYWERETQRAKGNEQSFHVSLRTLLGYYNQSESGSHTIQWMYGCKVGSDGRFLRGYLQYAYDGRDYIALNEDLKTWTAADVAAIITRRKWEQAGAAEYYRAYLEAECVEWLLRYLELGKETLLRTDPPKTHVTHHPGEGDVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVYHEGLPEPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, Q10 alpha chain
publication title Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 70
structure length 275
sequence length 276
ec nomenclature
pdb deposition date 2016-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j6hA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5j6hA01
4GFTB 5IEHB 4HK3J 4R26H 4HHAB 1V3KA 4P59L 1NCTA 5GSRA 1DQLH 3ARSA 3TBTB 3UTTB 1QO3A 4X98B 3PJSA 4JY6B 4PLJC 4OZHE 3GRWA 5DI8B 3MRKA 4OCRL 5C92A 1IT9L 3C2AH 1OW0C 1C12B 1FDLL 5DS8A 3F58L 4QGYA 4M7ZB 4PB0L 5IIEB 4HXBL 3GIVA 2NY1B 1TJGL 3C09B 1JWUB 2R1XA 1TZHB 2AJYL 3MREB 4O00A 1ZWIA 1IGTA 2D7PA 2FBJH 2PYEE 3CUPB 3T2PA 3TYGL 4X80L 3FO0H 2ADFL 4GXUN 2YPKA 3SDDD 1AXIB 4BSVA 2Z31A 1KCRH 3MV9B 1D5IH 5AAWA 5L9DH 1A1MB 4PGDA 2C3HA 4GKOA 3U4EB 1CFTB 3SKNB 5ESAB 2ZSVA 4KH2A 1RZJH 1FNAA 5C8JA 1YEGH 3GSOB 3IETA 3J8F7 4HG4J 2Z91B 4NZJA 1P4IH 4C83B 2RFXA 3GI9H 2YPLA 2YR3A 3QG7H 3BXNA 1A6ZA 1PSKH 1A6VL 1RULH 4C54A 4LLWB 2BX5A 1N4XL 5AWNH 2JB6A 4G9FE 4FQJL 1OSPL 2BDNH 4E41A 1T20B 3WV0A 3WDHA 1FVCB 5EOCH 1KCLA 3FCTB 4FQ1H 3SE3A 1IGIH 2YK1L 3FJTA 4JANB 5EPMB 5FKPA 2BNRB 3SQOL 3DYMA 2R1YA 4IMLB 2FWOB 2D7MA 4F7EB 3CU1A 4JKPL 4OCYH 4XXDA 5JPNB 2GJ6E 4G6AD 5J06A 4JM2F 2DJ4A 1FAKT 2CKNA 2VJXA 3EJJX 1CK0H 5C0CD 1J12A 4GW1B 1TMCB 4NZTL 3D1MC 3MJGX 3DVGB 3MJ8A 3G5ZA 4UZGA 5AZ2H 4LBEA 4XC1H 3K4ZA 1WAAE 1PZ5B 3WKML 4Q9QL 2QQNL 1QLRA 4O2EB 1Q9OB 4ZD3H 3PIQA 3OF6D 3FQNA 5ISZA 1BD2A 3OKDB 3LQZA 3P4OB 3SE8H 4Z8FH 3NH7H 3WO4C 3HI1B 1PG7W 3DGGA 3K4AA 1CIUA 4NCC2 2FH8A 4X6DF 1MY7A 1I7TA 1GVIA 5I76A 5J3HC 2GSGB 3TESA 4XBGA 1KULA 3MMEB 3TVMB 4LHUG 1FNSL 1QR1B 1KNOB 3T8XA 9CGTA 3QNZA 1OP3K 3ARXA 1S9XB 3JV6A 4V1DA 1W0WA 3QAZB 2OMBA 1XCTA 3CMOL 2DMKA 2GCYA 4HGMA 4KRNA 1RZKC 1I3VA 4CADB 4NHUA 1A7QL 5HYEA 5KVGH 1TQCC 5MEOA 3AS1A 1BWWA 5SX4I 4XRCA 2CRIA 4F57L 3F58H 5IESH 4R7NA 1VEMA 4PB0H 4HXBH 3SKOB 4PJBE 1NBQA 1TJGH 5ALCL 1AC0A 2YUVA 4NKOA 2YWZA 4YDVA 2AJYH 3FQXA 1NLDL 3K2MC 4ERSL 4GXVL 5CWSB 3MRPB 4WDIA 2ADFH 4LPCA 4N68A 2X4PB 4QO1A 5BW7A 2R29L 3VXNB 5MENB 1E28A 2O93L 2EYTA 2B5IC 4PJCF 5DJXA 4KJYB 3X11A 5HI3D 3C9NB 3TH3T 4OAWB 1XT5A 5CP3H 4PJDA 5E8DH 1BECA 3SBWA 8FABB 4Q9BA 1OL0A 3MRRB 4M62H 3LEXB 2E7CA 4QXGH 4X0KA 1Q8MA 1KTDB 4X7SL 1KJMB 1H5BA 2GEEA 3MOQA 1JP5A 4S1RL 1A6VH 1C16A 3MRIB 5DDHA 4XVUD 4IRSD 5J12B 3UYRH 5SWZB 2XZZA 4NO0A 3PNWA 2IMMA 3K81A 3AM8C 4G7VL 5DC4B 1OSPH 4MDIA 1IL1A 3DTXB 2YBRB 3L7FB 4YJZL 3FT3B 5HYIA 4QXUL 2RBLA 4IRZL 1RIVH 2APVA 3HAEG 4PV9B 4X6CF 3VWKB 4DN3L 2YK1H 3C60A 2V2XA 4XMLL 1SJEB 1OAXL 3HC0B 2VQ1A 1HXMA 5EO9B 5KS9E 3SQOH 4QRTA 2DTSA 1EVUA 1YN6B 4LLDA 3LV3B 4L9DA 4JFPB 3MJ6A 4FQXD 4JKPH 4JO1L 3IJHA 4JRYE 4NYLB 4N0FB 2HG5A 2NLJA 4TVPD 4OLWH 1D5MB 4R7DA 2ZSWB 1OGTB 1U8PA 5IK3A 4HIHB 4HUUB 5EWIL 2J1KA 4CMMA 2I60L 4ZXBC 1G7HA 4DAGL 1AQDB 5FHBL 4Q9QH 3F7VB 4PREA 1KBGL 1I1YB 5IB5A 3LD8B 3GGWB 3MLTB 4XWGL 1G7LA 2FGWL 2VLJE 3S36L 1PKQA 1FO0B 2W60A 3QFJB 4P5TD 3CIQA 1IARB 4QRRB 1QSFB 5GGTA 5LJYH 2P5EB 3BDYL 4Y2DD 1KB5B 3WNLA 1KEGL 1D9KB 4QT5B 5D4QA 5H8DA 4M1DL 2W07A 4JKMA 3W2DL 1YMME 5HGAB 3TFKD 2B1HH 4PUBL 5JHLL 1B88A 1XF2B 3G5VA 3MODL 3FONA 3KPRA 4LLQA 4YE4H 2WP3T 2M8XA 3CSGA 1V5JA 4BH7A 1A7PL 4LU5L 4OUOA 3CMOH 5GZND 3VXOA 5ICXB 4MS8D 4Z7WA 4NO5B 2BVQA 5TPWL 4WENB 4GO6B 1CFVL 4OLUH 1MPAH 5IEHA 3QIWB 3H42L 1JWSB 1JPGA 3UTTA 3OB0K 1BPVA 1FQ9C 4JY6A 2Y7QB 2HN7B 1YDPA 2Y23A 5C9JB 5DZNA 4M7LL 2APXA 5HSFA 3RY6A 4PRDA 3T3MF 2EYSB 3QB7C 2O5YL 5D2NB 3DROB 1KPRB 5IIEA 1NLDH 1NL0L 4GXVH 1JWUA 3KAAA 1TZHA 3MREA 4Z7NF 4LSTL 3ARBA 3KS0J 4YFDB 3ZYOA 2O61B 3P30L 4KI5E 3T0WA 3UP1A 3UC0L 3MV9A 5JW4N 4GRWF 4PJ8B 3SKJH 1CE6A 3MCKB 4HWBL 1Y6KR 3VFVB 1G7IB 4WFHE 1CFTA 1JRHL 1MJUL 1FLRH 5ESAA 4XPTL 4I0PA 3GSOA 2OZ4A 2CD0A 5F70A 4JLRB 2Z91A 4UQ2B 4HPOH 2ITDB 2NR6D 5DF0A 3MBEB 1T03L 3N50A 1BMGA 3HLAB 4G7VH 4LLWA 4JRXD 4HKZB 4RMUA 4WW2B 1U3YA 1UJ3C 3MOAL 3EYQC 4PJ5E 1UYWL 4HT1H 1P6AB 4NNPL 1G9NC 3ECBB 5TE6L 1K6QL 4WWID 3KS0H 4IRZH 4JQIH 2GFBA 4TTDD 1T20A 2OQJB 4AT6B 1DE4B 3NIFE 5FYJH 3PABB 3FCTA 4Y4HA 3TGXA 5IBLD 2OP4L 3O8XB 3B4NA 4TSBL 4NQVB 5EPMA 4JO1H 4Q7DA 2BNRA 2Q20A 3DHMA 1FFOA 4YHPB 2EDFA 3HS0B 4L5FL 4F7EA 2KPNA 5JPNA 4UTBL 5BXFB 3P9WB 1YC7A 3KPOA 2ZJSH 3S35X 5EZOL 3FO1B 4XI5C 2I60H 4U0RB 3GSNB 4GW1A 4ZSOB 5HHVL 1TMCA 4LPUA 3MRDA 5DC9B 4GSDL 5D7SL 1KBGH 2X4QA 3DVGA 4OZGA 4NNYB 1AHWB 1PZ5A 4LVNB 4J3WA 2EYRB 3RL2A 1Q9OA 5C0GB 1CFBA 3ARDC 4OQTA 1WZMA 3OKDA 3P4OA 1RU9H 4M1DH 2VMFA 4GH7B 2A6DA 3OQ3B 2FZ3A 3W2DH 2XZCL 2CUHA 1UM5L 3HI1A 5JHLH 2WBJB 3TBYB 3MODH 4HUKB 5DJ0B 2GSGA 5JO5B 2VKWA 5E99H 3MMEA 3D9AL 5EBLB 3TVMA 3U30B 4ZODA 3U46B 4Y19B 4M43L 1A7PH 1KNOA 4NWUL 3T0ED 4Y4FC 5TPWH 3VFNB 1S9XA 4YHNB 5IEKB 4LPXA 1N0LA 1QHOA 4JRYD 3H42H 3SJVB 4KVCL 1QQDB 3RKPA 2ICWJ 4CADA 3IDNB 3EYSH 1RV6X 4M7LH 4JFOA 3HG1B 5E4IA 3BIAX 5EU6D 