5J8YC

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
MPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polycomb protein Scm
publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
total genus 23
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yC00
2EAMA 2KMDA 2YTUA 2QB1A 1JI7A 4NJ8A 2E8OA 3BS7A 1PK3A 2DKZA 2KG5A 4RQMA 1DXSA 5JRTA 1V85A 1SV0C 3KKAC 4IS7A 2JV3A 1UCVA 2KE7A 3BS5B 4NL9A 1X9XA 3KKAA 2D3DA 2ESEA 1X40A 1SXEA 2LMRA 1SV4A 2FE9A 2KSOB 2F8KA 3TADC 2QARB 1B0XA 2DL0A 2L5YA 3TADA 1V38A 2EAOA 1SGGA 3BS5A 4PZOA 2E8NA 5KNIA 2DKXA 2Y9UA 2E8PA 2KSOA 3H8MA 3IDWA 1SV0A 4MHVA 1UQVA 2QB0B 1KW4A 3HILA 2D8CA 2F3NA 5JTIA 2B6GA 5JU5A 5J8YC 1SXDA 2F44A 1WWUA 2ES6A 1Z1VA 2QKQA 1LKYB 4RQNA 2LPEA 1PK1B 4PZNA 5J8YA 2K4PA 3BQ7A 2QB0A 3SENA 2KIVA 2K60A 5L1MA 1X66A 2QARA 3K1RB 2EAPA 3TACB 1F0MA 1LKYA 4NL9C 2Y9TA 1OXJA 1PK1A 1WWVA 1OW5A 3SEIA 1COKA 2EANA 2E8MA 2GLEA 5F3XB 1RG6A 1B4FA
chains in the Genus database with same CATH superfamily
1ZD3A 1B43A 2HBJA 5AK5A 5DDMA 9ICOA 2JEGA 4FFDA 3PMNA 4C4RA 1NZBA 1V85A 5EWGA 2K4EA 1MA7A 3TAPA 2WFAA 3F53A 9ICTA 2Q0ZX 4FZMA 1SIJA 1FFUA 2LMRA 2KSOB 1C20A 4I29A 2GO7A 3AQEA 2IA6A 3C1YA 4DO9A 3C5GA 2YX8A 1NZPA 4B9VA 9ICEA 3AUOA 5J0RA 5DLFA 4YG2A 5HMLA 1FIQA 2XO7A 2IHMA 1RQNA 3IDWA 1IXRA 5ALFA 3UQ2A 1F5SA 3AU2A 2BCSA 4DWIA 3CYMA 5AK4A 4QIWC 1L7OA 1V97A 1O03A 1DK3A 1D8LA 5KFMA 5KFJA 8ICCA 3NVVA 2VA2A 4R8UA 5AI9A 3JPOA 1Z00A 2G06A 1A6SA 5ALUA 5EE1A 2K60A 3PSTA 9ICNA 5L1MA 1X66A 4UBBA 4RT3A 2BCRA 2LKYA 5KT5A 1NNLA 4K4IA 1F0MA 3RJKA 2FLLA 3WK8A 2QLTA 2VANA 2W9MA 1V9PA 3ZDDA 2FPMA 1TVAA 1JRPA 1VLBA 2K4HA 5ALGA 1RYRA 2FMPA 4Z6EA 3H0MB 3TARA 1RG6A 1S0MA 3C23A 4FBUA 5DQIA 4UB2A 1ZQTA 1D8YA 5AKHA 4J9KA 4NY8A 3OPXA 4PPXA 2KFNA 5J0OA 2DPIA 4NLGA 3RRHA 3J81j 4KLDA 3JPSA 8ICPA 4RQ8A 4TQSA 2EZZA 2BQUA 3TADC 2W7OA 3WK4A 3IV6A 4O3QA 1T3NA 4U6PA 3UMBA 2EAOA 4FZNA 5KNIA 2W3SA 3LVWA 8ICFA 5L1LA 1L6NA 2AHOB 4MHVA 2QB0B 2HHSA 2C2RA 2G5IB 2KN7A 3RB6A 4JV0A 5CEHA 4F5NA 1LV5A 1O08A 4YMMA 1HUOA 2E3TA 2W9AA 1J2NA 1AQ6A 5G5GA 3RH5A 1K5OA 4QZGA 3RH4A 8ICKA 4LJXA 5D49A 3EPGA 2Y0SF 1N63A 4Q8EA 3N97B 4CGZA 1FO4A 5KFSA 2I6XA 4DFKA 5KFBA 2C2EA 2RDIA 1PK1A 4XQ8A 5IIOA 4EZ9A 5J2JA 1QLNA 3SEIA 4M6WA 4KLHA 2BPGA 5J0QA 5AK6A 3ZD9A 2EZXA 3UMGA 1KTQA 4KLTA 2RP5A 4Y2YA 3QU4A 5J2HA 2R8HA 4XRHA 4RNMA 4DQSA 2LM1A 5AKIA 1N62A 2W9CA 2WF5A 3HJEA 1Z4NA 4QZAA 4IS7A 1SZHA 2KE7A 2KD1A 3WK9A 2JHDA 5AI8A 3QU9A 4TUQA 1ZQVA 3NS1A 5J0UA 1IM4A 4MEXA 2YN4A 1DRGA 1SKWA 4E0DA 5CHGA 4IR9A 3UXNA 4O9MA 2Z7JA 2RQ5A 4F4XA 4I2IA 2D6FC 3OHAA 3WK6A 3HWTA 4EX7A 3QU2A 1HEKA 2FDRA 4Z6FA 1KBUA 4IQVA 3BS5A 4HAIA 3MR2A 4ECYA 1A77A 1CI4A 3C2KA 3GIIA 3BDPA 4RNOA 3TI0A 1U47A 3M7DA 2PI5A 1ZQUA 3HT3A 3RRGA 3EWAA 5KAFU 8ICQA 3PX6A 3EW9A 4EEKA 2EQYA 2W9CB 4CCHA 4U7CA 2PFNA 8ICJA 1N5XA 3MFHA 2RLTA 1YZ6A 4J9PA 5KFAA 2KKVA 3QZ7A 4I2HA 4JV1A 3K1RB 1RDFA 4Y2VA 2JZBA 4F5RA 2FI1A 4RQ6A 2B21A 3TANA 5CRXA 2WF7A 4F5OA 4JV2A 3NRZA 4FS1A 4B9MA 2BQRA 3IRUA 3AMZA 4J9SA 5ALXA 3SQIA 4G3IA 2E1EA 3BQ2A 4KLMA 3ZDAA 2KMDA 4YP3A 4QWEA 5KFUA 3JPTA 4UB6U 1SL0A 3UXPA 5KFWA 4F2SA 2FLNA 2DKZA 2ASDA 1BPDA 4F4KA 5J2DA 5J0YA 5KFCA 9ICGA 4A8EA 3C29A 2HW3A 1X9XA 2HI0A 2ZTDA 4QWDA 1X40A 2OHFA 1D9DA 4KTQA 1AROP 4QZFA 3QUBA 4QIWF 5C0YA 3GQCA 2JZBB 5AI4A 3BQTA 1ZQYA 2H3IA 1S76D 3IHQB 1KN5A 2N1RA 5HR6A 5ALTA 3K4GA 2Y9UA 5IILA 9ICJA 4P0PA 4BGDA 3H8MA 2HCFA 4NLCA 4KLLA 1UHUA 1GO3F 5KG4A 2AXTU 3SV3A 4JB3A 4C8OA 4ED1A 3Q8PB 1JALA 4J9LA 3D2NA 3V72A 4FS2A 4IRDA 1ZETA 5DLGA 4PZNA 3QUCA 4J9OA 8ICHA 4K4GA 1UPHA 4P0QB 4UARA 1KFTA 3HW8A 1MSWD 1SL1A 5EE0A 3Q8SB 3EYZA 2MRLA 5HNKA 3CW2C 1OXJA 4PHPA 3C2LA 2P66A 4RNNA 4IL6U 4ED0A 2P6RA 2Y1IA 4PHAA 1SWWA 1X2IA 4UAVA 1ZQDA 2LBOA 2Y1JA 3M6KA 2CXYA 9ICHA 4US8A 3JPQA 2HHVA 1NK9A 2HHUA 4I2GA 4KLEA 4RQ3A 4HYKA 4ED3A 1TK5A 5ALDA 2DUYA 4FBTA 2WF8A 3K75D 3OHBA 2ODGA 2AH5A 3RTVA 4Q45A 2MAXA 2KHVA 2AGQA 1ZQLA 1DXSA 8ICOA 1SV0C 5H2FU 3F5AA 5CP2A 3CRXA 1KLNA 5KG5A 4PH5A 3PMLA 4RQ7A 4NV0A 1DGSA 4MF2A 2ZUDA 3Q8RB 2YQEA 1HUZA 