5J7MA

Crystal structure of cupin 2 conserved barrel domain protein from kribbella flavida dsm 17836
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
122
structure length
122
Chain Sequence
NAMRTFDLVTGESLFVNDLRVVRWEQYGLGTAMPFQAMWYSVPPGDESPIDQHPELELSIVVAGTAHVTVGDTVHEVPHGNAFLLNSLEAHVVQNRSADEVLTVFSAYWYPEAATAAAEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cupin 2 conserved barrel domain protein
publication title Crystal structure of Cupin 2 conserved barrel domain protein from Kribbella flavida DSM 17836
rcsb
source organism Kribbella flavida
molecule tags Unknown function
total genus 24
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5j7mA00
4ORFA 4I01A 5J3UA 4JV4A 1OI6A 2OZ6A 3ROUA 3PLQA 1J3PA 1CAUB 1CAXA 3JZVA 4IEOA 3PNAA 1UPIA 1U12A 2Z69A 5LRSA 1RTVA 1EPZA 3LA2A 3CJXA 3BU7A 1QY4A 1J3RA 1O5LA 1NXMA 4AQ6A 3D0JA 4Q0QA 3EO6A 4XETA 1CAUA 3H1YA 1CGPA 1UCXA 1NE4A 2K0GA 2VPVA 3D82A 2XLGA 4XF1A 1ZREA 3FWEA 1ZRFA 5FPZA 3H7JA 4PJYA 4MGZE 3FX3A 4R8HA 2C0ZA 3OCPA 3H8UA 5CADA 5I0SA 2ZCWA 2KXLA 2QNKA 1RL3A 4B29A 3HT2A 3I54A 1LRHA 1G6NA 4XF0A 2IXCA 3DN7A 2N7GA 1OD5A 3UKNA 4FAGA 4TLFA 4X6RB 3L2HA 3RYPA 4QGMA 3M3IA 2Q30A 4IETA 1I5ZA 3I7DA 4HN1A 4MH0E 3U10A 3PVBB 3CEWA 2GZWA 5I8SA 3E5UA 4P9GA 3FFQA 4WVZA 3WW1A 4MUVA 1YFWA 2O1QA 1ZZ6A 2IXLA 4XFIA 5D1IA 3FHIB 2D5FA 4A2UA 2OPKA 4I09A 2PAKA 4XFAA 5JR7B 2HJIA 4L11A 1RC6A 2QCSB 4LUMA 3RYRA 2XLAA 1GQHA 4NVPA 2CGPA 5I0RA 3DL3A 2Q0AA 5CVRA 1CX4A 4E2QA 1YFYA 2BNNA 5KBFA 2VECA 3H1MA 4JVAA 2CV6A 2IXKA 3MZHA 1UIKA 1OFNA 1ZRRA 1TQ5A 3NL1A 3ST7A 5K8SA 2B5HA 1X7NA 3LOIA 4AQ2A 4BIFA 1DZTA 1Y3TA 3NKTA 3BPZA 2O8QA 4GULA 2H0VA 1HW5A 4F8AA 4MV2A 5JSPA 3ZDSA 4Q29A 4HLTA 3RZZA 3ACLA 1FI2A 2QDRA 4YYOA 2XKPA 2CAUA 4YRDA 2GC1A 3KGLA 2Y0OA 1O5UA 1NE6A 3CO2A 3IWZA 2MHFA 1Y9QA 4E2SA 2EA7A 2XKOA 2WFPA 3O14A 1CAWB 1LKNA 4O9EA 4QXKA 4LA3A 5BPXA 2MNGA 3H50A 2DCTA 1L3JA 4K8FA 2B8MA 3FE5A 2EAAA 3KSCA 4HVQA 3GBFA 3GYDA 4KU8A 4IEZA 1CAWA 1Q43A 4XFHA 1YFXA 4QX5A 4LUKA 4YNIA 3DKWA 1DGRA 4MZUA 4HSLA 3SHRA 3C3VA 4UBHA 4I2OA 3IBMA 2D93A 4D7SA 3S7IA 4Z82A 1O4TA 1VR3A 3OD0A 4FT8A 1X82A 2QJVA 2QVSB 4HN0A 2CAVA 4DINB 3EBRA 3I59B 1SEFA 1O3TA 5I8TA 1NYWA 1WA4A 4EWAA 5JSRA 4BH9A 2BNMA 1UW8A 1UIJA 1XE7A 3LWCA 4IESA 4KWKA 1ZZ7A 3MYXA 3E5QA 3QOPA 5FQ0B 1V70A 3SMHA 2Q4SA 2UYBA 3G7DA 1PM7A 1VP6A 3S7EA 5BY5A 3CLPA 4EWEA 1J59A 3H7YA 4EROA 3KGZA 4MGIE 3USSA 4FBFA 4ONUA 3NJZA 2V09A 2PQQA 4WBBA 5F1RA 1LR5A 4Q0SA 4E2GA 5E1RA 1ZZ9A 3EQEA 5FLJA 3B02A 3E6CC 1O3RA 5KHIA 5CU1A 2HKXA 4XFCA 3ES4A 3U0ZA 3OGJA 4BYYA 4Q0PA 2GC0A 2XHKA 4XFBA 3QACA 4ZU4A 4AVAA 5LRRA 5JCTA 4META 2BGCA 3LA3A 3R6SA 4RD7A 4N9IA 1LB2A 1VJ2A 3H3UA 2PFWA 1CAVB 3IIAA 1I6XA 4UBGA 4OLLA 1YFUA 2GH2A 2UY8A 4HMZA 1ZRDA 3RNSA 1EY2A 3NW4A 1DZRA 1RUOA 4CYDA 4LULA 4F7ZA 1X8EA 3IDCB 4IEQA 3RPQA 3TNQA 4YARA 2XL7A 4OFGA 1EYBA 1QXJA 1WGPA 1CAVA 4XEZA 2PHDA 3NSTA 3IDBB 1RGSA 3H1WA 4MX3A 3OF1A 4HBNA 1O3QA 2BNOA 4Z07A 5FDBA 4KWLA 5E16A 4D7TA 5I91A 3N4MA 2XL9A 5KHJA 5BV6A 1NZCA 2I45A 3HQXA 1CAXB 2XLFA 5FLIA 2ET1A 3BCWA 1O3SA 3KMHA 3ES1A 2PAEA 2OYZA 4KWJA 4J1WA 2PYTA 4QM9A 5J48A 2ET7A 2GU9A 1FXZA 3SCGA 2ZKLA 2H6BA 4IEVA 3SCHA 5LEJA 4N9HA 4HSJA 3EJKA 4IEYA 4ZU5A 4PIZA 2E9QA 3ETQA 2Q1ZB 4XFGA 1OMIA 2D40A 3E97A 3H9AA 4IEXA 1ZZ8A 4PIYA 4PIXA 5FPXA 1JUHA 2XGXA 4HVOA 4X6QB 1GQGA 3BALA 4LA2A 1DGWA 4QM8A 5I0TA 1IPKA 3LA7A 1H1MA 1ZZBA 4KU7A 2P17A 2IC1A 2PA7A 2MPFA 1FT9A 3RYKA 4QGNA 4HZFA 3RDIA 3H3ZA 4WZCA 1ZNPA 4JTOA 5FCCA 3WW3A 2GAUA 2UYAA 3U11A 4ZU7A 5KHGA 2IXIA 2B9UA 1YUDA 1X8MA 4LEJA 2ETEA 3I59A 4L2NA 1YWKA 2BEOA 3SCFA 1Q3EA 2H6CA 4R52A 4AVBA 4I0BA 4AVCA 4MGKE 5EZWA 4YSFA 1J1LA 3OTFA 3CL1A 4XF9A 3E5XA 5I93A 1UD1A 5AVPA 5FQ0A 3CF6E 4IEUA 3BB6A 2FQPA 3MPBA 2FMYA 2EVXA 1YHFA 2Z2SB 4I02A 5T3NA 4QMAA 5LEKA 4EWDA 4O9GA 2BYVE 3VHRA 3HT1A 5I0UA 4EV0A 1YLLA 1EP0A 3E6DA 2OA2A 2PHLA 1ZZCA 4I3PA 2K9ZA 5KHKA 4MGYE 5FLHA 3FJSA 4LTAA 4QGLA 4I0AA 5I8YA 4IEPA 2WC2A 2GC2A 4XF3A 4XFFA 3HIFA 1Q5OA 1ZVFA 2D5HA 2IXJA 1ZRCA 1H1IA 3MDPA 1QXRA 3KCCA 1J3QA 1O7FA 1SFNA 4UXAA 3S0MA 1RUNA 2IXHA 5C6CA 3SXWA 1XE8A 1XRUA 3E6BA 5BXXA 3WW4A 4J1XA 2F4PA 3LAGA 4IERA 3UKTA 5C8WA 2OZJA 1ZX5A 4LLOA 4Q0VA 1IPJA 5JSOA 4Q0UA 5EFUA 1PMIA 4KL1A 3FZ3A 4IEWA 3WW2A 3EHKA 1SQ4A 3LZZA 4AXOA 3DV8A 3TNPB 2PTMA 4BHPA 1QWRA 3M70A 5JAXA 2GC3A 4FAHA 3ELNA 4H7LA 5J7MA 5KHHA 1WLTA 3UKVA 2ATFA 3D0SA 5BUVA 2VQAA 5HI0A 4JTNA 3NVCA 4XF4A 2PAMA 2UY9A 1J58A 4HVRA
chains in the Genus database with same CATH superfamily
