5J8YC

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
MPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
molecule keywords Polycomb protein Scm
total genus 23
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yC00
3SEIA 2L5YA 1LKYB 2LMRA 2B6GA 1KW4A 5F3XB 2E8OA 1SV4A 2D3DA 2QKQA 1OXJA 3TADA 3BQ7A 2QB0B 1B4FA 2F44A 2ES6A 2EAOA 4MHVA 2QARA 1PK1A 2KIVA 5JTIA 2QB1A 2EAMA 4PZOA 3BS5B 2KE7A 1WWUA 3KKAC 4NJ8A 3SENA 2DKZA 2GLEA 1X66A 1PK3A 3IDWA 1SXEA 4RQMA 1V85A 3HILA 4RQNA 2Y9UA 1JI7A 1OW5A 2F8KA 3TACB 2K4PA 5JU5A 3KKAA 1WWVA 2K60A 1V38A 1B0XA 2DL0A 1COKA 3K1RB 3H8MA 2KMDA 5J8YA 2Y9TA 4IS7A 2QARB 2KG5A 2QB0A 4PZNA 2EAPA 2F3NA 3BS5A 1Z1VA 4NL9A 4NL9C 2KSOA 2YTUA 1DXSA 1F0MA 1PK1B 1SGGA 2D8CA 3TADC 1SV0C 2KSOB 2EANA 1SV0A 3BS7A 1UQVA 2ESEA 5KNIA 2LPEA 2E8MA 1LKYA 5JRTA 1SXDA 1X40A 1UCVA 5J8YC 2E8NA 2JV3A 2DKXA 1RG6A 2E8PA 5L1MA 1X9XA 2FE9A
chains in the Genus database with same CATH superfamily
4R8UA 5EOZA 3Q8SB 2B0CA 2R8KA 2HBKA 3PNCA 1KW4A 5EE1A 3MFIA 5AM3A 1Y88A 1RDFA 4Y2YA 3HWTA 1SV4A 4KX3A 2LM1A 3F2DA 2LKYA 4B9TA 4FZMA 5HHHA 1S77D 2DQNB 2RRDA 1KL9A 3D2SA 2V9WA 1N62A 1L3VA 2J6SA 3ZDEA 4UAUA 1ZQLA 3ICXA 2C22A 3UPQA 3AL0B 4RQNA 1NK0A 1JI7A 2ZXHA 4KX5A 1RM6C 3M9MB 3DEEA 3F5AA 2RQ5A 1NJXA 5JU5A 2ALZA 4M6WA 4IQWA 4QWCA 4DL6A 2ZTCA 1KKXA 1BPXA 3C5GA 4OJ5A 1X9MA 3KHRA 4FE3A 4PGYA 2KFZA 1RQNA 4E0DA 4ZOHC 5KFOA 3AEVA 5IIIA 5KG4A 3Q8QB 4KLEA 1QQ5A 1CI4A 2WB1F 1WG8A 3SR6A 2KVCA 1NK9A 3HKZC 5J2HA 7ICNA 5EE3A 1OUQA 1DK2A 3J81j 2R8IA 1LVHA 1Z4OA 5KFXA 2LM4A 2WTFA 5KNIA 1J2MA 2F1IA 8ICUA 1RPLA 7ICUA 3RRHA 2E8NA 3IP4B 4KLMA 2RHFA 4DFKA 1N48A 4I2HA 2ASJA 1TK5A 2NRVA 4P4PA 4DFPA 5GTHU 2ZIVA 2BPGA 1SIJA 4U7CA 4NLNA 3IHQB 3C5FA 5G5HA 5DLGA 4B9SA 2UVRA 4ED0A 4TQSA 4B9UA 1S0NA 2KZMA 1A0PA 3EWAA 5KFWA 3F53A 3PX4A 2JH7A 3RJFA 1SL0A 8ICLA 3SENA 3AU6A 1ZJMA 5EWFA 5J2CA 5L1KA 9ICMA 4DSJA 3CNHA 2MUTB 2ZIUA 5KFPA 4IRDA 2MA1A 4I2EA 8ICQA 2YX8A 3PY8A 4KLGA 2A3VA 1JUDA 7ICQA 3BQ2A 2W03A 4PHAA 1ZQTA 5C0YA 3RB0A 8ICBA 2CXYA 2LHTA 1HJPA 2ZUDA 4G9BA 2A1AA 2KFNA 8ICWA 3WKEA 4C8KA 5KT7A 4PGQA 3K4GA 3MR5A 3AMZA 4KLIA 4F4WA 2JEFA 2IBKA 1IM4A 5J2BA 2YN4A 4Z6FA 4F5RA 3RAXA 3TI0A 3L4PA 3PSFA 1L3TA 3SZ2A 4ECQA 8ICNA 4ECZA 2FDRA 3K75D 2HW3A 1S10A 4Q43A 4CDGA 8ICCA 2WAQC 3GIJA 2BCSA 2PFPA 9ICVA 3OTQA 4J03A 4RQ6A 2W55A 2UVVA 1S0VA 3CP8A 5GTIU 1PVQA 1XSNA 2P6RA 4JK1A 5ALLA 3B0YA 2BPFA 4BDPA 4CF5A 4R65A 5JTIA 4CF4A 3BZKA 5J0UA 3GV7B 2EZXA 2GH1A 3QUBA 4M9NA 4IC9A 4QZHA 2HOIA 5BPCA 4DEZA 3M8SA 4YR0A 1ZQPA 5KTQA 4US8A 3SYZA 3TACB 4YD1A 2XCPA 2KMDA 5J8YA 5L1JA 5F9LA 4RNMA 4P0QB 2Y0SC 4RQ8A 2NRTA 4F3OA 2F77X 1ZJNA 9ICFA 4M0AA 5KFIA 3ISCA 4DS5A 5TISU 4RQ3A 3T3FA 3Q8LA 3BS5A 3ED5A 5KG6A 2W7OA 3ORYA 3JPOA 1DRGA 4DF8A 4QWBA 2HSZA 1DK3A 2KKVA 3RJKA 2K4IA 4GIBA 4ECSA 3GV8B 2BCUA 2KSOB 5HP4A 4DSEA 7ICMA 1K5OA 2Y0SF 2HHUA 2P35A 1UQVA 5KFUA 1LKYA 3GV5B 4MF8A 1KFSA 1X40A 4IQVA 3T79A 1Z19A 2W9CA 4NLCA 1J2NA 3NRZA 4C80A 2W9BA 2B6GA 1WYGA 4EX6A 5KFVA 2BKEA 2C2DA 7ICLA 5AKZA 4QW8A 3RJEA 3HKZF 5ALMA 2HHWA 5DGBA 2Y1JA 3IN5A 4KTQA 3EYZA 3Q8KA 4PL1A 1BGXT 2XC9A 3PZPA 2AU0A 1SWVA 3M7DA 1F5SA 3UMGA 4DSIA 2N1RA 4M47A 5AI0A 1OW5A 5KT6A 1WWVA 1ZOLA 1ZQOA 1NZBA 2HCFA 2DL0A 2DGZA 2K8BB 5AM2A 4B9NA 5L1LA 5B5EU 4IRCA 2C2EA 4DWIA 3PMLA 5DQGA 3MR6A 4J9SA 5KT3A 3WKAA 3NASA 1KFTA 5DG7A 1QLNA 2FPLA 5IILA 5L1IA 1FEZA 2ISOA 4O5CA 2EAPA 3RJJA 5AI5A 3MDAA 2VJ5A 3SAHA 3QX7A 4XUSA 5DBCA 4Y2VA 2H3QA 5DQIA 2YMPA 1FIQA 3B0XA 1FFUA 1ZQGA 1XSLA 1BNPA 3WK5A 3TADC 1RYRA 8ICIA 4RT3A 1UPHA 2VKQA 4KLDA 3HJEA 2EANA 4DQRA 5DB8A 3ALRA 4UW9A 2D6FC 4O5KA 4NY8A 3S6JA 4UAWA 1BVSA 4FBUA 2HI0A 1UCVA 1X6IA 1SL1A 3TFSA 2HHQA 4C7ZA 2W3SA 1UT8A 1Z00A 2DFLA 4P2HA 1DGSA 4PPXA 3RJIA 9ICNA 2W9AA 4KLOA 4DFMA 2QKQA 2BCRA 4ED7A 4QZ8A 1N56A 9ICCA 2ZJAA 3PW2A 5KG2A 2EAOA 2ODGA 2W7PA 1ZQFA 4B9VA 4I2DA 3RB4A 9ICGA 2WF5A 1QQ6A 4F2RA 2K8AA 4ICAA 5KG5A 3NGDA 5AI8A 3H0LB 4IQUA 2P66A 3E0FA 8ICJA 3AQEA 3WK7A 2XY5A 4ED1A 1ZQHA 4UAVA 3NS1A 3KZXA 3JPTA 3GIIA 1BPEA 1S0MA 1D8YA 