4F5PA 5EWFA 3F2BA 2HBMA 4ECVA 2W03A 2F76X 1J2MA 3C21A 2E5SA 3BZCA 2W11A 1VDVA 4PZOA 4YR2A 1SKSA 5KG7A 2KJ5A 3F2DA 2A19A 3PNCA 5IIKA 1ZQNA 1ZQSA 2KTQA 2OWOA 4GLXA 1CEZA 2VJ4A 4BJQA 1SV0A 1Q46A 1ZQPA 9ICSA 4PJ0U 3HILA 3MABA 4C7ZA 2YMQA 2K4IA 1PZNA 5J8YC 1NJZA 3ZDCA 1VJ5A 2WTFA 4ECXA 4QZIA 2XY7A 1BPYA 4BXOB 3BQ7A 4DL3A 5K4LA 4RQ1A 2ZJAA 4J9QA 1RXWA 4IR1A 4YD1A 1NK8A 2NRVA 2AQ0A 5IIMA 3ISBA 9ICBA 1A0PA 2BZFA 3SR6A 1S0NA 5L1JA 1Q3VA 7ICJA 7ICLA 3RB0A 2AU0A 2E8MA 5BOMA 2G0AA 5AM5A 3TAQA 3ZI4A 8ICBA 9ICVA 9ICUA 2KVSA 1X9WA 4MFAA 4F2RA 2XC9A 4O3RA 2YTUA 4B6JA 5TISU 3BQ1A 1PK3A 3I76A 2JMGA 2LYHA 3OSPA 1X9SA 3L3FX 4KITB 7ICUA 1ZXIA 5KFYA 3D6JA 2DPJA 2ZIXB 3RBEA 5DGBA 3DDHA 1U4BA 1UT5A 1WCNA 2KV2A 4UB8U 5J2KA 4TURA 2DQNB 3H0RB 3IM1A 2ATLA 3OJSA 2NRTA 3NUQA 3RJHA 1WG8A 5A0LA 9ICXA 2NRXA 2NV3A 3BJYA 3ED5A 4I2DA 2C28A 3RR8A 5CB1A 1KW4A 8ICGA 4B9NA 4RPZA 3JPPA 5EOZA 4EZ6A 2F3NA 3QU5A 1SKRA 5ALMA 5KFXA 5AKJA 1BPEA 2QKQA 5ALZA 4C0ZA 4DSIA 1LVHA 2O6KA 4DOBA 3T5KA 2JRZA 4UAZA 3GDXA 3D2SA 2DWQA 1JMSA 1CRXA 3M9NB 4OD0A 4BUGA 2I1QA 1D8BA 2VJ5A 3QXGA 4YN4A 4TQRA 3Q8LA 1NK4A 5HP4A 4XUSA 3PW0A 5ALNA 1NKEA 2G08A 2XY5A 1XS9D 3AN1A 5F3XB 1ED1A 3HX0A 3AL0B 2BPCA 3GV8B 1H38A 4GXIA 1NK6A 1S97A 2HOFA 1JIHA 3GU3A 1ZQAA 1HIWA 5DKWA 8ICYA 5AHXA 5AKZA 2ZXIA 4RQMA 4CE6A 3KHRA 1QSLA 3MDAA 5AKLA 2FPKA 3PV8A 4JMUA 5AKEA 2W8KA 2YMLA 1RYUA 4UQGA 2E1FA 4C80A 4MEYA 2F1HA 5ALOA 4UB3A 4P4MA 2WB1C 2XVTA 3RFAA 2GH1A 1U49A 3QUQA 2F8LA 4DOCA 4JUZA 5ALLA 4O5KA 3IP4B 2EZYA 4R8UB 1Z00B 2PI4A 3NGDA 5JTIA 1S10A 8ICNA 5KFQA 1WWUA 5AM4A 2YMPA 5J0PA 5AM2A 1X6JA 4RQNA 1RPLA 5KFTA 2LPEA 4NXZA 1L3VA 2HHQA 5GTHU 2XGQA 4KLUA 4QZ9A 3ZD8A 3GV5B 1QQ6A 3THVA 4Y2JA 3WKCA 4ED7A 1LB2B 3TACB 2IBKA 4C4TA 2XY6A 3ETLA 4YFKA 3H4DA 3ETRA 5EWEA 3KFUF 7ICPA 3NRWA 7ICQA 1XO1A 5E79U 2ZJ8A 2MUTA 2C2DA 5DBCA 2PFPA 3EUB2 4UASA 1WCLA 1WYGA 2Q4TA 3WK5A 3F2CA 1P7DA 5AK3A 5KT4A 4MFFA 3T79A 1DOQA 4Y2RA 4R66A 2EDUA 4J9MA 1ZQKA 2F1IA 3K1ZA 2FE9A 2P35A 4R64A 2DL0A 4LVSA 2KZMA 4DSLA 5C5JA 3QZ8A 4YMOA 3RH6A 3NVYA 2RRDA 1X9MA 4O3MA 1KFDA 1K1QA 9ICQA 1QCKA 4F4YA 4B9SA 4I2EA 2VIXA 4YMNA 8ICMA 3ALRA 2AGOA 1Z4OA 1JROA 1ZQFA 3RB4A 3TFRA 1XWLA 4OCZA 3H8JA 1K1SA 4F72A 5J2CA 1PK1B 3C1ZA 4Y2PA 5DBBA 3OTQA 5DG9A 1ZD5A 4M6WB 2BCQA 4I2JA 2A1JA 4K4HA 3H8WA 4FE3A 5BPCA 4Y2QA 4Q43A 1XU4A 3T5HA 1ZQ1C 2V9WA 4DCCA 2ZIVA 1ZQZA 4KN4A 2VKQA 2W7PA 3KZIU 1KQQA 3PR4A 3E2EA 9ICMA 7ICVA 3H7IA 4IQTA 2DGZA 5DB9A 5ALRA 2KP7A 4PL1A 5L1IA 4UB1A 8ICTA 2KZ3A 2RHFA 5DQHA 3GILA 2KJ8A 1CUKA 3RAQA 2I5HA 2MA1A 1L7NA 1NJWA 1D9FA 1UCVA 3BS5B 4Y2SA 2BCVA 3B9JA 2CRXA 3TFSA 3KKAA 1ZJMA 4C8LA 1ZQHA 3FYHA 1TV9A 5B66U 4O5CA 4DOAA 2ZIUA 2A1JB 1NK0A 2ISOA 4F92B 3ZDBA 1ZQBA 5KFEA 5J2AA 1X6IA 1ZOLA 4JWNA 5AKXA 3H8SA 4BWMA 1S8OA 5J2IA 1SGGA 2MSNA 4ECTA 1QSYA 7ICNA 4ECZA 3GFKB 1ZJNA 2R18A 2XGPA 1PVQA 2XIDA 4QWCA 3UXOA 5DB6A 4AYBC 4EYHB 4YQWA 5J2EA 3M8SA 4M9HA 2CPRA 3T5LA 1L3UA 3S6JA 2B6GA 4M9NA 4QZHA 1TFRA 2ES6A 2HOQA 1NK5A 7ICTA 4KLOA 3N7PD 1ZQWA 2K4PA 3VC8A 2NRWA 4P2HA 3BQ0A 4ECRA 2QARA 3JPNA 2EAPA 5AKYA 4RPXA 4CF4A 4NL9C 5ALQA 4ECUA 3AU6A 1UA1A 1XSNA 2W04A 3MDCA 4USAA 4DFJA 2EANA 2HBLA 8ICRA 3SAHA 4ED6A 1M6YA 4KX5A 3ISDA 4DS5A 4NLZA 4JK1A 1PUZA 3WKBA 3V7KA 3NVWA 4PGQA 4RU9A 2QB1A 9ICPA 2LYAA 2AGPA 2WB1F 4QZ8A 5ALSA 3MBYA 1Q3UA 2BDUA 1L8OA 2FJ6A 5D46A 1KKXA 2W9BA 4NL9A 2JEFA 1T4GA 4I2BA 4UATA 5KG1A 2ZUBA 1N48A 1KEJA 1JXEA 4P0PB 2ESEA 3N4MB 4F5QA 8ICLA 4BX9C 1MC8A 5ALIA 3QUTA 3E58A 1S9FA 2QARB 1ZD2P 3I1YA 5G5HA 4I2CA 1BNOA 3E0FA 1V38A 2HHXA 3QYPA 5ALVA 5KFDA 5J29A 3ISCA 4EENA 1NOMA 2IMWP 5KFFA 4PL2A 2H3QA 4J9RA 1U45A 3WK7A 1SWVA 3KD3A 3O0FA 1S0OA 4CDGA 3WU2U 3GIMA 1IG6A 1JUDA 5DG8A 2BKEA 3B0XA 5AKGA 3G6XA 2A1AA 2A3VA 4B9UA 4OJOA 4UAWA 4O3NA 2PFQA 4X5VA 1N5WA 1RQLA 2PMZC 5AM0A 2F1JA 2KIVA 4OJLA 1S0VA 4TUPA 7ICKA 1NJYA 4GIBA 2FMQA 4TUSA 4QZBA 3ICXA 3LWMA 2W54A 3SMVA 3V6JA 5ALEA 3MR6A 1ZQGA 1LKYA 1C7YA 2K8CB 4BDPA 3KHHA 5KG3A 3AM9A 2HHTA 2ZXHA 1ECWA 4FZLA 5D4BA 3L5KA 3M9MB 3HPOA 2BDPA 2EAMA 1S77D 3V6HA 