1NAEA 1UY4A 1H2KA 4IGPA 4JAAA 4CCDA 5CFCB 1GQPA 2OZ6A 3M3OA 3PL0A 5A6YA 4NWWA 1LU1A 4WVVA 5GZGA 5JIUA 3JZVA 1LAJA 1UXXX 5JZGC 1JXNA 3VGIA 3VBUA 3ZFEB 1AYN3 1U12A 2Z69A 3LCPA 4RSUA 3OGSA 1S55A 2QTWB 4TZDA 2BQPA 4H3WA 2XJVA 2PHWA 3A0NA 4LBMA 1DGRN 4UF0A 5IFPA 2Y6FA 1JYIA 2VZQA 1RTVA 4N8MA 4IE7A 3LA2A 2BERA 5BNOB 1QY4A 3ZFGC 4AQ6A 4M01A 5BNNA 4DXTA 3O0VA 1EAH1 3MUZ1 2PHUA 2JICA 4OYUA 3O7OA 3OBAA 4QX7A 4CXWA 2YC4A 2WFF2 4EN7B 1B09A 4NPMA 1NE4A 2DVFA 5LW9A 3ZYGA 2D6PA 2JKBA 1JYTA 1OQDA 2XLGA 4Z2AA 2WO2A 5JOWA 4XF1A 3MFCA 3ZXDA 1ZREA 1ZBA2 1DU3D 4PJYA 1GNZA 2Y33A 2W68A 2FDHA 1XPWA 5KXEA 2CGOA 4BQ1A 3BI3A 3VBSB 1QHDA 2WA3A 5FY4A 2R30A 1V00A 3WCSA 5CADA 1RUC2 4P9LA 4PBOA 1LNSA 3M1HA 2GMEA 4AI1A 4EZ4A 1R092 3ZSLA 3LOBA 1MQTA 3EXUA 4Q4X2 3ZXFA 2GNMA 3AVRA 4OZXA 3I54A 3B7MA 3EMRA 5IVYA 3ZFFC 1Y9GA 4YW7A 2HEWF 3T2PA 2WN3A 5C4WB 2BV4A 5CB7A 1CESA 3ZSKA 1SLTA 1FAYA 1G9CA 3RYPA 2NN8A 4BMEA 3USUB 3VBOC 4TN7A 4ATEA 1VBE1 1OOPC 5C71A 2R7EB 2ES3A 2EIEA 5E89A 1TZOA 4ZONA 3VD7A 5JMCA 5I8SA 1QOTA 3ACFA 3KV4A 4NRPA 4W6YA 3N9MA 1HRV1 1R64A 4P9GA 4J25A 1CZSA 1HB1A 4GB32 1XU2A 4K3UA 2O8OA 1XNCA 3ABZA 5DZEA 5FYMA 4YM1A 1H0BA 2PAKA 4MOAA 3GZTB 4XHXA 5LCWL 2WT2A 3FBYA 5CKNA 3WDYA 2YU1A 4U2AA 4COVA 1FMD1 2JG9C 4LUMA 5FXXA 1PX4A 3WP5A 3WXPA 4AGGA 4CDXC 1GQHA 4EQVA 5FZ0A 4NVPA 5T52A 4GA9A 3VBHC 4CCJA 3I3MA 3DL3A 4AI2A 5T54A 1HN1A 3VV1A 3PUIA 2JG8B 4LNVA 1FPN3 3AC0A 2BNNA 1MVQA 1W90A 5KBFA 2XVLA 3H1MA 1QF3A 3BN6A 5E88A 1UIKA 5FTTC 2BGOA 1UWWA 3Q8EA 5APAA 1R082 2ADEA 1MEC3 5FZAA 2TUNA 2FDKA 1F8VA 4S2FA 3O1MA 3NMBA 1TME1 4G9SB 2B5HA 4C90A 4CU6A 1OBNA 2OQ6A 2VZUA 3LOIA 4HK9A 1LEDA 3FHAA 4CA9A 1DZTA 1W99A 2BRTA 4IV3A 5L9VA 4Y1VA 4A4AA 3LIHA 4GULA 4GWIA 2H0VA 3WF1A 3GZEA 1DYPA 4F8AA 3KF3A 4XJWA 4QQPA 3THDA 4YGDA 1FI2A 1NY72 3OBRA 2JDNA 2YY1A 1CZVA 1YXWA 2XKPA 4DEVA 4RYDA 2CAUA 3NV1A 3VUOA 5F39A 1Q8PA 2F6BA 2B45X 4LKDA 4AFBA 1AL0G 1NE6A 3I2IA 1W8WA 4PBPA 1K5MC 3HQRA 1BMV1 3WSOA 2AEZA 5GALA 4GIQA 2WFF3 4P9JA 1Y9QA 2MEV2 2EA7A 3D3AA 4E2SA 1BCXA 2HWD2 3F95A 3BIEA 1HB3A 3C7EA 3O0XA 3ZYPA 5FRAA 4QXKA 1C8M1 4LA3A 4JDMA 1HV0A 3RGBA 4HKLA 1WCDJ 2DUOA 1ZBA3 5D8AC 2PLV1 2X10A 4K8FA 1KGYA 2E7AA 3HNBM 1IS6A 2EAAA 3KCXA 1U5IA 4OI2A 1SDWA 3JBG2 1H2MA 1RUC3 5CFCA 5HXMA 1GANA 1UNBA 2K2SA 1V9U1 3P3NA 4CTEA 1R093 1PX3A 3NQHA 4BIOA 2W39A 1CQ9A 2VCCA 4CEWA 1Q43A 2VOXA 3ZFEA 4JGZC 1OQ1A 4XIOA 2I07B 2RS52 1A6CA 1J83A 3MF9A 4IQPA 5LBFA 1TMF1 5EV7A 4I2OA 4CRQA 4XJZA 5BNOA 2ZGRA 3WP4A 1O4TA 3WNXA 1D7PM 1XNTA 4GMP1 4RFRB 5CAZA 5DAWA 4QU2A 2SBAA 3CKHA 3AK0A 4FOQA 2JECA 4K9SA 4LO4B 3WCRA 4DUWA 5J37A 2QVSB 3ZVXA 2VZSA 4CDUC 1NLQA 4DINB 1KXGA 1L7RA 3EBRA 4Q4X1 4GB33 4JX0A 4EJRA 3PUQA 3W5NA 1BVVA 1H9WA 2WWSA 3APBA 3A22A 5HXVA 1SCSA 1WA4A 4RN5A 3TBDA 5JSRA 4FOYA 4DUVA 4COWA 2A71A 3LPFA 1UW8A 5IVFA 1H8TC 1ZZ7A 1ZA7A 3LQCA 3S57A 3VBSA 3E5QA 5FQ0B 3SMHA 1NT0A 1QJU2 2VZRA 1NCRB 3K4DA 4NHLA 2YC0A 4Q4W1 1PM7A 3WINE 1VP6A 1NA1B 1SLLA 2J1SA 5F2WA 4S2HA 5F5IA 4AK3A 4E9KA 4FTBA 4HPKA 3RWNA 3PUSA 1R1A1 2DVBA 4MSVA 2DVAA 3KGZA 5C4WA 4C8DA 2WSVA 4ONUA 2OQ7A 1YQ8A 4BISA 3ZSJA 4OHYA 1PIV2 5F1RA 2YBSA 4PHZA 3VDBA 4Q0SA 3V0BB 3FUOA 3USUA 3DYPA 4AVVA 3OGGA 3U07A 2WL1A 3AM2A 3HD8B 3N9NA 5DUWA 1Y4WA 1DDLA 1UZ0A 5F6KA 3IPVB 3E6CC 3FN9A 4PQQA 5E6HA 1O3RA 1R083 3U37A 4CU8A 1S0FA 2A6WA 2YDEA 4WM7A 1OA3A 3JCIA 1HDKA 2ZGMA 4YGCA 5LY2A 2NMOA 3U0ZA 3DXUA 3OGJA 4JQRA 4Q0PA 2GC0A 2R063 3O12A 3QACA 2ZZJA 1MS8A 2FDJA 4ZU4A 5JCTA 1VBA1 1AR92 2BGCA 3PVOA 1KEXA 2GP3A 4XJ9A 3WQ1A 3WY6A 4Y22B 5A3WA 3R0RA 1VJ2A 2QQJA 2RE9A 4DMIA 1IKPA 2GNDA 5LASA 1DHKB 4OI1A 2B4KA 5FZMA 4M3CF 4CEYB 1ZRDA 2UY8A 2BVBA 1PGW2 1QJX2 1J84A 4WM8B 5FP3A 2ZGQA 1GICA 5KWRA 3BOPA 2YUEA 4CYDA 3O1UA 1QJZA 1X8EA 3HPNA 4UFHA 1H4HA 3H0OA 2HWB2 1SFYA 3TNQA 4AEMA 5CNAA 4GKYA 5AC92 3OJBA 5F8PA 3VD5A 1EYBA 1WGPA 2ENRA 1ENXA 2MEV3 2RS12 1MS3A 3SKJE 1JTZX 1CAVA 2RV9A 1WMEA 1G9AA 2VGDA 3NSTA 1WBFA 3NNGA 5JDBA 4QPGC 4M3CB 4DY5A 1DP0A 4OHWA 4URAA 2YB7A 1JOPA 2OUJA 2DV9A 1IG3A 3OGRA 3X29B 3ZOIA 1RHI2 1XE0A 1W8ZA 5FDBA 4KWLA 3JBG3 4D7TA 2BW8A 3A0KA 3SH3A 3NAPB 3N4MA 4A41A 2W1QA 1OPMA 3LEMA 5CFDC 3RZLA 3PMEA 3N9PA 5KHJA 1GSLA 5A3UA 3V64A 3K51A 2HWD1 2XLFA 1YIPA 5L9BA 3ZN6B 3Q8AA 1BBT2 2JDYA 4QXHA 4BMBA 1W3XA 5J36A 2RS53 3AP9A 1RITA 4IV1C 4AYUA 1B35C 2A3YA 3ES1A 1W6OB 2OYZA 5JIAA 3N9OA 4E4SA 2PYTA 2JB4A 3JQXA 4QM9A 3T0DA 5IHRA 5F3GA 1OVPA 1W8HA 4BB3A 4I0WB 2GU9A 2D44A 3NJVA 2ZKLA 4IEVA 3SCHA 5LEJA 4N9HA 1RUH2 3C7FA 4HSJA 4N43B 5FBZA 4IEYA 3CJIB 1H6YA 4XQDA 5KC5A 3V65A 3LGRA 1YQ6A 5M0TA 2Z79A 3H9AA 2W46A 4IEXA 5F5CA 3WNPA 2WNVC 3PJYA 3QH6A 2WZEA 1AZDA 2ZOEB 4YVWC 3OYWB 5KXBA 4JRLA 4LBLA 4X6QB 1S0EA 1GQGA 2ORXA 3ZR6A 2DF7A 2VCAA 3M3EA 4LA2A 3HBZA 2Y0IA 4JCKA 2B46X 1IPKA 1CPNA 4YW4A 1HJGA 1UZZA 1W9WA 3NV2A 5K0UA 2YU2A 4GWJA 3PURA 2IC1A 2PA7A 4JGYC 4K1YA 3AJYA 3MHZA 1PIV3 3M8LA 4XE9A 2VL4A 4A44A 4QGNA 2E7TA 5GKAC 2OVUA 2JIJA 1W6NB 4K21A 4RS5B 4AFMA 1RUF1 4JTOA 3T4HB 1IGOA 2VO5A 5H9QA 2VE1A 1D0GA 4LOTA 3ZSEA 2UYAA 3SKVA 2JIGA 4DB5A 1QJU1 3I2HA 5FYUA 4ASKA 2A70A 4ZKTB 1UOJA 3H3LA 2YPJA 5AFEA 2IXIA 2VR4A 3RJRA 5BYNA 1X8MA 1AR93 2ZX0A 1YWKA 4GXLA 3INAA 3SCFA 5F3IA 2A7AA 4N53B 4DS0A 3WNLA 1UF2C 4LITA 5C5UA 1AYM1 3GHMA 3POIA 5GZEA 4XBNA 4YSFA 3TEYA 2R073 1GNYA 4YW6A 2V5YA 4YZ4A 2ZKNA 4JRAA 1FOD2 2Y6GA 3K2OA 3K3OA 4COZA 1QJX3 1CIWA 3KV5A 1UD1A 4Q26A 4FXKB 1REEA 5FQ0A 1RUG2 4IEUA 1NCRA 1YJLA 4UFLA 2Z2SB 1YHFA 1BJQA 2HWB3 1W8UA 5E8AA 2R0HA 4LE4A 1JOJA 2W1WA 2BYVE 3K46A 4BDVB 5L9RA 2XJSA 2JJ6A 3HT1A 2WKKA 1LGNA 1RUJ2 1I5PA 4GH4B 4N7IA 4Q2FA 4A6OA 4EV0A 1UMIA 2G19A 2W94A 2WZR1 3I2KA 3B00A 1ZZCA 4MGYE 1DGWX 3ILFA 4XPVA 4B1LA 1BZWA 5F37A 4Q4V1 3IPVA 2IFWA 4Z1VA 2VZTA 3BTZA 1L7QA 2DBIA 