2VA8A 5J2FA 3LK9A 4C8OA 4GXJA 4DQIA 4QZFA 4J9KA 1TFRA 3MGHA 3M1YA 2JHDA 5KT5A 1C20A 4EBCA 8ICEA 1L7MA 1Q46A 5DLFA 1JROA 1O03A 2E1FA 2Y1IA 4CF3A 3KOOA 2DPIA 1ZQXA 1TKDA 2VIXA 5CRXA 5DKWA 5DBBA 2AGOA 3MC1A 1CUKA 1NZPA 2G07A 2WB1C 4IQTA 1KSPA 1HUZA 3GQCA 2WF7A 1D9FA 5ALOA 3UXNA 1U45A 1KDHA 4XQ8A 4G3IA 4QIWF 4ED2A 3MR3A 2YB4A 9ICWA 2YMLA 4C0ZA 2LPEA 5KFQA 4MFFA 3KD3A 1L7NA 4F4XA 2Z7JA 2NO5A 1PZNA 2L5YA 4F92B 5TZVA 5AK3A 4Y2JA 5AK4A 2AGQA 4RQ5A 1D8BA 4CGZA 4CE6A 1H38A 7ICIA 2K8CB 4US9A 4DO9A 8ICPA 2F44A 4MHVA 4CNQA 3N97B 4YXMA 9ICXA 3SV4A 2BR0A 2WF8A 4UB6U 5ALYA 4GC7A 5CA7A 4BWMA 2DPJA 1S76D 1Z3EB 1ZQZA 1NOMA 2G5IB 1U47A 3MABA 3JPPA 1WCLA 1Q3VA 4QZAA 3M8RA 2HDOA 4UQGA 4USAA 3TARA 1BPDA 5DBAA 9ICRA 4J9NA 9ICBA 2IHMA 2E1EA 4DL5A 2C28A 3A0HU 4B9LA 2JEJA 4FS2A 4Z6CA 3QU7A 2Y9TA 2BZFA 3QZ7A 9ICKA 2MSNA 3I76A 1CRXA 1HIWA 1ECWA 4OO1J 7ICKA 2BDPA 2F3NA 1GO3F 3F5EA 1Z1VA 4QZDA 1MN8A 4NL9A 5HMLA 5AI6A 2JXJA 4YR2A 5ALIA 4M9GA 1SV0C 4I2AA 2EZYA 1QSLA 1T94A 1WUDA 5CJ7A 2LYAA 4OJLA 2UVWA 4F93B 1ZQVA 2ZIXB 1Z00B 4EBEA 4WJ3B 5KFGA 2I6XA 4I27A 8ICXA 4I2FA 2AH5A 2JGAA 2K4HA 2MUTA 2ZIUB 4ECRA 4F72A 4RUAA 4IR9A 2KJ5A 2Q0ZX 4YFKA 5DB7A 3HPOA 2H3IA 2NV3A 2BPCA 4Q44A 3N7SC 3NRWA 2I5HA 4OD0A 3UXOA 1N5WA 5IINA 2EAMA 2CN1A 5ALKA 1QH9A 4EBDA 5KG3A 4GXIA 4GXKA 4NXZA 4F4KA 3ZDAA 4MF2A 3IG5A 3BDPA 2KEYA 2KJ8A 4Y2XA 5KFAA 5J0TA 2OM6A 3QUCA 4F5PA 1ED1A 4K4GA 4DCCA 3ZD9A 1S0OA 4KLFA 3SAGA 1S8OA 2E3TA 4C4TA 4LVSA 4DSFA 5J2KA 1JXEA 4UB1A 1L6NA 5J0RA 1TE2A 4ECXA 2OYYA 4ECWA 4ELVA 4DL2A 3QUTA 5AKGA 3G6VA 1YZ7A 4JV2A 3AU2A 3B9JA 3CYMA 3THVA 1KRPA 2JH1A 1QQ7A 2MRLA 2YTUA 1NKCA 3WKCA 1ZYQA 3H0RB 4P4OA 2XCAA 3ZI4A 7ICJA 2OWOA 4ELUA 4J9LA 1IG6A 4P4MA 3PSPA 1SV0A 4UARA 2W43A 5J0QA 2HBJA 4K4IA 5HR7A 1LV5A 4RNNA 1ZQSA 2KZ3A 2R8JA 1MA7A 1SKSA 4BX9C 3GIMA 1LKYB 3NVYA 4YVZA 4JMUA 2IOHA 1XS9D 3BQ1A 1ZD4A 4BGDA 4PHDA 2CRXA 2WF6A 2PMZC 4Y2QA 3H0MB 5DDMA 1JRPA 4EYIB 5IIMA 5ALDA 3H8JA 3V6KA 4F2SA 2YMQA 1RQLA 4DQQA 2VA3A 1ZRMA 3H4BA 3H8SA 1UHUA 3BS5B 5KFHA 4O3PA 1ZXIA 2YQEA 3V6HA 1TAMA 5HNKA 4M6WB 2AHOB 3GILA 1SWWA 2KZZA 4O5EA 4C4RA 1KBUA 4FO6A 4R8UB 4DQPA 1NJZA 4QZIA 4RQ1A 1TAQA 1D9DA 1IIPA 1UA1A 8ICSA 2K60A 2JEIA 3K1RB 2HVIA 5KFJA 4X5VA 4DQSA 3I28A 3EW9A 1ZETA 4IS7A 8ICRA 3RH4A 1B43A 3BQTA 5BOLA 1HUOA 1FO4A 2FMPA 4IRKA 3ISBA 3SI8A 1U4BA 1VJ5A 1MQ3A 2JRZA 4BUGA 2BQ3A 2R8GA 1X9SA 4BJQA 1ZQQA 1L3UA 3MFHA 3GIKA 3L5KA 4RU9A 5A0LA 3UM9A 4UB5A 1X42A 3DV9A 4KN4A 2EDUA 4QWDA 2OCEA 3WK6A 3N28A 5ALHA 1AROP 3JPSA 4LZDA 4JWNA 3QNMA 2NRXA 3ZDBA 3LVVA 2W3RA 5ALJA 4UB2A 1T7PA 2FLPA 1XNSA 3GFKB 4LZGA 2FI1A 1L3SA 1OXJA 3NTUA 2BQUA 3QU5A 5ALSA 5J2JA 1X9WA 9ICAA 4NV0A 5ALFA 5IIOA 2QARA 1SZHA 2BGWA 4R66A 3HP6A 1L8OA 4JB3A 2RP5A 3H7IA 4UBBA 1ZQWA 3V7JA 3IG8A 2AQ0A 1RZTA 4KLHA 2ASDA 3OSNA 4NLBA 1LB2B 2HVHA 3BQ0A 2W9BB 1FFVA 3LVWA 2HHVA 1XO1A 3UQ2A 2AQ4A 2OXOA 2HBMA 1MC8A 4C4SA 2IMWP 4KITB 2W9MA 1T3QA 1L7OA 1X2IA 3QE9Y 1PUZA 2IHNA 4Q8EA 4AYBC 1XC9A 5KL1B 3G6YA 4NLGA 4CCHA 5AM0A 7ICGA 5EE0A 2KG5A 1WCNA 3LYSA 5CWRA 3BJYA 4HAIA 4OCZA 3EZ5A 2PMZF 2OHFA 1IV8A 3KTQA 3AQFA 3A0BU 5DB9A 3DDHA 2BCQA 5J2DA 4ED3A 1ZQYA 3RRGA 1KN5A 1ZQDA 2E8MA 4F8RA 4DL7A 1SXDA 1Z4NA 5AM1A 2IA6A 2KHQA 1X9XA 2V4QA 1NKBA 3NUQA 3KHHA 3AUOA 8ICMA 2KVSA 3QXGA 3ZD8A 1N60A 5F3XB 4I2BA 4F4ZA 5EE9A 4Z6DA 1V9PA 4M04A 5J2AA 2BQRA 3BQ7A 1MSWD 1Q3UA 9ICEA 3PSIA 8ICVA 2KJ9A 4YMNA 3WK8A 2H3FA 3Q8RB 3CW2C 3SAFA 4ED8A 4O3RA 5AKEA 2F1HA 4R64A 4DL3A 2XY6A 2DBYA 5CR0A 3V7KA 2O6KA 1PK3A 1YT3A 4EEYA 2FMQA 7ICVA 4XRHA 5AM4A 2F8KA 3QYPA 4I2CA 4Y2TA 2KIWA 5AKJA 5KT4A 2AXTU 4Y2UA 4QZEA 4OJ6A 5DQHA 5KFDA 1M6YA 5D49A 4TUPA 3OPXA 3QZ8A 2GWSA 3ETRA 4QWAA 4UBCA 5ALZA 3GZFA 5AI9A 4ECVA 4PZNA 4I29A 2ZJ8A 3RJGA 7ICRA 8ICGA 4F5NA 2G09A 4QZ9A 3C28A 4A8EA 3IRUA 2P6UA 3M6ZA 5KAIU 1KQQA 2FPMA 1SGGA 2D8CA 4NM1A 2KP7A 3M9NB 5KFFA 4YXJA 4RZRA 3PX6A 2KN7A 3BS7A 1TV9A 1XO0A 4RQ4A 4JUZA 1ZQ1C 3RH6A 4TUSA 5DDYA 7ICFA 5L1MA 2FE9A 1K1QA 3KHGA 4QZBA 1XU4A 1B22A 3D6JA 2E8OA 3IV6A 2BCVA 4EEKA 1RXWA 2QB0B 1B4FA 4FFDA 