1ZRNA 5DB7A 2UVUA 1N61A 3RBDA 3MR5A 8ICVA 2BR0A 5JRTA 4DQRA 4DSEA 2WHEA 3GV7B 4CRXA 3TQ1A 1L8LA 4C4SA 4QW9A 2VA3A 2D3DA 4UB5A 3PR5B 4IC9A 1N56A 3GIJA 2F8KA 2BHNA 1XNSA 5KG0A 4MF8A 9ICCA 1B0XA 2ZG6A 2KKPA 3U26A 3H4BA 4IQWA 4M47A 3MGIA 3MR3A 1UA0A 5KTQA 2E8NA 9ICFA 1XO0A 3HRDD 1ZQEA 4QZCA 2KJ9A 1ZQJA 2KSOA 4DS4A 3OSNA 4PGXA 1UQVA 2KHQA 4CF3A 1MQ2A 2OEHA 5KT6A 5EE3A 3WKDA 2F77X 4UB4A 9ICLA 3KHGA 2W43A 5ALJA 2H3ZA 5DBAA 1RYSA 2ZIWA 3EZ5A 1IV8A 4UW9A 5AI5A 4DSJA 9ICKA 4YR3A 2XI9A 3HP6A 2RDJA 4C7YA 4I2AA 3MFIA 5CWRA 1COOA 5HHHA 3DEEA 3RJJA 3D2QA 2KVCA 4NLBA 4F4WA 1A76A 4ED8A 4GXKA 2YB4A 4YXMA 4BWJA 3V6KA 9ICRA 5AIBA 1OW5A 2FMSA 5L1KA 3RF9A 4M0AA 3M1YA 4DLGA 2H5XA 2JH7A 2OM6A 2JEJA 2IOFK 4UAUA 1QQ7A 3LYSA 1Q8KA 1HJPA 1ZQOA 4EBCA 3SD7A 1ZQXA 4GXJA 4NLNA 2OYYA 2ZIWB 1S5LU 3KOOA 3F5EA 5DQGA 1UT8A 4J03A 1SB3C 2IOHA 3M6ZA 4AYBF 2I9GA 5EE9A 1FEZA 1SXEA 3IN5A 2IHNA 1BPXA 5AM1A 4F91B 5KG2A 3N7SC 8ICIA 4DSFA 2K89A 5AI0A 3KHLA 5AICA 1XC9A 1RM6C 4Z6CA 4FO6A 4DFPA 1TAUA 1TAMA 3N7RC 3FAHA 2DKXA 4RZRA 2E8PA 3CNHA 4P4PA 3VCBA 4DF4A 4F50A 5J0XA 4O3SA 3NVZA 3MGVA 1ZQCA 3OGUA 2HVIA 2JH1A 3BZKA 2J6UA 2G5HB 4F8RA 4KLSA 9ICWA 4KLFA 2QB0A 5J2BA 4RQ5A 3KTQA 4ZOHC 1FFVA 4Y2TA 4DQIA 3PSPA 1PVPA 7ICRA 8ICWA 1ZQMA 3MC1A 2XCPA 1PVRA 3PY8A 2YB1A 4KLIA 2K8AA 4ELTA 2K8BB 3LDAA 4GC6A 3PVXA 5KFOA 3PZPA 1TKDA 3M8RA 2JR5A 3RJIA 3RJEA 2C22A 2AJQA 3V7LA 4RT2A 5CA7A 5GTIU 2NO5A 8ICZA 3RB3A 3FC4A 4B9LA 1U9LA 5KL8B 3Q8KA 4B9TA 2ISPA 1RZTA 4YR0A 4QWAA 1TAQA 3B0YA 5KG6A 2WAQC 3UM9A 3G6VA 1J97A 4US9A 4C8MA 4OO1J 5IINA 4O5EA 4DL7A 4YVZA 2OCEA 2R8IA 1T94A 4ECQA 5HR7A 1NKBA 2L5YA 4KLJA 4O3OA 2HSZA 2VA8A 3TADA 1ZRMA 2BQ3A 1L3TA 1TK8A 2R8JA 1RXVA 3PO5A 2KICA 2PMZF 1U48A 4QJFB 3GIKA 7ICEA 1JX4A 4UBCA 4Q44A 1QSSA 5DB8A 3QE9Y 4EELA 5J0SA 4EEYA 4ZH4A 4M04A 3LK9A 3DV9A 2F44A 3RJFA 3HKZF 3C5FA 3IG8A 4ED2A 2J6TA 4I27A 2W8LA 4EYIB 2HBKA 5HMMA 3SYZA 2UVRA 5ALPA 2FPLA 1ZQIA 4Q8FA 5KT7A 3RJGA 2MUTB 4KN7A 5BOLA 4Y2UA 4ECWA 1B22A 4EBEA 4QW8A 3RAXA 1DK2A 2KK0A 2P6UA 5KFGA 2DFLA 3SV4A 3PW4A 3SAFA 3SAGA 4KLQA 3G6YA 1URJA 4M9JA 1T8EA 5T14A 1KRPA 3EPIA 7ICMA 2HDOA 4Z6DA 1JN3A 1DGJA 2DBYA 1KL9A 3SZ2A 4F71A 2J6SA 4NM2A 1B4FA 1SL2A 3FM9A 1KSPA 4YCXA 2HVHA 2KOBA 4DSKA 2HHWA 2AQ4A 2E8OA 2MU2A 3NTUA 2R8GA 2CN1A 8ICXA 3KKAC 5IIJA 5JUMA 2JXJA 4QZEA 3V7JA 1ZQQA 8ICAA 7ICOA 2V4RA 3MGHA 4J9NA 4DL4A 4O0IA 8ICEA 4PGYA 1L7MA 4ECSA 2G07A 2ALZA 2IOFA 2KFZA 4RPYA 3PSFA 5KAIU 2V4QA 4IRKA 3LVVA 3PSIA 2G09A 4NLKA 2PXIA 2JGAA 8ICSA 3QU7A 4DEZA 4R65A 3H0LB 4MFCA 2HOIA 2ZUCA 2D8CA 2W3RA 5AKKA 1L5UA 5KFLA 3ZDEA 3T3FA 2UVWA 4ELUA 2ZIVB 5TZVA 4IRCA 4G9BA 3SENA 4KMOB 4DL2A 5KT2A 2PFOA 1ZD4A 3SI8A 4OJ6A 1XSLA 2KNJA 2KZZA 4QWBA 1IIPA 4IQUA 2WF6A 2Y9TA 4NWIA 2YY6A 4C8NA 4KX3A 5L9XA 1BGXT 4DQPA 5AI6A 3QNMA 5J2FA 9ICIA 4PHDA 2XICA 4LZDA 4RUAA 4M9GA 1COKA 3Q8MA 5J2GA 4P0QA 2GLEA 2HMXA 4NM1A 3WKEA 7ICGA 4C8KA 7ICSA 4F4ZA 3I28A 4WJ3B 4M2YA 2XCAA 4Y2XA 4DQQA 1N60A 3ORYA 4OJ5A 1TE2A 2YMMA 1N2XA 2ASLA 3L4PA 5HHIA 1NJXA 1NI3A 5J0TA 1QTMA 2EH9A 2ZIUB 4ICAA 2W55A 4NJ8A 4ELVA 4ACOA 3WKAA 9ICAA 2JV3A 4O3PA 2LM4A 5J0WA 5KFNA 1ZYQA 8ICUA 4GC7A 1SV4A 2LI6A 2M0NA 3QX7A 3PX4A 5KFPA 3T5JA 3Q8QB 5ALHA 4RQ2A 2GOLA 4R63A 1BPBA 3QEBZ 1KDHA 7ICFA 3A0BU 2KEYA 2LYBA 4KMUA 5ALYA 3PO4A 5DGAA 4JWMA 1YZ7A 4AP9A 2F2AB 2OXOA 3C2MA 7ICHA 4DL5A 3H40A 4I2FA 2BCUA 2R8KA 1NKCA 5JU5A 3QEAZ 1Z3EB 3TKAA 1EXNA 5KL1B 4DFDA 1WUDA 3GZFA 2WF9A 5B5EU 5KT3A 2H3FA 4DF8A 5CR0A 5ALWA 4DLEA 4P4OA 2LHTA 5KFZA 2JEIA 3KZXA 3KBBA 5AM3A 3FDSA 1SZPA 5DDYA 1ZQRA 5KFHA 2WAQF 4BXOA 1WWVA 2BPFA 4CF5A 3UQ0A 3M9OB 2W9BB 1Z1BA 1OUQA 2ZJ5A 4RUCA 1Z19A 3AEVA 2Y0SC 1JI7A 5IIIA 1BPZA 3IG5A 3BS7A 2M9NA 3PX0A 1KFSA 5KFRA 2KG5A 2B0CA 3HKZC 3UMCA 4GFJA 4RQ0A 5KFVA 1Y88A 1L3SA 4I28A 3A0HU 3UPQA 1L7PA 1MN8A 4YXJA 4F3OA 1TK0A 3PW7A 5F9LA 2OH2A 2H3VA 3ONNA 1T7PA 2UVVA 3PW5A 1BNPA 5FP0A 1F44A 5ALKA 4PHEA 4QZDA 2BGWA 2ZIXA 4UAYA 1BVSA 3JPRA 5AIAA 4EX6A 4QNLA 1QQ5A 7ICIA 1XSPA 5KFKA 2PKEA 1T3QA 4CNQA 3NASA 2ZTEA 5CJ7A 3C28A 3N28A 2NRZA 4YD2A 1SXDA 3OJUA 5F9NA 5KFIA 2GWSA 1Z1VA 1LKYB 2NO4A 4LZGA 4M9LA 5J8YA 1NK7A 3R9KA 1QH9A 4DL6A 3LWLA 4XA5A 4DFMA 5DG7A 4RQ4A 4KLGA 1JXLA 2ASJA 3RR7A 4F93B 2DF4B 1MQ3A 3PW2A 2FLPA 1X42A 4EBDA 4OJPA 3AQFA 3CP8A 2NYVA 2KIWA 2ZTCA 1YT3A