4LGRB 2J6EL 3NIDF 2EDTA 3SKOA 4ELKB 4Z77A 1WC7B 1KLUB 3VH8B 1X5XA 4JFZH 2HTKD 2C4FT 1JCKA 4X99B 1S7VB 3LHPL 2X4PA 4OLXL 3VXNA 2DD8L 3P30H 4OV6F 5HGDB 2MPAL 3UC0H 4LP5A 2YPLE 2CXKA 1D5XB 1XGTB 3DETD 3F7YB 3FFCB 1QFWL 1JPTL 4OAWA 4UT6H 4YDIL 5DO2C 5HYQB 8FABA 4XPTH 3BYTA 5C0JA 3TNMB 4OZIF 3D48R 3MRRA 4Z7VE 3VGAB 3P4LA 3OMZA 5LGHL 4HX1A 3LEXA 3WFCH 1KTDA 5FYJE 1T03H 1I9JL 1KJMA 2L0DA 5FK9B 4PJGA 3MRIA 3LKNB 1X3DA 4JG1L 3EUUA 4NQXB 1XIWB 2YD5A 3VFSB 1HEZB 3LB6C 2YXMA 4HK0B 5DRZB 5TE6H 1K6QH 4PV8B 4HS6A 3DTXA 1J86A 4L8DB 3DUSB 3ZHDA 4BA8A 4G43B 1WZ1H 3CZJA 5FF6A 4XMKH 4PJIF 2OP4H 5KG9A 3VWKA 1SJEA 4TSBH 5B4MD 4QTIL 3BGMA 1C7TA 3CH8A 5EO9A 1RMFH 2PXYB 3RI5K 3C6LC 1CLOH 1CQYA 5DUPL 1YN6A 3LV3A 2DMBA 4JFPA 5F6HJ 5DVOA 3KLAB 1I1CA 1W72L 4NYLA 3UROR 4N0FA 1AP2B 3BWAB 1EBPA 2FJFB 4YDJB 5EZOH 3RWHB 5ISZE 3MZTA 2ZSWA 1BD2E 2AXGA 5HHVH 4WWKC 1MHEB 4HIHA 4GSDH 5D7SH 1JPSL 4HUUA 1S7UA 4JPKH 1AQDA 4Y5YC 2NW2A 3EDDA 1KV3A 1I1YA 3VFGL 3GGWA 3MLTA 3VFPB 4HWZB 5EOTB 2FEEL 1TQBB 1ZMYA 3V6OA 1T7VA 4XMPL 3QFJA 4QRRA 1KUMA 1QSFA 3B83A 1YNTB 1YY8B 4Q97A 2P5EA 3R1GH 3BMVA 3JSSA 4V1DE 1KB5A 2XZCH 5GJTL 4BQCA 1D9KA 4PJ5D 1UM4H 1DANT 4LRIA 3M17B 3MLUH 2GW5A 1C5DB 4IOFC 2A73B 5HGAA 1DEEA 4NHUE 5J8OA 3D9AH 3QUMB 1MREH 1XF2A 2C9AA 4N8PA 4M43H 4NWUH 2W9LA 5KBNC 1QRNA 5T5FL 4CW1B 2CDGB 2VZSA 2BVEA 4MCZA 4FHBD 4HJGB 1BQHB 2QV2A 5ICXA 3QUXB 2KH2B 4H0GA 4QNPE 4RGOH 5J9PB 3GKZA 3V8OA 3WD5L 1P5UA 4RGMC 4Z9KB 1EUUA 5E9DB 3QIWA 5SWSB 4PD4J 5HGBB 5DLMH 2PW1B 5GS0D 1L8JA 1NSNL 1JWSA 1CXFA 4MLIA 5LKNA 4NSKA 4F7CB 4H8WH 5J89A 1X5GA 5C9JA 4MJ6B 2JB5H 1K3IA 4OI9A 2XRAH 3MBXH 1ZKAA 4LCYB 5D2NA 4PJDE 3GK8H 2P5WA 3DROA 4K3DL 1ZHNB 2IAMC 2BOBB 25C8L 3ULVC 3G08B 1S7QA 3HB3C 3LHPH 4G6KL 4P9MH 1VADA 2MPAH 3K2UL 4PJEE 5INDA 5C3LD 2O61A 2WMPA 1QFWH 2DQIL 3I85A 4JM2B 4PJ8A 2VUYA 5E5UB 5FGBC 2CH8A 1I4FB 2UVFA 2W38A 3MCKA 3THML 3VFVA 5HYJD 1G7IA 4DW2L 4TULH 5LGHH 2V5MA 1VGEL 2ZUXA 2Y36H 1NFIB 1I9IH 1WIUA 1CICD 1I9JH 4Y4KC 3L9RB 4ZPVB 2ITDA 1IBGH 5IWLC 1U8LB 4DGYL 3U7YL 3GSRB 3ULUD 3L95B 3HLAA 2EIEA 4CNIA 2A0LD 2X7LA 5IW1B 4MJID 4HKZA 4G8EA 3KXFD 5L6YL 3ECBA 5E70A 4HS8L 4YBHA 3QNXB 4DVBA 1VACA 2Z31D 4X6DB 4NQDE 3DRQB 4QRPB 5FCUL 5GZOC 2OTWA 5AYQA 3Q1SL 4QTIH 2PO6C 2OLDA 3HUJA 3PABA 4L4TB 1FNFA 5DUPH 5I71C 3O8XA 4CL7A 4KK8D 4CMHB 4ZUSB 4YHPA 4MQ7B 3O4LB 3HS0A 4YHIB 4WTWA 2X4TB 1PKQE 2VDML 2YPLD 5F8RC 5BXFA 2OS7A 3TO4B 3FO1A 4P9HH 1ZTXL 4M61B 4ZSOA 2X44D 4X7CC 5M94B 2XT1B 4OJFL 1GC1L 4NNYA 3VFGH 4JKKA 1HQ4B 5E1HB 4OCMC 4PJXA 4E41D 3FO9B 5L88L 1I9EA 2EYRA 3RIFK 1HHJB 4BUGA 1M7DB 3Q6FA 3GMLB 4I48B 3SDAD 1HDMB 3RVWC 3KPRE 2C26A 3I3DA 5C0GA 4TOYH 5GJTH 4GRLC 4YHYC 4Z7WE 4YHLL 4PJCB 3DSNA 4B0MM 1F00I 1W8OA 3NZ8B 2WBJA 3GJEB 1EXUB 2VDRL 4IHOB 3UTTE 1AQKL 4MXWL 4F7PB 5HHPB 4K3JH 4XC3L 5I16B 3IDUA 2BC4B 1BZ9B 2VKXA 3MLYL 4Y19A 3WFDH 1HHKB 2VR9A 2PKDA 3S7GA 5IEKA 4YHNA 1U36A 1U42A 3G04B 4FQ2L 2V5YA 1NSNH 3RTQA 4LPYA 1DDHB 3RVVD 2YSSB 2E27L 2H3NB 5D7IB 4L8CB 5CS7A 2IGFH 2IQ9L 5EZJA 3HI5L 1V3MA 2HVJA 3HG1A 3K74B 1XCQA 3D39A 1U91B 5C0EA 5IVXF 3MV9E 1MCQA 4MNQD 4X6CB 2P7TB 4ELKA 1JYXA 1WC7A 3VH8A 1JHTB 2A1WL 2CQVA 1A3RL 4NO3B 4X99A 4PRBB 2JK5B 3HI6H 3KDMB 4JPVL 4H88L 1BBDL 5HGDA 2DQIH 1KELH 1Z9LA 4X4XB 4YHOL 5D2LF 4KTDH 4KKAD 1K4DA 3TZVB 1YYML 3FFCA 1XGQB 4NUGL 1DLHB 4DW2H 5GRJL 5HYQA 4NBZB 3OHXA 1NCAL 2LABA 1VGEH 4TVPL 1MFCL 3TNMA 1UCTA 1T80A 4Z5RB 1DUZB 1C5BL 1CGUA 2PTTB 3U0WL 3ARWA 5FOBA 3DARA 2E7MA 1BJ8A 1ETZA 3BJ91 4XGZB 2WLYA 1U2CA 5FK9A 4DGYH 3U7YH 2FD6H 2EECA 2J8UF 1OAUH 3LKNA 4NQXA 4L4VB 1T2XA 1XIWA 2EDJA 2BNRE 3BN3B 1HEZA 3VFSA 3BN9D 5DJ2B 4Q0XL 5DRZA 5L6YH 4ZO9A 4HS8H 1W0VB 2E6QA 2FLBT 2DS4A 2X70B 4PV8A 5CD5D 5IMMB 5FCUH 4CU6A 4G43A 3Q1SH 3DLQR 1PBYA 5HJ3B 4U05A 1G7MA 4DGIL 1RK1A 1MNUL 1J5OL 5I1EH 5CJQL 4WHYH 2PXYA 1PJ9A 4YDKH 2HRPL 1CVRA 4AM0B 1F2XK 1MRCH 5C6WH 4IOSD 3CNKA 3KLAA 2X89A 1TETL 3E6FB 3SCMD 1FL5B 1AP2A 4FFZL 4ONFH 3BWAA 1EEUA 4CJ1A 4YDJA 5FGCB 3RWHA 4JO3L 1C1EL 4NO0D 5FGSA 1MHEA 3GHBL 5E6ID 3S34L 1GC1H 3DXAB 5D7LB 4HEME 3QUZD 3W11C 3GSNL 2FYYB 3EJZD 4NGHH 1ZK9A 3LPFA 4WI3A 3P11H 4C55A 4KZEL 3C60D 3LIZL 1I1AB 3B2VL 3BRGC 1FO0H 1JNHB 4PD4K 4QY8A 2NY2C 1MH5B 4XNQB 3E3QC 1YNTA 1YY8A 4YHLH 2CK0L 3OKEB 5F21B 5F8QC 1WWAX 3PV6A 2CGRH 3B9KC 3BPCB 3BUYA 1C5DA 1AKJB 2VDRH 1SY6L 4A6YB 4AMKL 4E42B 1EVTC 5BV7C 4X6EB 5DEFA 1PKOA 4MXWH 4ZUUB 2I24N 4EXPX 4XC3H 5EFIB 3MLYH 5FA3B 1Q72H 4CW1A 2CDGA 4Q74A 3SDCA 2XXMB 4PJFB 5C0AD 4HJGA 4FQ2H 5A3ID 5JQHC 3QUXA 1AR1C 5J9PA 3P77A 5HPMA 5E9DA 4EDXA 2FHBA 2IQ9H 4K7PX 4ZDHA 3B3IB 5BS0B 5MENE 4ZS7L 2ERJC 3VD7A 4B50A 4NQSB 2BCKB 2GYSA 1XR8B 4LCYA 1P84K 3VGEA 3ME0A 2BOBA 4GLRH 3G08A 4B41A 4UUJA 3QCUH 3ZTJG 4H88H 1MRFL 3KPRD 1BBDH 4JR9L 5HI5D 1I75A 1FRGL 4PR5B 2QSQA 2VXQL 1FNHA 1U6AH 1YYMH 1CXLA 5GRJH 4L29B 1JBJA 3TJHC 5SWZE 1I4FA 4Q6YA 4TVPH 3WN5C 1MFCH 4R8WL 3V79C 3A67L 3DJ9A 3UTTD 1FNGB 3AY4A 2GY7B 1NFIA 4MNGB 1LQVA 2H9GB 3RZCD 3L9RA 3TN0D 3KPLB 5FO9B 2VSCA 2ZCKL 3NFNB 4DN4L 1U93B 4WCYL 2IPKA 3O6LL 3GSRA 2NY1D 3L95A 4Q0XH 4IRJC 4OKVB 5IW1A 3PQYB 3G5XB 