5J8YC

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
b'MPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polycomb protein Scm
publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
total genus 23
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yC00
1Z1VA 4IS7A 2DL0A 5KNIA 5JU5A 3SEIA 2KMDA 2QB1A 3TACB 2DKZA 2Y9UA 1LKYB 1SXEA 2E8PA 4RQNA 1SV4A 1DXSA 1SV0C 2EAMA 2ESEA 1PK1B 2KSOB 2E8NA 1SV0A 3BS7A 3TADC 2JV3A 2QKQA 1PK3A 2E8MA 2KE7A 3BS5A 2FE9A 1X40A 3TADA 1OW5A 4NJ8A 1COKA 2QB0B 2Y9TA 2EAOA 2KIVA 1V85A 1B4FA 2DKXA 1X66A 1X9XA 2QARB 5L1MA 3KKAC 1JI7A 2EANA 2EAPA 2D8CA 1UCVA 1LKYA 1SGGA 3KKAA 1OXJA 5J8YC 4MHVA 2F3NA 1PK1A 2YTUA 2KSOA 5J8YA 2F44A 3HILA 1SXDA 1WWUA 5JTIA 2K60A 1V38A 3H8MA 3SENA 2E8OA 1UQVA 2ES6A 1B0XA 2LPEA 3K1RB 1RG6A 2KG5A 5F3XB 2D3DA 2L5YA 2GLEA 2LMRA 2F8KA 2B6GA 2K4PA 2QB0A 1WWVA 4NL9C 4PZNA 4PZOA 1F0MA 3BQ7A 4RQMA 3BS5B 3IDWA 4NL9A 5JRTA 2QARA 1KW4A
chains in the Genus database with same CATH superfamily
4IS7A 1DGJA 5KFIA 3QU9A 2LYBA 2ZIVA 4XUSA 4GXKA 4O3NA 2LI6A 3OGUA 5AM4A 4I2AA 4P0PB 5DBBA 4F5RA 1PVQA 1NK6A 9ICLA 1MQ2A 4YR2A 3RRHA 3THVA 2HHTA 3PSFA 4YMOA 2ESEA 5AM5A 1PK1B 4ED3A 4QWCA 1SIJA 1Z00A 8ICWA 4UATA 1A77A 1X9MA 2VIXA 2FDRA 4RQ0A 1HIWA 2CRXA 2W3RA 1J97A 1T4GA 4YMNA 5D49A 2VA2A 1SZHA 2C28A 5ALJA 2R8IA 3HKZC 2NRTA 4EENA 3ZDEA 1NK9A 2XCAA 2BPGA 1TAMA 1VDVA 3BZCA 3C2MA 5ALXA 3MDCA 2JHDA 4F5PA 5AI4A 3RB0A 4FBTA 2J6TA 2FMSA 4Q8EA 3JPRA 3KBBA 3PMNA 2N1RA 2HOIA 2HOQA 2DUYA 4RUCA 3J81j 1JROA 1AQ6A 2PKEA 3RB6A 3SENA 5ALMA 2ZIUA 2MAXA 3QUQA 3CP8A 4DL2A 2RRDA 2WB1F 3OPXA 2D3DA 5KFRA 3WK9A 1N5WA 4BJQA 4MF2A 5L9XA 4F93B 1IXRA 3MR2A 2FI1A 4ECRA 2AQ4A 2EQYA 1D8BA 8ICXA 1SWVA 3TI0A 3NVVA 1QQ6A 4P2HA 1ZQZA 1RXWA 4KLSA 5KFKA 3IN5A 3SV3A 2E1FA 4JV2A 2W04A 2ATLA 2HHSA 7ICRA 4DO9A 3L3FX 4C4TA 1ZXIA 4QWDA 3ALRA 4NLNA 1VLBA 2K4HA 1ZQFA 1URJA 2BHNA 1ZQNA 5CWRA 2MRLA 3M9MB 1RYRA 3F5AA 2CXYA 4CF4A 2KN7A 1DXSA 1S0VA 8ICRA 2BQRA 3T5JA 2XC9A 4GC7A 1L7NA 1ZD2P 3C23A 4PGXA 1TV9A 3C5GA 1TK5A 1KL9A 7ICHA 2FE9A 3VCBA 4CF5A 5AI5A 5AI0A 7ICMA 8ICEA 4ECYA 3PW4A 5AI8A 3OTQA 4J9QA 2WF9A 1X66A 5KG5A 4G9BA 1HUZA 2KVCA 5KFZA 4AYBF 3M7DA 4F4WA 3H4BA 3WKDA 3N7SC 1ZOLA 5L1IA 2BKEA 2G07A 3NVYA 1CEZA 1ZQOA 1V38A 3H8MA 2WB1C 4DQPA 2E8OA 9ICEA 5D46A 3QYPA 2W9BB 4B9MA 5J2GA 2F8KA 2YMMA 4DQQA 3TKAA 3RJJA 1QSSA 5KT2A 4RQ5A 4JUZA 5CJ7A 4OJOA 3NTUA 4M9GA 4UW9A 2OCEA 4UB6U 4FO6A 3BZKA 4I2DA 4J9NA 2JZBB 4UARA 3IP4B 5D4BA 5ALQA 4BX9C 2ZTDA 5F9LA 2MUTB 4CGZA 5KT3A 4RQNA 3ZD8A 3H8SA 5J0WA 3BQ2A 1KEJA 5J2KA 1K1SA 1N62A 3RJHA 4KLEA 3L5KA 4YR0A 4DFMA 4F3OA 2W3SA 2HDOA 4P0QB 5KFLA 2DGZA 2HHXA 5J0RA 4RQ4A 9ICMA 2LM4A 1RYSA 3ETRA 5AKEA 4YD1A 5KFWA 1XNSA 4PL2A 3KOOA 3F2BA 5F9NA 2CN1A 1VJ5A 5J0YA 4NLGA 5BOMA 1Q8KA 4EEKA 2W7PA 2C2RA 5JUMA 8ICTA 5KFVA 4RPZA 1KBUA 2IHNA 2LM1A 3MR3A 3SAHA 2XY6A 1X2IA 2W8KA 3C28A 3OSNA 4TQSA 3VC8A 3I1YA 1RYUA 2IBKA 2K89A 1LKYA 2ZTEA 3UMBA 3N7RC 3OJSA 1ZQGA 4DEZA 7ICQA 3UXNA 5KAIU 4O3SA 4CF3A 3PSPA 4ED7A 4Z6FA 4I29A 3F2DA 4F5QA 3HILA 5AKGA 2ZIWB 9ICPA 1U48A 3GIJA 2LPEA 2P66A 5IIJA 1FFUA 5KT5A 1C7YA 4IR9A 4EELA 5J2AA 2PXIA 4B9NA 2B6GA 4ECVA 1L7OA 2OXOA 5B66U 4RNMA 1ZRNA 5EWFA 1L7PA 1UT8A 5KG3A 5KFSA 3SQIA 1H38A 4Y2VA 2WTFA 1Q3UA 5KFMA 2I6XA 4KLJA 1XO1A 2XICA 5DGBA 2KHVA 1T3QA 5DGAA 5AK5A 4LZGA 3K4GA 1S9FA 1SV0C 1MA7A 1PVRA 4ELVA 2YX8A 3T5HA 3PO4A 5J2DA 1X40A 3EUB2 1NK5A 1V97A 3WKBA 1BNOA 4HAIA 2KZMA 3PSIA 1ZQDA 4RUAA 4KLTA 4F5NA 4DOCA 4EYHB 4QW9A 4DQSA 3F53A 5AICA 2ZIVB 4FE3A 1NJYA 1YZ7A 3QX7A 4O5EA 1S76D 4DL3A 4NLZA 3PV8A 2KHQA 5DBAA 8ICOA 1ZQAA 2Y0SF 2Z7JA 4GXIA 1NZBA 2F8LA 9ICVA 2AGPA 4AP9A 4B9VA 4CRXA 3WK7A 5L1KA 3AM9A 7ICKA 3TFRA 1Z3EB 1Z00B 2H3QA 4ED0A 4PZNA 3V72A 1NI3A 2WF6A 4B9TA 1Z4NA 5JRTA 4RU9A 4I2FA 2ZUCA 4Q43A 9ICAA 3ZD9A 5JU5A 3RRGA 5ALUA 2MSNA 3WU2U 5KT7A 1JRPA 9ICOA 3V6JA 2BQ3A 4O0IA 2GO7A 4UAUA 1KKXA 7ICTA 2AQ0A 2MA1A 2W9MA 5EE3A 2BGWA 8ICUA 3PO5A 2NO4A 3WK4A 4TUSA 3EPGA 1JXEA 3QUCA 4YXJA 2G09A 1ZQSA 4YFKA 3V7LA 2ZIUB 2YB4A 1ZQBA 4IRCA 