2R042 2RM22 3JD72 4QB2A 2QKDA 3RJ2X 3HR9A 3HIFA 1K12A 2E53A 1Q5OA 1RHI3 1JZ3A 3BTYA 5EJ1B 1RINA 3TEWA 4YZ3A 3P6BA 3UL2A 3VDDA 1ZRCA 2HWB1 1OD3A 4AR2A 5F2SA 3MDPA 1MQTC 4Y22A 1S1AA 4NHKA 5AC91 1YNAA 3B94A 3IAQA 3WNMA 1Z7S1 3PIGA 2NM1A 1O7FA 1GWLA 1QIQA 2RS11 5FPVA 4CEYA 5C6CA 3SXWA 1XE8A 1XRUA 4P5HA 1BBT3 2VTFA 2YC2A 2Y38A 4S2GA 4WM8A 1LENA 4MVTA 3OOXA 5BXXA 4IL7A 5FREA 2YG0A 5B4XA 3WW4A 1RIRA 3UKTA 2HLEA 2ZEXA 2OZJA 3MW2A 1IPJA 2QUOA 5EFUA 4YM3A 4YW1A 3O1TA 3K4AA 4OQ9A 4NIGA 1JU3A 5SV8A 4KL1A 3FZ3A 2Y6HA 4M00A 5A7WB 2DURA 3WF4A 1RUH3 1X50A 4WV8A 5JPMB 1VBB1 4HKOA 2ZHKA 3CNAA 1WD4A 2ZXQA 2EALA 4M3CA 5JLVA 4AVTA 1AXKA 2Q8CA 3NRUA 1CZTA 4EN6B 1ULGA 5JAXA 1KS4A 1BBT1 3I3QA 3VBUB 1OUSA 3IAPA 1UU6A 1XSRA 3DECA 3U75A 3D0SA 1O6UA 2VQAA 3DKQA 2AC1A 3GBGA 5HI0A 4Y33A 3VKOA 5FZGA 1US3A 2JE9A 2PAMA 1W9YA 2UY9A 5HV4A 3NAPA 4MHRA 2CGNA 2RDRA 5T50A 2YFZA 1PK6A 1RVF2 5L7OC 4P02B 2VH9A 2XOMA 1KQRA 4JV4A 2CDOA 1US2A 5CA6A 4IEOA 2VNVA 3FBMA 4C1XA 4Y5Z0 1AR61 1VALA 3PNAA 2BFUL 2WQZC 1W6OA 1VAVA 4LO5B 1ND3C 3ASIA 1X9TA 3UGGA 2VMFA 4D6QA 4W50A 1MACA 2GNTA 4MO3M 1EPZA 4NIAA 4BLIA 4DZGA 4A3XA 5CKQA 4CCCA 1O5LA 4N43A 4L0PA 3NKGA 4IV3C 3CJIA 5FPAA 5FYTA 4NR1A 3MI8A 4BU2A 5EIYB 4I30A 1W03A 1QNWA 3D82A 4XMIA 5GZFA 4MYEA 5IW0A 2H0BA 4ARYA 5A70A 1VAMA 1UZYA 1FOD3 1PGSA 1UOGA 2GMMA 3OYWA 1WMDA 5FPZA 3H7JA 1APNA 2W0XA 1QJY3 3RZGA 2JDPA 1RUG3 2ARCA 2C0ZA 2XJTA 1W2OA 1UY2A 5FKBA 1W0OA 4KI5M 2ILMA 2HWC1 1NUKA 1JI6A 1JHNA 1UY3A 4HXCA 2ZAHA 4Y1XA 1RUJ3 5FO7B 3HT2A 2VCMA 4LO8A 1LRHA 2FMDA 5C33A 1NLRA 2ZGSA 5CG8A 2J42A 3DN7A 3OPWA 1SLCA 2YXSA 3UKNA 3WDUA 2JEMA 2RDNA 1W6NA 4RS5A 1OURA 4XABA 1PZ7A 3T08A 1OH4A 1OVSA 3JU9A 3M3IA 4QGMA 2DTYA 1LJ7A 2ZZQA 1NKGA 2Q30A 4UWDA 2RM23 1I5ZA 3JD73 1NG0A 4NIDA 5A3MA 1GP5A 1JZ7A 3U10A 5CFCC 1JYXA 2NPIA 2I74A 3CEWA 3IIIA 1HQNA 4A3ZA 3VZMA 4PI2A 3FFQA 3POJA 4N53A 3UNPA 4BQ4A 1YFWA 1ZZ6A 2VAUA 3ZFEC 3I4IA 4XFIA 1R1ZA 4IE5A 3RI9A 2WIIB 4Y26A 1C1FA 4LPLA 4XXPA 2BUKA 2WINB 4IGOA 4CU7A 2BOIA 1RXGA 3U4XA 2JX9A 4Y3OA 5AVAA 5FXVA 1KD7A 4HKWA 4IXLA 3I3DA 1SHWB 3FHQA 5JMOA 2FZ2A 1AJKA 2R041 2RM21 4L11A 4LBNA 5C8CA 4R9DA 1IHMA 3C7OA 5DAVA 3RYRA 2LM3A 2XLAA 1PHMA 4GH4A 1C57A 2VW0A 2YBKA 2YZ4A 3UETA 2GN7A 5ANNA 1CX4A 1O4ZA 1IPSA 4AVSA 2P34A 1HN0A 5A7SA 5FY8A 1VRBA 5LK7B 1F4AA 2XQXA 2XG3A 3I2OA 1OFNA 1TQ5A 1F4HA 2R1DA 4IE4A 5FYHA 5H9SA 3VBSC 1Z78A 1PMHX 1JZ6A 2W47A 3UV9A 2FDGA 3WDTA 1N3OA 5FZ1A 1W6QB 5B4NA 3IKWA 1N1VA 5K8SA 1ULPA 1NCQA 5FZLA 3RI8A 4CE8A 1X7NA 4AQ2A 4FPCA 4CCEA 1RVF3 1Y3TA 3VBFB 1OF4A 2O0OA 1IQDC 2O8QA 2PXJA 1S2EA 3OY8A 4ZY9A 5GLTA 3WG2A 1DYOA 3ZDSA 1FPN2 4OULA 4Q29A 2XBO1 3D6EA 3ZXGA 3WOGA 4QB6A 2WO1A 1HJFA 4QWNA 2X5IB 2C5DA 2IVJA 5LBEA 3FLRA 1V6IA 2DVGA 5FYIA 4NPLA 4YYOA 1S0IA 2Y6KA 1BLZA 1MEC2 4YRDA 3P1IA 1VRH1 3GHNA 5A7WA 2JB8A 3I3EA 4BCUA 1JS9A 5FYCA 1ODNA 3LDBA 4DQAA 1CX1A 4CUCA 4FPKA 3GJBA 2WLQA 3WG4A 1JODA 1VMHA 2YGLA 1NLSA 4CEWB 2AGSA 2OKXA 1GOHA 1TE1B 2AH2A 2MNGA 3ACIA 3JUUA 4Y1UA 1AVBA 1ASJ3 4FOVA 3M3QA 2P6CA 2RHPA 5A1AA 2ZMKA 2B8MA 3FE5A 2VZ1A 3KHBA 1C8NA 1F35A 3KSCA 4PF1A 4Q1RA 5DXDA 4ZS3A 3ACGA 3ZXJA 3SISA 4AL9A 3I97A 3I2FA 5DG1A 1RXFA 1V6NA 2ZHNA 4DFSA 1HXS2 4H14A 1URXA 3FLPA 2JG8C 4IEZA 3GCXA 1LECA 1LCLA 3OB8A 1CAWA 2Z4FA 4IUGA 4RHV2 4XW3A 2ZAAA 4LBJA 2JDAA 2E51A 3AX4A 1MS1A 3S6PA 2HEYF 1MZFA 1YFXA 4AHYA 5IYYA 1S0JA 5DDJ3 5FP9A 4SBVA 2JENA 5ERLA 2Y64A 2Q8EA 4K1ZA 4CCKA 5A7OA 1AYN1 1CWPA 4GALA 1DQ2A 4XBQA 2D93A 2ZMNA 4QDSA 1RUD2 1W0NA 1WZXA 4YW2A 5FY9A 2EXJA 5DABA 4E4DX 1ZRIA 4Z92B 1SBFA 4GWNA 4FT8A 5T5PA 5FUNA 1UYYA 4RA0A 5IJRA 1W6PB 4HPKB 4HANA 5FY5A 3QCWA 4LIVA 3PTYA 4L99A 3POWA 5FZOA 1MZ6A 2W08A 5I8TA 4D7YA 2YROA 2BNMA 2HWF2 1OLME 1UIJA 4AHZA 1RUI2 1YC61 3AZZA 3MYXA 3C7HA 4NPRA 2E7QA 4IDZA 1SLBA 1S0CA 3NV4A 4BZ4A 3G7DA 4WM7B 2A5ZA 5JVVA 3RQ0A 4YWAA 4EWEA 4NRQA 1J59A 1W8TA 4BK4A 5HPOA 1IS3A 3PUAA 4H2AA 4LIUA 3OG2A 4MGIE 4EROA 3USSA 1JMUB 1AXYA 4FBFA 4P9IA 3NJZA 2V09A 4IW3A 1WW6A 2VMEA 1E57A 2DDUA 2QQUA 2VVEA 1QH6A 4FPFA 4QQHA 1NQJA 3W20A 1ZZ9A 3AFKA 3EQEA 2X05A 5J98B 1I9RA 2BFUS 4XVHA 1ULOA 2DCJA 3M7AA 2ZS6B 4XFCA 1N1TA 2ZEZA 2QZ2A 4Y4YA 2A6VA 3HWJA 1LOFA 5IATA 5FZIA 2ZHMA 4XIKA 5LRRA 2RJLA 4JC1A 2G1MA 4META 4PDWB 2WNEA 3KB5A 3O1PA 1WUVA 5JOXA 2CTVA 1LB2A 1P8JA 1WCQA 1GZ9A 2BWCA 2PFWA 4P9YA 1NOVA 1CAVB 2GP5A 3IIAA 4OLLA 3SH4A 1YO8A 1PGL2 1COV2 3RNSA 3NW4A 5F9TA 5JOZA 1RUOA 4S2DA 1MZEA 3VZLA 2VW1A 5LY1A 2AREA 3W5MA 3EYPA 5LBCA 4YARA 2R062 4OFGA 5IVVA 3MFAA 4X8NA 5I0DA 2VC9A 2VMIA 5C3PA 3ZO0B 1RUE3 1JUIA 2CHHA 3VBRA 1YCIA 3NWKA 1K45A 1FPN1 1RGSA 3J26N 3U1XA 1HRI2 3PVNA 3DUIA 4MGQA 4AWDA 4LE3A 2W91A 1NCRC 4AI8A 4P9WA 1W6QA 3KZ4C 4HBNA 1NA1C 4F3JA 4NE9A 1O3QA 1XJAA 1MEC1 4G3YC 1UOBA 5CKMA 2Q5TA 4QPIA 3OBTA 1JH5A 3MUY1 5E16A 1U5YA 3IB3A 3VBFA 1UY0A 5I91A 2WNUB 4QPWA 1HXS3 1IZ3A 3NV3A 1AR72 4K40A 5JXJA 4RHV3 5BV6A 3WG1A 3ON7A 3DF0A 2I45A 2JDMA 4Y5TA 1CAXB 2VUCA 5FLIA 4FPGA 1OH3A 2X5IA 4D6SA 5LB6A 4B3NA 4C0HA 4EE2A 2DFCA 4BQ3A 1TNRA 4KWJA 4J1WA 4KBZA 3HQUA 3KWVA 1RUD3 3JQWA 2C9AA 4XBLA 3SC7X 5GZCA 1DLLA 2BVVA 4RQPA 5J48A 2QQOA 3NNFA 1FXZA 