1S8DB 5GS3A 2F8XC 2EXYD 3ARBD 1GH7A 3QNXA 4ZUWA 4X6DA 3ZSSA 3DRQA 4QRPA 4WEUD 1HYSD 1MNUH 5EORH 1J5OH 4YK4C 2R69L 3I50H 4QHKI 3BKJL 4KJPD 5HVHC 4L4TA 5CJQH 3QPXL 5L0QC 3ESVF 3B6SB 4I0PD 4ZUSA 4I5BA 5C71A 5IJKC 3O4LA 3DI2B 4YHIA 1BEYL 4JO3H 4NC0B 5DA0B 1C1EH 3QFJE 3TO4A 3RWJB 4QRRE 1QSFE 1NCNA 4KVNL 3O9WA 5FYKL 5EN2B 1EO5A 2P5EE 5CEZD 4M61A 1KG0B 3GSNH 3MQIA 3RKDD 4P2OC 4U1KA 4KDTC 5AG9A 1HQ4A 5GS2D 4OCSL 3LIZH 3FO9A 3KPMB 2ADJB 2K7QA 4BYHA 2AVGA 5IQ7L 1HHJA 3CVHB 1KIQA 1M7DA 3GMLA 4Y4HD 4ONOA 4UINH 3ILQC 2QL1A 3W0WB 3F7RA 5JORA 3PHOB 5KOVC 1DLFL 3ZDXE 4MJ4A 1SY6H 2F8VA 1T89A 4MQXD 2FO1A 4O2CA 1PDKA 2FSEB 4AMKH 1KPUB 2F54B 3GJEA 1NANI 1J1OL 1EXUA 3MC0A 1UZ6E 2QLVB 4IHOA 4JPWL 1ZAGA 5I1HH 4OZIB 3ILPB 1RUKH 4F7PA 5HHPA 2I07B 1HE7A 2ED8A 3QXDA 5I16A 4GQ9L 3MNVA 1HHKA 2XQBH 1ZLUH 1UXSA 3T0XA 3RVUC 3WO4B 2PUQT 5D2NE 4NIKB 4RFNC 2FEDC 1IM9B 3G04A 3JXAA 2WWKO 3BAEL 3Q3GA 2A38A 5JIIA 1U58B 4M7JH 4PJHA 4NKIL 1MJJA 3DYPA 5D7IA 5J6HB 4L8CA 4ZS7H 4PJ9D 5F97E 3ZE0E 2MWCA 5CMAB 1M7IB 1D5ZA 2CUMA 1R3LB 3QR2A 4PJIB 2OTPA 3AAZA 2P7TA 5IFAL 5BOZG 4ODVL 2YXFA 1JHTA 4JHAH 2NW3A 1HXYB 1ZSDB 5DURB 1REIA 1IGMH 2YRPA 4HJ0D 1FYHB 5D93C 2JK5A 3KDMA 1TQCB 1FRGH 3MFFA 2VXQH 1G1CA 2DDQL 3U36B 1HH9B 3TBSB 3TV3L 4JDVB 5GRVL 2FRGP 2E9WA 4I3RL 4R8WH 3A67H 1DLHA 1T04A 3GMMA 3O3BB 4W68A 1XGRB 2VDKH 1T1XB 2YD6A 3P40A 4Z5RA 1DUZA 4LCIH 5CP7A 4PRPB 2NY0D 4J3SA 3KPNA 2IPTH 5C08D 2B5IB 5LQBL 5IMLB 1NGXB 4R97C 1B90A 3OPZH 4XGZA 4DN4H 5KSVA 3O6LH 2ZUYA 4L4VA 3NBNA 4Y5VA 3BW9B 4J4PC 5DJ2A 4CVUA 1L7TH 4RAVA 1RQ5A 2X70A 5IMMA 4JO4L 4LVOC 2J8OA 5DK3A 3H9SA 4XH2B 2W59A 4UV7H 1IZKA 2VDPH 3IS1X 3JBG7 3QPXH 4ZSOE 3V95A 3VFRA 4YUEL 5KOMC 2B4CL 2P49B 4CGTA 4EKXA 2OI9C 3GMOB 3L6FB 4AM0A 1HCFX 2QHRL 1IEHA 1BEYH 4RFEB 5ITFA 1A5FH 1J8HB 3E6FA 4RA3A 1FL5A 5F3HA 4I77L 5LGKA 5FYKH 1Y6MR 4YBQC 4YFLI 1E6OL 2ATKA 4ELMF 4WI7A 3WIHL 4EQ2A 3RPIB 3P0GB 4UIKH 4J6RL 1CXEA 1D3CA 2VLRB 2FYYA 5H94B 1CCZA 4OCSH 5DHYB 3ROOA 3WIFA 1JFMA 2DL2A 3FN3A 4P2RD 3EFFB 5IQ7H 1JGVH 3T2QA 3V52L 5LG1A 3VWKD 1CDBA 4NN5C 4TNVF 1I1AA 2E7BA 3O3UN 1JNHA 4OCWL 4Y19E 1FL6B 3TBWA 2IMNA 4XNQA 4ZUVB 1TTUA 4ZXBB 4PRHD 1DLFH 2AS5M 5FA4B 1P4LA 3MRQA 3LN5B 1X5KA 2H45A 1ZT1B 4YH6A 3SJVE 1J1OH 5IB4B 1AKJA 1X5FA 4A6YA 1JVKA 4JPWH 4MD0B 5GGRB 4GRMB 4E42A 4HLZG 1ZV5A 4X6EA 3EHBD 4OIBA 3QUMH 4Y89A 5EFIA 4GQ9H 4PGJA 3HG1E 2MKWA 1G9EA 4U1IA 1CU4L 2MNUA 1OWWA 1ZVSA 1X5LA 4GKZA 4PJFA 3BAEH 5I1JL 1BFTA 5TFSL 3GRWL 5F9JB 4JFHD 1T0NA 3BT2L 1MCJA 1XF1A 4LDLB 1EHLL 3RJQB 3LZFL 3B3IA 5BS0A 1KF9B 2IH3B 2VZ1A 3QSKB 2P5ED 3LAFA 4APQC 4D9LL 4NQSA 5IFAH 2BCKA 3FFCE 4XP4H 1SBSL 4ODVH 1BP3B 1LE9B 1ZLVH 3L1OL 3H0TA 5I75C 3VH8G 4IIQC 4EXKA 1QRND 4LSPL 2DDQH 4ZFZB 1WFOA 4PR5A 4C58B 1BIIA 2IPUK 3SGEI 2IADB 3AS3A 1GPOL 4U1JB 5B8CC 2OJZL 3KLDA 7CGTA 4LIQH 5CKAA 1FNGA 5IB1B 5DXWA 3BO8B 4PLKC 3HPJB 5C86A 4MNGA 1C5CL 5LQBH 2P24B 1HQRB 1FE8L 3I2CL 2H9GA 3QDHA 4RMVA 1EZVX 1LMKA 4XP9L 2MHAA 5ALBL 5FO9A 2YEZB 4PLOB 3TCLB 4F33B 5IB3B 3HCVA 2P5WD 2R2BB 1KLGA 4YFLF 3NFNA 1U93A 3PHQB 5I8KH 4JFEB 4GW5B 2R0ZL 4OKVA 2E5EA 3G5XA 3MO1B 3GKWL 4JO4H 3OKLB 4UTAL 1E0OB 5ACZB 4DTGL 2QADD 2D0FA 5IBUG 4MHHI 1T4KB 1Z9OA 5E00A 2VDLL 5T5NG 3HNTL 4YUEH 5EBMB 5I17B 1UEYA 2B4CH 4KRPD 4D8PB 3BKML 3NFPB 3BZ4B 1UJ3B 2QHRH 3B6SA 5KSBF 4D94A 4QOKB 4KTYA 1Q9WB 3FL7A 3GSXB 4I77H 1VKXB 1BF8A 1CXKA 2CSPA 1NBZB 3SE4C 1U8MB 3RWJA 3MJ9L 1KGCE 2G5BB 5EN2A 2VOTA 3LEYL 2NYYD 4QHMB 4J6RH 1KG0A 2EDHA 2KDGA 4KK5D 4YXLL 3EDEA 4N0YL 4NKDB 1EEYB 3V52H 2BOCB 4K9EL 3TF7C 1MUJB 3KPMA 2ADJA 4LOUD 4U6HB 4P57A 1DBAL 4TN9A 3O8XD 1HNFA 2Z92B 3W0WA 5FKAB 4HV8B 4D3CL 1LVEA 3IRPX 2XQYG 5D2LB 1XMWA 5I73C 4F7TA 3PDGA 4OLZL 2FSEA 5IFHL 3IDGA 5E9DE 1KPUA 2F54A 5SWSE 5DJZB 3KPQB 1EPFA 5FB8B 1AD0A 1MHCB 5FYLD 4ZFFB 5I18L 3QI9C 1CU4H 3CSPA 1R3IL 2F5BL 3ARDB 2GK0A 3U79A 2MCG1 5I1JH 3B5GA 5TFSH 2DKUA 1YUHB 1EA9C 2P8PB 3T09A 4XT1C 3BT2H 1DBJL 1FZKA 3BP6B 2J8UB 1WIOA 1XF4B 3LZFH 5D71L 1FYTD 1YMHB 4ZQKB 4P4RB 5J11C 3D18B 4P4KD 4Y4FB 1SBSH 2ARJB 4PGBB 1ZHLB 3AXLB 3D69B 5E1AB 3RNQB 3BDBA 3L1OH 4HUNB 3CK0H 2JIXD 4LIQE 1A6AB 3S88L 1IGCL 1SJHB 1FORL 3GMQB 3ALPA 5GRXG 4U6YB 1HH9A 1FGNL 4S1DD 3TBSA 4JVPA 3GM8A 4JDVA 3RTQD 2OJZH 2H2PD 5F7EL 5DD6B 4MCYB 1TVBB 3U0TA 5EU5A 1XGRA 3FQTB 4M1GH 3HG1D 1FE8H 2ADIB 3I2CH 2XQYK 5MERA 1BQLL 3DURA 1WBZA 3D39D 4D9RE 4XP9H 4X6DE 5ALBH 3RUGA 3MYZA 4QRPE 4MWFB 5IMLA 1NGXA 3MGOB 1L7IH 3FOMA 4L4TE 2DQEL 1EV2E 1RZ7H 5IW3A 3VXUD 4XPAL 2R0ZH 3UEZA 1QZ1A 1T3FB 1KSRA 3BW9A 3JWDH 1ZGLP 5SX4H 4UTAH 4EN3C 3CFBA 3O4LE 4DTGH 3K46A 3V0AC 1EHNA 4I0KA 2Q3ZA 4HBCL 3RWFB 3HNTH 4XH2A 4F80A 3MXWL 1UZ8B 3BKMH 2NY6C 4XXCA 3CAFA 3QHFL 1TNNA 4OIAA 5LGJB 4FFWD 4MA7H 4HC1L 4POZD 5A2FA 3GMOA 3GIZH 3WKNA 5E08L 2DM4A 3CXHK 4JG0L 4G6FB 4AG4H 4RFEA 3MRMB 1X5HA 2CLVB 4HS3B 1A9BB 1J8HA 4M9OA 1F3DJ 4NFCA 5T1KB 3MJ9H 5I1KH 3UTQB 3LEYH 1UC6A 2NY3C 3C6LB 3RPIA 2Z8WC 2C1OA 4NN7C 2E6PA 4PJCE 5L2JA 4JREC 3VD4A 5H94A 2JCCB 1F6AB 5GGTL 1X7QA 1C8PA 5F9DC 2HFFA 2EDOA 1F6LL 4WWKB 1NAKH 3AUVA 4HIXL 1VSCA 1UKQA 5KVFH 2FX9L 1OSZB 2DYPB 