4RZRA 5KT4A 4PHDA 3BS5A 2G06A 5AK4A 1YT3A 3RR7A 7ICOA 1TK0A 2XI9A 4EBCA 1BPEA 2Y9TA 5ALRA 1UPHA 3DEEA 1S0OA 4ELUA 1L3VA 4YXMA 4F4ZA 1DGSA 1SZPA 1ZD3A 4P4OA 2K4EA 3K1ZA 2B0CA 4MFAA 3KKAC 1ZQXA 4NWIA 4UB1A 2EAPA 2ISPA 2FPMA 3ED5A 1ZQJA 1D8LA 3TANA 4NM2A 2F1IA 2LYHA 3NRWA 9ICQA 1S10A 5DG9A 4C8KA 5EWEA 4M9NA 9ICJA 3PNCA 4DF8A 4FS2A 3RR8A 2Y0SC 4YQWA 4KITB 2NV3A 1JX4A 3KD3A 5GTHU 4GC6A 1JN3A 1ZQPA 2UVUA 1RDFA 1SKRA 5CA7A 3HPOA 2PFNA 2R8JA 5IIOA 3SYZA 1A0PA 1MSWD 4NLKA 1UT5A 4GFJA 8ICQA 5K4LA 3MABA 2QARA 4DL4A 3QU2A 4QZIA 2ZXIA 4BDPA 8ICNA 2E5SA 1J2MA 5B5EU 1SL1A 4IQTA 5CB1A 1D8YA 4Q45A 1ZQRA 1M6YA 1IIPA 1BNPA 4KLLA 4J9SA 4QZBA 1NKEA 2ZIXA 4O3QA 2BDPA 2OM6A 3IM1A 3RJFA 2HW3A 1L8OA 5DB7A 2ZXHA 1T7PA 5TZVA 1ZQIA 2E8NA 3PX6A 8ICBA 4XA5A 3BS7A 1NK7A 1ZQ1C 1DK2A 1ECWA 2Q0ZX 3BDPA 3OHAA 4JK1A 5ALPA 1D9DA 5KG7A 3ZDBA 2DKXA 2IOHA 5J2BA 2WF7A 4OCZA 4Y2RA 2KFZA 1IM4A 5AKXA 2DWQA 2ZTCA 3LK9A 5HR7A 5GTIU 5DG8A 2HBMA 5BPCA 5A0LA 3IRUA 2XY7A 3UMGA 2HHWA 4RQ8A 3ICXA 3NUQA 2K8BB 2YMPA 1WWUA 1AROP 5KFUA 2XVTA 2R8KA 1RG6A 4USAA 4CE6A 1WYGA 3HT3A 1ZQEA 4O3PA 5KFJA 1NNLA 3SR6A 4J9MA 2HHQA 2QB0A 3ZDAA 2JGAA 4RQMA 4E0DA 1SWWA 1FEZA 5J2HA 2BCSA 3M6KA 3GZFA 3WK5A 3O0FA 4Y2SA 4R64A 2NO5A 4QW8A 2E3TA 5DB8A 1L6NA 3ETLA 5AKIA 4PH5A 1FFVA 3MR6A 1YZ6A 1UA1A 3D2QA 3C29A 2EH9A 1LKYB 4DLEA 3QU5A 3CRXA 3V6HA 4R66A 1CRXA 3QZ7A 7ICIA 4QZEA 2OH2A 4M0AA 5KG6A 4ED8A 1Y88A 3HRDD 5EE9A 4TUQA 3TADC 1BVSA 3GIKA 4F71A 4DQIA 1ZQHA 3Q8RB 2W43A 4UAWA 4KLHA 9ICIA 5KL8B 3BQ0A 3M6ZA 2BPFA 5DQHA 1X9XA 2BDUA 4PHEA 3PW2A 2D8CA 8ICZA 1OXJA 5J8YC 2LYAA 4FS1A 3Q8PB 3QUBA 4GLXA 2EZYA 3PY8A 1LVHA 3QEBZ 1SXDA 1ZRMA 2ASLA 2LHTA 4EEYA 2KD1A 2BR0A 2W9CA 3GV7B 2WFAA 4I2GA 2YMQA 4BGDA 5IIMA 1NOMA 2NRZA 2F1JA 5J2FA 4A8EA 8ICKA 3HJEA 3M8RA 1WUDA 1D9FA 4JWNA 3AEVA 3S6JA 1BPDA 2KV2A 4Y2UA 4DL5A 3MGVA 4YVZA 1SL2A 5IINA 2H3ZA 4C7YA 5KAFU 3I76A 1HJPA 4DSEA 1P7DA 1IG6A 8ICVA 3GV8B 7ICSA 5IIIA 8ICJA 1X9SA 3GDXA 5J0SA 7ICGA 2JRZA 5ALZA 4BWJA 1PUZA 2E8PA 1ZQVA 2H5XA 2ZJ8A 4KN4A 1KSPA 2WHEA 4HYKA 1DK3A 4I2HA 4ECUA 1V9PA 4DFKA 2A19A 2PMZC 2FMPA 3I28A 4M6WA 1K1QA 2KP7A 5ALEA 3TAQA 5J0OA 1L7MA 3PVXA 2KVSA 1OW5A 4OD0A 8ICHA 2ISOA 5KFDA 2ODGA 2EAOA 4ECTA 1T94A 3CYMA 3F5EA 3A0BU 2GH1A 2JXJA 5KFAA 7ICLA 1T3NA 2RDJA 4M9HA 3PR5B 4J03A 2P35A 4YD2A 3HX0A 2WF5A 4JB3A 4R63A 2KSOA 3JPNA 2F44A 3C1YA 3QEAZ 4IC9A 3M9OB 3GQCA 3AUOA 2W8LA 3AL0B 2GOLA 5KFYA 3V6KA 3OSPA 3RJKA 4YR3A 1NKCA 3AQFA 2RP5A 2PFOA 4C4SA 3F2CA 2AGOA 3BS5B 4NL9A 4JV1A 2HOFA 3JPPA 4ICAA 3H0LB 1QQ7A 4M9JA 4KLUA 5KNIA 4ED1A 2FPKA 3PZPA 4DFPA 2ASDA 4UB2A 1S0MA 5KG2A 8ICFA 5IIKA 1XWLA 2G5IB 5AI9A 1LV5A 3V7KA 1C20A 4UAVA 3MGHA 7ICFA 4KX5A 4Y2JA 2NYVA 4DWIA 2JEIA 5HMMA 1O03A 5AKLA 3DDHA 2DBYA 2KZ3A 2AJQA 3D2NA 1ZQQA 1ZQLA 3SAFA 5DDMA 5FP0A 4MFFA 4KN7A 3UMCA 2BCVA 2HVHA 3UM9A 1V85A 1X42A 4Z6EA 5HHIA 4CNQA 1S0NA 3N97B 1UHUA 2QARB 2YMLA 4KLFA 4OO1J 4LJXA 1JI7A 2BZFA 3EPIA 5ALYA 1SGGA 4RQ2A 2JEJA 4F8RA 4P4PA 3SZ2A 5DB9A 4I2JA 2HI0A 4YP3A 2OHFA 5KFTA 4EYIB 4YN4A 2M9NA 2O6KA 2ZIXB 3MFIA 3K1RB 4B9SA 4F5OA 1FO4A 4NM1A 2IOFK 4KLIA 5BOLA 3ZDCA 1NZPA 3Q8SB 3EZ5A 4DLGA 1WWVA 1X6JA 2DQNB 4C7ZA 3FC4A 4Y2PA 4C80A 5KFBA 1TKDA 4F4KA 4ECXA 4B9LA 2JEGA 5ALIA 3IHQB 1ZQYA 3LDAA 1TK8A 5ALHA 5C0YA 3ISCA 2DL0A 3NRZA 3QE9Y 4MFCA 2KMDA 2ZUBA 3A0HU 2W55A 2WF8A 2DKZA 2Y9UA 3H7IA 2Q4TA 1X9WA 2FLPA 2IHMA 1TVAA 3K75D 3WK6A 4RQ3A 2RQ5A 4EX6A 3KHGA 5KFQA 1SL0A 5AIAA 3MC1A 1JMSA 4NLBA 1PZNA 1KN5A 4PL1A 1U45A 3T5LA 3D2SA 2AU0A 3N4MB 1S97A 4MF8A 1T8EA 3Q8KA 4NJ8A 2HSZA 9ICWA 3H8JA 2OWOA 2QB0B 5AIBA 4QZCA 3DV9A 4J9PA 1B4FA 4IQVA 4DOBA 8ICPA 9ICKA 5ALKA 3UQ2A 3E0FA 4UASA 4XRHA 2VJ5A 1TFRA 2YY6A 3BQTA 1QH9A 5C5JA 1ZJMA 3H8WA 4DS5A 1ZQWA 1SB3C 5AKZA 5KG0A 5AM3A 4DSIA 4YG2A 4Y2TA 3WK8A 3C21A 4DSFA 2W03A 2W54A 3M8SA 2A1AA 3TFSA 4RQ6A 4M2YA 3HW8A 4QZFA 1Z1BA 1KDHA 4EZ9A 2R18A 4QNLA 2GLEA 1NK0A 4PZOA 1CUKA 8ICGA 2IA6A 4ACOA 7ICEA 1S77D 2XCPA 1XSLA 4RPXA 2R8GA 2KTQA 5DLFA 2BCUA 3KTQA 3G6VA 1JXLA 2DPIA 4UB5A 3QUTA 9ICSA 3CNHA 2NRVA 3EYZA 3NASA 