5BNPA 3SCGA 3TEZA 5IK7A 1WD3A 2VUJA 3IMMA 1C1LA 3PDQA 1S0GA 3CQOA 5GZDA 3EJKA 1PZ8A 2WFF1 4AI9A 5K0UB 1MS4A 4PIZA 5J96B 4CU9A 4FTSA 4WM8C 1OMIA 1ULDA 2D40A 2PQSA 1DQ4A 2VNRA 5CYYA 5T55A 3SEEA 3AYCA 1OC1A 2HWF3 3NNLA 4R9AA 5FPBA 5A3PA 2A73B 3SH5A 2XUEA 1RUI3 5FPXA 1ZBA1 3KF5A 3ZYIB 1POV3 2JXAA 4AHWA 4CCOA 2BZDA 1D4M3 2JDZA 2GH8A 4GJYA 2IZWA 4KNCA 2DFBA 1DGWA 4NHXA 1RUC1 4K20A 4LLFA 1RB8G 2DTWA 4KWUA 1ZZBA 4KU7A 1R091 2B9VA 2JG9B 4Q27A 4OHXA 2P17A 4XAAA 4OUSA 3CZUA 1GZCA 2QQNA 5FO9B 5JI9A 1FT9A 1GUIA 1QOOA 3TEXA 3WG3A 3PIJA 4IE0A 5JXIA 4P08A 4OHZA 3RDIA 3H3ZA 1OPOA 4WZCA 5A3NA 2G9ZA 3VDCA 5LA1A 2VQUA 2YPDA 3WW3A 1U0AA 3I3BA 1XNKA 4YLZA 1KFXL 1F2NA 3NAPC 3U11A 2F4LA 1S0DA 1LOAA 1W8OA 4OI4A 5C9AA 1LTEA 2O14A 1Q8OA 3PVEA 1W6PA 4K6BA 2RMU2 4YZ1A 3IZOA 4UW3A 3N7KA 4LHNA 1WLCA 2BEOA 3B9CA 2H6CA 2P1BA 4R52A 3WVJA 5JXGA 4GB31 4B8EA 2DCKA 1ZBE3 4I0BA 2YBPA 4O7XA 4UI9L 1LODA 3J4UH 1LOCA 2PHTA 1COV3 3R4UA 5I93A 4FI9A 4FFHA 1C3HA 4LHKA 3VB9A 2UWBA 3WHUA 2Y6JA 4D3WA 4UFKA 5K4LA 1GMMA 1GWMA 1QU0A 4GWMA 4NIIA 2EVXA 3WD5A 4I02A 3U78A 2XONA 3THCA 4QDRA 5HCAA 5LATA 2RS32 3VDDB 2Z5WA 1J1TA 2CL2A 3LEGA 5IK5A 3ORJA 3FLTA 4BPZA 1IQAA 1XYPA 2D3PA 2L9LA 2WAAA 4PT6A 4DXZA 1AF9A 4E27A 5KHKA 2R072 4LTAA 1HRI3 4QGLA 5EQUA 4I0AA 3LE0A 4DXSA 4NROA 5F5QA 2VXRA 3VKNA 3KHCA 2RG4A 4L8QA 4PCRA 2QFEA 4HOOA 2KD7A 1R081 4XDQA 3T0BA 2VUAA 5JPNB 3OEBA 4AAXA 3RRDA 1DYKA 2IXJA 3AMNA 4PDWA 1E5SA 2WA4A 1H1IA 3ME2A 1SMVA 2R061 5BNOC 4BWOA 1AR73 4FXGB 2CYFA 4Y1ZA 1F5FA 3UT0A 5IT6A 4ET7A 3SITA 1SCRA 1K42A 2EIDA 4QDQA 5GJ6A 4FSJA 1LOGA 4NAOA 4RS5C 3O1SA 1GLHA 4OUEA 2VNGA 2P3IA 4JGZB 4J1XA 3WR0A 4AI0A 4DRRA 1NY71 1VBC3 4IERA 3ALQA 1ZX5A 3A7QA 2HWE2 3LKJA 4RL7A 1LGCA 3N3HA 2ZGPA 3HOBA 4QX2A 1GP4A 1WCSA 2JDHA 3PHMA 4M4PA 1AR83 4CDWC 1SZBA 3ZMNA 1W2AX 1SQ4A 1BK1A 3T0AA 4BK5A 3POGA 1UOFA 1SLAA 2E26A 1PK6B 2W87A 3LZZA 1W39A 1XXNA 4Z2WA 3TNPB 3J7HA 4CDUB 2MEV1 4QX8A 4SLIA 1BQPA 3TWIA 2R0FA 4QU1A 4R9CA 4FAHA 1A8DA 1XNBA 3ELNA 4FP3A 5FAXA 1CD3G 1E5RA 5J1XA 4JTNA 2F17A 1WMXA 3JB8A 1QDCA 1H8TB 4XF4A 1WW5A 1W8NA 1J58A 1X33A 4HVRA 2WNUA 3AP4A 4LEJA 3HN3A 2LALA 2FD8A 3JBG1 1FATA 1XOYA 2OS2A 4XCBA 2EF6A 3ROUA 5A1FA 2ZGNA 3C8XA 1NXD1 1CAXA 1LESA 5AFBA 1O8PA 5FZCA 5FZHA 3M4FA 2GNBA 1CR7A 1TG7A 1UPIA 1W9FA 3VKMA 3J9SA 5DMYA 1QMJA 5LRSA 2RS51 4AI3A 2NMNA 2A1XA 4ES9A 4Q4Y2 3KS7A 1S0BA 3ILRA 3AYEA 4QXCA 2W52A 4PLMA 4CP2A 4YG0A 3D5OA 1W3VA 3BU7A 1POV0 1TEIA 5FUPA 4CZSA 1O59A 3MIHA 1QNYA 2D6LX 3D0JA 3KLSA 3SEPA 3EO6A 3LEKA 2RMU3 4XETA 3AL5A 1CAUA 3GBWA 3H1YA 3N7LA 4FQZA 4XTMA 3THPA 2ZBJA 1OQEA 3VD3A 3WUCA 2QQIA 1ONAA 2BWAA 1XYNA 2E6VA 2JD4A 3AXDA 3FX3A 3MW3A 4I3GA 3IM0A 2ZGLA 4R8HA 4YVSC 3OCPA 2D98A 1UN1A 1XU1A 2XDVA 2WYSA 4MLOA 2A6ZA 4XTPA 3W9AA 4CDQB 2W5FA 1K5JA 1GNHA 5FZKA 1VLNA 3HNMA 5A1LA 2JG9A 3AZVA 1YQ5A 2QNKA 2RS33 3ZYBA 5C70A 3ACHA 2XUMA 4AEJA 4B29A 4DO0A 2C24A 2Z42A 2P3YA 5KR7A 2VOTA 4XF0A 5FZEA 1KFUL 4FQ4A 5GLVA 3VBUC 4PLNA 1OD5A 4FAGA 3MIGA 4URTA 4ZXKA 5H9RA 3K75B 5F32A 1PIV1 2DBNA 1F5JA 1LHOA 3KVAA 4YW3A 1QDOA 3R4SA 1QJY2 4QPGB 5IVJA 1RJ7A 4IETA 2NZ9A 2XHNA 4D94A 1MS0A 4UOJA 4MH0E 3GZUC 3VL9A 2HBUA 1ENRA 1V6KA 4GQ7A 2W92A 5BNNC 5C8CB 3ZN5A 3M2MA 2WLPA 5EJZB 3VHNA 3E5UA 4A7YA 4Y5SA 4NOTA 4WVZA 3WW1A 3K48A 4MUVA 5FZ4A 1AR91 4CSWA 1RMU3 5EP9A 3I2GA 4QQ2A 5EYYA 1JYNA 1C5IA 1WCUA 3ZYHA 3OPZA 2WR9A 5C3RA 4YG6A 1UMHA 2R071 4A2UA 4D0QA 3MIDA 4XFAA 1PGW1 1QJX1 1UPSA 4YM0A 3TYJA 2HWE3 3HEIA 3V0AA 5JR7B 1A34A 4AZZA 1Y7BA 2OX0A 5J09A 2AUYA 1ZA4A 2XR4A 2VBDA 3RZJA 2XJPA 2VBPA 1XSQA 2DUPA 1WW4A 2RR13 1NCQB 5FMBA 5A80A 1EUTA 2CGPA 5I0RA 3SLIA 2AZ5A 2Q0AA 1HB4A 1GZTA 4CVUA 1AL22 1IS4A 3OY8B 1YJKA 1YFYA 2NLRA 1EV12 2YGMA 2AR6A 3MLJA 3MGUA 3JB4C 4JVAA 1LHWA 2CV6A 2E33A 5F5AA 3HMYA 4AQTA 2ZJCA 2CU5A 2A6XA 3MLKA 2QE3A 4XMAA 5D8AA 5FOBB 3T09A 3ST7A 5A7PA 2I2SA 5CBLA 1EPWA 2VQTA 4DPNA 1JZ2A 5FMOS 2GALA 4BQWA 5DN2A 1RHI1 4AQSA 2VOWA 4MXWA 5FZ7A 5EHDA 3TN93 1VMJA 4BIFA 4CPBD 1CPMA 3LPGA 3NKTA 5A3OA 2LW8A 3KM5A 1QQP2 1FNZA 3J8F2 1UKRA 1ALYA 3ZXEA 1HW5A 4JDNA 5JSPA 4JGZA 1PVC2 4HLTA 1HIXA 3G6JB 4JGYB 1VB2A 2GMPA 5T5OA 3ACLA 3RZZA 3WDVA 1W8FA 2FHRA 3MLLA 4CPBA 4DUXA 4Q4Y3 4GAZA 4BOWA 5ANQA 1CONA 2YV8A 3KGLA 1LOFC 1ENQA 2Y0OA 1O5UA 2K46A 4GKXA 2VMGA 1BYHA 3CO2A 2QDNA 3LB9A 2XVGA 2NP0A 4NUBA 3IWZA 1RUH1 4CDUA 2MHFA 3GNEA 4W6XA 1Y43B 2CY6A 5ACA2 3H8XA 1ND2B 4UAPA 2FCVA 2XKOA 3O14A 1CAWB 4JQTA 3IMNA 3WLUA 1BXHA 1ST8A 3WEZA 3B01A 4ISQA 2HYXA 3H50A 1CIYA 5DZFA 4HT1T 3N7MA 3T2TA 1H8TA 3AKRA 1H9PA 3HJRA 3QH7A 2ZX2A 1H6XA 4QQOA 1QJFA 3AZWA 4KGQA 2ZEWA 5FWEA 1G8WA 4KU8A 1DQ5A 2QBXA 3SNMA 1W2TA 1Q8SA 3AP7A 3MPPG 3RVHA 5F3CA 4BJ0A 4KBBA 1RJ8A 3AP6A 4BQXA 1CVNA 4QX5A 4LQRA 1ASJ2 4UW5A 4YNIA 5EWSA 5FZOB 4GZ9A 2VVDA 2ZHLA 3C3VA 4R4XA 4UBHA 3IBMA 1FNYA 1XNAA 4D7SA 3VDAA 1VR3A 1VMFA 2XJRA 3BVCA 1WCKA 3VBFC 4D69A 3IDAA 2BU9A 3WHTA 2G4IA 1X82A 2OIIA 2QJVA 3ENRA 4HN0A 2LS6A 5DUVA 1QH7A 4XJAA 2CAVA 1PO23 1F31A 3ZLIA 1BHGA 3WF0A 1U5XA 3I59B 4BLJA 4LMFA 2JE7A 4Y24A 4Y4RA 3J7LA 2X5IC 3H42B 3MIBA 1QKQA 2P37A 1O3TA 5DDJ2 1NYWA 1T2XA 1NX9A 4OMDA 4EWAA 4XQ4A 1PNFA 