chains in the Genus database with same CATH topology
2EAMA 2KMDA 2YTUA 2QB1A 1JI7A 4NJ8A 2E8OA 3BS7A 1PK3A 2DKZA 2KG5A 4RQMA 1DXSA 5JRTA 1V85A 1SV0C 3KKAC 4IS7A 2JV3A 1UCVA 2KE7A 3BS5B 4NL9A 1X9XA 3KKAA 2D3DA 2ESEA 1X40A 1SXEA 2LMRA 1SV4A 2FE9A 2KSOB 2F8KA 3TADC 2QARB 1B0XA 2DL0A 2L5YA 3TADA 1V38A 2EAOA 1SGGA 3BS5A 4PZOA 2E8NA 5KNIA 2DKXA 2Y9UA 2E8PA 2KSOA 3H8MA 3IDWA 1SV0A 4MHVA 1UQVA 2QB0B 1KW4A 3HILA 2D8CA 2F3NA 5JTIA 2B6GA 5JU5A 5J8YC 1SXDA 2F44A 1WWUA 2ES6A 1Z1VA 2QKQA 1LKYB 4RQNA 2LPEA 1PK1B 4PZNA 5J8YA 2K4PA 3BQ7A 2QB0A 3SENA 2KIVA 2K60A 5L1MA 1X66A 2QARA 3K1RB 2EAPA 3TACB 1F0MA 1LKYA 4NL9C 2Y9TA 1OXJA 1PK1A 1WWVA 1OW5A 3SEIA 1COKA 2EANA 2E8MA 2GLEA 5F3XB 1RG6A 1B4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAM A;  2KMD A;  2YTU A;  2QB1 A;  1JI7 A;  4NJ8 A;  2E8O A;  3BS7 A;  1PK3 A;  2DKZ A;  2KG5 A;  4RQM A;  1DXS A;  5JRT A;  1V85 A;  1SV0 C;  3KKA C;  4IS7 A;  2JV3 A;  1UCV A;  2KE7 A;  3BS5 B;  4NL9 A;  1X9X A;  3KKA A;  2D3D A;  2ESE A;  1X40 A;  1SXE A;  2LMR A;  1SV4 A;  2FE9 A;  2KSO B;  2F8K A;  3TAD C;  2QAR B;  1B0X A;  2DL0 A;  2L5Y A;  3TAD A;  1V38 A;  2EAO A;  1SGG A;  3BS5 A;  4PZO A;  2E8N A;  5KNI A;  2DKX A;  2Y9U A;  2E8P A;  2KSO A;  3H8M A;  3IDW A;  1SV0 A;  4MHV A;  1UQV A;  2QB0 B;  1KW4 A;  3HIL A;  2D8C A;  2F3N A;  5JTI A;  2B6G A;  5JU5 A;  5J8Y C;  1SXD A;  2F44 A;  1WWU A;  2ES6 A;  1Z1V A;  2QKQ A;  1LKY B;  4RQN A;  2LPE A;  1PK1 B;  4PZN A;  5J8Y A;  2K4P A;  3BQ7 A;  2QB0 A;  3SEN A;  2KIV A;  2K60 A;  5L1M A;  1X66 A;  2QAR A;  3K1R B;  2EAP A;  3TAC B;  1F0M A;  1LKY A;  4NL9 C;  2Y9T A;  1OXJ A;  1PK1 A;  1WWV A;  1OW5 A;  3SEI A;  1COK A;  2EAN A;  2E8M A;  2GLE A;  5F3X B;  1RG6 A;  1B4F A; 
#chains in the Genus database with same CATH topology
 1ZD3 A;  1B43 A;  2HBJ A;  5AK5 A;  5DDM A;  9ICO A;  2JEG A;  4FFD A;  3PMN A;  4C4R A;  1NZB A;  1V85 A;  5EWG A;  2K4E A;  1MA7 A;  3TAP A;  2WFA A;  3F53 A;  9ICT A;  2Q0Z X;  4FZM A;  1SIJ A;  1FFU A;  2LMR A;  2KSO B;  1C20 A;  4I29 A;  2GO7 A;  3AQE A;  2IA6 A;  3C1Y A;  4DO9 A;  3C5G A;  2YX8 A;  1NZP A;  4B9V A;  9ICE A;  3AUO A;  5J0R A;  5DLF A;  4YG2 A;  5HML A;  1FIQ A;  2XO7 A;  2IHM A;  1RQN A;  3IDW A;  1IXR A;  5ALF A;  3UQ2 A;  1F5S A;  3AU2 A;  2BCS A;  4DWI A;  3CYM A;  5AK4 A;  4QIW C;  1L7O A;  1V97 A;  1O03 A;  1DK3 A;  1D8L A;  5KFM A;  5KFJ A;  8ICC A;  3NVV A;  2VA2 A;  4R8U A;  5AI9 A;  3JPO A;  1Z00 A;  2G06 A;  1A6S A;  5ALU A;  5EE1 A;  2K60 A;  3PST A;  9ICN A;  5L1M A;  1X66 A;  4UBB A;  4RT3 A;  2BCR A;  2LKY A;  5KT5 A;  1NNL A;  4K4I A;  1F0M A;  3RJK A;  2FLL A;  3WK8 A;  2QLT A;  2VAN A;  2W9M A;  1V9P A;  3ZDD A;  2FPM A;  1TVA A;  1JRP A;  1VLB A;  2K4H A;  5ALG A;  1RYR A;  2FMP A;  4Z6E A;  3H0M B;  3TAR A;  1RG6 A;  1S0M A;  3C23 A;  4FBU A;  5DQI A;  4UB2 A;  1ZQT A;  1D8Y A;  5AKH A;  4J9K A;  4NY8 A;  3OPX A;  4PPX A;  2KFN A;  5J0O A;  2DPI A;  4NLG A;  3RRH A;  3J81 j;  4KLD A;  3JPS A;  8ICP A;  4RQ8 A;  4TQS A;  2EZZ A;  2BQU A;  3TAD C;  2W7O A;  3WK4 A;  3IV6 A;  4O3Q A;  1T3N A;  4U6P A;  3UMB A;  2EAO A;  4FZN A;  5KNI A;  2W3S A;  3LVW A;  8ICF A;  5L1L A;  1L6N A;  2AHO B;  4MHV A;  2QB0 B;  2HHS A;  2C2R A;  2G5I B;  2KN7 A;  3RB6 A;  4JV0 A;  5CEH A;  4F5N A;  1LV5 A;  1O08 A;  4YMM A;  1HUO A;  2E3T A;  2W9A A;  1J2N A;  1AQ6 A;  5G5G A;  3RH5 A;  1K5O A;  4QZG A;  3RH4 A;  8ICK A;  4LJX A;  5D49 A;  3EPG A;  2Y0S F;  1N63 A;  4Q8E A;  3N97 B;  4CGZ A;  1FO4 A;  5KFS A;  2I6X A;  4DFK A;  5KFB A;  2C2E A;  2RDI A;  1PK1 A;  4XQ8 A;  5IIO A;  4EZ9 A;  5J2J A;  1QLN A;  3SEI A;  4M6W A;  4KLH A;  2BPG A;  5J0Q A;  5AK6 A;  3ZD9 A;  2EZX A;  3UMG A;  1KTQ A;  4KLT A;  2RP5 A;  4Y2Y A;  3QU4 