4ZUVA 4IS6B 3WFEL 4ZXBA 3QEGL 4Y5YB 1AGCA 4U3HA 2RGSA 4OLZH 5FA4A 1UWEH 4PDCE 3KYMB 3U7WH 2AQ3A 5F1NA 5FDYA 4GRWH 3I6KB 5IB4A 5D9SB 4MD0A 5GGRA 3T0DA 5I18H 4GRMA 4KK9C 3CFKB 1R3IH 5D7IE 5CZVH 1F3DH 5HHMB 3Q5YA 5T1MB 3BEWB 4KY1H 4TSAL 4JZJC 5F6IC 2A74B 2VDQH 3VWJD 1R5VA 3C5ZC 4X6CE 4P46C 3DWTA 1DR9A 5JHDD 5D71H 1J05A 2E9BA 2IJ0C 1KJVA 4HUVB 1P7KB 4HJJH 4MAYC 5T3ZH 2W9DH 3PUCA 3MLRL 4IBLT 1TJIH 4RMSA 4WGWB 3MYJA 4XPBH 2R0WL 2YD1A 5DUML 1LE9A 3S88H 4RGMB 1I3RA 1MY5A 4GG6F 3QISA 3LSOA 3FZUD 4UV4H 5F7HA 1VENA 3OKYA 3SDCD 2LQRA 1V7NL 4ZPTB 1FGNH 3V9FA 3QUXD 2G75B 5F7EH 4ODWA 3TA3C 2IADA 2K3TA 2DICA 1ZS8A 4L4VE 2IAMB 4O5LL 1T22B 4PP2B 2XKUA 1R3HB 3LH2L 4POUB 5MEQB 4M1CD 2BSRB 1BQLH 3BHBA 1TCRA 4XP1L 5JUEL 3HPJA 1QBLL 1IAKB 4FFEX 2P24A 2VITB 1DUYB 4FZEL 3OAYH 5CEZL 5IMOB 4L3CA 5C0NC 3ULSB 2DQEH 4F33A 4Z6AT 3TCLA 2YEZA 4ODUB 4XPAH 5D1XD 4X4YB 1UT9A 3AREC 3PHQA 5EU7E 3QQ9C 1L9NA 2YKLL 4XNMA 2XKNB 2W0LA 4BKLB 3OKLA 3P2TA 3RWCB 4BQBA 4Y4KB 5ACZA 2ZP0T 5FGCE 3MXWH 1T4KA 4Z78B 4NKQB 2DLEA 5EBMA 3QNYA 3DXAE 5I17A 5D7LE 1AH1A 4HC1H 1FJ1B 2O26U 3NFPA 3BZ4A 1UJ3A 3MFGB 1W8NA 4JG0H 3D85B 1T66C 3FAWA 3OXSB 5CEXB 1Q9WA 1V7ML 2C3WA 4HMDA 2E3VA 1OTTD 3PWPB 1RIUL 1YEHH 1KC5H 3LMJL 2PO6B 1IAIM 4Z7NE 2HJLA 1U8MA 1F3RB 3VXRB 2DIJA 1X6LA 2I9LB 2G5BA 5I71B 4DZBB 2MQCA 4QHMA 1AIFB 2DQDL 1PFCA 4D9QD 3STBA 1NLBL 4OQTL 1FAIH 1YPZB 1EEYA 2ZUQC 3MGTB 4L1DA 3GJFB 4CN4A 1MUJA 4U6HA 1RHHB 1EFXB 3RY4A 3CVHH 4HIXH 4BSWA 4L4TD 2FX9H 3WFEH 5BOPA 1N26A 3QEGH 3BQUC 4G8GB 4Q6IC 4DZ8B 4PJFE 1S7WB 3IJYB 2E7LC 4WIQA 1WVZA 2IANB 1PW3A 4N5ED 2UZXB 1U8JB 3Q5TA 2HT3D 4ONHB 5T3ZE 3KPQA 5FB8A 5BS0E 1MHCA 4ZFFA 3O9WD 4TSAH 4HSQA 3B9EA 3ARDA 3VI3F 4GRLB 4YHYB 5DJAB 3CLFL 5IR1B 1YUHA 2P8PA 1U3HA 2Y4SA 5JIHA 4UBDD 2AABL 5D5MF 1XF4A 1FV1B 4ODSL 4TUOA 5D1QA 1QBAA 3MLRH 1AXSA 1ZGLM 3QIBC 4LKCA 4P4RA 4PP1D 1CDUA 5DJ6B 3D18A 4Y4FA 5DUMH 2ARJA 1GXEA 2AV1B 3AXLA 4PGBA 5E1AA 4YXKL 5JXED 3RGVA 3Q48A 3G6JA 1A6AA 2H41A 3BD5A 3GMQA 2ZKHH 1TFHA 4QXTB 1V7NH 4MNGE 3SPVA 5IHZB 1PY4A 4U6YA 4MMXC 5A2KH 4UAOC 1A6UL 5HY9A 3ZYJA 2VLKB 4Z7UF 2C7UA 3L5JA 2M26A 3VFUB 3LH2H 3VXSA 3HFML 3IKCA 1TCMA 4ELMB 1AJ7L 2CLRB 2Y72A 1TVBA 2EKSB 2AJXL 3PQYE 4XP1H 3C8KB 1DQQB 3FQTA 3CXDH 1NCBL 2ADIA 2AJZB 3N1QC 1G7QB 5CEZH 4ALAL 1QSEA 5D7KE 3VDCA 5E7FA 3F8UB 2X4SA 1GZPB 3O6FC 3SGKC 2GTZB 5L2KB 5TDNB 3L3DB 5T3XL 4G5ZL 4EZMA 3PHSA 4BFIB 2OYPA 2XN9A 2YKLH 4DUWA 4KI1A 1M1SA 2X9XA 3NACL 5EU4A 3WFBL 1MLBA 4JFQB 3GB7B 5H35B 3V5HB 5A40E 2EIZB 2BY1A 5MHSE 5ADPL 3AS2A 4HUWA 1AGBA 1R6VA 1MCHA 3IDMB 3PWUB 4H20L 2QQKH 4RZCB 2UWEF 3NIDE 5FYJU 4DUXA 5CJ5A 4YQXH 1J0ZA 3ARFA 3MRMA 3LMJH 2CLVA 3QUYC 4YR6B 5T1KA 5ITBL 3PWLA 3ZT6A 3VFMB 3UTQA 1RZ8B 2EC9U 4FABL 3W0WE 5JPMB 2DQDH 4XNUL 1HKFA 1OHQA 1P7QA 2YPVL 1AI1L 1OTSC 2HT2C 3C6LA 3KPSD 5CJOH 4Q58C 1EEZB 1QFOA 4YIQA 4JDZB 2JCCA 1B0RB 2F54E 3E2HC 2AJUH 4HFUH 2D0GA 5TH2B 3H9SD 2FJGB 1D6VL 2ZCHH 4OZIE 5ADOL 4Y88A 4S1QH 1B6UA 1KPVB 3GMRB 1WWBX 1DEDA 2EDXA 4Y5YA 1MHHB 4R4FH 5J0BA 4WY7L 5L8JB 1ZGLA 3I6KA 4YHML 4QWWC 4HGKC 4FG6C 4U33A 2UUDK 3Q5OA 3B2UD 1DBBL 5HHMA 2NY2B 1CDHA 2H32H 5DGQA 5IM7A 1HINL 1RUAL 1A47A 3OSKA 5I1IL 3O2DL 3O6KL 3B9KB 4PJIE 1E4WH 3UTSB 1H3TA 3ZE1F 4ODSH 1IAII 5BV7B 3UO1L 2IFFH 3I9GL 3SGJA 5I1AB 1IGYB 5TE7H 3QCVL 1I1AD 4HUVA 1P7KA 4FQLL 2JKXA 1R24A 3KHOA 3CCHB 3RHWF 2C1PB 4YXKH 3SHSA 1DN2A 5DA4A 5F9OH 3BRDA 5CIPB 2OR8A 1QKZL 1AKJD 4NRZB 3CSYB 3CVIL 5JW3L 4P2QB 1XGYL 3QG6B 4U1HB 3H9HB 4PY8I 1TDQA 3LDBC 2WP3O 4WTXA 1BOGB 4FFVD 5KSBB 4M6NL 5E5RB 1NGWA 4PRPE 5EC1B 1A6UH 2W91A 1I1RA 2ERJB 2GQHA 3X12B 5HHQB 1HHHB 4AL8L 2YC1B 2B1AH 2Y06L 3MJ7A 5DVLA 3SDDC 4YWGL 4PLNC 2B0SL 5I1GH 5I2IB 4PP2A 1RZGB 3VRJA 1R3HA 4N0CD 1NCBH 1QFHA 2BSRA 1NUFA 1CXHA 4PY7B 1AXTH 2G2RB 1P2CB 4RRPA 1IAKA 2YN5A 2VITA 1Q0YL 5IMOA 3MRBB 5B22A 5SV4A 5T3XH 4G5ZH 1BWMA 3P4NA 1LEIA 3WN5B 4GT7A 3NACH 1JZ4A 4H0HB 2ICES 2JJWA 1JRHI 5JA9A 5JOEA 1JGLL 1F3JA 1JZ5A 2UZIH 2XKNA 4OZFB 4BKLA 4F37F 3RWCA 4AK1A 2QR0B 1J8HE 4Y4KA 5ADPH 4U31A 5DFVD 4ZUTB 4PGEA 3N1PC 4A2LA 3U6RB 1RVFH 3MV7B 5GGSY 5KW9L 3V2AR 3HPLB 1WBXA 1F42A 1KJ2B 1QPXA 1A4KA 4IRJB 1C7SA 1IGFH 2J88L 1NCDL 4OV5A 2LVCA 2VLRE 3OXRB 1L6ZA 5FYLL 3T3PF 4Y8DC 3WCYA 1G9NH 4XP5H 4TUKL 5ITBH 1KCSL 3PWPA 2ID5A 4FABH 2IEPA 4AJ0A 2PO6A 4YK4B 2NPLX 4HAFA 5HVHB 4XNUH 3VXRA 4G6AC 1QNZH 4DZBA 2YMXH 5L0QB 5DFWH 4HIIB 2AJVL 4IM8A 2DAVA 1DSFH 4Z7QE 3VU2A 1YPZA 4MYWB 4R2GC 5C7XH 4JGJA 3DV6B 3GJFA 3FRPA 3P0YL 5IVZA 5ADOH 5BQ7B 1OT1A 3QWRD 1EFXA 1ACYH 1U8QB 2XICA 1RJLA 3SO5A 5F71A 4G8GA 4P2OB 1QFPA 1S7WA 4WY7H 1JI2A 3K8LA 3CX5J 4WRLA 5KAQF 2IANA 4MDJB 5FO7B 2V2WB 4YHMH 6FABH 5E8NB 5MP6H 1U8JA 4WFFD 4ONHA 1ACZA 3LKPB 1HINH 4TRPL 1OGAB 1RUAH 1UACL 2BXZA 5I1IH 3MGAA 3IFOB 1S9WB 3S5LB 5AD0B 4QRQB 1IM3A 3K1KC 4DCQA 5IR1A 1UB5B 2WIMA 3QCVH 5F6HI 1FV1A 1U95A 3P73A 1GC1C 3U9UB 1NBYB 1RJYA 5DJ6A 4NQCD 1F2QA 3WNPA 3RZWA 4RFNB 4P3DB 3CVIH 5JW3H 2DQGH 1XGYH 4RGND 1KTLB 4KXZH 5IVNA 1I8KB 2HTLD 4M6OL 5TQ0H 4M6NH 1CT8B 1IZJA 4QXTA 2Y6SD 5IHZA 3E6HB 4Q2ZB 4AL8H 1SBBA 5F1SA 2Y06H 5JIPA 1MEXH 3IAPA 