1FOD1 3VHOA 1XE7A 1JN2P 1UX7A 1ULCA 1V6OA 4H7MA 5FZ8A 3URFA 1FV3A 3U4SA 1QJY1 2LROA 3AYAA 4LORA 1RUG1 3LEIA 4CDQA 3GGLA 3AP5A 4FFFA 4BQ5A 3FL7A 4FFGA 3T3YA 4HFSA 2UYBA 4ZZ5A 4GD4A 3S7EA 3CLPA 4XHBA 4LBOA 1AHSA 3RMXA 4AGVA 4CEWC 1JZ4A 1ENSA 1RUJ1 2WT1A 1GWKA 1AL23 3FUQA 4NAMA 2PQQA 4YW5A 1EV13 1YQ2A 1LR5A 3B69A 5FJHA 4QPGA 4E2GA 5LA2A 1JU4A 4E8DA 2BP6A 3LF7A 5DUXA 1VBE2 1UYPA 3MBWA 5FLJA 4XQWA 1N3PA 5CU1A 4EN9B 3TOJA 3VKLA 4R9BA 2HKXA 1Z0HA 2YMZA 3JD71 4QHBA 3ES4A 4ARXA 2OW4A 5F6LB 4A7ZA 1HRV2 4DY3A 1XBFA 4XFBA 2X29A 5L73A 4JDOA 2D6KA 4AEDB 4AVAA 2ZGKA 3R6SA 3ZYRA 3BUCA 4N9IA 1VAKA 1QQP3 5CFDA 3J8F3 3DPRB 5C5TA 4OUMA 2Q8OA 4HL0A 5L7OB 3H8RA 1K3IA 3P3PA 3H3UA 1ACCA 1AL21 3WP3A 1I6XA 1PVC3 1YEWA 3VBRB 4NO4A 4PF5A 4BXSV 4HMZA 5CEHA 3I49A 1W2UA 3PMSA 1EY2A 2WAOA 4BXFA 1DZRA 1B35A 1G86A 1VBD3 4LULA 2FBEA 3AB0A 3PU3A 4FPYA 1H8VA 1T6GC 2WWUA 3IDCB 3RPQA 4M0NA 3LSDA 1FMD2 3RS6A 1IKQA 1AX0A 3DCQA 2XB6C 2D43A 4QPIB 5FWJA 1QXJA 4A42A 4D6RA 2DCZA 1QXPA 3S5QA 5C4WC 4CCLA 2PHRA 4YM2A 3TB0A 5ACA3 2KA3A 1V6MA 4Y20B 2D3SA 2PHDA 3VD9A 2EXKA 3IDBB 1H30A 1HV1A 4HONA 1IOAA 1GV9A 1Q56A 3T2QA 4Z8BA 3OF1A 1VIWB 1PM4A 3AKTA 4YVWA 4F83A 3BU0A 1DCSA 4QKNA 1TME2 4WM7C 4K7JA 4XUTA 2BNOA 4Z07A 1W04A 3ZR5A 1DLCA 5ABJB 3POFA 4RQPB 1BVP1 5A32A 5BNPB 3ZSMA 1V6JA 4CUGA 1RVF1 3RZKA 3S5AA 4FO9A 1W9TA 3WNOA 1RUE2 3NJXA 5DQ0A 4JGYA 3HQXA 3KT7A 4COUA 4DNYA 4EZHA 4RFT0 3ZDVA 2EIGA 2JD9A 1YIFA 3ETPA 2J1VA 2PAEA 5FR3A 5IVEA 4TTGA 4KQ7A 2ZGUA 4NHMA 1O4YA 3VZJA 2P5BA 2SLIA 4LBQB 2ET7A 4P5YA 4PDWC 4DOUA 1EAH3 2H6BA 3OPTA 1BMV2 2ARXA 3QD6A 1JHJA 2A6YA 4OHVA 3PUHA 4XOGA 1ND2A 2PN5A 5IVCA 4ZU5A 5IVBA 2QQVA 3Q8BA 1AX1A 4LHSA 5ISLA 1C8M2 1HLCA 3ETQA 5A7QA 4XFGA 2CWSA 3E97A 1G9DA 4RR3B 5F7UA 3IN9A 4OQ8A 1LHVA 1ZZ8A 3AMHA 4TYSA 2PLV2 4PIYA 2VD7A 3ZXKA 1ASJ1 4ES8A 4AHXA 3OUHA 1M4WA 2XGXA 4R4ZA 5FKCA 2ZX3A 4TWTA 1DG6A 3BTXA 1SBDA 3AMQA 3UGHA 2BBVA 3BALA 1V9U2 2JKXA 5DZGA 4BA6A 3A21A 4QM8A 5I0TA 2VULA 3OUJA 3T2OA 5C9AB 5IFTA 1SFPA 1H1MA 2P3KA 4FPLA 2VMHA 2BBAA 4LJHA 2MPFA 1DBNA 1SACA 5CZKA 1FV2A 4KH9A 2VUDA 1FYUA 1UU5A 5FFOC 3RYKA 3T1MA 5DDJ1 1RYYA 1TMF2 3BPSA 1VBE3 1ZNPA 1C28A 4B7EA 3AMMA 3TAYA 1BKZA 5FXZA 1D4M2 2VQ0A 2ZEYA 2QQWA 2WNUC 3E1F1 2B7YA 2ZGTA 5KHGA 4A45A 1HRV3 3B9IA 4NRMA 4FPJA 3I59A 3CDZB 1I3HA 1LU2A 4ITCA 1Q3EA 4ZS2A 5F3EA 3OTFA 2WSUA 4KG0A 3CL1A 3J7NA 4WVWA 3WNKA 4AFCA 1HX6A 3J7MA 3UGFA 3CF6E 1OKOA 1GZWA 1HQWA 2ZX4A 3BB6A 4JZRA 2J7MA 4LO7A 2XJUA 2LRPA 1WW7A 2JE8A 4Q4W2 3L2YA 4QXBA 2ZMLA 1LHNA 1FMD3 2FCTA 2PHXA 2QZ3A 2TBVA 1O8SA 4QMAA 1A8MA 2X8KA 4EWDA 3ZYFA 5GM0A 3WQ0A 5K0UC 1R1A2 3WQ7A 1GOGA 3KCYA 3VHRA 2ZABA 2PMWB 4UFMA 2BDRA 2WZ8A 3E6DA 1ZBE2 4FPHA 2PHLA 4FCAA 4I3PA 2K9ZA 5FMDA 3AVSA 1D2QA 2DVDA 3FJSA 3IDEA 5FLHA 5JZGB 5DAQA 1HQLA 3VLBB 2EIBA 3VL8A 2IFRA 2GC2A 4XF3A 3VKFC 4XFFA 1TME3 2WO3A 4XZUG 5A6QA 5EJ3A 1OT5A 1W2NA 2W2IA 4AEDA 2DUQA 2D5HA 2W1UA 1VBA2 5GLUA 1QXRA 5K9YA 3KCCA 3ZFGB 1UYXA 3DPRA 5L7OA 4UYBA 5LK5A 1TNFA 3LFIA 1J3QA 1RUNA 1S2KA 4UXAA 1DQ1A 2HBTA 1A3KA 5FIXA 3HN1A 4WVMB 1SPPB 3E6BA 4YZ5A 1A78A 2A3WA 2WS92 3F2ZA 2F4PA 5FK8A 4DIQA 3K3NA 1ND3A 2R6QA 5DG2A 3NO8A 3AFGA 4LLOA 4QKBA 2P3JA 4Q0UA 4G4FA 5JSOA 1PMIA 4YGEA 4GJZA 3RSJA 5K7PA 5EPAA 3UJOA 5EYXA 3I2JA 3FFZA 3WW2A 4E4ZA 2Y60A 1GP6A 1UAIA 3JXSA 4RGKA 4Y20A 3DV8A 2IVIB 4AXOA 1G9FA 1H4GA 1C8M3 1RUE1 3THTA 3M70A 3PU8A 3MV11 5LBBA 4ZZ8A 4RGAA 3ZFFB 3WX5A 2GC3A 2D97A 4COYA 4YFWA 2JWPA 5L19A 2PLV3 1VBC2 5KHHA 1WLTA 3N36A 5BUVA 4KG8A 4ZXEA 1OSGA 3OGVA 4QPYA 3T30A 3DYMA 4JKLA 3NVCA 5ABJA 3VBOB 1AR82 3VDDC 3RZHA 1V9U3 1OOPB 4ORFA 4DRVA 4CUAA 3MF6A 2RDQA 4I01A 3RWKX 4LBQD 5J3UA 1OI6A 3R4DB 5FMCA 4XC9A 1HXS1 4BQ2A 5JR2A 4LO6B 3PLQA 4AGRA 1J3PA 4ZHNA 1CAUB 1N47A 2J1AA 2RJ2A 4CEYC 2EAKA 4RHV1 5DAXA 3B93A 5JOYA 1MS9A 1YI7A 3L9JT 4NJ4A 4FPOB 3OSDA 2VOVA 5IK8A 5FPLA 2ADDA 1TMF3 3R05A 2XQRA 2IWGB 5BNQA 4LBQA 1VE0A 3AL6A 4BE3A 3D8CA 4GMP3 3B5LB 1RUD1 4AOCA 3CJXA 1WWYA 1I1EA 4LK7A 1J3RA 1NXMA 4Q0QA 3AZYA 2RVAA 4C1WA 1UQXA 3Q8CA 4AFDA 5HV0A 1DIWA 4Q4X3 1CGPA 4CDXB 4YPJA 1UCXA 3D4KA 1LULA 5EXOA 4OZOA 1JZ5A 2AEYA 3VBHB 3ITQA 2K0GA 2VPVA 2WWJA 4IE6A 4M3CE 4Q8LA 4NWVA 4RR3A 3ZIWA 4J6GA 2RDSA 4LT5A 2NQYA 2EXHA 2OXBA 3FWEA 5FMOL 1ZRFA 1NZIA 2HWF1 4MGZE 5CISA 4RGGA 1RUI1 1XC6A 4Q5OA 4Q4W3 1POV1 1UKGA 5FY0A 3ZXAC 2PHFA 3MW4A 4TSVA 4ASMB 1D4M1 1NQDA 3T1LA 3H8UA 5I0SA 2W95A 2WN2A 1PK6C 2RJKA 2KXLA 2ZCWA 1WLDA 4WZFA 2UWAA 1JOBA 4B1MA 1RL3A 1R1A3 2TEPA 5GLWA 3AKSA 2FZ1A 3LDRA 1G6NA 1KJRA 1UO9A 1Q8VA 2IXCA 2N7GA 4X8PA 1JYCA 5FP7A 2LTNA 4FPEA 4TLFA 4X6RB 3L2HA 4CP9B 1RUF2 3WF2A 2VTXA 4H55A 1AX2A 3H8OA 4ASLA 2JDUA 3I7DA 4HN1A 5FZ6A 2GN3A 3V0AB 3PVBB 4FFIA 5JI7A 4N43C 2GZWA 1VBA3 2WDBA 5JWPA 3CJIC 1JZ8A 2G9FA 2BJSA 3POYA 4OCTA 2D6MA 1K5MB 1TVGA 1AYM2 2CSGA 2O1QA 3Q8FA 4IGQA 4QHZA 4XUQA 2IXLA 5IK4A 3W59A 1ZBE1 5D1IA 3FHIB 4P14A 2D5FA 2P4EA 4QKFA 2OPKA 3N9QA 2OT7A 2WS93 3ECQA 3PJQA 1XNDA 4I09A 4INDA 1PGL1 3Q9OA 1COV1 1UX6A 2KR2A 3K77A 1G9BA 4O65A 4XACA 2HJIA 4LBKA 5D8AB 1RC6A 1CN1A 1KDKA 2QCSB 2VVFA 1GYKA 5SV5A 1C4RA 4QD2A 1U5ZA 1XB9A 2WJSA 3WZ1A 4MXWB 4YG3A 2W3JA 