3FM9A 4MFAA 5AKLA 5ALWA 4IR1A 2FPKA 4Q8FA 3PSTA 1SKRA 2XVTA 2DF4B 4F4YA 2WF9A 2F76X 3D2NA 2H3VA 5D4BA 1AQ6A 3HILA 1C7YA 5D46A 2AJQA 3N7RC 3MGVA 3E2EA 3H8WA 3E58A 4DFJA 5AI4A 4DFDA 3RJHA 5IIJA 1NI3A 5KL8B 1X6JA 3PVXA 4RT2A 2B21A 1UT5A 3WK9A 2VANA 2A1JA 1DOQA 1ZQIA 2W9CB 2F8LA 3U26A 2NO4A 3ZDCA 3UMCA 3C21A 9ICSA 5J2EA 3FAHA 5AKXA 3C1ZA 1NJYA 3OGUA 3UQ0A 5KG0A 2KTQA 4TUQA 8ICKA 4P0PB 2ATLA 3KZIU 5EWEA 4FZNA 2EZZA 2NRZA 5J0PA 4QZCA 1MQ2A 4Z6EA 2Q4TA 4O3QA 3BZCA 5J0XA 2HMXA 2VJ4A 4JV1A 1YZ6A 3PO5A 3PW4A 3MR2A 4RNOA 3V7LA 3N4MB 4J9QA 2JV3A 2E8PA 1N61A 4DSKA 1J97A 5CHGA 8ICZA 4O3SA 5K4LA 4NM2A 1NK7A 1JX4A 5F9NA 1KEJA 3PW5A 3EPGA 2W04A 2F2AB 4QIWC 2D3DA 1ZQMA 5ALPA 2EQYA 5KG7A 1BPBA 2MAXA 4ZH4A 3C23A 3EUB2 1WWUA 4J9MA 3SV3A 2EH9A 3AM9A 4EZ6A 4NJ8A 2J6UA 9ICHA 2DKZA 1QSSA 2W8LA 1O08A 3H40A 4JV0A 2F1JA 5J2GA 4RQMA 1D8LA 4AYBF 4PGXA 7ICPA 2V4RA 3I1YA 5H2FU 3Q8MA 4P0QA 1TAUA 1TVAA 2XICA 1NKEA 1V38A 4YCXA 1TK0A 5B66U 3TAQA 3JPNA 2R18A 3C2KA 3RFAA 3PW7A 1DGJA 3NVWA 1RYSA 5AIBA 5AICA 1QTMA 1COOA 1F44A 2ZIWA 9ICJA 4QNLA 4HYKA 5KAFU 5ALEA 2VA2A 2A19A 3QU4A 1NK5A 3LWMA 4UB8U 2PI4A 1DXSA 1F0MA 5J2IA 1VLBA 3QU9A 5IIKA 3IM1A 4B6JA 2JR5A 3KHLA 8ICAA 1N2XA 3SD7A 1QCKA 2LYBA 4YN4A 4B9MA 4BXOA 3KFUF 3PW0A 7ICOA 4UAZA 4QZGA 2DKXA 3RBEA 5KFMA 1RG6A 5KFLA 3EPIA 2C2RA 4UAYA 2NYVA 3T5LA 1T3NA 2OH2A 2KICA 8ICFA 2HHSA 5ALQA 9ICIA 3HW8A 1ZQNA 2RDJA 2ZIWB 1N63A 4RPZA 4KLSA 3TADA 1ZQUA 2RLTA 4ECTA 2KKPA 1A77A 1N5XA 5JUMA 4I2GA 4YMMA 5J29A 4KLQA 3NVZA 2UVUA 5AKYA 1A6SA 2H5XA 4PZOA 1P7DA 4K4HA 3KKAC 5KFEA 9ICUA 4O3NA 2GLEA 3UXPA 4NLZA 4J9PA 3K1ZA 4YMOA 3QU2A 1RXVA 3OJSA 1V85A 1Q8KA 3WU2U 2GOLA 1ZQAA 1TK8A 5KFNA 3OHAA 3CRXA 4FBTA 3SMVA 7ICEA 5L9XA 5AK5A 1HEKA 2ZIVB 4NWIA 4YD2A 7ICHA 4M9HA 3AN1A 2K4EA 3TANA 2DUYA 4DF4A 5AIAA 4M2YA 5J0OA 1VDVA 1U9LA 3PR5B 3RR8A 5KFSA 1BPZA 4PH5A 5CB1A 3Q8PB 4EENA 1L5UA 2MU2A 4NL9C 3RH5A 4DSLA 2W8KA 1QSYA 4EZ9A 3TFRA 1PK1B 2A1JB 2YY6A 3JPQA 1PVPA 4MEXA 3QEBZ 4CRXA 3M9OB 1URJA 4O0IA 4F5OA 4DOBA 4EYHB 1U48A 5HHIA 4DS4A 3VCBA 5JRTA 2E5SA 1SL2A 3NVVA 5DGAA 2J6TA 5J0WA 4QWEA 2ISPA 4R63A 4P0PA 3SEIA 7ICTA 3GDXA 1ZQRA 2I1QA 5FP0A 1SB3C 4PL2A 5BOMA 1ZQEA 3FDSA 4RUCA 4C7YA 4M9LA 2BDUA 4TQRA 2QLTA 3MDCA 5KFBA 3M6KA 3WKDA 4RPYA 1PK1A 2KD1A 3LWLA 5ALXA 4YP3A 4KMOB 5ALUA 4LJXA 5AKHA 3HT3A 4DLGA 5EWGA 2KHVA 2QB1A 2KE7A 2PI5A 2WFAA 4IL6U 2NRWA 2KOBA 4KLJA 1X66A 8ICYA 1EXNA 1T4GA 2M0NA 4YR3A 4C8LA 8ICTA 1ZQKA 2Y9UA 3MGIA 2PFQA 3HX0A 1NK4A 1SKWA 3RF9A 8ICOA 3KKAA 4Y2RA 1ZQBA 4F91B 1KTQA 1B0XA 3FC4A 3H8MA 2ZUCA 3WK4A 2DWQA 9ICLA 1S5LU 2LBOA 4O9MA 4OJOA 4O3MA 4YQWA 5CP2A 3R9KA 2FMSA 2HHTA 4Y2SA 4KN7A 4Q45A 2QB0A 2LI6A 3RBDA 4C8MA 1ZD5A 2G0AA 4GFJA 2G5HB 3D2QA 9ICTA 4RQ7A 3VC8A 4PJ0U 2ZIXA 4OJPA 3QEAZ 1JALA 2HBLA 5AHXA 1ZRNA 4ACOA 4F71A 4U6PA 2XI9A 3GU3A 4O3OA 3KBBA 2ESEA 2RDIA 3RR7A 9ICOA 2R8HA 1ZD2P 1IXRA 2LYHA 3T5HA 2XGQA 4MFCA 4GLXA 4J9OA 4I2IA 1JN3A 3RAQA 4FZLA 1NK8A 2ES6A 2JZBB 4YG2A 4DLEA 1U49A 4NLKA 3O0FA 3C1YA 4RQ2A 5CEHA 4ED6A 4MEYA 2ZG6A 5KFZA 4I2JA 3N7PD 1JIHA 4UB4A 4QW9A 4GC6A 5J0SA 5AK6A 1SXEA 2XGPA 2K4PA 4C8NA 4PHEA 3F2CA 2FLLA 4KLLA 2OEHA 2HOFA 5G5GA 1SZPA 1NK6A 3ZDDA 2ZXIA 5HMMA 4BWJA 1ZQJA 5KFRA 5HR6A 3V72A 3PO4A 5ALTA 3MBYA 2GO7A 1Z1BA 1UA0A 1T8EA 1CEZA 2FLNA 2HOQA 2PXIA 3SQIA 5DB6A 4KLTA 4J9RA 2G06A 5C5JA 3TQ1A 9ICQA 5J0YA 2YMMA 5AM5A 4RPXA 2XY7A 2KSOA 3F2BA 1RYUA 1NNLA 1A76A 1L8LA 2XO7A 1BPYA 4DL4A 4ECYA 2PKEA 2IOFA 4KLUA 3OJUA 1JMSA 2KK0A 3ISDA 3PR4A 4UB3A 2ZTEA 3TKAA 3L3FX 3RB6A 4UATA 4F50A 2FJ6A 5ALGA 4F5QA 2ZTDA 2IOFK 1KLNA 5T14A 5AKIA 5E79U 2LMRA 4DOCA 1XSPA 2G08A 3OHBA 1S9FA 3UMBA 3HRDD 4Y2PA 5KFKA 3JPRA 2W11A 2KNJA 1V97A 2PFNA 2KIVA 3RTVA 2XIDA 2KV2A 1K1SA 2K89A 7ICSA 5KT2A 4I28A 2W54A 4M9JA 3WKBA 2CPRA 1XWLA 2ZUBA 3LDAA 1BNOA 1KFDA 4RQ0A 3OSPA 3IDWA 3PMNA 3ONNA 4FS1A 4KMUA 3PX0A 2BHNA 2WHEA 3C29A 3C2MA 1PVRA 2WAQF 4XA5A 4QJFB 4ELTA 3FYHA 4EX7A 1ZQCA 3H4DA 5KFYA 4AP9A 1COKA 3QUQA 4BXOB 4JWMA 2YB1A 5ALNA 3T5JA 9ICPA 3TAPA 5DG9A 4TURA 5DG8A 2QARB 3T5KA 2HHXA 3ETLA 5ALRA 2M9NA 4UASA 3PV8A 2H3ZA 1JXLA 2I9GA 2PFOA 4ECUA 1NJWA 3RB3A 2ZJ5A 1ZD3A 2AGPA 8ICHA 5KFCA 2JZBA 1S97A 3C2LA 5KG1A 5KFTA 4EELA 2ASLA 3G6XA 1L7PA 5ALVA 2JMGA 4PHPA 5AKKA 3V6JA 5J8YC 2JEGA 4DOAA