4LKXB 4ZFOL 4UIMB 4YWGH 3VGBA 1A3QA 2B0SH 3ARYA 3VFUA 3PDOB 5KVMC 3AFLA 3HE7A 5SV3A 4IMKC 3T0AA 5J3HD 3WJJA 4JFEE 2CLRA 2DL9A 5D93B 5MI0C 2EDYA 2XWJA 3O6ML 2PR4H 1Q0YH 2X4RA 3JTSB 1Z0MA 5D7JD 3T2NL 3RIAK 4PRIB 3RL1B 2I9TB 3EO1B 4OIIH 3UAJD 3NCYP 5CJXC 1UA6L 1GZPA 2HA1A 4FS0A 5L2KA 1QFWI 5TDNA 5DT1L 5CBAB 1BFVL 1NCUA 4XVUC 4IRSC 3PP4L 3BEVB 4QOKE 3UBXI 4JFQA 4YAQB 3GB7A 5H35A 3BISA 3V5HA 5I8EA 5IUSA 2EIZA 2XACC 4R97B 5KW9H 5T1LD 3QA3B 1NFKA 1J0HA 3JV5A 1GCFA 4LCWD 3BPLC 4AEIL 1PX3A 4WUUB 1BM3L 4NQED 3S3SA 3PWUA 1QTYT 3VXMD 4RZCA 1LO3L 1V3JA 1P5VA 5IT2L 4TUKH 3IGAA 4ODTL 4AIZB 4LVOB 4XNXL 1ROWA 4YR6A 1J1PL 1BVLA 1RZ8A 5JPMA 1O5DT 2AJVH 3ZL4L 2AJSH 1VPOL 3MRJB 5C09B 4JJHA 2OI9B 3REVB 4KAQL 5D2LE 4GUPB 1EEZA 4RDQF 3WE6A 5F7UA 3P0YH 3MLZL 1B0RA 2NXZD 1KEML 2R56H 4LF3B 4M8VA 5F72S 3OKMB 5L7XH 5B3JF 4M7KL 4GG6B 1QSZA 5J1AB 4KQ4H 4PBVC 4ZOBA 2W0FB 2VZOA 4BFEA 5BVPL 3Q6GL 1KPVA 4P5TC 3DV4B 4HBQA 3GMRA 3LOWA 4Y2DC 3MUGB 2J8UE 2VL5A 3ZDYF 1WICA 4W81A 1QSVA 4R4BB 4ODHL 5ESQB 4J2XA 1UACH 4NN5B 3TFKC 1KTKE 3LPGA 5HHOB 1GOGA 3E3QA 5JOPD 2P8MB 1U8KB 4FNLL 2BK8A 1FSKC 3UTSA 1O7VA 4LGPB 3BPNC 5GZNC 3ZT7A 3MLVL 4MS8C 3QDMB 5I1AA 1IGYA 5HDOA 5TF0A 1YY9D 1JFQL 4WO4A 4E5XB 3CDGA 4ZNEE 1ONQB 5FECB 1F4HA 2ESVB 1YECL 3VDBA 5EB9A 3MROA 2Q86B 2D31B 1OARL 5LBSL 3W82A 3B8YA 4NRZA 3UDWC 4X9FA 4M6OH 5HYSB 3QG6A 4U1HA 3J7HA 3M45A 2YZ1A 1FFNB 1NC4A 1BOGA 3VRLF 4NC1C 4APQB 5EC1A 1GAFL 4FXLA 1Z9SA 2YD3A 5HDLA 1Z3GH 3FQWB 3X12A 5E03A 3ARVA 1SEQL 4OM0L 5I75B 5MEPB 1RZGA 1FBIL 3N1FC 4IIQB 4ODXA 1T83C 3O6MH 3UJIL 2AXJA 3OJDB 4PY7A 3T2NH 5F93C 2G2RA 1P2CA 1RSFA 2VLMD 1TTFA 3B5TA 3MRBA 3OGOE 5DT1H 2NR6C 4FQHB 3PP4H 5B8CB 3K4DA 3S6CA 3WN5A 2ZPKL 2A9NL 3F5WB 3ZE2F 4NT6B 3UPCA 3HHRB 4OZFA 1I1FB 2QR0A 4ZUTA 1H8NA 1L6XA 3CFJA 5F9WC 3MLWL 1PAMA 3MV7A 1ZHBB 2AEPL 2H8PB 1S78D 4TTDC 1KJ2A 1NFDA 1BFOB 1LO3H 4IRJA 5IT2H 4Z76A 2JCCE 4HKJB 1ADQA 4KKNA 3L3HB 4XHJD 4XNXH 1U41A 3CX5K 5D5MB 4YZFE 1PQZB 1IC4H 5IF0B 1G7PB 3KLHC 1MFDL 3U1SL 4M4PA 3NPZB 3DVNB 5AAMA 1GGYA 2X1QA 4HIIA 3HMXA 4I1NB 3SDXB 3ES6B 3MLZH 5EO1A 5IJKA 2HYMA 1TJHL 4ZAKA 4OGXL 3DV6A 4LQFL 5BQ7A 5HHME 3REWB 3HRZB 3HN3A 4HUMB 1U8QA 4KUCD 1JV5A 4L3AA 4X5WB 4P2OA 4Z7UB 1KB9K 2PYEA 2MSPA 1KJ3H 4PBXA 2V2WA 4J1UB 5E8NA 1K5NB 4QHUA 2LAAA 4DVRL 3QWQB 3IFLL 1KCGC 3QIUD 3LKPA 4K71C 4NZUH 4GKNA 1RURH 3LY6A 3S5LA 5CZXD 4URTB 5DD3L 1A22B 1OAZL 2DTML 5I73B 3I02A 3QXUA 3T0EC 1UB5A 4RWYL 5SX5H 1GIGH 1JFQH 3QI9B 1EAPB 3O11B 2V9TA 2R2EB 3O0RH 4OT1H 4Y1AB 2PW2B 1YECH 5EUOF 4AYFA 1RJZB 4UU9A 1J7VR 1OARH 2XNAB 4G9FA 4R4ND 2IH1B 4P3DA 3QO0B 5EIQA 3BZFB 1ZLSL 1KTLA 3ULVE 2P48B 4LHQB 1I8KA 1YNLL 4OCNC 1K4CA 5C07D 4M93C 1CT8A 1CGVA 2HTKC 4WV1C 5DC0A 2DQCL 3E6HA 2HLAB 5J11B 4OI7A 2ZNXA 1Q9KB 1NANH 4KMTH 1R3KB 1U3HD 4PS4L 1SEQH 4UIMA 1H3VA 3MNWB 1FBIH 3UJIH 4HIEB 1H0DA 3DETC 5D1QD 4S0UC 1UB6B 3V7MA 4A2MA 5FM5M 3UYPA 3TIEB 3JTSA 4RRPG 4X7TA 3RL1A 2I9TA 1CDGA 4AEFA 3EO1A 3QWOA 4KPHL 1HHGB 2WUBL 2R9HD 3RGVD 1WAAA 4Q9RL 1WEJL 1A2YB 5CBAA 3BKCL 2ZCLL 3HZKA 3O2VL 4WFGE 3H7BB 4I3SL 3L5XH 1LO2L 3CU7A 4YAQA 3MLWH 1BOYA 2WNGA 3PWPE 3LKOB 4U2YA 2AEPH 1BREA 3QA3A 1F58L 3VXRE 3VXSD 3IDXL 1OB1A 3LCYA 4ZTPL 4N8VA 5B4MC 5GRYA 4EN3B 4OM1L 1QSED 2YHGA 1YPZE 5D72H 1Y0LB 2FECL 1MFDH 4AIZA 3U1SH 4OUUB 4YHKL 3MZGB 1JGDB 2BY0A 5ILTL 2B2XL 3MRLB 2EDQA 3U4AA 2LVEA 2NY6B 3HC3L 1OAQL 2XN9D 2V7NB 4G8GE 5EA0H 3DOSA 3GBNL 3EYVB 1RZFL 3N1MC 5C09A 3REVA 2OI9A 2IANE 1TJHH 5E94B 1A21A 4KQ3H 1X44A 2CK2A 1Y18B 4OGXH 2H2SC 4LF3A 4LQFH 1VEPA 4YNYB 5F7KC 3WDIA 4KTEH 4OZ4A 3SOBL 3FRPG 1N6UA 5J1AA 3NABL 1WT5C 3VA2C 2W0FA 3KJ6L 1H3XA 3D25B 2NY3B 1G0XA 3G6AB 2QQLL 4NN7B 3GSUB 4JREB 3S37X 1UH4A 1CD0A 5FUZL 4C56D 3ARFD 2BY2A 4XAKD 2PYFB 1JHKL 3IFLH 3P0VH 2IBZX 2HRLA 1WFUA 3WJLC 5ESQA 3ZYIA 2C3VB 2B4CC 3HMWL 1P7QD 5HHOA 3WO3B 2DKSA 4FTVB 4QLRA 2DTMH 2BNQB 1K8DB 1WCBB 4X6BB 1U2HA 3S98A 4OZHF 2JJTC 3QDMA 1I7RB 5BV7H 5DMGD 5I30H 3V6BR 2YRZA 4I9WD 1YNKL 3PP3K 4FA8A 5GS0C 2BJML 1CGXA 3QEQB 3A6CH 4JZJB 5F6IB 3UYOD 3BE1L 4BSJA 2DJSA 5GISL 2VLKE 1FIGH 5FECA 3C5ZB 4K3HA 2ESVA 4P46B 2YRLA 2D31A 5CIPH 4HF5H 2Q8BL 3E8UL 4ELME 3QHTC 4G8IB 1PG7H 4MA8H 2AK4B 5HYSA 5KSUB 5TGBA 2APBA 2HH0L 4MAYB 4JHZA 4XB7A 3FO2B 3VMNA 2VNCA 4APQA 3BP5B 1R0AL 4PS4H 5DR5L 1A6TB 1F13A 3GI8H 3OX8A 5L2KE 3ZKMD 3GJFK 4R90L 4RQQB 5MEPA 3OKNB 3H3BC 4S0SD 4JN1L 5I8OH 4I8DA 4Z95L 4QGTA 2WUBH 4Q9RH 3D2UA 3ARTA 1WEJH 1CICC 4JDTL 4LLMA 3TA3B 1HWHB 5J56B 2P8LA 1LK2A 3O3DB 3BKCH 4RMRA 4PJAF 5I66B 4FQHA 5B8CA 1IILE 4LSRL 2BSED 1DQMH 3ULUC 3F5WA 4LVHC 4NT6A 2ZG3A 3AU1A 1I1FA 2EH8L 3QEHB 1F58H 4X5XB 3IDXH 1ZHBA 5I19H 1UM6H 1UXWB 3IS0X 1FGVH 4ZTPH 1OD7A 1YMMA 3AREB 5AZEL 1F4XL 2NY7L 2A6KA 3R4DA 1BFOA 5DFTA 3G6DL 1IAOB 1QRKA 2Z8RA 1RIHL 4HKJA 4B53A 1MCFA 3SGEH 4YHKH 3OGCB 2B2XH 5D5MA 1PQZA 5K9KB 5F96L 5IF0A 1G7PA 3BKYH 4LLYB 4JAMB 4N9GB 5ESVB 1BAFH 3HC3H 3MV8B 1ZHKB 5ID0B 3GBNH 1WIPA 1RZFH 5E2JA 4GAGL 3WUZA 3DVNA 2BVUA 5FYKU 5CEYB 5DMIH 3SDXA 3ES6A 3GSWB 2OL3L 2VIRB 2WWMD 4QTHB 3GMNB 4MLSA 5F7DB 3FB8B 4NBXB 2VXSH 5CP3A 5JW5A 4O51A 