3GF6A 3KQ4B 2WZR2 1FX5A 3DXTA 3DYOA 2CDPA 5CVRA 1RMU2 1UL9A 2WT0A 4E2QA 5JZGA 4V2VA 4Q4V2 4QT6A 3P5BA 1BK0A 2VECA 2XVKA 2IXKA 4L97A 3O0WA 3MZHA 1HRI1 4AFAA 1ZRRA 2D6NA 2WS91 2J1TA 2E63A 4NN0A 2EXIA 3NL1A 3OUIA 4XXAA 4CDQC 3ZYJB 3CMGA 2J1RA 2VBBA 1F15A 2VM9A 3HAGA 4XUNA 3BYWA 2WO7A 4XAEA 5TSWA 2ID4A 4YFZA 2RR12 3ZFGA 4LR4A 1MVEA 1V6LA 1Z7S2 4N53C 5IAXA 3BPZA 1JBCA 2JG8A 1AR71 1F9KA 2LUWA 2Y26A 2FCUA 3A4UA 2HWD3 5T5JA 3RFRA 4MV2A 4WVMA 4CXXA 1SPPA 4XILA 2HYKA 2BGPA 2R49A 2WQ8A 1OLQA 2QDRA 2V4VA 1N1YA 4EN8B 1S4CA 1LHUA 1VBC1 4HETA 2B42B 2BOJA 5HCFA 5C8CC 2GC1A 4XJ8A 5FYBA 3ZMOA 4HG6B 1LGBA 1UU4A 1AR81 1UXZA 1KDMA 3TN92 2D7FA 4GH4C 3ZKYA 2QQMA 3BOWA 2WQ4A 3KV9A 5FZDA 2G9GA 3AKPA 5FBJA 1VBB2 4AEKA 3LIGA 2B39A 5FP8A 3ILNA 4JHZA 3ZFFA 2WFPA 1LKNA 4O9EA 2IUWA 5HCBA 1DFQA 2R32A 5BPXA 3ZM8A 1C5HA 1GFF2 1OLMA 4MG2A 2DCTA 2FDIA 1L3JA 2XJQA 3SQOA 4QKDA 4MHUA 4MADA 2GSYA 3O1RA 3VBOA 3BKZA 5DUUA 1OXCA 4MXVA 5FUIA 4HVQA 4DXRA 1NCQC 1OOPA 1WA6X 3GBFA 2ZX1A 1BEV2 4KGGA 3GYDA 1EUUA 2VZOA 1ULEA 2X09A 5FO8B 4GMP0 1PNGA 5KC6A 3ZKUA 4XCAA 1XYOA 3AYDA 3UYJA 3WP6A 1D4VB 3VZKA 3PTRB 4B4PA 4FTEA 4EN0A 2J1EA 1ODMA 1AR62 4ZPIA 4XFHA 2ERFA 1V0AA 5CG9A 1H2LA 3ZX7A 3VD4A 2VMDA 2OUHA 5C3SA 4LUKA 3LDKA 1RUF3 3KV6A 2V73A 1DGRA 3DKWA 1AUYA 4HSLA 4MZUA 2Y34A 3SHRA 5HBAA 4NMIA 1DZQA 3S7IA 1QJU3 2ARAA 2YYOA 4Z82A 3NNJA 3U14A 2Y6LA 2UURA 3OD0A 4M4RA 1POQA 2FDFA 1W6MB 3ZN4A 2XH6A 4CDXA 4ATFA 2VY0A 2RMU1 1KRIA 4O61A 3KVBA 3VBHA 1AYM3 1GKBA 4AAPA 1SEFA 2J1UA 3IT8A 2A3XA 4LOSA 3OD4A 5GLZA 4MGTA 2WBKA 5LZ6A 5A6ZA 4BH9A 4BQYA 4TLGA 3FMGA 4PI0A 3WNNA 4AF9A 1QJEA 3LWCA 2TNFA 4IESA 4KWKA 4PQ9A 4YGBA 4CUBA 5IUQA 3QOPA 5FY1A 1V70A 3CZJA 1UZWA 1Q8QA 2Q4SA 2HWC2 5A33B 3VZOA 5BY5A 2AACA 2VTXJ 3BODA 5FYYA 5FZBA 4CDWB 1ND2C 2Q8DA 1PO12 2RS31 1PO22 1W05A 2C4XA 3H7YA 1LOEA 2ZA9A 2WZR3 2VCBA 4QAWA 4XDOA 5FV3A 3I8TA 3WF3A 5A3LA 2WRAA 1M06G 2GDFA 2ZACA 5CFDB 4WBBA 4CP9A 1E5IA 3FC0A 5L36A 3TRSB 4Q4V3 4V1PA 2E32A 2KM2A 5E1RA 1LEMA 2CWMA 4AE2A 2HEVF 2D3RA 1DF0A 3B02A 1MPXA 1D2SA 5KHIA 4IV1B 5FYSA 1WMFA 4OI0A 4V2WA 4L9BA 2DWRA 1NA1A 4W6WA 1B35B 4YZ2A 1N1SA 5KXDA 4CCNA 1OF3A 1H2NA 1MR5A 5FZ3A 1HKDA 3POSA 4BYYA 3MIFA 2JDKA 1GU3A 1QEXA 2XHKA 4OVEA 5AC93 5HCHA 1K5MA 1Z7S3 3KD4A 3LA3A 1ZM1A 5FZFA 1X9PA 4RD7A 4FOWA 4NHYA 3GALA 2RS13 2P2KA 1VPHA 3QBQA 2ZPXA 3V0BA 2EICA 5H9PA 2R1BA 1RMU1 4XZPA 4UBGA 5A6XA 1YFUA 2GH2A 2C1FA 3WDWA 2Y8KA 2NYYA 3CBNA 1H1AA 1OFSA 2WNVB 4UT5A 1OHFA 4F7ZA 2HWE1 4YVWB 3POEA 4CXYA 3B3QE 4IEQA 4LKSA 4XUPA 3ZPOA 1IG0A 2XL7A 2RR11 2YHJA 4CP0A 3ZIXA 1KITA 3C7GA 2PELA 1VBB3 2CNAA 4K8RB 4P00B 5FP4A 5A32B 3LD8A 4LKFA 1T6BX 4XEZA 1DQ0A 2C9KA 3H1WA 2R16A 3N35A 4JKKA 3LFMA 3KT4A 4MX3A 1KJLA 4QX1A 2W9XA 4FVVA 1VBD2 3KT1A 2VXJA 4UW4A 4YVSB 2XXZA 4QX0A 4UFJA 1BEV3 4TXWA 3TN91 3MEPA 2BPA2 2XL9A 3OBZA 2ARBA 3BGAA 1NZCA 1AR63 2XBO2 2VW2A 2ET1A 1REDA 1LOBA 1MZ5A 1WLWA 1X36A 2BTVC 2J22A 5CIRA 3BCWA 3O5SA 1O3SA 3K4ZA 3KMHA 4E8CA 3CU7A 4L92A 5C7GA 1VRH2 4Q4Y1 1W0PA 4LK6A 4UF0B 1QGLA 3S30A 3WV6A 4AEDC 4Q8KA 3DGTA 4MGSA 1SBEA 1UY1A 1BEV1 1W06A 2DU0A 4LXLA 2C6SA 4B4QA 2XWBB 3DPRC 5FYVA 3HBKA 5BNNB 5FJKA 4UW6A 5IWFA 4A6SA 3VBRC 3WQBA 3ZN6A 3ZXLA 5D21A 4EYUA 3AXEA 1ULFA 2E9QA 3VHPA 2Q1ZB 3CHXA 4AW7A 3POBA 4B4RA 1GOFA 4PIXA 1JUHA 4NIHA 4HVOA 3DEMA 5C3OA 1WBLA 2VU9A 2HWC3 2ZGOA 4QPIC 5FYZA 1QOSA 3AKQA 5G05L 3QLQA 1EAH2 2VZ3A 5LA9A 3GZAA 2XPJA 5FY7A 1YQCA 4U36A 3W58A 3LA7A 1E5HA 3GJAA 3MO4A 1PO13 4OMCA 4AG4A 5T5LA 3BIWE 1KS5A 1MQTB 3V56A 4N90A 3AZXA 2QQKA 5FK7A 4W65A 1CJPA 1G7YA 2VNOA 4XYXA 1D0HA 1AYN2 2E31A 5JUVA 4KMQA 4DEQA 3M3CA 4E4HA 4HZFA 2V4AA 4QQLA 5FCCA 2A75A 5C3QA 1Y9MA 3HNYM 3CIHA 4HK8A 3T4VA 5ABJC 5LWBA 2GAUA 1XQNA 1GZWB 4RQPC 5FZ9A 2VOKA 3UESA 4ZU7A 5BNPC 1W6MA 2V5DA 2VZVA 3RZMA 4ISRA 1AJOA 2B9UA 1YUDA 1L7LA 1STMA 2DCYA 2ETEA 4M0HA 1JYWA 4L2NA 1OA4A 3GM8A 1PO11 1CJDA 1PO21 2QQPA 4AVBA 4QX3A 1O91A 4AVCA 4MGKE 1JW6A 5EZWA 1J1LA 4JHTA 3LSEA 3N9LA 4JKMA 4XF9A 1SG3A 3E5XA 1SLIA 5AVPA 3GDBA 3BTAA 5B2GB 3O1VA 1HB2A 4B7KA 2R043 3GXUA 3WUDA 5A33A 3MPBA 1OLRA 2FQPA 3MIEA 4XJUA 2FMYA 3AJZA 5A7NA 3MICA 4XUOA 5T3NA 3WDXA 4CDWA 5LEKA 3GCWA 4O9GA 4D8MA 5I0UA 1YLLA 1EP0A 1IS5A 2VMCA 2VG9A 5DPNA 2V72A 4P9XA 4RR3C 1YI9A 2OA2A 1PMJX 4C0BA 3OEAA 3I2DA 4W4ZA 1EV11 1PVXA 1DQ6A 3W21A 4IV1A 5FOJB 4IEPA 2WC2A 5I8YA 1UZVA 1DGLA 2D6OX 2X53S 5FPUA 1GR3A 1JYVA 1PZ9A 1ND3B 5KXCA 3N7JA 2WYFA 5C9AC 4XDPA 1ZVFA 2DU1A 3HVDA 3KQRA 2ORZA 4CCMA 1W28A 5IAVA 2OPWA 3ZPYA 4FP2A 3RMYA 1VB4A 1W9SA 1SFNA 4IV3B 3MV01 3S0MA 1QQP1 3J8F1 2XBO3 1YYNA 2IXHA 1YRZA 4N7UA 4UFIA 2WUHA 1OA2A 2WABA 4W8JA 1PVC1 4QHOA 2WZPP 5A3TA 5JXHA 2WNVA 3LAGA 5C8WA 2XMLA 5LA0A 4PLOA 1UMZA 5FXWA 1MS5A 3NNMA 4Q0VA 1VRH3 3NJYA 1OUXA 3ATGA 3RG0A 1VBD1 3A23A 3VN4A 4LHLA 1SDDB 2HH9A 1REFA 2UU8A 3EB7A 4IEWA 4XURA 1GBGA 3WT3A 1N3QA 2QQLA 1AXZA 3EHKA 2DYCA 1WKYA 1S2BA 2Q1MA 5G04L 2YFUA 4LKEA 4CP1A 1OKQA 2PTMA 3VZNA 2AYHA 4BHPA 1QWRA 5ACA1 2VZPA 4BM8A 1ZYBA 1UYZA 4Q1PA 2W1SA 2ZTNA 2P6HA 4QB1A 4Y1YA 4A7KA 4H7LA 3UK9A 2UWCA 3AMPA 5J7MA 5DAPA 3UKVA 2ATFA 4C91A 3O1OA 3UJQA 4YVSA 2AENA 2WNOA 2XWJB 2C26A 2VJXA 2Q1FA 3C2UA 5D2AA
chains in the Genus database with same CATH topology
1H2KA 4JAAA 5CFCB 2OZ6A 3M3OA 4NWWA 1LU1A 4WVVA 5GZGA 5JIUA 3JZVA 5JZGC 1JXNA 3VGIA 3VBUA 3ZFEB 1AYN3 1U12A 2Z69A 3LCPA 4RSUA 1S55A 4TZDA 2BQPA 4H3WA 2XJVA 2PHWA 3A0NA 4LBMA 1DGRN 1JYIA 1RTVA 3LA2A 5BNOB 1QY4A 3ZFGC 4AQ6A 4M01A 5BNNA 3O0VA 1EAH1 2PHUA 2JICA 3O7OA 2WFF2 4EN7B 1B09A 1NE4A 2DVFA 3ZYGA 2D6PA 2JKBA 1OQDA 2XLGA 5JOWA 4XF1A 3MFCA 3ZXDA 1ZREA 1ZBA2 1DU3D 4PJYA 1GNZA 2W68A 5KXEA 2CGOA 4BQ1A 3VBSB 1QHDA 2WA3A 2R30A 1V00A 3WCSA 5CADA 1RUC2 4P9LA 4PBOA 3M1HA 2GMEA 4AI1A 1R092 3ZSLA 3LOBA 1MQTA 3EXUA 4Q4X2 3ZXFA 2GNMA 4OZXA 3I54A 3B7MA 3ZFFC 2HEWF 5C4WB 5CB7A 1CESA 3ZSKA 1SLTA 1FAYA 1G9CA 3RYPA 2NN8A 4BMEA 3USUB 3VBOC 4ATEA 1VBE1 1OOPC 2ES3A 5E89A 5JMCA 5I8SA 1QOTA 4W6YA 1HRV1 4P9GA 4GB32 1XU2A 4K3UA 2O8OA 1XNCA 5DZEA 4YM1A 1H0BA 2PAKA 3GZTB 4XHXA 2WT2A 3FBYA 3WDYA 4U2AA 4COVA 1FMD1 2JG9C 4LUMA 3WP5A 4AGGA 4CDXC 3WXPA 1GQHA 4NVPA 5T52A 4GA9A 3VBHC 3DL3A 4AI2A 5T54A 3VV1A 2JG8B 4LNVA 1FPN3 2BNNA 1MVQA 5KBFA 2XVLA 3H1MA 1QF3A 5E88A 1UIKA 5FTTC 1R082 1MEC3 2TUNA 1F8VA 4S2FA 4C90A 1TME1 4G9SB 2B5HA 4HK9A 3LOIA 1LEDA 1DZTA 4IV3A 4Y1VA 4GULA 2H0VA 1DYPA 4F8AA 4XJWA 4QQPA 4YGDA 1FI2A 1NY72 3OBRA 2YY1A 1YXWA 2XKPA 2CAUA 3NV1A 3VUOA 1Q8PA 2F6BA 2B45X 4AFBA 1AL0G 1NE6A 4PBPA 1K5MC 1BMV1 5GALA 4GIQA 2WFF3 4P9JA 1Y9QA 2MEV2 2EA7A 4E2SA 1BCXA 2HWD2 3ZYPA 3O0XA 5FRAA 4QXKA 1C8M1 4LA3A 4JDMA 1HV0A 4HKLA 1WCDJ 2DUOA 1ZBA3 5D8AC 2PLV1 4K8FA 2E7AA 1IS6A 2EAAA 3KCXA 1U5IA 4OI2A 1SDWA 3JBG2 1H2MA 1RUC3 5CFCA 1GANA 4CTEA 2K2SA 1V9U1 3P3NA 1R093 4BIOA 2W39A 1CQ9A 4CEWA 1Q43A 2VOXA 3ZFEA 4JGZC 1OQ1A 4XIOA 2I07B 2RS52 1A6CA 3MF9A 4IQPA 4I2OA 1TMF1 5EV7A 4CRQA 4XJZA 5BNOA 2ZGRA 3WP4A 1O4TA 3WNXA 4GMP1 5CAZA 4QU2A 2SBAA 4FOQA 3AK0A 4K9SA 2JECA 4LO4B 3WCRA 5J37A 2QVSB 3ZVXA 4CDUC 4DINB 1KXGA 3EBRA 4Q4X1 4GB33 4EJRA 1BVVA 1H9WA 2WWSA 3APBA 5HXVA 1SCSA 1WA4A 3TBDA 5JSRA 4FOYA 4COWA 2A71A 1UW8A 1H8TC 1ZZ7A 3VBSA 3E5QA 5FQ0B 3SMHA 1QJU2 4NHLA 3WINE 1NCRB 2YC0A 4Q4W1 1PM7A 1VP6A 1NA1B 1SLLA 4AK3A 4S2HA 4E9KA 4FTBA 4HPKA 3RWNA 1R1A1 2DVBA 4MSVA 2DVAA 3KGZA 5C4WA 2WSVA 4ONUA 4OHYA 3ZSJA 1PIV2 5F1RA 3V0BB 4Q0SA 3FUOA 3USUA 4AVVA 3OGGA 3U07A 2WL1A 3AM2A 3HD8B 5DUWA 1DDLA 5F6KA 3E6CC 3IPVB 1O3RA 1R083 1S0FA 2A6WA 2YDEA 4WM7A 1OA3A 3JCIA 1HDKA 2ZGMA 4YGCA 2NMOA 3U0ZA 3OGJA 4JQRA 4Q0PA 2GC0A 2R063 3O12A 3QACA 2ZZJA 1MS8A 4ZU4A 5JCTA 1VBA1 1AR92 2BGCA 3PVOA 4XJ9A 3WY6A 3WQ1A 4Y22B 3R0RA 1VJ2A 2RE9A 4DMIA 1IKPA 2GNDA 4OI1A 1DHKB 4M3CF 4CEYB 1ZRDA 2UY8A 2BVBA 1PGW2 1QJX2 4WM8B 2ZGQA 1GICA 5KWRA 3BOPA 2YUEA 4CYDA 1QJZA 1X8EA 1H4HA 3H0OA 2HWB2 1SFYA 3TNQA 4AEMA 5CNAA 4GKYA 5AC92 3OJBA 1EYBA 1WGPA 2ENRA 1ENXA 2MEV3 2RS12 1MS3A 1JTZX 1CAVA 1WMEA 1G9AA 2VGDA 3NSTA 1WBFA 5JDBA 4QPGC 4M3CB 4DY5A 4OHWA 2OUJA 2DV9A 3X29B 1RHI2 5FDBA 4KWLA 3JBG3 4D7TA 2BW8A 3A0KA 3SH3A 3NAPB 3N4MA 1OPMA 5CFDC 3PMEA 5KHJA 1GSLA 3V64A 3K51A 2HWD1 2XLFA 1YIPA 3ZN6B 1BBT2 4BMBA 5J36A 2RS53 3AP9A 1RITA 4IV1C 4AYUA 1B35C 2A3YA 3ES1A 1W6OB 2OYZA 5JIAA 4E4SA 2PYTA 3JQXA 4QM9A 4I0WB 2D44A 2GU9A 2ZKLA 4IEVA 3SCHA 5LEJA 4N9HA 1RUH2 4HSJA 4N43B 5FBZA 4IEYA 3CJIB 4XQDA 5KC5A 3V65A 3LGRA 2Z79A 3H9AA 4IEXA 2WNVC 3PJYA 3QH6A 1AZDA 2ZOEB 4YVWC 3OYWB 5KXBA 4JRLA 4LBLA 4X6QB 1S0EA 1GQGA 2DF7A 4LA2A 3M3EA 3HBZA 2Y0IA 4JCKA 2B46X 1IPKA 1CPNA 4YW4A 1UZZA 3NV2A 5K0UA 2IC1A 2PA7A 4JGYC 4K1YA 3AJYA 1PIV3 3M8LA 4XE9A 4QGNA 2E7TA 5GKAC 2OVUA 4K21A 1W6NB 4RS5B 4AFMA 1RUF1 4JTOA 1IGOA 5H9QA 1D0GA 3ZSEA 2UYAA 4DB5A 1QJU1 2A70A 4ZKTB 5AFEA 2YPJA 2IXIA 3RJRA 5BYNA 1X8MA 1AR93 2ZX0A 1YWKA 4GXLA 3INAA 3SCFA 2A7AA 4N53B 4DS0A 1UF2C 1AYM1 3GHMA 5GZEA 4YSFA 4XBNA 2R073 2V5YA 4YZ4A 2ZKNA 4JRAA 1FOD2 4COZA 1QJX3 1CIWA 1UD1A 4Q26A 4FXKB 1REEA 5FQ0A 1RUG2 4IEUA 1NCRA 1YJLA 2Z2SB 1YHFA 1BJQA 2HWB3 5E8AA 2R0HA 4LE4A 1JOJA 2BYVE 2XJSA 2JJ6A 3HT1A 2WKKA 1LGNA 1RUJ2 4GH4B 4N7IA 4Q2FA 4EV0A 2WZR1 3B00A 1ZZCA 4MGYE 1DGWX 3ILFA 4XPVA 1BZWA 4Q4V1 3IPVA 2IFWA 4Z1VA 2R042 2RM22 3JD72 2QKDA 3RJ2X 3HR9A 3HIFA 2E53A 1Q5OA 1RHI3 1RINA 4YZ3A 3UL2A 3VDDA 1ZRCA 2HWB1 3MDPA 1MQTC 4Y22A 1S1AA 4NHKA 5AC91 1YNAA 3B94A 1Z7S1 2NM1A 1O7FA 2RS11 4CEYA 5C6CA 3SXWA 1XE8A 1XRUA 4P5HA 1BBT3 2Y38A 4S2GA 4WM8A 1LENA 4MVTA 5BXXA 3WW4A 4IL7A 5FREA 1RIRA 3UKTA 2OZJA 3MW2A 1IPJA 2QUOA 5EFUA 4YM3A 4YW1A 5SV8A 4KL1A 3FZ3A 4M00A 2DURA 1RUH3 1X50A 4WV8A 5JPMB 1VBB1 4HKOA 2ZHKA 3CNAA 1WD4A 4M3CA 2EALA 5JLVA 4AVTA 1AXKA 4EN6B 5JAXA 1ULGA 1KS4A 1BBT1 3VBUB 1UU6A 3D0SA 2VQAA 3GBGA 5HI0A 3VKOA 2JE9A 2PAMA 2UY9A 3NAPA 2CGNA 5T50A 1PK6A 1RVF2 5L7OC 2VH9A 1KQRA 4JV4A 5CA6A 4IEOA 3FBMA 4C1XA 4Y5Z0 1AR61 1VALA 3PNAA 2BFUL 2WQZC 1W6OA 1VAVA 4LO5B 1ND3C 3ASIA 1MACA 2GNTA 1EPZA 4BLIA 4DZGA 4A3XA 1O5LA 4N43A 3NKGA 4IV3C 3CJIA 4NR1A 3MI8A 4I30A 1QNWA 3D82A 4XMIA 5GZFA 4MYEA 2H0BA 1VAMA 1UZYA 1FOD3 1PGSA 2GMMA 3OYWA 1WMDA 5FPZA 3H7JA 1APNA 2W0XA 1QJY3 1RUG3 2C0ZA 2XJTA 1W0OA 2ILMA 2HWC1 1JHNA 2ZAHA 4Y1XA 1RUJ3 5FO7B 3HT2A 4LO8A 1LRHA 2FMDA 5C33A 1NLRA 2ZGSA 5CG8A 3DN7A 1SLCA 2YXSA 3UKNA 3WDUA 2JEMA 1W6NA 4RS5A 1PZ7A 3JU9A 3M3IA 