chains in the Genus database with same CATH topology
3SEIA 2L5YA 1LKYB 2LMRA 2B6GA 1KW4A 5F3XB 2E8OA 1SV4A 2D3DA 2QKQA 1OXJA 3TADA 3BQ7A 2QB0B 1B4FA 2F44A 2ES6A 2EAOA 4MHVA 2QARA 1PK1A 2KIVA 5JTIA 2QB1A 2EAMA 4PZOA 3BS5B 2KE7A 1WWUA 3KKAC 4NJ8A 3SENA 2DKZA 2GLEA 1X66A 1PK3A 3IDWA 1SXEA 4RQMA 1V85A 3HILA 4RQNA 2Y9UA 1JI7A 1OW5A 2F8KA 3TACB 2K4PA 5JU5A 3KKAA 1WWVA 2K60A 1V38A 1B0XA 2DL0A 1COKA 3K1RB 3H8MA 2KMDA 5J8YA 2Y9TA 4IS7A 2QARB 2KG5A 2QB0A 4PZNA 2EAPA 2F3NA 3BS5A 1Z1VA 4NL9A 4NL9C 2KSOA 2YTUA 1DXSA 1F0MA 1PK1B 1SGGA 2D8CA 3TADC 1SV0C 2KSOB 2EANA 1SV0A 3BS7A 1UQVA 2ESEA 5KNIA 2LPEA 2E8MA 1LKYA 5JRTA 1SXDA 1X40A 1UCVA 5J8YC 2E8NA 2JV3A 2DKXA 1RG6A 2E8PA 5L1MA 1X9XA 2FE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEI A;  2L5Y A;  1LKY B;  2LMR A;  2B6G A;  1KW4 A;  5F3X B;  2E8O A;  1SV4 A;  2D3D A;  2QKQ A;  1OXJ A;  3TAD A;  3BQ7 A;  2QB0 B;  1B4F A;  2F44 A;  2ES6 A;  2EAO A;  4MHV A;  2QAR A;  1PK1 A;  2KIV A;  5JTI A;  2QB1 A;  2EAM A;  4PZO A;  3BS5 B;  2KE7 A;  1WWU A;  3KKA C;  4NJ8 A;  3SEN A;  2DKZ A;  2GLE A;  1X66 A;  1PK3 A;  3IDW A;  1SXE A;  4RQM A;  1V85 A;  3HIL A;  4RQN A;  2Y9U A;  1JI7 A;  1OW5 A;  2F8K A;  3TAC B;  2K4P A;  5JU5 A;  3KKA A;  1WWV A;  2K60 A;  1V38 A;  1B0X A;  2DL0 A;  1COK A;  3K1R B;  3H8M A;  2KMD A;  5J8Y A;  2Y9T A;  4IS7 A;  2QAR B;  2KG5 A;  2QB0 A;  4PZN A;  2EAP A;  2F3N A;  3BS5 A;  1Z1V A;  4NL9 A;  4NL9 C;  2KSO A;  2YTU A;  1DXS A;  1F0M A;  1PK1 B;  1SGG A;  2D8C A;  3TAD C;  1SV0 C;  2KSO B;  2EAN A;  1SV0 A;  3BS7 A;  1UQV A;  2ESE A;  5KNI A;  2LPE A;  2E8M A;  1LKY A;  5JRT A;  1SXD A;  1X40 A;  1UCV A;  5J8Y C;  2E8N A;  2JV3 A;  2DKX A;  1RG6 A;  2E8P A;  5L1M A;  1X9X A;  2FE9 A; 
#chains in the Genus database with same CATH topology
 4R8U A;  5EOZ A;  3Q8S B;  2B0C A;  2R8K A;  2HBK A;  3PNC A;  1KW4 A;  5EE1 A;  3MFI A;  5AM3 A;  1Y88 A;  1RDF A;  4Y2Y A;  3HWT A;  1SV4 A;  4KX3 A;  2LM1 A;  3F2D A;  2LKY A;  4B9T A;  4FZM A;  5HHH A;  1S77 D;  2DQN B;  2RRD A;  1KL9 A;  3D2S A;  2V9W A;  1N62 A;  1L3V A;  2J6S A;  3ZDE A;  4UAU A;  1ZQL A;  3ICX A;  2C22 A;  3UPQ A;  3AL0 B;  4RQN A;  1NK0 A;  1JI7 A;  2ZXH A;  4KX5 A;  1RM6 C;  3M9M B;  3DEE A;  3F5A A;  2RQ5 A;  1NJX A;  5JU5 A;  2ALZ A;  4M6W A;  4IQW A;  4QWC A;  4DL6 A;  2ZTC A;  1KKX A;  1BPX A;  3C5G A;  4OJ5 A;  1X9M A;  3KHR A;  4FE3 A;  4PGY A;  2KFZ A;  1RQN A;  4E0D A;  4ZOH C;  5KFO A;  3AEV A;  5III A;  5KG4 A;  3Q8Q B;  4KLE A;  1QQ5 A;  1CI4 A;  2WB1 F;  1WG8 A;  3SR6 A;  2KVC A;  1NK9 A;  3HKZ C;  5J2H A;  7ICN A;  5EE3 A;  1OUQ A;  1DK2 A;  3J81 j;  2R8I A;  1LVH A;  1Z4O A;  5KFX A;  2LM4 A;  2WTF A;  5KNI A;  1J2M A;  2F1I A;  8ICU A;  1RPL A;  7ICU A;  3RRH A;  2E8N A;  3IP4 B;  4KLM A;  2RHF A;  4DFK A;  1N48 A;  4I2H A;  2ASJ A;  1TK5 A;  2NRV A;  4P4P A;  4DFP A;  5GTH U;  2ZIV A;  2BPG A;  1SIJ A;  4U7C A;  4NLN A;  3IHQ B;  3C5F A;  5G5H A;  5DLG A;  4B9S A;  2UVR A;  4ED0 A;  4TQS A;  4B9U A;  1S0N A;  2KZM A;  1A0P A;  3EWA A;  5KFW A;  3F53 A;  3PX4 A;  2JH7 A;  3RJF A;  1SL0 A;  8ICL A;  3SEN A;  3AU6 A;  1ZJM A;  5EWF A;  5J2C A;  5L1K A;  9ICM A;  4DSJ A;  3CNH A;  2MUT B;  2ZIU A;  5KFP A;  4IRD A;  2MA1 A;  4I2E A;  8ICQ A;  2YX8 A;  3PY8 A;  4KLG A;  2A3V A;  1JUD A;  7ICQ A;  3BQ2 A;  2W03 A;  4PHA A;  1ZQT A;  5C0Y A;  3RB0 A;  8ICB A;  2CXY A;  2LHT A;  1HJP A;  2ZUD A;  4G9B A;  2A1A A;  2KFN A;  8ICW A;  3WKE A;  4C8K A;  5KT7 A;  4PGQ A;  3K4G A;  3MR5 A;  3AMZ A;  4KLI A;  4F4W A;  2JEF A;  2IBK A;  1IM4 A;  5J2B A;  2YN4 A;  4Z6F A;  4F5R A;  3RAX A;  3TI0 A;  3L4P A;  3PSF A;  1L3T A;  3SZ2 A;  4ECQ A;  8ICN A;  4ECZ A;  2FDR A;  3K75 D;  2HW3 A;  1S10 A;  4Q43 A;  4CDG A;  8ICC A;  2WAQ C;  3GIJ A;  2BCS A;  2PFP A;  9ICV A;  3OTQ A;  4J03 A;  4RQ6 A;  2W55 A;  2UVV A;  1S0V A;  3CP8 A;  5GTI U;  1PVQ A;  1XSN A;  2P6R A;  4JK1 A;  5ALL A;  3B0Y A;  2BPF A;  4BDP A;  4CF5 A;  4R65 A;  5JTI A;  4CF4 A;  3BZK A;  5J0U A;  3GV7 B;  2EZX A;  2GH1 A;  3QUB A;  4M9N A;  4IC9 A;  4QZH A;  2HOI A;  5BPC A;  4DEZ A;  3M8S A;  4YR0 A;  1ZQP A;  5KTQ A;  4US8 A;  3SYZ A;  3TAC B;  4YD1 A;  2XCP A;  2KMD A;  5J8Y A;  5L1J A;  5F9L A;  4RNM A;  4P0Q B;  2Y0S C;  4RQ8 A;  2NRT A;  4F3O A;  2F77 X;  1ZJN A;  9ICF A;  4M0A A;  5KFI A;  3ISC A;  4DS5 A;  5TIS U;  4RQ3 A;  3T3F A;  3Q8L A;  3BS5 A;  3ED5 A;  5KG6 A;  2W7O A;  3ORY A;  3JPO A;  1DRG A;  4DF8 A;  4QWB A;  2HSZ A;  1DK3 A;  2KKV A;  3RJK A;  2K4I A;  4GIB A;  4ECS A;  3GV8 B;  2BCU A;  2KSO B;  5HP4 A;  4DSE A;  7ICM A;  1K5O A;  2Y0S F;  2HHU A;  2P35 A;  1UQV A;  5KFU A;  1LKY A;  3GV5 B;  4MF8 A;  1KFS A;  1X40 A;  4IQV A;  3T79 A;  1Z19 A;  2W9C A;  4NLC A;  1J2N A;  3NRZ A;  4C80 A;  2W9B A;  2B6G A;  1WYG A;  4EX6 A;  5KFV A;  2BKE A;  2C2D A;  7ICL A;  5AKZ A;  4QW8 A;  3RJE A;  3HKZ F;  5ALM A;  2HHW A;  5DGB A;  2Y1J A;  3IN5 A;  4KTQ A;  3EYZ A;  3Q8K A;  4PL1 A;  1BGX T;  2XC9 A;  3PZP A;  2AU0 A;  1SWV A;  3M7D A;  1F5S A;  3UMG A;  4DSI A;  2N1R A;  4M47 A;  5AI0 A;  1OW5 A;  5KT6 A;  1WWV A;  1ZOL A;  1ZQO A;  1NZB A;  2HCF A;  2DL0 A;  2DGZ A;  2K8B B;  5AM2 A;  4B9N A;  5L1L A;  5B5E U;  4IRC A;  2C2E A;  4DWI A;  3PML A;  5DQG A;  3MR6 A;  4J9S A;  5KT3 A;  3WKA A;  3NAS A;  1KFT A;  5DG7 A;  1QLN A;  2FPL A;  5IIL A;  5L1I A;  1FEZ A;  2ISO A;  4O5C A;  2EAP A;  3RJJ A;  5AI5 A;  3MDA A;  2VJ5 A;  3SAH A;  3QX7 A;  4XUS A;  5DBC A;  4Y2V A;  2H3Q A;  5DQI A;  2YMP A;  1FIQ A;  3B0X A;  1FFU A;  1ZQG A;  1XSL A;  1BNP A;  3WK5 A;  3TAD C;  1RYR A;  8ICI A;  4RT3 A;  1UPH A;  2VKQ A;  4KLD A;  3HJE A;  2EAN A;  4DQR A;  5DB8 A;  3ALR A;  4UW9 A;  2D6F C;  4O5K A;  4NY8 A;  3S6J A;  4UAW A;  1BVS A;  4FBU A;  2HI0 A;  1UCV A;  1X6I A;  1SL1 A;  3TFS A;  2HHQ A;  4C7Z A;  2W3S A;  1UT8 A;  1Z00 A;  2DFL A;  4P2H A;  1DGS A;  4PPX A;  3RJI A;  9ICN A;  2W9A A;  4KLO A;  4DFM A;  2QKQ A;  2BCR A;  4ED7 A;  4QZ8 A;  1N56 A;  9ICC A;  2ZJA A;  3PW2 A;  5KG2 A;  2EAO A;  2ODG A;  2W7P A;  1ZQF A;  4B9V A;  4I2D A;  3RB4 A;  9ICG A;  2WF5 A;  1QQ6 A;  4F2R A;  2K8A A;  4ICA A;  5KG5 A;  3NGD A;  5AI8 A;  3H0L B;  4IQU A;  2P66 A;  3E0F A;  8ICJ A;  3AQE A;  3WK7 A;  2XY5 A;  4ED1 A;  1ZQH A;  4UAV A;  3NS1 A;  3KZX A;  3JPT A;  3GII A;  1BPE A;  1S0M A;  1D8Y A;  2VA8 A;  5J2F A;  3LK9 A;  4C8O A;  4GXJ A;  4DQI A;  4QZF A;  4J9K A;  1TFR A;  3MGH A;  3M1Y A;  2JHD A;  5KT5 A;  1C20 A;  4EBC A;  8ICE A;  1L7M A;  1Q46 A;  5DLF A;  1JRO A;  1O03 A;  2E1F A;  2Y1I A;  4CF3 A;  3KOO A;  2DPI A;  1ZQX A;  1TKD A;  2VIX A;  5CRX A;  5DKW A;  5DBB A;  2AGO A;  3MC1 A;  1CUK A;  1NZP A;  2G07 A;  2WB1 C;  4IQT A;  1KSP A;  1HUZ A;  3GQC A;  2WF7 A;  1D9F A;  5ALO A;  3UXN A;  1U45 A;  1KDH A;  4XQ8 A;  4G3I A;  4QIW F;  4ED2 A;  3MR3 A;  2YB4 A;  9ICW A;  2YML A;  4C0Z A;  2LPE A;  5KFQ A;  4MFF A;  3KD3 A;  1L7N A;  4F4X A;  2Z7J A;  2NO5 A;  1PZN A;  2L5Y A;  4F92 B;  5TZV A;  5AK3 A;  4Y2J A;  5AK4 A;  2AGQ A;  4RQ5 A;  1D8B A;  4CGZ A;  4CE6 A;  1H38 A;  7ICI A;  2K8C B;  4US9 A;  4DO9 A;  8ICP A;  2F44 A;  4MHV A;  4CNQ A;  3N97 B;  4YXM A;  9ICX A;  3SV4 A;  2BR0 A;  2WF8 A;  4UB6 U;  5ALY A;  4GC7 A;  5CA7 A;  4BWM A;  2DPJ A;  1S76 D;  1Z3E B;  1ZQZ A;  1NOM A;  2G5I B;  1U47 A;  3MAB A;  3JPP A;  1WCL A;  1Q3V A;  4QZA A;  3M8R A;  2HDO A;  4UQG A;  4USA A;  3TAR A;  1BPD A;  5DBA A;  9ICR A;  4J9N A;  9ICB A;  2IHM A;  2E1E A;  4DL5 A;  2C28 A;  3A0H U;  4B9L A;  2JEJ A;  4FS2 A;  4Z6C A;  3QU7 A;  2Y9T A;  2BZF A;  3QZ7 A;  9ICK A;  2MSN A;  3I76 A;  1CRX A;  1HIW A;  1ECW A;  4OO1 J;  7ICK A;  2BDP A;  2F3N A;  1GO3 F;  3F5E A;  1Z1V A;  4QZD A;  1MN8 A;  4NL9 A;  5HML A;  5AI6 A;  2JXJ A;  