3HRZA 3E3QE 1DN0B 2QQLH 3SE3C 4O02L 3SDAC 4U1SB 4LSSL 5BRZD 4X5WA 3LVEA 4WHCA 5JLZB 3UTSE 3W5NA 1MI5B 3TP4A 1XR9B 2ZUQB 4J1UA 4MZ2A 1T0MA 1A9EB 1K5NA 2CJUL 3VXRD 4KMLB 3ZTNL 3BQUB 2GITA 4M5YL 4WFEE 3VG0L 4Q6IB 5IVOA 1Q1JH 2AXFA 2OK0L 1VB9A 1CF8L 4BM7A 4P2QE 1V05A 3A0OA 4B5EA 4MAUL 4H25B 1AO7B 3HZMB 1EUTA 1YNKH 1EFXD 4U6TA 4WEMB 4XCFL 2BJMH 3RVVC 5KSBE 1EAPA 3BH8A 2J12B 4PJBF 5GISH 1RUPL 4Y1AA 2PW2A 3BVNA 3OL2A 1RJZA 3R0NA 4K9EC 3V4PL 2XNAA 4QF1B 4QRSA 2Q8BH 1IE5A 3QO0A 3NAAL 1LO0L 1YEJL 2HH0H 1JWMA 5B39B 3I3BA 5KVEH 2V7HB 2VDOH 5KZCB 3MRGB 4JM4H 2AP2A 3QIBB 1R0AH 5EBGA 2HLAA 2ZUTA 1JK8B 3BFOA 5J6GB 1Q9KA 4R90H 3KVQA 1R3KA 2BNUB 3MNWA 1MCWM 2YD9A 4KKAC 2VZ3A 3M8OL 4OTXL 5L8LB 3LKRB 1UB6A 5F1IB 4JN1H 4Y7MA 4JGMA 2AW2A 1Q0XH 4QHNB 3TIEA 4V3EB 4UAOB 3MV7E 1AY1H 1QBBA 1FIEA 4BZ2L 1HHGA 1KXVC 4LSRH 1A2YA 1UQSA 4Y8AA 1BVZA 3OAZH 2DBLL 3IF1B 1ZA6A 3BN9C 2EH8H 5T33L 4M3KB 1EDQA 4OZFG 1CBVH 4OFPA 3OR6B 5CD5C 3LKOA 5KS9F 5C0BD 1CIDA 2X9YA 4KJWD 3O6FB 3K1DA 1FZMA 1F4XH 3HE7D 2DN7A 3V4UH 3NA9H 3HKFA 1E6JL 1WBYB 4NO2B 2AEQL 3QULB 1OM3L 3SBWC 2ZUVA 4HFWA 5GXBB 1RIHH 3KR3L 4FQIL 1P4BL 2CRZA 3QQNA 3QDJB 5F96H 4AH2B 2KL6A 2EC9T 4OD1L 4OUUA 5DHXB 1HKLL 2FJHA 5CUSL 4L3ED 3SCMC 3CC5A 1H5BC 4GAGH 1BBJA 4WEBL 3STZB 2KKQA 1S7SB 2V7NA 3I6LE 3PXJA 1HZHL 3LKQB 2OL3H 4HPYL 5E6IC 4QHLB 1EGJL 5E94A 4ZNCD 4P2CG 1U3JA 3QUZC 4YGVB 3QFDB 4NDMB 5IG7B 2WBWB 3QUYB 4YNYA 2GI7A 5GJSH 2J7LA 5D70H 1OGAE 4O02H 3C60C 3D25A 4LSSH 1MIML 4J7RA 5CJBA 4HKBB 4HD9A 3G6AA 4JFDB 1EHAA 4MHHG 4DKFH 3E2HB 1A0QL 4R9HA 5DVKA 2CJUH 3VFOB 2PYFA 3HZVB 4BZ1H 3QEUA 5IW6B 3ZTNH 1E4XI 1LEGB 1HN1A 4LEOA 4X9HA 4X8XA 4OGZA 3WS6A 4FTVA 5KJRL 3AGVA 4HQQL 4UNVA 3HE6D 2BNQA 3S5LG 5CD3B 4Z7VA 3F6LA 2ATPA 1WCBA 1XZ0A 4X6BA 4JZNA 5J13C 5A3IC 4XCFH 3BP4B 1GOHA 1K9TA 1NKOA 5DK2B 4N1HB 5GIRA 1M05A 1NCWL 4LFHG 5HI4D 2NX5B 3QEQA 1I3GH 4KMQA 3WNKA 2DQUH 4M7LT 1UENA 1WISA 2CMRH 3V4PH 2G9HA 1W72B 4AEEA 4OF3A 3C5ZA 3NAAH 1YEJH 2BVTA 4P46A 4XBPB 1MHPL 4G8IA 4U4BA 3FB7A 5KSUA 1B0GB 3PGFL 5CSZB 1ZE3C 1MRDL 3RPKA 3VXTA 2VH5H 3U2SA 3FO2A 2V17L 3VGHA 3H2WA 4N0RA 3K0WA 1CFQB 4PRIE 3TIDB 5I1DB 3BP5A 1X4XA 5HI5C 3TYFA 3QHZL 1ULVA 5IMKB 4KUZH 4F9PA 2DQFB 5GHWH 5E2WL 1KN4L 5BVJB 4C57C 3LDBB 4WO4D 1MCPH 4KROD 4PIRF 4NRXB 4NRYB 4Y16A 2EKJA 4L8SB 2FBOJ 4BZ2H 5IB2B 3SDDB 3RZCC 1AR1D 4KKCD 2IWGA 4TSCL 3SEPA 4WUKH 4WUUE 3TN0C 3O3DA 4NKMA 5I66A 1NMBL 4G7YL 1NC4D 3Q2CA 1WSST 1N5AB 1F4YL 4U1LB 3PWJA 3NIFF 3BZEA 1M6OA 1HSBA 1T2JA 4XAWH 2EXYC 3ARBC 3QEHA 2J3SA 1T5XB 1E6JH 4P59H 1K2DA 1UXWA 3QJHA 1OM3H 3HNVL 1HYSC 4L9LC 5C09E 3KGRA 4FQIH 4KJPC 1P4BH 3NIGF 4N8VG 2HLFD 1IAOA 4OCRH 1IT9H 2X4UB 4OD1H 3VCLA 1FDLH 4I0PC 3DX9B 3F12A 5CUSH 3OGCA 3O41B 4GG6E 3EJYD 5K9KA 2Q76B 3QH3B 4GKSB 4LLYA 4PRAA 4JAMA 4N9GA 4WEBH 3AC0A 3UZEA 1ZHKA 1T1YB 4OI8A 1NDGA 3EYFB 1FFPB 4HPYH 4PFEA 3TYGH 1I7ZB 4N90E 4X80H 2DI7A 5CEYA 2FNBA 1Q9LB 5DD0L 5H37H 1T21B 3RKDC 2VIRA 5IQ9B 3GMNA 3FB8A 4HWBA 3ARQA 4TUJB 1MIMH 5HHOE 3GMPB 2ICWA 4Y4HC 1QYGL 4GBXD 5JZ7D 4MA3A 1HSAB 5C0CB 5JLZA 4WNQB 1SYVB 4F3FA 3RI5F 4MQTB 1R5IA 4R2GB 3QDME 1TVHB 4PJEA 1JZ8A 2FATL 4MQXC 1A9EA 5INCA 5E2UL 5IKCB 1K8IB 1ZLWK 1N4XH 3OAZK 3OKOA 4HQQH 1GSMA 3BQUA 1LD9B 3JWOL 4FQJH 1M71B 4Q6IA 3ULUF 2ESVE 5LWYL 2PNDA 4ZAKD 3OR7B 1BGXL 1UCBL 1RK0B 4BFGA 1EERB 3HZMA 1NCWH 1NKRA 4WW1B 2VN7A 2BHZA 3KNBB 3RJDA 5DMKB 3CX2A 2ZG1A 4YFEA 4PJ9C 4XNYL 4GAYA 1UH3A 3MPCA 5GS1B 2PYED 2JF1A 3VFTA 1DZBA 2GJZB 1D7FA 1MHPH 1X6NA 4HIJB 3RFZC 5E8PA 2CLZB 4NQDA 3IXAB 4KHTL 2V7HA 5HYSG 4GAFB 1MRDH 1MIEL 4NZTH 2DM7A 3ILQD 2V17H 3MRGA 5BMFL 4HJ0C 4BUHA 3QHZH 4K8RD 4RAHA 3WKMH 1JK8A 2QQNH 1DQJB 3AB0C 2IC2A 1J10A 2BSTB 1J0JA 3FMGL 3L5HA 2OTUA 5K9OA 5E2WH 2BNUA 1PG7X 1GHFL 5DZOA 3DVFA 2FDBP 1WUNT 3KPTA 2XKSA 3O81A 4F8QA 5EC2B 4LFHD 3LKRA 1TZGL 3BYYA 4OFVA 3JZ7A 4WGVB 5EBWB 1FVDB 4G9FD 2NY0C 1IAIL 3I3EA 1F4AA 1I8IB 1NMBH 4PTUB 5CINL 5CZKA 3VI3E 4G7YH 2P42B 1FVEA 4HWNA 1F4YH 1FNSH 5MI0B 1NQBA 4PYGA 2A9ML 2ZOKB 1EBAA 5JNYB 3IF1A 4BQ8A 2KUTA 3H6JA 4EI5D 1P9MA 5D5ME 1MCIA 1U8HB 5GGQL 3OR6A 4BQ9A 1NH6A 1H3PL 2CUIA 1L4IA 3LKSB 1N6QL 2GJ6D 4HHAA 3OZ9L 1A7QH 4XBEL 5DJ8B 3HR5B 1WBYA 4IRSB 3QULA 3TBTA 3DMMD 4X98A 3SDXE 1NMCC 2CKBL 5DZLA 3EZJB 4XPHL 4F57H 4CU7A 5DI8A 2OBGA 3ZHKA 4HG4K 1C12A 5ALCH 1MWAL 4RIRB 4QKXB 2F9BT 3MV01 3QQ3B 3BPLB 3WUWB 4NOBA 3F7PC 4ERSH 4LHUD 1C08B 3STZA 1S7SA 3N85L 2R29H 5DD0H 5D8JL 4Z7UE 3CUPA 4QCIB 4QHLA 5D1ZC 5HVGB 5JW4Q 4YGVA 4JCMA 5IG7A 3QUYA 3WHXB 2NXYD 4DFIA 1A1MA 4EDWL 4KKLD 3U4EA 5IHUL 1QYGH 1FN4B 1SVCP 3SKNA 1EEQA 1NPUA 3QYCA 1IKNC 3B43A 3FAXA 4X7SH 1QUNA 3E2HA 4S1RH 3R8QA 5M7QA 2WQ8A 2EH7L 4C83A 3VGFA 3HZVA 3QUKB 4Y1AE 1YEEL 1LEGA 1MF2L 4J3VA 4P5TB 3EHBC 4QNPF 5LWYH 3NCYS 4RWHA 4XPGL 1G9ML 4JY5L 4XP6L 4Y2DB 4QXUH 5HXMA 3VGDA 2RIKA 4DN3H 4PJAB 2OSLB 4XMLH 1OAXH 3VW3L 3BP4A 2XV6B 1FVCA 5DK2A 5I15L 2AI0L 3DGCR 3V6OC 1QVOB 3RIFF 2NX5A 4JANA 4PJDF 5C0DB 1XEDA 1H3GA 4N90D 3DUHA 4RAUB 4IMLA 1FSKB 5IGXL 1VFMA 2FWOA 3BPNB 3RY5A 3SO3C 3FB6B 32C2B 3C8DA 1CGSL 1B0GA 4Z0XB 1HHIB 4M00A 5EWIH 5BMFH 5CSZA 3PG2A 