A;  5J2H A;  2R8H A;  4XRH A;  4RNM A;  4DQS A;  2LM1 A;  5AKI A;  1N62 A;  2W9C A;  2WF5 A;  3HJE A;  1Z4N A;  4QZA A;  4IS7 A;  1SZH A;  2KE7 A;  2KD1 A;  3WK9 A;  2JHD A;  5AI8 A;  3QU9 A;  4TUQ A;  1ZQV A;  3NS1 A;  5J0U A;  1IM4 A;  4MEX A;  2YN4 A;  1DRG A;  1SKW A;  4E0D A;  5CHG A;  4IR9 A;  3UXN A;  4O9M A;  2Z7J A;  2RQ5 A;  4F4X A;  4I2I A;  2D6F C;  3OHA A;  3WK6 A;  3HWT A;  4EX7 A;  3QU2 A;  1HEK A;  2FDR A;  4Z6F A;  1KBU A;  4IQV A;  3BS5 A;  4HAI A;  3MR2 A;  4ECY A;  1A77 A;  1CI4 A;  3C2K A;  3GII A;  3BDP A;  4RNO A;  3TI0 A;  1U47 A;  3M7D A;  2PI5 A;  1ZQU A;  3HT3 A;  3RRG A;  3EWA A;  5KAF U;  8ICQ A;  3PX6 A;  3EW9 A;  4EEK A;  2EQY A;  2W9C B;  4CCH A;  4U7C A;  2PFN A;  8ICJ A;  1N5X A;  3MFH A;  2RLT A;  1YZ6 A;  4J9P A;  5KFA A;  2KKV A;  3QZ7 A;  4I2H A;  4JV1 A;  3K1R B;  1RDF A;  4Y2V A;  2JZB A;  4F5R A;  2FI1 A;  4RQ6 A;  2B21 A;  3TAN A;  5CRX A;  2WF7 A;  4F5O A;  4JV2 A;  3NRZ A;  4FS1 A;  4B9M A;  2BQR A;  3IRU A;  3AMZ A;  4J9S A;  5ALX A;  3SQI A;  4G3I A;  2E1E A;  3BQ2 A;  4KLM A;  3ZDA A;  2KMD A;  4YP3 A;  4QWE A;  5KFU A;  3JPT A;  4UB6 U;  1SL0 A;  3UXP A;  5KFW A;  4F2S A;  2FLN A;  2DKZ A;  2ASD A;  1BPD A;  4F4K A;  5J2D A;  5J0Y A;  5KFC A;  9ICG A;  4A8E A;  3C29 A;  2HW3 A;  1X9X A;  2HI0 A;  2ZTD A;  4QWD A;  1X40 A;  2OHF A;  1D9D A;  4KTQ A;  1ARO P;  4QZF A;  3QUB A;  4QIW F;  5C0Y A;  3GQC A;  2JZB B;  5AI4 A;  3BQT A;  1ZQY A;  2H3I A;  1S76 D;  3IHQ B;  1KN5 A;  2N1R A;  5HR6 A;  5ALT A;  3K4G A;  2Y9U A;  5IIL A;  9ICJ A;  4P0P A;  4BGD A;  3H8M A;  2HCF A;  4NLC A;  4KLL A;  1UHU A;  1GO3 F;  5KG4 A;  2AXT U;  3SV3 A;  4JB3 A;  4C8O A;  4ED1 A;  3Q8P B;  1JAL A;  4J9L A;  3D2N A;  3V72 A;  4FS2 A;  4IRD A;  1ZET A;  5DLG A;  4PZN A;  3QUC A;  4J9O A;  8ICH A;  4K4G A;  1UPH A;  4P0Q B;  4UAR A;  1KFT A;  3HW8 A;  1MSW D;  1SL1 A;  5EE0 A;  3Q8S B;  3EYZ A;  2MRL A;  5HNK A;  3CW2 C;  1OXJ A;  4PHP A;  3C2L A;  2P66 A;  4RNN A;  4IL6 U;  4ED0 A;  2P6R A;  2Y1I A;  4PHA A;  1SWW A;  1X2I A;  4UAV A;  1ZQD A;  2LBO A;  2Y1J A;  3M6K A;  2CXY A;  9ICH A;  4US8 A;  3JPQ A;  2HHV A;  1NK9 A;  2HHU A;  4I2G A;  4KLE A;  4RQ3 A;  4HYK A;  4ED3 A;  1TK5 A;  5ALD A;  2DUY A;  4FBT A;  2WF8 A;  3K75 D;  3OHB A;  2ODG A;  2AH5 A;  3RTV A;  4Q45 A;  2MAX A;  2KHV A;  2AGQ A;  1ZQL A;  1DXS A;  8ICO A;  1SV0 C;  5H2F U;  3F5A A;  5CP2 A;  3CRX A;  1KLN A;  5KG5 A;  4PH5 A;  3PML A;  4RQ7 A;  4NV0 A;  1DGS A;  4MF2 A;  2ZUD A;  3Q8R B;  2YQE A;  1HUZ A;  4F5P A;  5EWF A;  3F2B A;  2HBM A;  4ECV A;  2W03 A;  2F76 X;  1J2M A;  3C21 A;  2E5S A;  3BZC A;  2W11 A;  1VDV A;  4PZO A;  4YR2 A;  1SKS A;  5KG7 A;  2KJ5 A;  3F2D A;  2A19 A;  3PNC A;  5IIK A;  1ZQN A;  1ZQS A;  2KTQ A;  2OWO A;  4GLX A;  1CEZ A;  2VJ4 A;  4BJQ A;  1SV0 A;  1Q46 A;  1ZQP A;  9ICS A;  4PJ0 U;  3HIL A;  3MAB A;  4C7Z A;  2YMQ A;  2K4I A;  1PZN A;  5J8Y C;  1NJZ A;  3ZDC A;  1VJ5 A;  2WTF A;  4ECX A;  4QZI A;  2XY7 A;  1BPY A;  4BXO B;  3BQ7 A;  4DL3 A;  5K4L A;  4RQ1 A;  2ZJA A;  4J9Q A;  1RXW A;  4IR1 A;  4YD1 A;  1NK8 A;  2NRV A;  2AQ0 A;  5IIM A;  3ISB A;  9ICB A;  1A0P A;  2BZF A;  3SR6 A;  1S0N A;  5L1J A;  1Q3V A;  7ICJ A;  7ICL A;  3RB0 A;  2AU0 A;  2E8M A;  5BOM A;  2G0A A;  5AM5 A;  3TAQ A;  3ZI4 A;  8ICB A;  9ICV A;  9ICU A;  2KVS A;  1X9W A;  4MFA A;  4F2R A;  2XC9 A;  4O3R A;  2YTU A;  4B6J A;  5TIS U;  3BQ1 A;  1PK3 A;  3I76 A;  2JMG A;  2LYH A;  3OSP A;  1X9S A;  3L3F X;  4KIT B;  7ICU A;  1ZXI A;  5KFY A;  3D6J A;  2DPJ A;  2ZIX B;  3RBE A;  5DGB A;  3DDH A;  1U4B A;  1UT5 A;  1WCN A;  2KV2 A;  4UB8 U;  5J2K A;  4TUR A;  2DQN B;  3H0R B;  3IM1 A;  2ATL A;  3OJS A;  2NRT A;  3NUQ A;  3RJH A;  1WG8 A;  5A0L A;  9ICX A;  2NRX A;  2NV3 A;  3BJY A;  3ED5 A;  4I2D A;  2C28 A;  3RR8 A;  5CB1 A;  1KW4 A;  8ICG A;  4B9N A;  4RPZ A;  3JPP A;  5EOZ A;  4EZ6 A;  2F3N A;  3QU5 A;  1SKR A;  5ALM A;  5KFX A;  5AKJ A;  1BPE A;  2QKQ A;  5ALZ A;  