5ALGA 3GFKB 4F72A 1BGXT 4YMMA 1KTQA 4ZH4A 4O5CA 4PHAA 2EDUA 8ICYA 2VJ4A 2K8AA 3UXPA 1N5XA 1WG8A 2HBKA 2KKVA 4C8MA 4LZDA 5E79U 2IMWP 5AKYA 2VA8A 4QZGA 4UB4A 1NJWA 2F76X 1TAUA 3C2LA 1XS9D 5KFNA 3OJUA 5J2EA 2W9CB 4QZ9A 2UVRA 3B9JA 1Z4OA 4I2IA 5CR0A 2I1QA 3RJGA 2C2EA 1XO0A 4J9KA 1MN8A 3AMZA 3PX0A 4R8UA 1TAQA 3ZDDA 2FPLA 1FIQA 4NXZA 3UQ0A 1SKSA 2KFNA 3SAGA 3IG8A 1UCVA 3PX4A 4J9RA 5T14A 1L5UA 3RH5A 1J2NA 1BPZA 8ICMA 2D6FC 2RHFA 2A1JA 2RDIA 5KFHA 2G5HB 8ICIA 4EZ6A 2ES6A 4RT3A 3LVWA 2V9WA 2YB1A 5IILA 5AI6A 4FBUA 3EWAA 3PW0A 1KLNA 3QNMA 5AM1A 2JMGA 2L5YA 5DQIA 1KQQA 4QZ8A 2W9AA 1NK8A 5DQGA 3C1ZA 1ZJNA 4M6WB 4BWMA 3BQ7A 2KKPA 1CI4A 1B22A 2BPCA 3MGIA 3PSTA 4QZHA 4KLOA 4KLMA 4BUGA 2I5HA 3RH6A 2LBOA 7ICVA 1ZD4A 3LVVA 5CEHA 4J9LA 3OHBA 4JMUA 4OJPA 2UVWA 2H3FA 1ED1A 2GWSA 5KG1A 2FMQA 1ZQMA 1U9LA 4RNNA 5CP2A 3PR4A 4JWMA 1L3UA 3JPQA 3HP6A 2AH5A 4Z6DA 2DFLA 2KSOB 3E58A 3FM9A 3KZXA 4GXJA 1KFSA 4NY8A 5G5HA 2OEHA 2ALZA 5AHXA 2QKQA 2E8MA 4O3MA 4KMUA 3LWMA 3RAQA 1L8LA 3NS1A 4TURA 2XIDA 3SD7A 1COKA 1HUOA 5ALSA 9ICXA 3RJIA 4KLDA 4OJLA 2JR5A 4NLCA 2G08A 5L1MA 4QJFB 2EANA 3Q8LA 4BXOA 4ED2A 4US9A 1HEKA 2PMZF 4DL6A 4B9UA 4GIBA 4ZOHC 4U6PA 5DG7A 3TQ1A 9ICTA 1RPLA 2YQEA 4ECZA 2KEYA 7ICPA 4F92B 2DPJA 1U47A 4X5VA 2P6RA 3SV4A 2K60A 5KFPA 5KTQA 2BCQA 3KHRA 2BQUA 2KG5A 4M47A 4ECQA 5AM0A 1KFTA 2A3VA 3V7JA 4Q44A 2CPRA 2F2AB 7ICUA 2K4PA 1S5LU 3E2EA 4K4GA 1RQNA 5AK3A 4RNOA 4Z6CA 5J2IA 3BJYA 4Y2YA 2VKQA 4IQUA 4KTQA 1F44A 4F4YA 3H0MB 3GIIA 5KFEA 2AHOB 1OUQA 4US8A 2BCRA 1JUDA 5ALFA 3TACB 9ICGA 3T79A 3CW2C 4XQ8A 3T5KA 3RBEA 1N56A 1NJXA 1MQ3A 3QXGA 2JH7A 2VANA 1ZQCA 5L1LA 2J6SA 2FLLA 3ISBA 4O3RA 1N2XA 3R9KA 4PGYA 7ICNA 4DQRA 3B0YA 2WAQF 1SV0A 4C0ZA 3FDSA 3FAHA 2PI4A 1QSYA 5ALVA 4DS4A 2K8CB 2XGPA 9ICNA 4Y2QA 4QWBA 1ZQUA 1QLNA 5L1JA 4I28A 1RZTA 1SKWA 3HWTA 1BPYA 1N60A 3IV6A 4IRDA 4KLGA 4P0PA 5J2CA 4CCHA 2EZXA 3IG5A 4DSJA 3M9NB 3EW9A 1JALA 3GILA 2R8HA 2F3NA 9ICBA 1PK1A 2KOBA 4DCCA 3M1YA 3KHLA 5JTIA 4ELTA 3Q8QB 3RB4A 2YN4A 3D6JA 3C5FA 1XU4A 1BPBA 3NVWA 4QIWF 3TAPA 2HCFA 2NRXA 3RJEA 1K5OA 3PMLA 4KX3A 4EBEA 2K4IA 7ICJA 3NVZA 1ZD5A 3NGDA 4FZMA 2KZZA 3UXOA 4WJ3B 5EWGA 5AKJA 4J9OA 4IL6U 4LVSA 3IDWA 1NKBA 1ZETA 1KW4A 2ZG6A 1Q46A 2H3IA 4I2BA 3SI8A 1O08A 2PI5A 1U49A 2E1EA 3RF9A 3SEIA 4ECSA 4MEYA 3WKEA 3KHHA 4M04A 4DFJA 3QZ8A 2C22A 4QWEA 1L3TA 4Y2XA 4DL7A 1ZQKA 4G3IA 1LB2B 4JV0A 4AYBC 4RT2A 2WAQC 4O3OA 2KJ5A 2EAMA 5DBCA 1XSPA 2XY5A 1N61A 2JV3A 3BQ1A 3KFUF 4UB8U 3RAXA 2KE7A 1L3SA 5ALDA 4TUPA 2QLTA 1IV8A 5G5GA 4OJ5A 2OYYA 5ALTA 2HHVA 3MBYA 2W11A 2KNJA 5DB6A 2IOFA 4TQRA 3H0RB 5CRXA 3KZIU 1EXNA 4PPXA 4RQ7A 3RFAA 4RQ1A 4KLQA 3RBDA 2W7OA 5HMLA 9ICUA 9ICFA 4ECWA 1N63A 3KKAA 2H3VA 3N28A 5KG4A 2KJ9A 4I2CA 2XO7A 4QIWC 4C8LA 4IRKA 1B0XA 4PJ0U 5KFFA 4EBDA 5AK6A 5F3XB 5DDYA 1RM6C 1XSNA 2Y1IA 1JIHA 8ICSA 5KT6A 4ED6A 4F50A 1WCNA 1F0MA 1UA0A 4K4IA 4QZDA 3WKCA 3PW7A 1TE2A 1WCLA 4C8OA 1N48A 2UVVA 4F4XA 3AU2A 5J29A 3MR5A 4DFDA 4R8UB 1U4BA 2ZJAA 5AKKA 5ALNA 5AM2A 5AKHA 2JH1A 3Q8MA 3PW5A 1NJZA 1PVPA 5KFXA 4DF4A 1SXEA 5EOZA 8ICLA 2DF4B 2A1JB 3C2KA 4PGQA 4IQWA 3GU3A 2HBJA 4FFDA 2W9BA 9ICHA 5ALOA 3FYHA 2PFPA 5TISU 5CHGA 2FLNA 4DSLA 4PHPA 1PK3A 3JPTA 3QU7A 5J2JA 4UQGA 4DSKA 3GV5B 4KMOB 5J0XA 3G6YA 2FJ6A 3AU6A 2MU2A 5J0UA 4NV0A 2JZBA 4FZNA 4OJ6A 2Y1JA 2ZUDA 5H2FU 1KRPA 4MEXA 3T3FA 4IR1A 5HHHA 5J0TA 3H4DA 2AXTU 8ICAA 3GIMA 4I27A 4O9MA 3B0XA 4YCXA 4RPYA 9ICCA 2MUTA 3ZI4A 2XGQA 2F77X 2NRWA 3SMVA 1F5SA 1DOQA 2AGQA 3ISDA 1NK4A 2YTUA 1QTMA 2HBLA 9ICRA 4K4HA 4DOAA 2LKYA 3MFHA 4P0QA 1B43A 5HNKA 4UBCA 1BPXA 5EE0A 3U26A 5DLGA 3MDAA 5KFGA 1X6IA 4UAYA 2LMRA 3UPQA 3RH4A 4Q8FA 4NL9C 4F2SA 2V4QA 3ONNA 4CDGA 2ASJA 2KIWA 1Z1VA 3LYSA 3G6XA 2KICA 2PFQA 2VA3A 1QSLA 2HMXA 3N7PD 2QB1A 3RTVA 4C4RA 2I9GA 3ORYA 4M9LA 4BXOB 2ZIWA 4QWAA 2F1HA 1QQ5A 2P6UA 2V4RA 1RQLA 1SV4A 3H40A 1QCKA 1XC9A 1S8OA 5HR6A 1A6SA 1GO3F 5KFOA 8ICCA 4UB3A 3AQEA 5ALWA 2KJ8A 3L4PA 5ALLA 3TADA 2G0AA 4B6JA 5HP4A 4U7CA 2HVIA 1ZYQA 1ZQTA 4C8NA 2KIVA 5J0QA 5EE1A 3HKZF 1MC8A 1DRGA 2ZJ5A 4O5KA 3JPSA 1Q3VA 4I2EA 3RB3A 2EZZA 1RXVA 2KK0A 4P4MA 2HHUA 4F2RA 2M0NA 4R65A 4MHVA 1A76A 3LWLA 2J6UA 5J8YA 4UAZA 1COOA 4UBBA 5DKWA 1UQVA 1KFDA 4EX7A 2C2DA 5KL1B 1Z19A 2RLTA 4FZLA 2B21A 5J0PA 4QZAA 3JPOA 2JEFA 4F91B 3AN1A 3QU4A 3TARA 5KFCA 3WKAA