5E95B 4DAGH 3SKUD 5FHBH 4FMFA 1CFQA 5I1DA 3FMGH 4XWGH 4PY8J 3IRZA 2FGWH 5IMKA 4MXQA 5F44A 12E8L 4GG8B 3S36H 3T1FB 4O2EA 2DQFA 1TZGH 3FOLB 5BVJA 5DMYA 4WVRA 3BDYH 3EYOB 1GGBL 2EDBA 4OLVL 1KEGH 1IAIH 1IRAY 3RP1A 4L8SA 4PUBH 3SDDA 3I6GB 4GS7C 4BFBD 5BZDB 4XWOD 3PWNB 2RR3A 4IOIB 2N7BA 3C5SB 3N1GC 4FP8L 4U1LA 1QR1A 4LU5H 3ZE1E 5F3BB 2PCPB 1DQDL 2VISB 1CFVH 2FO4B 1N6QH 1T5XA 2QADC 3X3FL 1KXTB 1SEBB 4LMQI 3RBSA 2CKBH 4KRPC 5GGVL 4JRXB 4D0BB 3GM0A 1MWAH 2O5YH 3D2UD 5F9WB 3DX9A 3IJSB 5A16B 2Q7YB 3HR6A 3L3IB 4GKSA 1NL0H 2VLJD 5D8JH 1T1YA 1KT2B 4MVBD 3EYFA 1FFPA 1I7ZA 4LSTH 5BCAA 1MJ7L 1A6WL 3MRPA 5CWSA 5MENA 4HZLB 2NYYC 1Q9LA 1CN4A 2NY5L 2DRUA 1T21A 2LE9A 2JJVA 4PGCB 2ZZUT 3W5MA 4AQOA 4HWBH 4EDWH 2XOTA 4KJYA 5IHUH 3C9NA 1YMMD 1JRHH 1MJUH 2DOCA 4LOUC 2NTFB 3FKUS 1JYVA 3GMPA 4FTVE 3MLXL 2ITCB 4JJ5B 2BNQE 5JDSB 1ZA3B 1U8NB 1HSAA 3ZO0A 1VERA 5C0CA 5KSAC 3DO7B 4AY0A 1SYVA 4MSWB 1MQ8A 4HULB 1ZEAL 1S7XB 4U3CA 3G9VA 3KYKL 3HRPA 3UTPE 5IKCA 5GGSB 1K8IA 1T5WB 1P1ZB 5SWZA 3QEQE 5I1LB 4JY5H 3MOAH 5DYOB 4OBRA 1UYWH 4NNPH 4F8TA 3VA6A 1QEWB 5BO1L 1JPFB 2YBRA 2O5XL 3V5DB 3L7FA 5CAYB 5I8CB 3FT3A 2AK4E 4LL9A 3VD9A 1RK0A 2AI0H 4PV9A 4K55A 3SE9L 3CPLB 4ETQB 3HC0A 3H7LA 1AGFB 4NP4L 1RUQL 4K71B 1X5YA 8CGTA 5IGXH 5DMKA 2F19L 3ALWA 1JZ2A 4L5FH 1JNJA 5GS1A 2PTVA 3MOBL 1FL3B 5TDPB 4UTBH 2HKFL 3TJEL 4MA1C 2GJZA 4P4KC 3T0EB 3NCJL 4FQCL 4HIJA 4U6XB 4X4ME 2CLZA 1CGSH 4KI5D 5KVDL 1D5MA 3HZYB 5HGGS 1OGTA 4G6JL 4RBPH 5KANI 4FQQB 3RHWK 1A1NB 2EDNA 4WFHD 4YDLC 3L5WB 5FFLA 1H8OA 3UPAA 12E8H 1DQJA 3F7VA 3TH4T 5EUKB 5EU6B 1OAKL 3RWEB 1WZKA 4S1DC 4FXKB 4OF8A 4JZOB 3D6GA 1FO0A 2CDEB 3RTQC 2H2PC 3MA7B 5EC2A 1BQUA 1GGBH 4M93B 4WV1B 3O3EB 4K94L 2VC2L 1UM5H 5EBWA 4QT5A 3CFCL 4DUVA 1I8IA 1N8ZB 4PTUA 3RDTC 3PL6C 5FO8B 4IMKA 4P0DA 1BQSA 4QRUB 3NA4A 1G6RL 5DVNA 4U49A 2ZOKA 1DQDH 1HCVA 1VESA 2E8YA 3BPOC 4LAQL 2VQTA 3CDFA 1JF1B 4OZGF 4NO5A 2BVOB 2QBWA 2XG4A 1JGUL 4KVCH 3MV8E 3LKSA 2W1NA 5EOQL 3TPKA 5DJ8A 3HR5A 2K9UA 4IRSA 1G7JB 2H6PB 3QXAB 3BOVA 3MA9L 3MCG1 4HCRL 4M6ML 4RFOL 2Y7QA 4D0DB 2HN7A 1T7ZA 2J6EH 4FFWC 5DEZA 3T08A 4POZC 4YO0B 4LASL 2EYSA 3TBVB 2AERT 3B8SA 2FB4L 1KPRA 3QQ3A 3E0GA 3WUWA 4LARL 4OBSA 3NN8B 1C08A 3ZLQC 4MJ2A 4OLXH 2NY5H 2DD8H 1MI5E 2HMID 2BY3A 1VCAA 4QCIA 2NMSA 2VAJA 1CTNA 4GMSL 5HD8D 5IROC 1JPTH 4YDIH 4I4WB 4O58L 2B8OT 5GSVB 3MLXH 1FN4A 2LU3A 5K59F 1UWXH 2E7LE 1B2WL 2LU4A 2NZIA 1ZEAH 4DK6A 3KYNB 4JLRA 4UQ2A 1AO7E 3O45B 3ZKND 3IB4A 2WAHA 4JG1H 3MBEA 2EDRA 1FCCA 3QUKA 5EIIB 1L0XA 4WI8A 4NWTL 5BO1H 4WW2A 3GBML 1LO5B 2O5XH 1VHPA 3VWJC 1SMOA 3U0PB 3T65B 3BX7C 3SE9H 1YQVL 2OSLA 2I25N 2D7TL 1YN7B 2OQJA 4D2NA 4KKBC 4NP4H 4AT6A 2W65B 1DE4A 5C0IB 4HZAA 2A77L 4OFIA 1S7RB 1I8LC 3IVKB 1QVOA 2F19H 3EKCA 4U1MB 4NQVA 3MOBH 4JQXC 5C0DA 3M1BB 4RAUA 1W72H 1IC5L 1A3LL 1GL4B 3EW3B 3HC4L 4FQCH 3DX7B 1CGWA 2L4OA 5KVDH 5CGYD 4MS8A 1FG9C 1OPGL 5EO0B 1NUGA 2AQ2A 4G6JH 4NCDA 1HHIA 1JPSH 4PJGF 3UZQA 3IU3B 1UVQB 3GSNA 3FZUC 1NAML 5DSCB 5C0FB 2BNQD 4Z18A 4S10A 5B3JE 2Y9RT 1GOFA 3SDCC 1AHWA 4JFFB 3ZSTA 4XMPH 5FYJD 2BVPB 4KXZI 4K94H 3FOLA 4EUPH 4RNRB 4M1CC 4U0QB 3ZDYE 3V0VB 1MELA 1SY6A 1S9VB 2EC8A 4HH9B 3OJ2C 5FEBA 3SN6N 1ZXQA 3TBYA 3PWNA 5D1XC 5DJ0A 5JO5A 5A1AA 3TLRA 5T5FH 5EBLA 5HYJB 1QO3B 1I9RL 3U46A 4YC2C 3QDJE 2KZ1B 2PCPA 3R06B 1JGUH 4XZUB 3ARZA 3VFNA 2FO4A 3WD5H 1CICB 4HWUA 3TT1L 5EOQH 2YA0A 5DS8B 2CDFB 3SJVA 3TWCL 1QQDA 2CRYA 5JOFB 5DD1L 3MA9H 4RFOH 4HCRH 2SEBB 5ISZD 3IDNA 1TIUA 1BD2D 1F97A 2R1XB 2LU7A 1ZWIB 5GQBA 4MJIB 1IGTB 1L0YA 4S0TD 1MCKA 4Y16D 2D9QB 3KXFB 5E56A 2Q7YA 1DVFC 3HMXL 2FB4H 4K3DH 4P3CL 1M4KA 3O3AB 4BSVB 4MD5B 3S8WA 25C8H 2XI9A 3L3IA 4YLQT 1OTTC 3VRLE 1KLUA 4G6KH 4RBPK 4I2XB 1I3UA 1LP9F 4JFDE 3K2UH 4RISL 1S7VA 1SM3L 5C8JB 2D7NA 4GMSH 4PPTA 3IETB 4V1DD 2MTPA 4JY4B 1D5XA 1W2KT 1XGTA 4LLUB 4NUJB 4OGAC 3THMH 3F7YA 2RFXB 1IJ9A 2O5ZL 2C5DC 3FB5B 3ZDXF 3BXNB 1OLZA 4F7MB 1JYWA 3EOYG 5JDSA 1ZA3A 1U8NA 4OFDA 3DO7A 1MSPA 2JB6B 2P46B 4K7FB 1PD6A 1ZVYA 3DUUB 1A4JB 3FN0L 2EE9A 4K8RL 4YGAB 4E41B 3QRFM 4P2YA 2X40A 4N5EC 4NWTH 2HT3C 2NX5E 4K2UL 1P1ZA 3OAUL 3SDAB 5I1LA 3O9WC 4HK0A 2KZWA 5FKPB 3S35L 5FM8A 1QEWA 3C6SB 3QZWB 4L8DA 4XHQA 2R1YB 3DUSA 4R0LC 1YQVH 1XAUA 2QSTA 5I74C 5I8CA 3ZE0F 3PXHA 5FHAL 1Z2KA 1A7NL 5B38B 2Y07L 2R15A 4UBDC 1MOEA 2YD2A 3CPLA 5K93A 3LPWA 1AGFA 1OP5H 5ECJE 1IC5H 1A3LH 3HC4H 4RA0C 4XCCL 2BRRL 3MRHB 1FL3A 5TDPA 2VDMH 4LBEB 1OPGH 3QDGB 1A1OB 4U6XA 2AV7B 1TTGA 2FJFA 5ABDE 5T1DL 5JXEC 2QJDA 1CG9B 1ZTXH 3HZYA 2JE8A 1NAMH 3BQUD 4FQQA 4TPRL 4OJFH 3FQNB 1A1NA 2UYLB 1MFEL 3L5WA 3LQZB 1IFHL 1RUML 5L88H 5EUKA 5EU6A 3RWEA 4MNQB 4FXKA 3VFPA 4JZOA 2AK1L 4HWZA 5EOTA 5E6YA 1EO8L 5H2BB 5I76B 1UWXK 5BJTB 3HUJF 4IDJL 4XBGB 3O3EA 1N5YL 3T8XB 2GAZB 3M17A 4GRWB 2A73A 4J8RB 1AQKH 1VGKB 1G0DA 4NQDD 3QUMA 4QRUA 3NVQA 2Z35B 4R26L 2ARJQ 4V3DB 3TT1H 1JF1A 1BQHA 1KENL 3TWCH 5EU3B 5DD1H 1RPQA 2HFGL 2E27H 1Z6JT 4PJXF 5SWSA 5HGBA 2PW1A 4WU7B 4NKOB 3HI5H 2H6PA 3QXAA 4I18C 3TPUB 4F7CA 4D0DA 4MJ6A 1PX4A 4P3CH 3VI4E 4ESKA 4YO0A 4X9BA 2EYTB 3TBVA 3ALXA 3FO0L 2A1WH 5DJXB 1A3RH 1CDYA 2FGZA 1ZHNA 