4C0Z A;  4DSI A;  1LVH A;  2O6K A;  4DOB A;  3T5K A;  2JRZ A;  4UAZ A;  3GDX A;  3D2S A;  2DWQ A;  1JMS A;  1CRX A;  3M9N B;  4OD0 A;  4BUG A;  2I1Q A;  1D8B A;  2VJ5 A;  3QXG A;  4YN4 A;  4TQR A;  3Q8L A;  1NK4 A;  5HP4 A;  4XUS A;  3PW0 A;  5ALN A;  1NKE A;  2G08 A;  2XY5 A;  1XS9 D;  3AN1 A;  5F3X B;  1ED1 A;  3HX0 A;  3AL0 B;  2BPC A;  3GV8 B;  1H38 A;  4GXI A;  1NK6 A;  1S97 A;  2HOF A;  1JIH A;  3GU3 A;  1ZQA A;  1HIW A;  5DKW A;  8ICY A;  5AHX A;  5AKZ A;  2ZXI A;  4RQM A;  4CE6 A;  3KHR A;  1QSL A;  3MDA A;  5AKL A;  2FPK A;  3PV8 A;  4JMU A;  5AKE A;  2W8K A;  2YML A;  1RYU A;  4UQG A;  2E1F A;  4C80 A;  4MEY A;  2F1H A;  5ALO A;  4UB3 A;  4P4M A;  2WB1 C;  2XVT A;  3RFA A;  2GH1 A;  1U49 A;  3QUQ A;  2F8L A;  4DOC A;  4JUZ A;  5ALL A;  4O5K A;  3IP4 B;  2EZY A;  4R8U B;  1Z00 B;  2PI4 A;  3NGD A;  5JTI A;  1S10 A;  8ICN A;  5KFQ A;  1WWU A;  5AM4 A;  2YMP A;  5J0P A;  5AM2 A;  1X6J A;  4RQN A;  1RPL A;  5KFT A;  2LPE A;  4NXZ A;  1L3V A;  2HHQ A;  5GTH U;  2XGQ A;  4KLU A;  4QZ9 A;  3ZD8 A;  3GV5 B;  1QQ6 A;  3THV A;  4Y2J A;  3WKC A;  4ED7 A;  1LB2 B;  3TAC B;  2IBK A;  4C4T A;  2XY6 A;  3ETL A;  4YFK A;  3H4D A;  3ETR A;  5EWE A;  3KFU F;  7ICP A;  3NRW A;  7ICQ A;  1XO1 A;  5E79 U;  2ZJ8 A;  2MUT A;  2C2D A;  5DBC A;  2PFP A;  3EUB 2;  4UAS A;  1WCL A;  1WYG A;  2Q4T A;  3WK5 A;  3F2C A;  1P7D A;  5AK3 A;  5KT4 A;  4MFF A;  3T79 A;  1DOQ A;  4Y2R A;  4R66 A;  2EDU A;  4J9M A;  1ZQK A;  2F1I A;  3K1Z A;  2FE9 A;  2P35 A;  4R64 A;  2DL0 A;  4LVS A;  2KZM A;  4DSL A;  5C5J A;  3QZ8 A;  4YMO A;  3RH6 A;  3NVY A;  2RRD A;  1X9M A;  4O3M A;  1KFD A;  1K1Q A;  9ICQ A;  1QCK A;  4F4Y A;  4B9S A;  4I2E A;  2VIX A;  4YMN A;  8ICM A;  3ALR A;  2AGO A;  1Z4O A;  1JRO A;  1ZQF A;  3RB4 A;  3TFR A;  1XWL A;  4OCZ A;  3H8J A;  1K1S A;  4F72 A;  5J2C A;  1PK1 B;  3C1Z A;  4Y2P A;  5DBB A;  3OTQ A;  5DG9 A;  1ZD5 A;  4M6W B;  2BCQ A;  4I2J A;  2A1J A;  4K4H A;  3H8W A;  4FE3 A;  5BPC A;  4Y2Q A;  4Q43 A;  1XU4 A;  3T5H A;  1ZQ1 C;  2V9W A;  4DCC A;  2ZIV A;  1ZQZ A;  4KN4 A;  2VKQ A;  2W7P A;  3KZI U;  1KQQ A;  3PR4 A;  3E2E A;  9ICM A;  7ICV A;  3H7I A;  4IQT A;  2DGZ A;  5DB9 A;  5ALR A;  2KP7 A;  4PL1 A;  5L1I A;  4UB1 A;  8ICT A;  2KZ3 A;  2RHF A;  5DQH A;  3GIL A;  2KJ8 A;  1CUK A;  3RAQ A;  2I5H A;  2MA1 A;  1L7N A;  1NJW A;  1D9F A;  1UCV A;  3BS5 B;  4Y2S A;  2BCV A;  3B9J A;  2CRX A;  3TFS A;  3KKA A;  1ZJM A;  4C8L A;  1ZQH A;  3FYH A;  1TV9 A;  5B66 U;  4O5C A;  4DOA A;  2ZIU A;  2A1J B;  1NK0 A;  2ISO A;  4F92 B;  3ZDB A;  1ZQB A;  5KFE A;  5J2A A;  1X6I A;  1ZOL A;  4JWN A;  5AKX A;  3H8S A;  4BWM A;  1S8O A;  5J2I A;  1SGG A;  2MSN A;  4ECT A;  1QSY A;  7ICN A;  4ECZ A;  3GFK B;  1ZJN A;  2R18 A;  2XGP A;  1PVQ A;  2XID A;  4QWC A;  3UXO A;  5DB6 A;  4AYB C;  4EYH B;  4YQW A;  5J2E A;  3M8S A;  4M9H A;  2CPR A;  3T5L A;  1L3U A;  3S6J A;  2B6G A;  4M9N A;  4QZH A;  1TFR A;  2ES6 A;  2HOQ A;  1NK5 A;  7ICT A;  4KLO A;  3N7P D;  1ZQW A;  2K4P A;  3VC8 A;  2NRW A;  4P2H A;  3BQ0 A;  4ECR A;  2QAR A;  3JPN A;  2EAP A;  5AKY A;  4RPX A;  4CF4 A;  4NL9 C;  5ALQ A;  4ECU A;  3AU6 A;  1UA1 A;  1XSN A;  2W04 A;  3MDC A;  4USA A;  4DFJ A;  2EAN A;  2HBL A;  8ICR A;  3SAH A;  4ED6 A;  1M6Y A;  4KX5 A;  3ISD A;  4DS5 A;  4NLZ A;  4JK1 A;  1PUZ A;  3WKB A;  3V7K A;  3NVW A;  4PGQ A;  4RU9 A;  2QB1 A;  9ICP A;  2LYA A;  2AGP A;  2WB1 F;  4QZ8 A;  5ALS A;  3MBY A;  1Q3U A;  2BDU A;  1L8O A;  2FJ6 A;  5D46 A;  1KKX A;  2W9B A;  4NL9 A;  2JEF A;  1T4G A;  4I2B A;  4UAT A;  5KG1 A;  2ZUB A;  1N48 A;  1KEJ A;  1JXE A;  4P0P B;  2ESE A;  3N4M B;  4F5Q A;  8ICL A;  4BX9 C;  1MC8 A;  5ALI A;  3QUT A;  3E58 A;  1S9F A;  2QAR B;  1ZD2 P;  3I1Y A;  5G5H A;  4I2C A;  1BNO A;  3E0F A;  1V38 A;  2HHX A;  3QYP A;  5ALV A;  5KFD A;  5J29 A;  3ISC A;  4EEN A;  1NOM A;  2IMW P;  5KFF A;  4PL2 A;  2H3Q A;  4J9R A;  1U45 A;  3WK7 A;  1SWV A;  3KD3 A;  3O0F A;  1S0O A;  4CDG A;  3WU2 U;  