chains in the Genus database with same CATH topology
1Z1VA 4IS7A 2DL0A 5KNIA 5JU5A 3SEIA 2KMDA 2QB1A 3TACB 2DKZA 2Y9UA 1LKYB 1SXEA 2E8PA 4RQNA 1SV4A 1DXSA 1SV0C 2EAMA 2ESEA 1PK1B 2KSOB 2E8NA 1SV0A 3BS7A 3TADC 2JV3A 2QKQA 1PK3A 2E8MA 2KE7A 3BS5A 2FE9A 1X40A 3TADA 1OW5A 4NJ8A 1COKA 2QB0B 2Y9TA 2EAOA 2KIVA 1V85A 1B4FA 2DKXA 1X66A 1X9XA 2QARB 5L1MA 3KKAC 1JI7A 2EANA 2EAPA 2D8CA 1UCVA 1LKYA 1SGGA 3KKAA 1OXJA 5J8YC 4MHVA 2F3NA 1PK1A 2YTUA 2KSOA 5J8YA 2F44A 3HILA 1SXDA 1WWUA 5JTIA 2K60A 1V38A 3H8MA 3SENA 2E8OA 1UQVA 2ES6A 1B0XA 2LPEA 3K1RB 1RG6A 2KG5A 5F3XB 2D3DA 2L5YA 2GLEA 2LMRA 2F8KA 2B6GA 2K4PA 2QB0A 1WWVA 4NL9C 4PZNA 4PZOA 1F0MA 3BQ7A 4RQMA 3BS5B 3IDWA 4NL9A 5JRTA 2QARA 1KW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1V A;  4IS7 A;  2DL0 A;  5KNI A;  5JU5 A;  3SEI A;  2KMD A;  2QB1 A;  3TAC B;  2DKZ A;  2Y9U A;  1LKY B;  1SXE A;  2E8P A;  4RQN A;  1SV4 A;  1DXS A;  1SV0 C;  2EAM A;  2ESE A;  1PK1 B;  2KSO B;  2E8N A;  1SV0 A;  3BS7 A;  3TAD C;  2JV3 A;  2QKQ A;  1PK3 A;  2E8M A;  2KE7 A;  3BS5 A;  2FE9 A;  1X40 A;  3TAD A;  1OW5 A;  4NJ8 A;  1COK A;  2QB0 B;  2Y9T A;  2EAO A;  2KIV A;  1V85 A;  1B4F A;  2DKX A;  1X66 A;  1X9X A;  2QAR B;  5L1M A;  3KKA C;  1JI7 A;  2EAN A;  2EAP A;  2D8C A;  1UCV A;  1LKY A;  1SGG A;  3KKA A;  1OXJ A;  5J8Y C;  4MHV A;  2F3N A;  1PK1 A;  2YTU A;  2KSO A;  5J8Y A;  2F44 A;  3HIL A;  1SXD A;  1WWU A;  5JTI A;  2K60 A;  1V38 A;  3H8M A;  3SEN A;  2E8O A;  1UQV A;  2ES6 A;  1B0X A;  2LPE A;  3K1R B;  1RG6 A;  2KG5 A;  5F3X B;  2D3D A;  2L5Y A;  2GLE A;  2LMR A;  2F8K A;  2B6G A;  2K4P A;  2QB0 A;  1WWV A;  4NL9 C;  4PZN A;  4PZO A;  1F0M A;  3BQ7 A;  4RQM A;  3BS5 B;  3IDW A;  4NL9 A;  5JRT A;  2QAR A;  1KW4 A; 
#chains in the Genus database with same CATH topology
 4IS7 A;  1DGJ A;  5KFI A;  3QU9 A;  2LYB A;  2ZIV A;  4XUS A;  4GXK A;  4O3N A;  2LI6 A;  3OGU A;  5AM4 A;  4I2A A;  4P0P B;  5DBB A;  4F5R A;  1PVQ A;  1NK6 A;  9ICL A;  1MQ2 A;  4YR2 A;  3RRH A;  3THV A;  2HHT A;  3PSF A;  4YMO A;  2ESE A;  5AM5 A;  1PK1 B;  4ED3 A;  4QWC A;  1SIJ A;  1Z00 A;  8ICW A;  4UAT A;  1A77 A;  1X9M A;  2VIX A;  2FDR A;  4RQ0 A;  1HIW A;  2CRX A;  2W3R A;  1J97 A;  1T4G A;  4YMN A;  5D49 A;  2VA2 A;  1SZH A;  2C28 A;  5ALJ A;  2R8I A;  3HKZ C;  2NRT A;  4EEN A;  3ZDE A;  1NK9 A;  2XCA A;  2BPG A;  1TAM A;  1VDV A;  3BZC A;  3C2M A;  5ALX A;  3MDC A;  2JHD A;  4F5P A;  5AI4 A;  3RB0 A;  4FBT A;  2J6T A;  2FMS A;  4Q8E A;  3JPR A;  3KBB A;  3PMN A;  2N1R A;  2HOI A;  2HOQ A;  2DUY A;  4RUC A;  3J81 j;  1JRO A;  1AQ6 A;  2PKE A;  3RB6 A;  3SEN A;  5ALM A;  2ZIU A;  2MAX A;  3QUQ A;  3CP8 A;  4DL2 A;  2RRD A;  2WB1 F;  3OPX A;  2D3D A;  5KFR A;  3WK9 A;  1N5W A;  4BJQ A;  4MF2 A;  5L9X A;  4F93 B;  1IXR A;  3MR2 A;  2FI1 A;  4ECR A;  2AQ4 A;  2EQY A;  1D8B A;  8ICX A;  1SWV A;  3TI0 A;  3NVV A;  1QQ6 A;  4P2H A;  1ZQZ A;  1RXW A;  4KLS A;  5KFK A;  3IN5 A;  3SV3 A;  2E1F A;  4JV2 A;  2W04 A;  2ATL A;  2HHS A;  7ICR A;  4DO9 A;  3L3F X;  4C4T A;  1ZXI A;  4QWD A;  3ALR A;  4NLN A;  1VLB A;  2K4H A;  1ZQF A;  1URJ A;  2BHN A;  1ZQN A;  5CWR A;  2MRL A;  3M9M B;  1RYR A;  3F5A A;  2CXY A;  4CF4 A;  2KN7 A;  1DXS A;  1S0V A;  8ICR A;  2BQR A;  3T5J A;  2XC9 A;  4GC7 A;  1L7N A;  1ZD2 P;  3C23 A;  4PGX A;  1TV9 A;  3C5G A;  1TK5 A;  1KL9 A;  7ICH A;  2FE9 A;  3VCB A;  4CF5 A;  5AI5 A;  5AI0 A;  7ICM A;  8ICE A;  4ECY A;  3PW4 A;  5AI8 A;  3OTQ A;  4J9Q A;  2WF9 A;  1X66 A;  5KG5 A;  4G9B A;  1HUZ A;  2KVC A;  5KFZ A;  4AYB F;  3M7D A;  4F4W A;  3H4B A;  3WKD A;  3N7S C;  1ZOL A;  5L1I A;  2BKE A;  2G07 A;  3NVY A;  1CEZ A;  1ZQO A;  1V38 A;  3H8M A;  2WB1 C;  4DQP A;  2E8O A;  9ICE A;  5D46 A;  3QYP A;  2W9B B;  4B9M A;  