4QGMA 2DTYA 1LJ7A 2ZZQA 2Q30A 2RM23 1I5ZA 3JD73 1NG0A 5A3MA 3U10A 5CFCC 2NPIA 2I74A 3CEWA 1HQNA 3VZMA 3FFQA 4N53A 1YFWA 1ZZ6A 3ZFEC 3I4IA 4XFIA 1R1ZA 3RI9A 2WIIB 4Y26A 1C1FA 4XXPA 2BUKA 2WINB 3U4XA 2JX9A 5AVAA 1KD7A 4HKWA 4IXLA 2FZ2A 1AJKA 2R041 2RM21 4L11A 4LBNA 5C8CA 4R9DA 1IHMA 3RYRA 2LM3A 2XLAA 1PHMA 4GH4A 1C57A 2VW0A 2YZ4A 2GN7A 1CX4A 1O4ZA 4AVSA 2P34A 5LK7B 2XG3A 1OFNA 1TQ5A 2R1DA 5H9SA 3VBSC 1Z78A 3UV9A 3WDTA 1N3OA 1W6QB 3IKWA 1N1VA 5K8SA 1NCQA 3RI8A 1X7NA 4AQ2A 4FPCA 1RVF3 1Y3TA 3VBFB 2O0OA 2O8QA 3OY8A 5GLTA 3WG2A 3ZDSA 1FPN2 4OULA 4Q29A 2XBO1 3D6EA 3ZXGA 3WOGA 2X5IB 2C5DA 4YYOA 3FLRA 1V6IA 2DVGA 1S0IA 1MEC2 4YRDA 1VRH1 3GHNA 4BCUA 4DQAA 4FPKA 2WLQA 3WG4A 2YGLA 1NLSA 4CEWB 2AGSA 4Y1UA 1TE1B 2AH2A 2MNGA 3JUUA 1AVBA 1ASJ3 4FOVA 3M3QA 2RHPA 2ZMKA 2B8MA 3FE5A 1C8NA 3KSCA 4Q1RA 5DXDA 3ZXJA 3SISA 5DG1A 1V6NA 2ZHNA 4DFSA 1HXS2 4H14A 1URXA 3FLPA 2JG8C 4IEZA 1LECA 1LCLA 1CAWA 4XW3A 4RHV2 2ZAAA 4LBJA 2E51A 3AX4A 1MS1A 3S6PA 2HEYF 1MZFA 1YFXA 4AHYA 1S0JA 5DDJ3 4SBVA 2JENA 4K1ZA 1AYN1 4GALA 1DQ2A 4XBQA 2D93A 2ZMNA 1RUD2 4YW2A 4E4DX 2EXJA 4Z92B 1SBFA 4GWNA 4FT8A 5T5PA 4RA0A 1W6PB 4HPKB 4HANA 3QCWA 3PTYA 4L99A 3POWA 1MZ6A 2W08A 5I8TA 4D7YA 2YROA 2BNMA 2HWF2 1UIJA 4AHZA 1RUI2 3AZZA 3MYXA 4NPRA 2E7QA 1SLBA 1S0CA 3NV4A 4BZ4A 3G7DA 4WM7B 2A5ZA 5JVVA 3RQ0A 4EWEA 1J59A 1IS3A 4EROA 4MGIE 3USSA 1AXYA 4FBFA 4P9IA 3NJZA 2V09A 1WW6A 1E57A 2VVEA 1QH6A 4FPFA 4QQHA 1NQJA 1ZZ9A 3AFKA 3EQEA 5J98B 1I9RA 2BFUS 2DCJA 3M7AA 2ZS6B 4XFCA 1N1TA 2QZ2A 4Y4YA 2A6VA 3HWJA 1LOFA 2ZHMA 4XIKA 5LRRA 2RJLA 4JC1A 4META 4PDWB 2WNEA 3KB5A 1WUVA 5JOXA 2CTVA 1LB2A 1GZ9A 2BWCA 2PFWA 4P9YA 1NOVA 1CAVB 3IIAA 4OLLA 3SH4A 1YO8A 1PGL2 1COV2 3RNSA 3NW4A 5F9TA 5JOZA 1RUOA 4S2DA 1MZEA 3VZLA 2VW1A 2AREA 4YARA 2R062 4OFGA 3MFAA 4X8NA 2VMIA 3ZO0B 1RUE3 1JUIA 3VBRA 1YCIA 3NWKA 1RGSA 1FPN1 3J26N 1HRI2 3PVNA 3DUIA 4AWDA 4LE3A 1NCRC 4AI8A 4P9WA 1W6QA 3KZ4C 4HBNA 1NA1C 4F3JA 1O3QA 1MEC1 4G3YC 2Q5TA 4QPIA 3OBTA 1JH5A 5E16A 1U5YA 3VBFA 5I91A 2WNUB 1HXS3 1IZ3A 3NV3A 1AR72 4K40A 4RHV3 5BV6A 3WG1A 3DF0A 2I45A 1CAXB 5FLIA 4FPGA 2X5IA 4C0HA 4B3NA 2DFCA 1TNRA 4KWJA 4J1WA 1RUD3 3JQWA 2C9AA 4XBLA 5J48A 5GZCA 1DLLA 2BVVA 4RQPA 5IK7A 1FXZA 5BNPA 3SCGA 1WD3A 2VUJA 1C1LA 1S0GA 5GZDA 3EJKA 1PZ8A 2WFF1 5K0UB 1MS4A 4PIZA 5J96B 4FTSA 4WM8C 1OMIA 1ULDA 2D40A 2VNRA 1DQ4A 5T55A 3AYCA 2HWF3 4R9AA 2A73B 3SH5A 1RUI3 5FPXA 1ZBA1 3ZYIB 1POV3 2JXAA 4AHWA 1D4M3 2JDZA 2GH8A 2IZWA 4KNCA 2DFBA 1DGWA 1RUC1 4K20A 4LLFA 1RB8G 2DTWA 1ZZBA 4KU7A 1R091 2JG9B 4Q27A 4OHXA 2P17A 4OUSA 1GZCA 5FO9B 5JI9A 1FT9A 1QOOA 3WG3A 4OHZA 3RDIA 3H3ZA 1OPOA 4WZCA 3WW3A 1U0AA 1XNKA 4YLZA 1KFXL 1F2NA 3NAPC 3U11A 1S0DA 1LOAA 4OI4A 5C9AA 1LTEA 3PVEA 1Q8OA 4K6BA 1W6PA 2RMU2 4YZ1A 4UW3A 3N7KA 4LHNA 1WLCA 2BEOA 3B9CA 2H6CA 4R52A 3WVJA 4GB31 4B8EA 2DCKA 1ZBE3 4I0BA 1LODA 3J4UH 1LOCA 2PHTA 1COV3 3R4UA 5I93A 1C3HA 4LHKA 2UWBA 3WHUA 4D3WA 1QU0A 4GWMA 2EVXA 3WD5A 4I02A 5HCAA 2RS32 3VDDB 2Z5WA 1J1TA 2CL2A 5IK5A 3FLTA 4BPZA 1IQAA 1XYPA 2D3PA 4DXZA 1AF9A 4E27A 5KHKA 2R072 4LTAA 1HRI3 4QGLA 4I0AA 5F5QA 2VXRA 3VKNA 4L8QA 4PCRA 2QFEA 1R081 4XDQA 2VUAA 5JPNB 3RRDA 1DYKA 2IXJA 3AMNA 4PDWA 2WA4A 1H1IA 3ME2A 1SMVA 2R061 5BNOC 4BWOA 1AR73 4FXGB 2CYFA 4Y1ZA 1F5FA 5IT6A 3SITA 1SCRA 5GJ6A 4FSJA 1LOGA 4RS5C 1GLHA 2VNGA 2P3IA 4JGZB 4J1XA 3WR0A 4AI0A 4DRRA 1NY71 1VBC3 4IERA 3ALQA 1ZX5A 2HWE2 3LKJA 4RL7A 1LGCA 3N3HA 2ZGPA 1WCSA 3PHMA 4CDWC 1AR83 3ZMNA 1SQ4A 1BK1A 1SLAA 3LZZA 1PK6B 1W39A 1XXNA 4Z2WA 3TNPB 4CDUB 2MEV1 4SLIA 1BQPA 3TWIA 2R0FA 4R9CA 4FAHA 1A8DA 1XNBA 3ELNA 4FP3A 5FAXA 1CD3G 4JTNA 3JB8A 1QDCA 1H8TB 4XF4A 1WW5A 1J58A 4LEJA 1X33A 4HVRA 2WNUA 3AP4A 2LALA 3JBG1 1FATA 2EF6A 3ROUA 2ZGNA 1NXD1 1CAXA 1LESA 5AFBA 3M4FA 2GNBA 1CR7A 1UPIA 3VKMA 3J9SA 1QMJA 5LRSA 2RS51 4AI3A 2NMNA 4ES9A 4Q4Y2 3KS7A 1S0BA 3ILRA 3AYEA 2W52A 4PLMA 4CP2A 4YG0A 3D5OA 3BU7A 4CZSA 1POV0 1TEIA 3MIHA 1QNYA 2D6LX 3D0JA 3KLSA 3EO6A 2RMU3 4XETA 1CAUA 3GBWA 3H1YA 3N7LA 4FQZA 4XTMA 3THPA 2ZBJA 1OQEA 3WUCA 1ONAA 2BWAA 1XYNA 2E6VA 2JD4A 3AXDA 3FX3A 3MW3A 4I3GA 3IM0A 2ZGLA 4R8HA 4YVSC 3OCPA 2D98A 1UN1A 1XU1A 4MLOA 4XTPA 2A6ZA 3W9AA 4CDQB 1GNHA 1VLNA 2JG9A 3AZVA 2QNKA 2RS33 2XUMA 4AEJA 4B29A 2Z42A 4XF0A 1KFUL 4FQ4A 5GLVA 3VBUC 4PLNA 1OD5A 4FAGA 3MIGA 4URTA 4ZXKA 5H9RA 1PIV1 1F5JA 1LHOA 4YW3A 1QDOA 3R4SA 1QJY2 4QPGB 1RJ7A 4IETA 2NZ9A 4D94A 1MS0A 4MH0E 3GZUC 3VL9A 1ENRA 1V6KA 4GQ7A 5BNNC 5C8CB 3ZN5A 3M2MA 2WLPA 3VHNA 4A7YA 3E5UA 4NOTA 4WVZA 3WW1A 3K48A 4MUVA 1AR91 1RMU3 5EYYA 4QQ2A 1C5IA 3OPZA 4YG6A 2R071 4A2UA 3MIDA 4XFAA 1PGW1 1QJX1 1UPSA 4YM0A 3TYJA 2HWE3 3V0AA 5JR7B 1Y7BA 5J09A 2AUYA 1ZA4A 2XJPA 2DUPA 2RR13 1WW4A 1NCQB 2CGPA 5I0RA 3SLIA 2AZ5A 2Q0AA 1AL22 1IS4A 3OY8B 1YJKA 1YFYA 2NLRA 1EV12 2YGMA 2AR6A 3MLJA 3MGUA 3JB4C 4JVAA 1LHWA 2CV6A 3HMYA 4AQTA 2ZJCA 3MLKA 2A6XA 2QE3A 4XMAA 5D8AA 5FOBB 3ST7A 5CBLA 2I2SA 1EPWA 4DPNA 5FMOS 2GALA 1RHI1 4AQSA 2VOWA 4MXWA 3TN93 4BIFA 1CPMA 3NKTA 3KM5A 1QQP2 1FNZA 3J8F2 1UKRA 1ALYA 3ZXEA 1HW5A 4JDNA 5JSPA 4JGZA 1PVC2 4HLTA 1HIXA 3G6JB 4JGYB 1VB2A 2GMPA 5T5OA 3ACLA 3RZZA 3WDVA 2FHRA 3MLLA 4Q4Y3