4YR2 A;  5ALI A;  4M9G A;  1SV0 C;  4I2A A;  2EZY A;  1QSL A;  1T94 A;  1WUD A;  5CJ7 A;  2LYA A;  4OJL A;  2UVW A;  4F93 B;  1ZQV A;  2ZIX B;  1Z00 B;  4EBE A;  4WJ3 B;  5KFG A;  2I6X A;  4I27 A;  8ICX A;  4I2F A;  2AH5 A;  2JGA A;  2K4H A;  2MUT A;  2ZIU B;  4ECR A;  4F72 A;  4RUA A;  4IR9 A;  2KJ5 A;  2Q0Z X;  4YFK A;  5DB7 A;  3HPO A;  2H3I A;  2NV3 A;  2BPC A;  4Q44 A;  3N7S C;  3NRW A;  2I5H A;  4OD0 A;  3UXO A;  1N5W A;  5IIN A;  2EAM A;  2CN1 A;  5ALK A;  1QH9 A;  4EBD A;  5KG3 A;  4GXI A;  4GXK A;  4NXZ A;  4F4K A;  3ZDA A;  4MF2 A;  3IG5 A;  3BDP A;  2KEY A;  2KJ8 A;  4Y2X A;  5KFA A;  5J0T A;  2OM6 A;  3QUC A;  4F5P A;  1ED1 A;  4K4G A;  4DCC A;  3ZD9 A;  1S0O A;  4KLF A;  3SAG A;  1S8O A;  2E3T A;  4C4T A;  4LVS A;  4DSF A;  5J2K A;  1JXE A;  4UB1 A;  1L6N A;  5J0R A;  1TE2 A;  4ECX A;  2OYY A;  4ECW A;  4ELV A;  4DL2 A;  3QUT A;  5AKG A;  3G6V A;  1YZ7 A;  4JV2 A;  3AU2 A;  3B9J A;  3CYM A;  3THV A;  1KRP A;  2JH1 A;  1QQ7 A;  2MRL A;  2YTU A;  1NKC A;  3WKC A;  1ZYQ A;  3H0R B;  4P4O A;  2XCA A;  3ZI4 A;  7ICJ A;  2OWO A;  4ELU A;  4J9L A;  1IG6 A;  4P4M A;  3PSP A;  1SV0 A;  4UAR A;  2W43 A;  5J0Q A;  2HBJ A;  4K4I A;  5HR7 A;  1LV5 A;  4RNN A;  1ZQS A;  2KZ3 A;  2R8J A;  1MA7 A;  1SKS A;  4BX9 C;  3GIM A;  1LKY B;  3NVY A;  4YVZ A;  4JMU A;  2IOH A;  1XS9 D;  3BQ1 A;  1ZD4 A;  4BGD A;  4PHD A;  2CRX A;  2WF6 A;  2PMZ C;  4Y2Q A;  3H0M B;  5DDM A;  1JRP A;  4EYI B;  5IIM A;  5ALD A;  3H8J A;  3V6K A;  4F2S A;  2YMQ A;  1RQL A;  4DQQ A;  2VA3 A;  1ZRM A;  3H4B A;  3H8S A;  1UHU A;  3BS5 B;  5KFH A;  4O3P A;  1ZXI A;  2YQE A;  3V6H A;  1TAM A;  5HNK A;  4M6W B;  2AHO B;  3GIL A;  1SWW A;  2KZZ A;  4O5E A;  4C4R A;  1KBU A;  4FO6 A;  4R8U B;  4DQP A;  1NJZ A;  4QZI A;  4RQ1 A;  1TAQ A;  1D9D A;  1IIP A;  1UA1 A;  8ICS A;  2K60 A;  2JEI A;  3K1R B;  2HVI A;  5KFJ A;  4X5V A;  4DQS A;  3I28 A;  3EW9 A;  1ZET A;  4IS7 A;  8ICR A;  3RH4 A;  1B43 A;  3BQT A;  5BOL A;  1HUO A;  1FO4 A;  2FMP A;  4IRK A;  3ISB A;  3SI8 A;  1U4B A;  1VJ5 A;  1MQ3 A;  2JRZ A;  4BUG A;  2BQ3 A;  2R8G A;  1X9S A;  4BJQ A;  1ZQQ A;  1L3U A;  3MFH A;  3GIK A;  3L5K A;  4RU9 A;  5A0L A;  3UM9 A;  4UB5 A;  1X42 A;  3DV9 A;  4KN4 A;  2EDU A;  4QWD A;  2OCE A;  3WK6 A;  3N28 A;  5ALH A;  1ARO P;  3JPS A;  4LZD A;  4JWN A;  3QNM A;  2NRX A;  3ZDB A;  3LVV A;  2W3R A;  5ALJ A;  4UB2 A;  1T7P A;  2FLP A;  1XNS A;  3GFK B;  4LZG A;  2FI1 A;  1L3S A;  1OXJ A;  3NTU A;  2BQU A;  3QU5 A;  5ALS A;  5J2J A;  1X9W A;  9ICA A;  4NV0 A;  5ALF A;  5IIO A;  2QAR A;  1SZH A;  2BGW A;  4R66 A;  3HP6 A;  1L8O A;  4JB3 A;  2RP5 A;  3H7I A;  4UBB A;  1ZQW A;  3V7J A;  3IG8 A;  2AQ0 A;  1RZT A;  4KLH A;  2ASD A;  3OSN A;  4NLB A;  1LB2 B;  2HVH A;  3BQ0 A;  2W9B B;  1FFV A;  3LVW A;  2HHV A;  1XO1 A;  3UQ2 A;  2AQ4 A;  2OXO A;  2HBM A;  1MC8 A;  4C4S A;  2IMW P;  4KIT B;  2W9M A;  1T3Q A;  1L7O A;  1X2I A;  3QE9 Y;  1PUZ A;  2IHN A;  4Q8E A;  4AYB C;  1XC9 A;  5KL1 B;  3G6Y A;  4NLG A;  4CCH A;  5AM0 A;  7ICG A;  5EE0 A;  2KG5 A;  1WCN A;  3LYS A;  5CWR A;  3BJY A;  4HAI A;  4OCZ A;  3EZ5 A;  2PMZ F;  2OHF A;  1IV8 A;  3KTQ A;  3AQF A;  3A0B U;  5DB9 A;  3DDH A;  2BCQ A;  5J2D A;  4ED3 A;  1ZQY A;  3RRG A;  1KN5 A;  1ZQD A;  2E8M A;  4F8R A;  4DL7 A;  1SXD A;  1Z4N A;  5AM1 A;  2IA6 A;  2KHQ A;  1X9X A;  2V4Q A;  1NKB A;  3NUQ A;  3KHH A;  3AUO A;  8ICM A;  2KVS A;  3QXG A;  3ZD8 A;  1N60 A;  5F3X B;  4I2B A;  4F4Z A;  5EE9 A;  4Z6D A;  1V9P A;  4M04 A;  5J2A A;  2BQR A;  3BQ7 A;  1MSW D;  1Q3U A;  9ICE A;  3PSI A;  8ICV A;  2KJ9 A;  4YMN A;  3WK8 A;  2H3F A;  3Q8R B;  3CW2 C;  3SAF A;  4ED8 A;  4O3R A;  5AKE A;  2F1H A;  4R64 A;  4DL3 A;  2XY6 A;  2DBY A;  5CR0 A;  3V7K A;  2O6K A;  1PK3 A;  1YT3 A;  4EEY A;  2FMQ A;  7ICV A;  4XRH A;  5AM4 A;  2F8K A;  3QYP A;  4I2C A;  4Y2T A;  2KIW A;  5AKJ A;  5KT4 A;  2AXT U;  4Y2U A;  4QZE A;  4OJ6 A;  5DQH A;  5KFD A;  1M6Y A;  5D49 A;  4TUP A;  3OPX A;  