5J2G A;  2F8K A;  2YMM A;  4DQQ A;  3TKA A;  3RJJ A;  1QSS A;  5KT2 A;  4RQ5 A;  4JUZ A;  5CJ7 A;  4OJO A;  3NTU A;  4M9G A;  4UW9 A;  2OCE A;  4UB6 U;  4FO6 A;  3BZK A;  4I2D A;  4J9N A;  2JZB B;  4UAR A;  3IP4 B;  5D4B A;  5ALQ A;  4BX9 C;  2ZTD A;  5F9L A;  2MUT B;  4CGZ A;  5KT3 A;  4RQN A;  3ZD8 A;  3H8S A;  5J0W A;  3BQ2 A;  1KEJ A;  5J2K A;  1K1S A;  1N62 A;  3RJH A;  4KLE A;  3L5K A;  4YR0 A;  4DFM A;  4F3O A;  2W3S A;  2HDO A;  4P0Q B;  5KFL A;  2DGZ A;  2HHX A;  5J0R A;  4RQ4 A;  9ICM A;  2LM4 A;  1RYS A;  3ETR A;  5AKE A;  4YD1 A;  5KFW A;  1XNS A;  4PL2 A;  3KOO A;  3F2B A;  5F9N A;  2CN1 A;  1VJ5 A;  5J0Y A;  4NLG A;  5BOM A;  1Q8K A;  4EEK A;  2W7P A;  2C2R A;  5JUM A;  8ICT A;  5KFV A;  4RPZ A;  1KBU A;  2IHN A;  2LM1 A;  3MR3 A;  3SAH A;  2XY6 A;  1X2I A;  2W8K A;  3C28 A;  3OSN A;  4TQS A;  3VC8 A;  3I1Y A;  1RYU A;  2IBK A;  2K89 A;  1LKY A;  2ZTE A;  3UMB A;  3N7R C;  3OJS A;  1ZQG A;  4DEZ A;  7ICQ A;  3UXN A;  5KAI U;  4O3S A;  4CF3 A;  3PSP A;  4ED7 A;  4Z6F A;  4I29 A;  3F2D A;  4F5Q A;  3HIL A;  5AKG A;  2ZIW B;  9ICP A;  1U48 A;  3GIJ A;  2LPE A;  2P66 A;  5IIJ A;  1FFU A;  5KT5 A;  1C7Y A;  4IR9 A;  4EEL A;  5J2A A;  2PXI A;  4B9N A;  2B6G A;  4ECV A;  1L7O A;  2OXO A;  5B66 U;  4RNM A;  1ZRN A;  5EWF A;  1L7P A;  1UT8 A;  5KG3 A;  5KFS A;  3SQI A;  1H38 A;  4Y2V A;  2WTF A;  1Q3U A;  5KFM A;  2I6X A;  4KLJ A;  1XO1 A;  2XIC A;  5DGB A;  2KHV A;  1T3Q A;  5DGA A;  5AK5 A;  4LZG A;  3K4G A;  1S9F A;  1SV0 C;  1MA7 A;  1PVR A;  4ELV A;  2YX8 A;  3T5H A;  3PO4 A;  5J2D A;  1X40 A;  3EUB 2;  1NK5 A;  1V97 A;  3WKB A;  1BNO A;  4HAI A;  2KZM A;  3PSI A;  1ZQD A;  4RUA A;  4KLT A;  4F5N A;  4DOC A;  4EYH B;  4QW9 A;  4DQS A;  3F53 A;  5AIC A;  2ZIV B;  4FE3 A;  1NJY A;  1YZ7 A;  3QX7 A;  4O5E A;  1S76 D;  4DL3 A;  4NLZ A;  3PV8 A;  2KHQ A;  5DBA A;  8ICO A;  1ZQA A;  2Y0S F;  2Z7J A;  4GXI A;  1NZB A;  2F8L A;  9ICV A;  2AGP A;  4AP9 A;  4B9V A;  4CRX A;  3WK7 A;  5L1K A;  3AM9 A;  7ICK A;  3TFR A;  1Z3E B;  1Z00 B;  2H3Q A;  4ED0 A;  4PZN A;  3V72 A;  1NI3 A;  2WF6 A;  4B9T A;  1Z4N A;  5JRT A;  4RU9 A;  4I2F A;  2ZUC A;  4Q43 A;  9ICA A;  3ZD9 A;  5JU5 A;  3RRG A;  5ALU A;  2MSN A;  3WU2 U;  5KT7 A;  1JRP A;  9ICO A;  3V6J A;  2BQ3 A;  4O0I A;  2GO7 A;  4UAU A;  1KKX A;  7ICT A;  2AQ0 A;  2MA1 A;  2W9M A;  5EE3 A;  2BGW A;  8ICU A;  3PO5 A;  2NO4 A;  3WK4 A;  4TUS A;  3EPG A;  1JXE A;  3QUC A;  4YXJ A;  2G09 A;  1ZQS A;  4YFK A;  3V7L A;  2ZIU B;  2YB4 A;  1ZQB A;  4IRC A;  4RZR A;  5KT4 A;  4PHD A;  3BS5 A;  2G06 A;  5AK4 A;  1YT3 A;  3RR7 A;  7ICO A;  1TK0 A;  2XI9 A;  4EBC A;  1BPE A;  2Y9T A;  5ALR A;  1UPH A;  3DEE A;  1S0O A;  4ELU A;  1L3V A;  4YXM A;  4F4Z A;  1DGS A;  1SZP A;  1ZD3 A;  4P4O A;  2K4E A;  3K1Z A;  2B0C A;  4MFA A;  3KKA C;  1ZQX A;  4NWI A;  4UB1 A;  2EAP A;  2ISP A;  2FPM A;  3ED5 A;  1ZQJ A;  1D8L A;  3TAN A;  4NM2 A;  2F1I A;  2LYH A;  3NRW A;  9ICQ A;  1S10 A;  5DG9 A;  4C8K A;  5EWE A;  4M9N A;  9ICJ A;  3PNC A;  4DF8 A;  4FS2 A;  3RR8 A;  2Y0S C;  4YQW A;  4KIT B;  2NV3 A;  1JX4 A;  3KD3 A;  5GTH U;  4GC6 A;  1JN3 A;  1ZQP A;  2UVU A;  1RDF A;  1SKR A;  5CA7 A;  3HPO A;  2PFN A;  2R8J A;  5IIO A;  3SYZ A;  1A0P A;  1MSW D;  4NLK A;  1UT5 A;  4GFJ A;  8ICQ A;  5K4L A;  3MAB A;  2QAR A;  4DL4 A;  3QU2 A;  4QZI A;  2ZXI A;  4BDP A;  8ICN A;  2E5S A;  1J2M A;  5B5E U;  1SL1 A;  4IQT A;  5CB1 A;  1D8Y A;  4Q45 A;  1ZQR A;  1M6Y A;  1IIP A;  1BNP A;  4KLL A;  4J9S A;  4QZB A;  1NKE A;  2ZIX A;  4O3Q A;  2BDP A;  2OM6 A;  3IM1 A;  3RJF A;  2HW3 A;  1L8O A;  5DB7 A;  2ZXH A;  1T7P A;  5TZV A;  1ZQI A;  2E8N A;  3PX6 A;  8ICB A;  4XA5 A;  3BS7 A;  1NK7 A;  1ZQ1 C;  1DK2 A;  1ECW A;  2Q0Z X;  3BDP A;  3OHA A;  4JK1 A;  5ALP A;  1D9D A;  5KG7 A;  3ZDB A;  2DKX A;  2IOH A;  5J2B A;  2WF7 A;  4OCZ A;  4Y2R A;  2KFZ A;  1IM4 A;  5AKX A;  2DWQ A;  2ZTC A;  3LK9 A;  5HR7 A;  5GTI U;  5DG8 A;  2HBM A;  5BPC A;  5A0L A;  3IRU A;  