3GIM A;  1IG6 A;  1JUD A;  5DG8 A;  2BKE A;  3B0X A;  5AKG A;  3G6X A;  2A1A A;  2A3V A;  4B9U A;  4OJO A;  4UAW A;  4O3N A;  2PFQ A;  4X5V A;  1N5W A;  1RQL A;  2PMZ C;  5AM0 A;  2F1J A;  2KIV A;  4OJL A;  1S0V A;  4TUP A;  7ICK A;  1NJY A;  4GIB A;  2FMQ A;  4TUS A;  4QZB A;  3ICX A;  3LWM A;  2W54 A;  3SMV A;  3V6J A;  5ALE A;  3MR6 A;  1ZQG A;  1LKY A;  1C7Y A;  2K8C B;  4BDP A;  3KHH A;  5KG3 A;  3AM9 A;  2HHT A;  2ZXH A;  1ECW A;  4FZL A;  5D4B A;  3L5K A;  3M9M B;  3HPO A;  2BDP A;  2EAM A;  1S77 D;  3V6H A;  1ZRN A;  5DB7 A;  2UVU A;  1N61 A;  3RBD A;  3MR5 A;  8ICV A;  2BR0 A;  5JRT A;  4DQR A;  4DSE A;  2WHE A;  3GV7 B;  4CRX A;  3TQ1 A;  1L8L A;  4C4S A;  4QW9 A;  2VA3 A;  2D3D A;  4UB5 A;  3PR5 B;  4IC9 A;  1N56 A;  3GIJ A;  2F8K A;  2BHN A;  1XNS A;  5KG0 A;  4MF8 A;  9ICC A;  1B0X A;  2ZG6 A;  2KKP A;  3U26 A;  3H4B A;  4IQW A;  4M47 A;  3MGI A;  3MR3 A;  1UA0 A;  5KTQ A;  2E8N A;  9ICF A;  1XO0 A;  3HRD D;  1ZQE A;  4QZC A;  2KJ9 A;  1ZQJ A;  2KSO A;  4DS4 A;  3OSN A;  4PGX A;  1UQV A;  2KHQ A;  4CF3 A;  1MQ2 A;  2OEH A;  5KT6 A;  5EE3 A;  3WKD A;  2F77 X;  4UB4 A;  9ICL A;  3KHG A;  2W43 A;  5ALJ A;  2H3Z A;  5DBA A;  1RYS A;  2ZIW A;  3EZ5 A;  1IV8 A;  4UW9 A;  5AI5 A;  4DSJ A;  9ICK A;  4YR3 A;  2XI9 A;  3HP6 A;  2RDJ A;  4C7Y A;  4I2A A;  3MFI A;  5CWR A;  1COO A;  5HHH A;  3DEE A;  3RJJ A;  3D2Q A;  2KVC A;  4NLB A;  4F4W A;  1A76 A;  4ED8 A;  4GXK A;  2YB4 A;  4YXM A;  4BWJ A;  3V6K A;  9ICR A;  5AIB A;  1OW5 A;  2FMS A;  5L1K A;  3RF9 A;  4M0A A;  3M1Y A;  4DLG A;  2H5X A;  2JH7 A;  2OM6 A;  2JEJ A;  2IOF K;  4UAU A;  1QQ7 A;  3LYS A;  1Q8K A;  1HJP A;  1ZQO A;  4EBC A;  3SD7 A;  1ZQX A;  4GXJ A;  4NLN A;  2OYY A;  2ZIW B;  1S5L U;  3KOO A;  3F5E A;  5DQG A;  1UT8 A;  4J03 A;  1SB3 C;  2IOH A;  3M6Z A;  4AYB F;  2I9G A;  5EE9 A;  1FEZ A;  1SXE A;  3IN5 A;  2IHN A;  1BPX A;  5AM1 A;  4F91 B;  5KG2 A;  3N7S C;  8ICI A;  4DSF A;  2K89 A;  5AI0 A;  3KHL A;  5AIC A;  1XC9 A;  1RM6 C;  4Z6C A;  4FO6 A;  4DFP A;  1TAU A;  1TAM A;  3N7R C;  3FAH A;  2DKX A;  4RZR A;  2E8P A;  3CNH A;  4P4P A;  3VCB A;  4DF4 A;  4F50 A;  5J0X A;  4O3S A;  3NVZ A;  3MGV A;  1ZQC A;  3OGU A;  2HVI A;  2JH1 A;  3BZK A;  2J6U A;  2G5H B;  4F8R A;  4KLS A;  9ICW A;  4KLF A;  2QB0 A;  5J2B A;  4RQ5 A;  3KTQ A;  4ZOH C;  1FFV A;  4Y2T A;  4DQI A;  3PSP A;  1PVP A;  7ICR A;  8ICW A;  1ZQM A;  3MC1 A;  2XCP A;  1PVR A;  3PY8 A;  2YB1 A;  4KLI A;  2K8A A;  4ELT A;  2K8B B;  3LDA A;  4GC6 A;  3PVX A;  5KFO A;  3PZP A;  1TKD A;  3M8R A;  2JR5 A;  3RJI A;  3RJE A;  2C22 A;  2AJQ A;  3V7L A;  4RT2 A;  5CA7 A;  5GTI U;  2NO5 A;  8ICZ A;  3RB3 A;  3FC4 A;  4B9L A;  1U9L A;  5KL8 B;  3Q8K A;  4B9T A;  2ISP A;  1RZT A;  4YR0 A;  4QWA A;  1TAQ A;  3B0Y A;  5KG6 A;  2WAQ C;  3UM9 A;  3G6V A;  1J97 A;  4US9 A;  4C8M A;  4OO1 J;  5IIN A;  4O5E A;  4DL7 A;  4YVZ A;  2OCE A;  2R8I A;  1T94 A;  4ECQ A;  5HR7 A;  1NKB A;  2L5Y A;  4KLJ A;  4O3O A;  2HSZ A;  2VA8 A;  3TAD A;  1ZRM A;  2BQ3 A;  1L3T A;  1TK8 A;  2R8J A;  1RXV A;  3PO5 A;  2KIC A;  2PMZ F;  1U48 A;  4QJF B;  3GIK A;  7ICE A;  1JX4 A;  4UBC A;  4Q44 A;  1QSS A;  5DB8 A;  3QE9 Y;  4EEL A;  5J0S A;  4EEY A;  4ZH4 A;  4M04 A;  3LK9 A;  3DV9 A;  2F44 A;  3RJF A;  3HKZ F;  3C5F A;  3IG8 A;  4ED2 A;  2J6T A;  4I27 A;  2W8L A;  4EYI B;  2HBK A;  5HMM A;  3SYZ A;  2UVR A;  5ALP A;  2FPL A;  1ZQI A;  4Q8F A;  5KT7 A;  3RJG A;  2MUT B;  4KN7 A;  5BOL A;  4Y2U A;  4ECW A;  1B22 A;  4EBE A;  4QW8 A;  3RAX A;  1DK2 A;  2KK0 A;  2P6U A;  5KFG A;  2DFL A;  3SV4 A;  3PW4 A;  3SAF A;  3SAG A;  4KLQ A;  3G6Y A;  1URJ A;  4M9J A;  1T8E A;  5T14 A;  1KRP A;  3EPI A;  7ICM A;  2HDO A;  4Z6D A;  1JN3 A;  1DGJ A;  2DBY A;  1KL9 A;  3SZ2 A;  4F71 A;  2J6S A;  4NM2 A;  1B4F A;  1SL2 A;  3FM9 A;  1KSP A;  4YCX A;  2HVH A;  2KOB A;  4DSK A;  2HHW A;  2AQ4 A;  2E8O A;  2MU2 A;  3NTU A;  2R8G A;  2CN1 A;  8ICX A;  3KKA C;  5IIJ A;  5JUM A;  2JXJ A;  4QZE A;  