3QZ8 A;  2GWS A;  3ETR A;  4QWA A;  4UBC A;  5ALZ A;  3GZF A;  5AI9 A;  4ECV A;  4PZN A;  4I29 A;  2ZJ8 A;  3RJG A;  7ICR A;  8ICG A;  4F5N A;  2G09 A;  4QZ9 A;  3C28 A;  4A8E A;  3IRU A;  2P6U A;  3M6Z A;  5KAI U;  1KQQ A;  2FPM A;  1SGG A;  2D8C A;  4NM1 A;  2KP7 A;  3M9N B;  5KFF A;  4YXJ A;  4RZR A;  3PX6 A;  2KN7 A;  3BS7 A;  1TV9 A;  1XO0 A;  4RQ4 A;  4JUZ A;  1ZQ1 C;  3RH6 A;  4TUS A;  5DDY A;  7ICF A;  5L1M A;  2FE9 A;  1K1Q A;  3KHG A;  4QZB A;  1XU4 A;  1B22 A;  3D6J A;  2E8O A;  3IV6 A;  2BCV A;  4EEK A;  1RXW A;  2QB0 B;  1B4F A;  4FFD A;  3FM9 A;  4MFA A;  5AKL A;  5ALW A;  4IR1 A;  2FPK A;  4Q8F A;  3PST A;  1SKR A;  2XVT A;  2DF4 B;  4F4Y A;  2WF9 A;  2F76 X;  3D2N A;  2H3V A;  5D4B A;  1AQ6 A;  3HIL A;  1C7Y A;  5D46 A;  2AJQ A;  3N7R C;  3MGV A;  3E2E A;  3H8W A;  3E58 A;  4DFJ A;  5AI4 A;  4DFD A;  3RJH A;  5IIJ A;  1NI3 A;  5KL8 B;  1X6J A;  3PVX A;  4RT2 A;  2B21 A;  1UT5 A;  3WK9 A;  2VAN A;  2A1J A;  1DOQ A;  1ZQI A;  2W9C B;  2F8L A;  3U26 A;  2NO4 A;  3ZDC A;  3UMC A;  3C21 A;  9ICS A;  5J2E A;  3FAH A;  5AKX A;  3C1Z A;  1NJY A;  3OGU A;  3UQ0 A;  5KG0 A;  2KTQ A;  4TUQ A;  8ICK A;  4P0P B;  2ATL A;  3KZI U;  5EWE A;  4FZN A;  2EZZ A;  2NRZ A;  5J0P A;  4QZC A;  1MQ2 A;  4Z6E A;  2Q4T A;  4O3Q A;  3BZC A;  5J0X A;  2HMX A;  2VJ4 A;  4JV1 A;  1YZ6 A;  3PO5 A;  3PW4 A;  3MR2 A;  4RNO A;  3V7L A;  3N4M B;  4J9Q A;  2JV3 A;  2E8P A;  1N61 A;  4DSK A;  1J97 A;  5CHG A;  8ICZ A;  4O3S A;  5K4L A;  4NM2 A;  1NK7 A;  1JX4 A;  5F9N A;  1KEJ A;  3PW5 A;  3EPG A;  2W04 A;  2F2A B;  4QIW C;  2D3D A;  1ZQM A;  5ALP A;  2EQY A;  5KG7 A;  1BPB A;  2MAX A;  4ZH4 A;  3C23 A;  3EUB 2;  1WWU A;  4J9M A;  3SV3 A;  2EH9 A;  3AM9 A;  4EZ6 A;  4NJ8 A;  2J6U A;  9ICH A;  2DKZ A;  1QSS A;  2W8L A;  1O08 A;  3H40 A;  4JV0 A;  2F1J A;  5J2G A;  4RQM A;  1D8L A;  4AYB F;  4PGX A;  7ICP A;  2V4R A;  3I1Y A;  5H2F U;  3Q8M A;  4P0Q A;  1TAU A;  1TVA A;  2XIC A;  1NKE A;  1V38 A;  4YCX A;  1TK0 A;  5B66 U;  3TAQ A;  3JPN A;  2R18 A;  3C2K A;  3RFA A;  3PW7 A;  1DGJ A;  3NVW A;  1RYS A;  5AIB A;  5AIC A;  1QTM A;  1COO A;  1F44 A;  2ZIW A;  9ICJ A;  4QNL A;  4HYK A;  5KAF U;  5ALE A;  2VA2 A;  2A19 A;  3QU4 A;  1NK5 A;  3LWM A;  4UB8 U;  2PI4 A;  1DXS A;  1F0M A;  5J2I A;  1VLB A;  3QU9 A;  5IIK A;  3IM1 A;  4B6J A;  2JR5 A;  3KHL A;  8ICA A;  1N2X A;  3SD7 A;  1QCK A;  2LYB A;  4YN4 A;  4B9M A;  4BXO A;  3KFU F;  3PW0 A;  7ICO A;  4UAZ A;  4QZG A;  2DKX A;  3RBE A;  5KFM A;  1RG6 A;  5KFL A;  3EPI A;  2C2R A;  4UAY A;  2NYV A;  3T5L A;  1T3N A;  2OH2 A;  2KIC A;  8ICF A;  2HHS A;  5ALQ A;  9ICI A;  3HW8 A;  1ZQN A;  2RDJ A;  2ZIW B;  1N63 A;  4RPZ A;  4KLS A;  3TAD A;  1ZQU A;  2RLT A;  4ECT A;  2KKP A;  1A77 A;  1N5X A;  5JUM A;  4I2G A;  4YMM A;  5J29 A;  4KLQ A;  3NVZ A;  2UVU A;  5AKY A;  1A6S A;  2H5X A;  4PZO A;  1P7D A;  4K4H A;  3KKA C;  5KFE A;  9ICU A;  4O3N A;  2GLE A;  3UXP A;  4NLZ A;  4J9P A;  3K1Z A;  4YMO A;  3QU2 A;  1RXV A;  3OJS A;  1V85 A;  1Q8K A;  3WU2 U;  2GOL A;  1ZQA A;  1TK8 A;  5KFN A;  3OHA A;  3CRX A;  4FBT A;  3SMV A;  7ICE A;  5L9X A;  5AK5 A;  1HEK A;  2ZIV B;  4NWI A;  4YD2 A;  7ICH A;  4M9H A;  3AN1 A;  2K4E A;  3TAN A;  2DUY A;  4DF4 A;  5AIA A;  4M2Y A;  5J0O A;  1VDV A;  1U9L A;  3PR5 B;  3RR8 A;  5KFS A;  1BPZ A;  4PH5 A;  5CB1 A;  3Q8P B;  4EEN A;  1L5U A;  2MU2 A;  4NL9 C;  3RH5 A;  4DSL A;  2W8K A;  1QSY A;  4EZ9 A;  3TFR A;  1PK1 B;  2A1J B;  2YY6 A;  3JPQ A;  1PVP A;  4MEX A;  3QEB Z;  4CRX A;  3M9O B;  1URJ A;  4O0I A;  4F5O A;  4DOB A;  4EYH B;  1U48 A;  5HHI A;  4DS4 A;  3VCB A;  5JRT A;  2E5S A;  1SL2 A;  3NVV A;  5DGA A;  2J6T A;  5J0W A;  4QWE A;  2ISP A;  4R63 A;  4P0P A;  3SEI A;  7ICT A;  3GDX A;  1ZQR A;  2I1Q A;  5FP0 A;  1SB3 C;  4PL2 A;  5BOM A;  1ZQE A;  3FDS A;  4RUC A;  4C7Y A;  4M9L A;  2BDU A;  4TQR A;  2QLT A;  3MDC A;  5KFB A;  3M6K A;  3WKD A;  4RPY A;  1PK1 A;  2KD1 A;  3LWL A;  5ALX A;  4YP3 A;  4KMO