2XY7 A;  3UMG A;  2HHW A;  4RQ8 A;  3ICX A;  3NUQ A;  2K8B B;  2YMP A;  1WWU A;  1ARO P;  5KFU A;  2XVT A;  2R8K A;  1RG6 A;  4USA A;  4CE6 A;  1WYG A;  3HT3 A;  1ZQE A;  4O3P A;  5KFJ A;  1NNL A;  3SR6 A;  4J9M A;  2HHQ A;  2QB0 A;  3ZDA A;  2JGA A;  4RQM A;  4E0D A;  1SWW A;  1FEZ A;  5J2H A;  2BCS A;  3M6K A;  3GZF A;  3WK5 A;  3O0F A;  4Y2S A;  4R64 A;  2NO5 A;  4QW8 A;  2E3T A;  5DB8 A;  1L6N A;  3ETL A;  5AKI A;  4PH5 A;  1FFV A;  3MR6 A;  1YZ6 A;  1UA1 A;  3D2Q A;  3C29 A;  2EH9 A;  1LKY B;  4DLE A;  3QU5 A;  3CRX A;  3V6H A;  4R66 A;  1CRX A;  3QZ7 A;  7ICI A;  4QZE A;  2OH2 A;  4M0A A;  5KG6 A;  4ED8 A;  1Y88 A;  3HRD D;  5EE9 A;  4TUQ A;  3TAD C;  1BVS A;  3GIK A;  4F71 A;  4DQI A;  1ZQH A;  3Q8R B;  2W43 A;  4UAW A;  4KLH A;  9ICI A;  5KL8 B;  3BQ0 A;  3M6Z A;  2BPF A;  5DQH A;  1X9X A;  2BDU A;  4PHE A;  3PW2 A;  2D8C A;  8ICZ A;  1OXJ A;  5J8Y C;  2LYA A;  4FS1 A;  3Q8P B;  3QUB A;  4GLX A;  2EZY A;  3PY8 A;  1LVH A;  3QEB Z;  1SXD A;  1ZRM A;  2ASL A;  2LHT A;  4EEY A;  2KD1 A;  2BR0 A;  2W9C A;  3GV7 B;  2WFA A;  4I2G A;  2YMQ A;  4BGD A;  5IIM A;  1NOM A;  2NRZ A;  2F1J A;  5J2F A;  4A8E A;  8ICK A;  3HJE A;  3M8R A;  1WUD A;  1D9F A;  4JWN A;  3AEV A;  3S6J A;  1BPD A;  2KV2 A;  4Y2U A;  4DL5 A;  3MGV A;  4YVZ A;  1SL2 A;  5IIN A;  2H3Z A;  4C7Y A;  5KAF U;  3I76 A;  1HJP A;  4DSE A;  1P7D A;  1IG6 A;  8ICV A;  3GV8 B;  7ICS A;  5III A;  8ICJ A;  1X9S A;  3GDX A;  5J0S A;  7ICG A;  2JRZ A;  5ALZ A;  4BWJ A;  1PUZ A;  2E8P A;  1ZQV A;  2H5X A;  2ZJ8 A;  4KN4 A;  1KSP A;  2WHE A;  4HYK A;  1DK3 A;  4I2H A;  4ECU A;  1V9P A;  4DFK A;  2A19 A;  2PMZ C;  2FMP A;  3I28 A;  4M6W A;  1K1Q A;  2KP7 A;  5ALE A;  3TAQ A;  5J0O A;  1L7M A;  3PVX A;  2KVS A;  1OW5 A;  4OD0 A;  8ICH A;  2ISO A;  5KFD A;  2ODG A;  2EAO A;  4ECT A;  1T94 A;  3CYM A;  3F5E A;  3A0B U;  2GH1 A;  2JXJ A;  5KFA A;  7ICL A;  1T3N A;  2RDJ A;  4M9H A;  3PR5 B;  4J03 A;  2P35 A;  4YD2 A;  3HX0 A;  2WF5 A;  4JB3 A;  4R63 A;  2KSO A;  3JPN A;  2F44 A;  3C1Y A;  3QEA Z;  4IC9 A;  3M9O B;  3GQC A;  3AUO A;  2W8L A;  3AL0 B;  2GOL A;  5KFY A;  3V6K A;  3OSP A;  3RJK A;  4YR3 A;  1NKC A;  3AQF A;  2RP5 A;  2PFO A;  4C4S A;  3F2C A;  2AGO A;  3BS5 B;  4NL9 A;  4JV1 A;  2HOF A;  3JPP A;  4ICA A;  3H0L B;  1QQ7 A;  4M9J A;  4KLU A;  5KNI A;  4ED1 A;  2FPK A;  3PZP A;  4DFP A;  2ASD A;  4UB2 A;  1S0M A;  5KG2 A;  8ICF A;  5IIK A;  1XWL A;  2G5I B;  5AI9 A;  1LV5 A;  3V7K A;  1C20 A;  4UAV A;  3MGH A;  7ICF A;  4KX5 A;  4Y2J A;  2NYV A;  4DWI A;  2JEI A;  5HMM A;  1O03 A;  5AKL A;  3DDH A;  2DBY A;  2KZ3 A;  2AJQ A;  3D2N A;  1ZQQ A;  1ZQL A;  3SAF A;  5DDM A;  5FP0 A;  4MFF A;  4KN7 A;  3UMC A;  2BCV A;  2HVH A;  3UM9 A;  1V85 A;  1X42 A;  4Z6E A;  5HHI A;  4CNQ A;  1S0N A;  3N97 B;  1UHU A;  2QAR B;  2YML A;  4KLF A;  4OO1 J;  4LJX A;  1JI7 A;  2BZF A;  3EPI A;  5ALY A;  1SGG A;  4RQ2 A;  2JEJ A;  4F8R A;  4P4P A;  3SZ2 A;  5DB9 A;  4I2J A;  2HI0 A;  4YP3 A;  2OHF A;  5KFT A;  4EYI B;  4YN4 A;  2M9N A;  2O6K A;  2ZIX B;  3MFI A;  3K1R B;  4B9S A;  4F5O A;  1FO4 A;  4NM1 A;  2IOF K;  4KLI A;  5BOL A;  3ZDC A;  1NZP A;  3Q8S B;  3EZ5 A;  4DLG A;  1WWV A;  1X6J A;  2DQN B;  4C7Z A;  3FC4 A;  4Y2P A;  4C80 A;  5KFB A;  1TKD A;  4F4K A;  4ECX A;  4B9L A;  2JEG A;  5ALI A;  3IHQ B;  1ZQY A;  3LDA A;  1TK8 A;  5ALH A;  5C0Y A;  3ISC A;  2DL0 A;  3NRZ A;  3QE9 Y;  4MFC A;  2KMD A;  2ZUB A;  3A0H U;  2W55 A;  2WF8 A;  2DKZ A;  2Y9U A;  3H7I A;  2Q4T A;  1X9W A;  2FLP A;  2IHM A;  1TVA A;  3K75 D;  3WK6 A;  4RQ3 A;  2RQ5 A;  4EX6 A;  3KHG A;  5KFQ A;  1SL0 A;  5AIA A;  3MC1 A;  1JMS A;  4NLB A;  1PZN A;  1KN5 A;  4PL1 A;  1U45 A;  3T5L A;  3D2S A;  2AU0 A;  3N4M B;  1S97 A;  4MF8 A;  1T8E A;  3Q8K A;  4NJ8 A;  2HSZ A;  9ICW A;  3H8J A;  2OWO A;  2QB0 B;  5AIB A;  4QZC A;  3DV9 A;  4J9P A;  1B4F A;  4IQV A;  4DOB A;  8ICP A;  9ICK A;  5ALK A;  3UQ2 A;  3E0F A;  4UAS A;  4XRH A;  2VJ5 A;  1TFR A;  2YY6 A;  