3V7J A;  1ZQQ A;  8ICA A;  7ICO A;  2V4R A;  3MGH A;  4J9N A;  4DL4 A;  4O0I A;  8ICE A;  4PGY A;  1L7M A;  4ECS A;  2G07 A;  2ALZ A;  2IOF A;  2KFZ A;  4RPY A;  3PSF A;  5KAI U;  2V4Q A;  4IRK A;  3LVV A;  3PSI A;  2G09 A;  4NLK A;  2PXI A;  2JGA A;  8ICS A;  3QU7 A;  4DEZ A;  4R65 A;  3H0L B;  4MFC A;  2HOI A;  2ZUC A;  2D8C A;  2W3R A;  5AKK A;  1L5U A;  5KFL A;  3ZDE A;  3T3F A;  2UVW A;  4ELU A;  2ZIV B;  5TZV A;  4IRC A;  4G9B A;  3SEN A;  4KMO B;  4DL2 A;  5KT2 A;  2PFO A;  1ZD4 A;  3SI8 A;  4OJ6 A;  1XSL A;  2KNJ A;  2KZZ A;  4QWB A;  1IIP A;  4IQU A;  2WF6 A;  2Y9T A;  4NWI A;  2YY6 A;  4C8N A;  4KX3 A;  5L9X A;  1BGX T;  4DQP A;  5AI6 A;  3QNM A;  5J2F A;  9ICI A;  4PHD A;  2XIC A;  4LZD A;  4RUA A;  4M9G A;  1COK A;  3Q8M A;  5J2G A;  4P0Q A;  2GLE A;  2HMX A;  4NM1 A;  3WKE A;  7ICG A;  4C8K A;  7ICS A;  4F4Z A;  3I28 A;  4WJ3 B;  4M2Y A;  2XCA A;  4Y2X A;  4DQQ A;  1N60 A;  3ORY A;  4OJ5 A;  1TE2 A;  2YMM A;  1N2X A;  2ASL A;  3L4P A;  5HHI A;  1NJX A;  1NI3 A;  5J0T A;  1QTM A;  2EH9 A;  2ZIU B;  4ICA A;  2W55 A;  4NJ8 A;  4ELV A;  4ACO A;  3WKA A;  9ICA A;  2JV3 A;  4O3P A;  2LM4 A;  5J0W A;  5KFN A;  1ZYQ A;  8ICU A;  4GC7 A;  1SV4 A;  2LI6 A;  2M0N A;  3QX7 A;  3PX4 A;  5KFP A;  3T5J A;  3Q8Q B;  5ALH A;  4RQ2 A;  2GOL A;  4R63 A;  1BPB A;  3QEB Z;  1KDH A;  7ICF A;  3A0B U;  2KEY A;  2LYB A;  4KMU A;  5ALY A;  3PO4 A;  5DGA A;  4JWM A;  1YZ7 A;  4AP9 A;  2F2A B;  2OXO A;  3C2M A;  7ICH A;  4DL5 A;  3H40 A;  4I2F A;  2BCU A;  2R8K A;  1NKC A;  5JU5 A;  3QEA Z;  1Z3E B;  3TKA A;  1EXN A;  5KL1 B;  4DFD A;  1WUD A;  3GZF A;  2WF9 A;  5B5E U;  5KT3 A;  2H3F A;  4DF8 A;  5CR0 A;  5ALW A;  4DLE A;  4P4O A;  2LHT A;  5KFZ A;  2JEI A;  3KZX A;  3KBB A;  5AM3 A;  3FDS A;  1SZP A;  5DDY A;  1ZQR A;  5KFH A;  2WAQ F;  4BXO A;  1WWV A;  2BPF A;  4CF5 A;  3UQ0 A;  3M9O B;  2W9B B;  1Z1B A;  1OUQ A;  2ZJ5 A;  4RUC A;  1Z19 A;  3AEV A;  2Y0S C;  1JI7 A;  5III A;  1BPZ A;  3IG5 A;  3BS7 A;  2M9N A;  3PX0 A;  1KFS A;  5KFR A;  2KG5 A;  2B0C A;  3HKZ C;  3UMC A;  4GFJ A;  4RQ0 A;  5KFV A;  1Y88 A;  1L3S A;  4I28 A;  3A0H U;  3UPQ A;  1L7P A;  1MN8 A;  4YXJ A;  4F3O A;  1TK0 A;  3PW7 A;  5F9L A;  2OH2 A;  2H3V A;  3ONN A;  1T7P A;  2UVV A;  3PW5 A;  1BNP A;  5FP0 A;  1F44 A;  5ALK A;  4PHE A;  4QZD A;  2BGW A;  2ZIX A;  4UAY A;  1BVS A;  3JPR A;  5AIA A;  4EX6 A;  4QNL A;  1QQ5 A;  7ICI A;  1XSP A;  5KFK A;  2PKE A;  1T3Q A;  4CNQ A;  3NAS A;  2ZTE A;  5CJ7 A;  3C28 A;  3N28 A;  2NRZ A;  4YD2 A;  1SXD A;  3OJU A;  5F9N A;  5KFI A;  2GWS A;  1Z1V A;  1LKY B;  2NO4 A;  4LZG A;  4M9L A;  5J8Y A;  1NK7 A;  3R9K A;  1QH9 A;  4DL6 A;  3LWL A;  4XA5 A;  4DFM A;  5DG7 A;  4RQ4 A;  4KLG A;  1JXL A;  2ASJ A;  3RR7 A;  4F93 B;  2DF4 B;  1MQ3 A;  3PW2 A;  2FLP A;  1X42 A;  4EBD A;  4OJP A;  3AQF A;  3CP8 A;  2NYV A;  2KIW A;  2ZTC A;  1YT3 A; 
#chains in the Genus database with same CATH homology
 2EAM A;  2KMD A;  2YTU A;  2QB1 A;  1JI7 A;  4NJ8 A;  2E8O A;  3BS7 A;  1PK3 A;  2DKZ A;  2KG5 A;  4RQM A;  1DXS A;  5JRT A;  1V85 A;  1SV0 C;  3KKA C;  4IS7 A;  2JV3 A;  1UCV A;  2KE7 A;  3BS5 B;  4NL9 A;  1X9X A;  3KKA A;  2D3D A;  2ESE A;  1X40 A;  1SXE A;  2LMR A;  1SV4 A;  2FE9 A;  2KSO B;  2F8K A;  3TAD C;  2QAR B;  1B0X A;  2DL0 A;  2L5Y A;  3TAD A;  1V38 A;  2EAO A;  1SGG A;  3BS5 A;  4PZO A;  2E8N A;  5KNI A;  2DKX A;  2Y9U A;  2E8P A;  2KSO A;  3H8M A;  3IDW A;  1SV0 A;  4MHV A;  1UQV A;  2QB0 B;  1KW4 A;  3HIL A;  2D8C A;  2F3N A;  5JTI A;  2B6G A;  5JU5 A;  5J8Y C;  1SXD A;  2F44 A;  1WWU A;  2ES6 A;  1Z1V A;  2QKQ A;  1LKY B;  4RQN A;  2LPE A;  1PK1 B;  4PZN A;  5J8Y A;  2K4P A;  3BQ7 A;  2QB0 A;  3SEN A;  2KIV A;  2K60 A;  5L1M A;  1X66 A;  2QAR A;  3K1R B;  2EAP A;  3TAC B;  1F0M A;  1LKY A;  4NL9 C;  2Y9T A;  1OXJ A;  1PK1 A;  1WWV A;  1OW5 A;  3SEI A;  1COK A;  2EAN A;  2E8M A;  2GLE A;  5F3X B;  1RG6 A;  1B4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...