B;  5ALU A;  4LJX A;  5AKH A;  3HT3 A;  4DLG A;  5EWG A;  2KHV A;  2QB1 A;  2KE7 A;  2PI5 A;  2WFA A;  4IL6 U;  2NRW A;  2KOB A;  4KLJ A;  1X66 A;  8ICY A;  1EXN A;  1T4G A;  2M0N A;  4YR3 A;  4C8L A;  8ICT A;  1ZQK A;  2Y9U A;  3MGI A;  2PFQ A;  3HX0 A;  1NK4 A;  1SKW A;  3RF9 A;  8ICO A;  3KKA A;  4Y2R A;  1ZQB A;  4F91 B;  1KTQ A;  1B0X A;  3FC4 A;  3H8M A;  2ZUC A;  3WK4 A;  2DWQ A;  9ICL A;  1S5L U;  2LBO A;  4O9M A;  4OJO A;  4O3M A;  4YQW A;  5CP2 A;  3R9K A;  2FMS A;  2HHT A;  4Y2S A;  4KN7 A;  4Q45 A;  2QB0 A;  2LI6 A;  3RBD A;  4C8M A;  1ZD5 A;  2G0A A;  4GFJ A;  2G5H B;  3D2Q A;  9ICT A;  4RQ7 A;  3VC8 A;  4PJ0 U;  2ZIX A;  4OJP A;  3QEA Z;  1JAL A;  2HBL A;  5AHX A;  1ZRN A;  4ACO A;  4F71 A;  4U6P A;  2XI9 A;  3GU3 A;  4O3O A;  3KBB A;  2ESE A;  2RDI A;  3RR7 A;  9ICO A;  2R8H A;  1ZD2 P;  1IXR A;  2LYH A;  3T5H A;  2XGQ A;  4MFC A;  4GLX A;  4J9O A;  4I2I A;  1JN3 A;  3RAQ A;  4FZL A;  1NK8 A;  2ES6 A;  2JZB B;  4YG2 A;  4DLE A;  1U49 A;  4NLK A;  3O0F A;  3C1Y A;  4RQ2 A;  5CEH A;  4ED6 A;  4MEY A;  2ZG6 A;  5KFZ A;  4I2J A;  3N7P D;  1JIH A;  4UB4 A;  4QW9 A;  4GC6 A;  5J0S A;  5AK6 A;  1SXE A;  2XGP A;  2K4P A;  4C8N A;  4PHE A;  3F2C A;  2FLL A;  4KLL A;  2OEH A;  2HOF A;  5G5G A;  1SZP A;  1NK6 A;  3ZDD A;  2ZXI A;  5HMM A;  4BWJ A;  1ZQJ A;  5KFR A;  5HR6 A;  3V72 A;  3PO4 A;  5ALT A;  3MBY A;  2GO7 A;  1Z1B A;  1UA0 A;  1T8E A;  1CEZ A;  2FLN A;  2HOQ A;  2PXI A;  3SQI A;  5DB6 A;  4KLT A;  4J9R A;  2G06 A;  5C5J A;  3TQ1 A;  9ICQ A;  5J0Y A;  2YMM A;  5AM5 A;  4RPX A;  2XY7 A;  2KSO A;  3F2B A;  1RYU A;  1NNL A;  1A76 A;  1L8L A;  2XO7 A;  1BPY A;  4DL4 A;  4ECY A;  2PKE A;  2IOF A;  4KLU A;  3OJU A;  1JMS A;  2KK0 A;  3ISD A;  3PR4 A;  4UB3 A;  2ZTE A;  3TKA A;  3L3F X;  3RB6 A;  4UAT A;  4F50 A;  2FJ6 A;  5ALG A;  4F5Q A;  2ZTD A;  2IOF K;  1KLN A;  5T14 A;  5AKI A;  5E79 U;  2LMR A;  4DOC A;  1XSP A;  2G08 A;  3OHB A;  1S9F A;  3UMB A;  3HRD D;  4Y2P A;  5KFK A;  3JPR A;  2W11 A;  2KNJ A;  1V97 A;  2PFN A;  2KIV A;  3RTV A;  2XID A;  2KV2 A;  1K1S A;  2K89 A;  7ICS A;  5KT2 A;  4I28 A;  2W54 A;  4M9J A;  3WKB A;  2CPR A;  1XWL A;  2ZUB A;  3LDA A;  1BNO A;  1KFD A;  4RQ0 A;  3OSP A;  3IDW A;  3PMN A;  3ONN A;  4FS1 A;  4KMU A;  3PX0 A;  2BHN A;  2WHE A;  3C29 A;  3C2M A;  1PVR A;  2WAQ F;  4XA5 A;  4QJF B;  4ELT A;  3FYH A;  4EX7 A;  1ZQC A;  3H4D A;  5KFY A;  4AP9 A;  1COK A;  3QUQ A;  4BXO B;  4JWM A;  2YB1 A;  5ALN A;  3T5J A;  9ICP A;  3TAP A;  5DG9 A;  4TUR A;  5DG8 A;  2QAR B;  3T5K A;  2HHX A;  3ETL A;  5ALR A;  2M9N A;  4UAS A;  3PV8 A;  2H3Z A;  1JXL A;  2I9G A;  2PFO A;  4ECU A;  1NJW A;  3RB3 A;  2ZJ5 A;  1ZD3 A;  2AGP A;  8ICH A;  5KFC A;  2JZB A;  1S97 A;  3C2L A;  5KG1 A;  5KFT A;  4EEL A;  2ASL A;  3G6X A;  1L7P A;  5ALV A;  2JMG A;  4PHP A;  5AKK A;  3V6J A;  5J8Y C;  2JEG A;  4DOA A; 
#chains in the Genus database with same CATH homology
 3SEI A;  2L5Y A;  1LKY B;  2LMR A;  2B6G A;  1KW4 A;  5F3X B;  2E8O A;  1SV4 A;  2D3D A;  2QKQ A;  1OXJ A;  3TAD A;  3BQ7 A;  2QB0 B;  1B4F A;  2F44 A;  2ES6 A;  2EAO A;  4MHV A;  2QAR A;  1PK1 A;  2KIV A;  5JTI A;  2QB1 A;  2EAM A;  4PZO A;  3BS5 B;  2KE7 A;  1WWU A;  3KKA C;  4NJ8 A;  3SEN A;  2DKZ A;  2GLE A;  1X66 A;  1PK3 A;  3IDW A;  1SXE A;  4RQM A;  1V85 A;  3HIL A;  4RQN A;  2Y9U A;  1JI7 A;  1OW5 A;  2F8K A;  3TAC B;  2K4P A;  5JU5 A;  3KKA A;  1WWV A;  2K60 A;  1V38 A;  1B0X A;  2DL0 A;  1COK A;  3K1R B;  3H8M A;  2KMD A;  5J8Y A;  2Y9T A;  4IS7 A;  2QAR B;  2KG5 A;  2QB0 A;  4PZN A;  2EAP A;  2F3N A;  3BS5 A;  1Z1V A;  4NL9 A;  4NL9 C;  2KSO A;  2YTU A;  1DXS A;  1F0M A;  1PK1 B;  1SGG A;  2D8C A;  3TAD C;  1SV0 C;  2KSO B;  2EAN A;  1SV0 A;  3BS7 A;  1UQV A;  2ESE A;  5KNI A;  2LPE A;  2E8M A;  1LKY A;  5JRT A;  1SXD A;  1X40 A;  1UCV A;  5J8Y C;  2E8N A;  2JV3 A;  2DKX A;  1RG6 A;  2E8P A;  5L1M A;  1X9X A;  2FE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...