3BQT A;  1QH9 A;  5C5J A;  1ZJM A;  3H8W A;  4DS5 A;  1ZQW A;  1SB3 C;  5AKZ A;  5KG0 A;  5AM3 A;  4DSI A;  4YG2 A;  4Y2T A;  3WK8 A;  3C21 A;  4DSF A;  2W03 A;  2W54 A;  3M8S A;  2A1A A;  3TFS A;  4RQ6 A;  4M2Y A;  3HW8 A;  4QZF A;  1Z1B A;  1KDH A;  4EZ9 A;  2R18 A;  4QNL A;  2GLE A;  1NK0 A;  4PZO A;  1CUK A;  8ICG A;  2IA6 A;  4ACO A;  7ICE A;  1S77 D;  2XCP A;  1XSL A;  4RPX A;  2R8G A;  2KTQ A;  5DLF A;  2BCU A;  3KTQ A;  3G6V A;  1JXL A;  2DPI A;  4UB5 A;  3QUT A;  9ICS A;  3CNH A;  2NRV A;  3EYZ A;  3NAS A;  5ALG A;  3GFK B;  4F72 A;  1BGX T;  4YMM A;  1KTQ A;  4ZH4 A;  4O5C A;  4PHA A;  2EDU A;  8ICY A;  2VJ4 A;  2K8A A;  3UXP A;  1N5X A;  1WG8 A;  2HBK A;  2KKV A;  4C8M A;  4LZD A;  5E79 U;  2IMW P;  5AKY A;  2VA8 A;  4QZG A;  4UB4 A;  1NJW A;  2F76 X;  1TAU A;  3C2L A;  1XS9 D;  5KFN A;  3OJU A;  5J2E A;  2W9C B;  4QZ9 A;  2UVR A;  3B9J A;  1Z4O A;  4I2I A;  5CR0 A;  2I1Q A;  3RJG A;  2C2E A;  1XO0 A;  4J9K A;  1MN8 A;  3AMZ A;  3PX0 A;  4R8U A;  1TAQ A;  3ZDD A;  2FPL A;  1FIQ A;  4NXZ A;  3UQ0 A;  1SKS A;  2KFN A;  3SAG A;  3IG8 A;  1UCV A;  3PX4 A;  4J9R A;  5T14 A;  1L5U A;  3RH5 A;  1J2N A;  1BPZ A;  8ICM A;  2D6F C;  2RHF A;  2A1J A;  2RDI A;  5KFH A;  2G5H B;  8ICI A;  4EZ6 A;  2ES6 A;  4RT3 A;  3LVW A;  2V9W A;  2YB1 A;  5IIL A;  5AI6 A;  4FBU A;  3EWA A;  3PW0 A;  1KLN A;  3QNM A;  5AM1 A;  2JMG A;  2L5Y A;  5DQI A;  1KQQ A;  4QZ8 A;  2W9A A;  1NK8 A;  5DQG A;  3C1Z A;  1ZJN A;  4M6W B;  4BWM A;  3BQ7 A;  2KKP A;  1CI4 A;  1B22 A;  2BPC A;  3MGI A;  3PST A;  4QZH A;  4KLO A;  4KLM A;  4BUG A;  2I5H A;  3RH6 A;  2LBO A;  7ICV A;  1ZD4 A;  3LVV A;  5CEH A;  4J9L A;  3OHB A;  4JMU A;  4OJP A;  2UVW A;  2H3F A;  1ED1 A;  2GWS A;  5KG1 A;  2FMQ A;  1ZQM A;  1U9L A;  4RNN A;  5CP2 A;  3PR4 A;  4JWM A;  1L3U A;  3JPQ A;  3HP6 A;  2AH5 A;  4Z6D A;  2DFL A;  2KSO B;  3E58 A;  3FM9 A;  3KZX A;  4GXJ A;  1KFS A;  4NY8 A;  5G5H A;  2OEH A;  2ALZ A;  5AHX A;  2QKQ A;  2E8M A;  4O3M A;  4KMU A;  3LWM A;  3RAQ A;  1L8L A;  3NS1 A;  4TUR A;  2XID A;  3SD7 A;  1COK A;  1HUO A;  5ALS A;  9ICX A;  3RJI A;  4KLD A;  4OJL A;  2JR5 A;  4NLC A;  2G08 A;  5L1M A;  4QJF B;  2EAN A;  3Q8L A;  4BXO A;  4ED2 A;  4US9 A;  1HEK A;  2PMZ F;  4DL6 A;  4B9U A;  4GIB A;  4ZOH C;  4U6P A;  5DG7 A;  3TQ1 A;  9ICT A;  1RPL A;  2YQE A;  4ECZ A;  2KEY A;  7ICP A;  4F92 B;  2DPJ A;  1U47 A;  4X5V A;  2P6R A;  3SV4 A;  2K60 A;  5KFP A;  5KTQ A;  2BCQ A;  3KHR A;  2BQU A;  2KG5 A;  4M47 A;  4ECQ A;  5AM0 A;  1KFT A;  2A3V A;  3V7J A;  4Q44 A;  2CPR A;  2F2A B;  7ICU A;  2K4P A;  1S5L U;  3E2E A;  4K4G A;  1RQN A;  5AK3 A;  4RNO A;  4Z6C A;  5J2I A;  3BJY A;  4Y2Y A;  2VKQ A;  4IQU A;  4KTQ A;  1F44 A;  4F4Y A;  3H0M B;  3GII A;  5KFE A;  2AHO B;  1OUQ A;  4US8 A;  2BCR A;  1JUD A;  5ALF A;  3TAC B;  9ICG A;  3T79 A;  3CW2 C;  4XQ8 A;  3T5K A;  3RBE A;  1N56 A;  1NJX A;  1MQ3 A;  3QXG A;  2JH7 A;  2VAN A;  1ZQC A;  5L1L A;  2J6S A;  2FLL A;  3ISB A;  4O3R A;  1N2X A;  3R9K A;  4PGY A;  7ICN A;  4DQR A;  3B0Y A;  2WAQ F;  1SV0 A;  4C0Z A;  3FDS A;  3FAH A;  2PI4 A;  1QSY A;  5ALV A;  4DS4 A;  2K8C B;  2XGP A;  9ICN A;  4Y2Q A;  4QWB A;  1ZQU A;  1QLN A;  5L1J A;  4I28 A;  1RZT A;  1SKW A;  3HWT A;  1BPY A;  1N60 A;  3IV6 A;  4IRD A;  4KLG A;  4P0P A;  5J2C A;  4CCH A;  2EZX A;  3IG5 A;  4DSJ A;  3M9N B;  3EW9 A;  1JAL A;  3GIL A;  2R8H A;  2F3N A;  9ICB A;  1PK1 A;  2KOB A;  4DCC A;  3M1Y A;  3KHL A;  5JTI A;  4ELT A;  3Q8Q B;  3RB4 A;  2YN4 A;  3D6J A;  3C5F A;  1XU4 A;  1BPB A;  3NVW A;  4QIW F;  3TAP A;  2HCF A;  2NRX A;  3RJE A;  1K5O A;  3PML A;  4KX3 A;  4EBE A;  2K4I A;  7ICJ A;  3NVZ A;  1ZD5 A;  3NGD A;  4FZM A;  2KZZ A;  3UXO A;  4WJ3 B;  5EWG A;  5AKJ A;  4J9O A;  4IL6 U;  4LVS A;  3IDW A;  1NKB A;  1ZET A;  1KW4 A;  2ZG6 A;  1Q46 A;  2H3I A;  4I2B A;  3SI8 A;  1O08 A;  2PI5 A;  1U49 A;  2E1E A;  3RF9 A;  3SEI A;  4ECS A;  4MEY A;  3WKE A;  3KHH A;  4M04 A;  4DFJ A;  3QZ8 A;  