1T6VN 4RISH 1D5IL 2OJEB 2NY4D 3GDBA 3NN8A 4JPVH 5C0CE 2I27N 3WNOA 5E2TL 1SM3H 4Y5VC 3FHAA 2EEDA 4YHOH 4LCUB 1RZJL 4KC3B 1NEZB 4NUGH 2O5ZH 4X0KB 4P23C 4I4WA 4JM2A 3SCMB 1H5BB 1NCAH 5GSVA 3BDXA 2COQA 2EDEA 1C5BH 3U0WH 5E6IB 1OP9A 1I85C 1RULL 3PE9A 3QUZB 3FN0H 5FXCH 4TYUA 4ZPVA 4B7IA 1U8LA 2VRAA 4Q9CA 3OAUH 1WT5A 3U4BL 1QOKA 5EIIA 2HJKB 3C60B 2V2XB 1TZIB 2X4NB 2HT4D 3S35H 3B2UC 5EOCL 1HXMB 4FQ1L 4QRTB 1IGIL 4LLDB 3IJHB 5LXGL 1S3KL 3QUYD 4AENB 3T65A 3MV9D 2Y07H 4DGIH 2HG5B 1NBVL 1YN7A 1R5WB 2NLJB 1NGQL 5C0IA 4DEPC 2LV4A 3IVKA 2HRPH 3X17A 4WHYG 4XCCH 5JW4M 1TETH 1CK0L 1AC6A 1WF5A 3QPQD 4MQ7A 3VD5A 4FFZH 4PREB 5C0AB 5J13B 4HGWB 2X4TA 1D6EB 2EEAA 2JJTA 1YZZA 5EO0A 1QBML 4PG2A 4PBWD 4HUXB 3GHBH 4TPRH 3S34H 1DP0A 2W60B 3UX9B 3IU3A 4M6AA 1UVQA 2EDKA 5C0FA 4NZDA 1IFHH 1RUMH 4JFFA 3ARRA 3SE8L 4KZEH 2GK2A 4Z8FL 3B2VH 4X8JB 4I48A 1HDMA 3BWUC 2CK0H 5GGUB 3EGSB 1N5YH 1VFUA 1B6DA 3FONB 4N0CC 2BNRD 1CFSB 4BH7B 1S9VA 3NFSL 1WWWX 4PJCA 5EZLB 7FABL 2FLRT 3NZ8A 2BVQB 2JJUA 1JPGB 5HYJA 2BC4A 2ED7A 1BZ9A 2WM0A 1YDPB 5KVGL 1KENH 2HP4A 3R06A 4XZUA 2EICA 5DEGB 4JQVA 4MXQD 2HFGH 3RZCB 4PRDB 1CICA 5DFVC 3TN0B 2CDFA 5IESL 1DDHA 5JOFA 2YSSA 4FXGB 1OP5K 2H3NA 3K80A 2SEBA 1IC1A 4MJIA 4W4OC 3ARBB 1U91A 3KXFA 5F7LB 1NJ9B 2EZ0D 3O3AA 4TVPE 4X6CA 4MD5A 5F89B 5EOCJ 1HILB 3AS0A 1CE6B 1KOAA 1MRFH 4L9LB 4NZRL 5E2TH 3WUWG 4I2XA 3TVMD 2MMXA 4NO3A 4JR9H 2PN5A 1RFDL 4PRBA 5E8DL 3IAQA 1H15B 4I0PB 4M62L 4JY4A 4X4XA 2IBZY 3P3YA 1HI6B 4G59A 1CDIA 4LLUA 4NUJA 3TZVA 4P5KB 1XGQA 4QXGL 3QXTA 3FB5A 1ZVHA 2G60L 4F7MA 4PJ7F 2QEJA 3UYRL 3N06B 4UT9L 5I9QC 1WTLA 2PTTA 3OBAA 1INEL 4K7FA 2ZCKH 4PJAE 3KHQA 4X9IA 3DUUA 1A4JA 2F74B 3U4BH 4WCYH 2GFBB 3NCBB 3HAEH 4Y4HB 5HHXL 3SDAA 1RIVL 3DVIA 1F45A 4CBPA 5MEND 4H26B 3OB0H 5D96C 1W0VA 3C6SA 1S3KH 5LXGH 3QZWA 1QFUL 1FFOB 3L3KB 3RVXD 2MJWA 1NBVH 1NGQH 2R69H 3BKJH 5HJ3A 3U82B 5B38A 2ORBL 4CJ0A 3KPOB 1J1XL 3KYOB 4OLWL 3T04D 1N6VA 4AIOA 3MRDB 2X4QB 3MRHA 4OZGB 2X1OA 4R2GD 2EIBA 3T0BA 1GRWA 3QDGA 1A1OA 3G5YB 1QBMH 5CSBA 3MJ9A 2AV7A 3X13B 2JJSC 4KVNH 4RGNC 3RL2B 1CG9A 5SWZD 4NC1E 1P7HL 1CZ8L 2HTLC 3DXAA 5D7LA 2UYLA 4PJ9B 5GS0L 2Y6SC 3P9MB 2XY1A 2A6DB 5CHNB 2FZ3B 2IPUG 5TJWK 4MNQA 1FFRA 2HJFB 1E4XL 5A2LH 5H2BA 2B1HL 2R4RL 3HA0A 5BJTA 1MH5A 1KFAL 3PWVB 3BZDA 3DHJA 3OKEA 4CN1A 3IDJB 5FCSH 2XWTB 1OTUD 3NFSH 3AB0B 7FABH 4OD3L 1SJXA 3BPCA 1IAMA 2GAZA 4YE4L 5D7JC 4OKDA 1H3UA 1AFVL 3UAJC 4J8RA 3CD4A 1VGKA 5FUCC 4ZUUA 4NJ9L 4WI5A 2G5RA 2H32B 4JRXE 4OLUL 1MPAL 2Z35A 3GFUA 3IDYC 5FA3A 3CFDB 2CIIB 4JFOB 2NY0B 3CDYA 1OAYL 4MXVF 5EU3A 5C08B 4RCAA 4NKIH 4Z77B 3QFJD 4WU7A 4QRRD 1RAMA 1QSFD 3P9LB 3TPUA 4EI6B 3VGGA 4P3WA 3ULUL 1D9KD 3WNMA 4WU5B 4WTZA 3CFEB 1XGUB 1XR8A 5K9QG 4NZRH 1BX2B 3VFWB 1F8TL 1RFDH 4HEPG 2B20A 3SKJL 2OJEA 4OD2B 6CGTA 1NMCB 4YX2L 3ET9F 5CJ8A 5C0JB 2Z8VC 4OF0A 4PRNB 4LCUA 3TV3H 1FLRL 4HX1B 3TCXA 1OW0A 1NEZA 2FECI 4I3RH 2NXZC 4L29A 3SCMA 2G60H 3QIWD 4HPOL 3T0VA 4PJGB 3VMPA 4XXCC 4OCXL 4UT9H 3JV4B 4PJHF 5E6IA 1INEH 5D1ZB 5D7IF 1IVLA 3RWGB 5FM5O 3QUZA 4HS6B 1YA5A 3KPLA 4HT1L 2EDWA 5AUMB 4P2RB 5FF6B 5HHXH 1OF2B 5KG9B 4JQIL 2HJKA 1DCLA 1TZIA 2X4NA 3BGMB 5FYJL 1DBKL 3PQYA 1S8DA 1QFUH 1ZLUK 2X4OB 1WJ3A 2K1MA 4PRHB 5C70A 3T0EE 4JO2L 4LPTA 5FYKE 4AENA 3AMLA 4ONGL 4EVNB 2ORBH 2DI8A 4O9HL 4UB0L 4PJ8D 1IEAB 5DVMA 1R5WA 5DD5L 1J1XH 3QDAA 4XCYB 5IHBA 1QR4A 4HC1A 5F7MC 2AXGB 4U3XA 1YY9C 2ZOLB 2ZJSL 1S7UB 4XVTL 3IXTB 3DPBA 2YA2A 5EU6E 2NW2B 1FFQA 1X5JA 5C0AA 5HDBF 2DJUA 1ITCA 4HGWA 1D6EA 3MBED 1CZ8H 1E6OH 2AJ3B 5FIEA 4HUXA 4I13B 3WIHH 1MCEA 1EX0A 5GS0H 1F4WL 4NM4L 3T4YB 5IVXB 1RU9L 3SO3B 4KDWA 1PLGL 1E4XH 3CVHA 1DEEB 4X8JA 4ZOCA 1LQSR 2R4RH 4OCWH 3UJTL 1LP9B 3IU4L 4UQ3B 4TNWF 5TE4L 1KFAH 4N9OB 3KWWB 5GGUA 4U6VL 3EGSA 3H9YA 4OD3H 1CFSA 3PHOA 4K7PL 5E99L 1QRNB 4HW6A 1AFVH 3AROA 3BRFA 3FT4B 4MCZB 5EZLA 1CL7L 2EXWD 4NJ9H 1NUNB 2VN4A 3ZHLA 4S1SL 4OZIA 3ILPA 1TVDA 2I07A 3UZVB 2F58L 2IBBA 2VAAB 4NSKB 2OR9L 3EYSL 4ORGB 2NNAB 4U7MA 1OAYH 2W92A 5DEGA 3GRWH 4GS7B 3RZCA 1IM9A 1BQHG 1LGVA 3TN0A 2APWA 1EHLH 1U58A 2P5WB 4FXGA 5C3TA 1S78C 5J6HA 1S7QB 4ZG1A 4D9LH 3ULUH 4JFZL 1VADB 5CMAA 3RRQA 1M7IA 1UJTA 5INDB 1R3LA 2QADB 4XHJC 4PJIA 1NJ9A 1MCCA 2WBJD 1F8TH 4IEFB 5F89A 4HWEL 1HILA 5GGVY 2FH6A 4L9LA 4YX2H 1HXYA 2P47B 1ZSDA 2QSVA 1VFOA 2XIDA 2XXCB 4LSPH 4KRPB 2F53B 4UT6L 4Y19D 3CGTA 4KK6D 1H15A 1MAKA 3U36A 4KFZC 1GPOH 1HI6A 3SJVD 4PJFF 4P5KA 3WFCL 4OCXH 2OX5A 3O3BA 4CNIB 3WLBB 1T1XA 1C5CH 2X7LB 4G8EB 3RX8A 1U8IB 43CAB 3ZKQD 4PRPA 1VFBB 4DVBB 1VACB 2F74A 2OTWB 3HUJB 1DBKH 1WZ1L 2I5YL 4LLAA 1A14L 4XMKL 3QIUC 4PTTB 3GKWH 5KSAB 4H26A 4JO2H 1PEWA 3EOBB 1RMFL 4ONGH 4O9HH 5CZXC 1CLOL 4UB0H 3L3KA 3KLHD 5DD5H 2VDLH 4LCCC 2EO9A 3FFCD 3NIGE 3LS4L 4MQSB 3KYOA 4XTRC 4XVTH 3AM8A 2DQTL 3L6FA 4JFFE 4J3TA 4LNRB 1NGPL 4JPKL 4F9LC 2NZ9D 2XTJC 3G5YA 4R4NC 3STLB 4PJXB 5CLWA 3X13A 1ZLVK 4P5MB 3NCEB 2EEBA 4LK4A 3Q6FB 3RVTD 1XIWD 1F4WH 4NM4H 1FYTB 2VE6B 3DX8B 4YXLH 4PJ9A 3P9MA 4N0YH 4E0RB 2VLRA 2XPGB 4K9EH 4NFDA 5DHYA 5GRVK 1PLGH 4MA1B 4P4KB 3R1GL 5CHNA 3P4MB 3EFFA 3UJTH 1U3HC 3IU4H 1UM4L 5TE4H 2UY6A