2C22 A;  4QWE A;  1L3T A;  4Y2X A;  4DL7 A;  1ZQK A;  4G3I A;  1LB2 B;  4JV0 A;  4AYB C;  4RT2 A;  2WAQ C;  4O3O A;  2KJ5 A;  2EAM A;  5DBC A;  1XSP A;  2XY5 A;  1N61 A;  2JV3 A;  3BQ1 A;  3KFU F;  4UB8 U;  3RAX A;  2KE7 A;  1L3S A;  5ALD A;  4TUP A;  2QLT A;  1IV8 A;  5G5G A;  4OJ5 A;  2OYY A;  5ALT A;  2HHV A;  3MBY A;  2W11 A;  2KNJ A;  5DB6 A;  2IOF A;  4TQR A;  3H0R B;  5CRX A;  3KZI U;  1EXN A;  4PPX A;  4RQ7 A;  3RFA A;  4RQ1 A;  4KLQ A;  3RBD A;  2W7O A;  5HML A;  9ICU A;  9ICF A;  4ECW A;  1N63 A;  3KKA A;  2H3V A;  3N28 A;  5KG4 A;  2KJ9 A;  4I2C A;  2XO7 A;  4QIW C;  4C8L A;  4IRK A;  1B0X A;  4PJ0 U;  5KFF A;  4EBD A;  5AK6 A;  5F3X B;  5DDY A;  1RM6 C;  1XSN A;  2Y1I A;  1JIH A;  8ICS A;  5KT6 A;  4ED6 A;  4F50 A;  1WCN A;  1F0M A;  1UA0 A;  4K4I A;  4QZD A;  3WKC A;  3PW7 A;  1TE2 A;  1WCL A;  4C8O A;  1N48 A;  2UVV A;  4F4X A;  3AU2 A;  5J29 A;  3MR5 A;  4DFD A;  4R8U B;  1U4B A;  2ZJA A;  5AKK A;  5ALN A;  5AM2 A;  5AKH A;  2JH1 A;  3Q8M A;  3PW5 A;  1NJZ A;  1PVP A;  5KFX A;  4DF4 A;  1SXE A;  5EOZ A;  8ICL A;  2DF4 B;  2A1J B;  3C2K A;  4PGQ A;  4IQW A;  3GU3 A;  2HBJ A;  4FFD A;  2W9B A;  9ICH A;  5ALO A;  3FYH A;  2PFP A;  5TIS U;  5CHG A;  2FLN A;  4DSL A;  4PHP A;  1PK3 A;  3JPT A;  3QU7 A;  5J2J A;  4UQG A;  4DSK A;  3GV5 B;  4KMO B;  5J0X A;  3G6Y A;  2FJ6 A;  3AU6 A;  2MU2 A;  5J0U A;  4NV0 A;  2JZB A;  4FZN A;  4OJ6 A;  2Y1J A;  2ZUD A;  5H2F U;  1KRP A;  4MEX A;  3T3F A;  4IR1 A;  5HHH A;  5J0T A;  3H4D A;  2AXT U;  8ICA A;  3GIM A;  4I27 A;  4O9M A;  3B0X A;  4YCX A;  4RPY A;  9ICC A;  2MUT A;  3ZI4 A;  2XGQ A;  2F77 X;  2NRW A;  3SMV A;  1F5S A;  1DOQ A;  2AGQ A;  3ISD A;  1NK4 A;  2YTU A;  1QTM A;  2HBL A;  9ICR A;  4K4H A;  4DOA A;  2LKY A;  3MFH A;  4P0Q A;  1B43 A;  5HNK A;  4UBC A;  1BPX A;  5EE0 A;  3U26 A;  5DLG A;  3MDA A;  5KFG A;  1X6I A;  4UAY A;  2LMR A;  3UPQ A;  3RH4 A;  4Q8F A;  4NL9 C;  4F2S A;  2V4Q A;  3ONN A;  4CDG A;  2ASJ A;  2KIW A;  1Z1V A;  3LYS A;  3G6X A;  2KIC A;  2PFQ A;  2VA3 A;  1QSL A;  2HMX A;  3N7P D;  2QB1 A;  3RTV A;  4C4R A;  2I9G A;  3ORY A;  4M9L A;  4BXO B;  2ZIW A;  4QWA A;  2F1H A;  1QQ5 A;  2P6U A;  2V4R A;  1RQL A;  1SV4 A;  3H40 A;  1QCK A;  1XC9 A;  1S8O A;  5HR6 A;  1A6S A;  1GO3 F;  5KFO A;  8ICC A;  4UB3 A;  3AQE A;  5ALW A;  2KJ8 A;  3L4P A;  5ALL A;  3TAD A;  2G0A A;  4B6J A;  5HP4 A;  4U7C A;  2HVI A;  1ZYQ A;  1ZQT A;  4C8N A;  2KIV A;  5J0Q A;  5EE1 A;  3HKZ F;  1MC8 A;  1DRG A;  2ZJ5 A;  4O5K A;  3JPS A;  1Q3V A;  4I2E A;  3RB3 A;  2EZZ A;  1RXV A;  2KK0 A;  4P4M A;  2HHU A;  4F2R A;  2M0N A;  4R65 A;  4MHV A;  1A76 A;  3LWL A;  2J6U A;  5J8Y A;  4UAZ A;  1COO A;  4UBB A;  5DKW A;  1UQV A;  1KFD A;  4EX7 A;  2C2D A;  5KL1 B;  1Z19 A;  2RLT A;  4FZL A;  2B21 A;  5J0P A;  4QZA A;  3JPO A;  2JEF A;  4F91 B;  3AN1 A;  3QU4 A;  3TAR A;  5KFC A;  3WKA A; 
#chains in the Genus database with same CATH homology
 1Z1V A;  4IS7 A;  2DL0 A;  5KNI A;  5JU5 A;  3SEI A;  2KMD A;  2QB1 A;  3TAC B;  2DKZ A;  2Y9U A;  1LKY B;  1SXE A;  2E8P A;  4RQN A;  1SV4 A;  1DXS A;  1SV0 C;  2EAM A;  2ESE A;  1PK1 B;  2KSO B;  2E8N A;  1SV0 A;  3BS7 A;  3TAD C;  2JV3 A;  2QKQ A;  1PK3 A;  2E8M A;  2KE7 A;  3BS5 A;  2FE9 A;  1X40 A;  3TAD A;  1OW5 A;  4NJ8 A;  1COK A;  2QB0 B;  2Y9T A;  2EAO A;  2KIV A;  1V85 A;  1B4F A;  2DKX A;  1X66 A;  1X9X A;  2QAR B;  5L1M A;  3KKA C;  1JI7 A;  2EAN A;  2EAP A;  2D8C A;  1UCV A;  1LKY A;  1SGG A;  3KKA A;  1OXJ A;  5J8Y C;  4MHV A;  2F3N A;  1PK1 A;  2YTU A;  2KSO A;  5J8Y A;  2F44 A;  3HIL A;  1SXD A;  1WWU A;  5JTI A;  2K60 A;  1V38 A;  3H8M A;  3SEN A;  2E8O A;  1UQV A;  2ES6 A;  1B0X A;  2LPE A;  3K1R B;  1RG6 A;  2KG5 A;  5F3X B;  2D3D A;  2L5Y A;  2GLE A;  2LMR A;  2F8K A;  2B6G A;  2K4P A;  2QB0 A;  1WWV A;  4NL9 C;  4PZN A;  4PZO A;  1F0M A;  3BQ7 A;  4RQM A;  3BS5 B;  3IDW A;  4NL9 A;  5JRT A;  2QAR A;  1KW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...