5J8YC

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
MPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
molecule keywords Polycomb protein Scm
molecule tags Nuclear protein
source organism Drosophila melanogaster
total genus 23
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yC00
2ESEA 2YTUA 1LKYB 4NL9C 2L5YA 1WWUA 3KKAC 5KNIA 2DKZA 3BS5B 2E8OA 1UCVA 2KSOA 2LPEA 2B6GA 2D3DA 2LMRA 2E8MA 2F3NA 3K1RB 3SEIA 2E8PA 2EAOA 4IS7A 3IDWA 2ES6A 1SXEA 2JV3A 1DXSA 2QARB 1JI7A 1OXJA 1OW5A 4NL9A 1SV0C 1Z1VA 3KKAA 1SV4A 1LKYA 3TACB 2K60A 2DL0A 3H8MA 2K4PA 1PK3A 2GLEA 3BS5A 2E8NA 1RG6A 1V85A 1PK1B 1X9XA 1F0MA 2Y9UA 2D8CA 2KG5A 2QARA 1SV0A 1V38A 5JTIA 1KW4A 2KIVA 3HILA 2QB0B 2KSOB 2EANA 2QB1A 1SXDA 5L1MA 5F3XB 5JU5A 3TADC 5J8YC 4RQMA 4NJ8A 2KMDA 2FE9A 2F44A 1PK1A 3SENA 1SGGA 4RQNA 1UQVA 2EAPA 1X66A 2DKXA 3BS7A 4MHVA 3TADA 1B4FA 5J8YA 3BQ7A 2QB0A 4PZOA 2EAMA 2Y9TA 2KE7A 4PZNA 1COKA 2F8KA 1X40A 5JRTA 2QKQA 1B0XA 1WWVA
chains in the Genus database with same CATH superfamily
4YR2A 5ALVA 1ZXIA 4O3QA 4M9NA 1QSLA 2HHUA 3KTQA 3TI0A 3ED5A 2D6FC 2E5SA 1TVAA 3LVWA 1ZQCA 4RT3A 4DS4A 1RYSA 1AROP 4YMOA 5HR7A 1ZETA 3LDAA 4CE6A 4ACOA 2Q0ZX 9ICLA 3OHAA 3A0BU 1KBUA 2I6XA 2KZMA 4MFAA 1SV0C 1SV4A 1B22A 5J0UA 5KT5A 5KT4A 1ZQLA 4QW8A 2KIWA 1S0VA 1ECWA 4KLFA 3BS5A 4XA5A 2HCFA 2YMMA 2W7PA 3UQ2A 1NK4A 5J0SA 8ICFA 4ELVA 4Y2YA 4Z6FA 3SZ2A 3D2QA 1QQ5A 1NJZA 2K8BB 1KN5A 5IIMA 3TARA 2FMSA 3PV8A 2HBMA 2P6RA 2QB0B 4DFDA 4UB1A 5F3XB 2KV2A 1BPZA 3NUQA 5AHXA 4O3RA 1MQ2A 3SV3A 4O3NA 4Q8FA 3M6KA 7ICKA 1JN3A 1UPHA 1X9MA 4IC9A 4P4PA 8ICRA 1LB2B 2DFLA 4A8EA 5EWGA 4NLZA 5DGAA 2UVWA 5G5HA 5L1KA 1RQLA 8ICNA 2ZIWA 5KG5A 1Z00A 2A19A 4FE3A 4R66A 2W8KA 4JV1A 4C4RA 1S76D 4ECRA 9ICTA 2HHXA 5C0YA 3EWAA 3NRZA 1XS9D 3HT3A 4RU9A 1X40A 2HDOA 4RQ0A 1KRPA 2YY6A 4I29A 3RB3A 5BOLA 1CRXA 5IIKA 4B6JA 1JALA 4GXKA 2E8OA 1JROA 4DOCA 2DF4B 3Q8SB 3PMLA 4DS5A 4O5EA 2I1QA 3R9KA 1JI7A 3AMZA 1OXJA 3T3FA 2JRZA 3TFRA 2HHWA 2GO7A 4YP3A 2F1IA 1Z19A 3T79A 1RG6A 2K89A 1V85A 2A1AA 5ALJA 3CP8A 2ZIVA 4KLGA 2HOFA 1QLNA 3D2SA 1NJYA 3THVA 4JV0A 5L9XA 5CEHA 2KTQA 2KIVA 3RRHA 4NM1A 3QEAZ 4BDPA 2AGQA 1JRPA 2AU0A 2AGOA 2C22A 4F2RA 3RAXA 1S0OA 4LJXA 4I2GA 4QZBA 2F44A 3LK9A 5DG8A 3Q8QB 2HOQA 5J29A 1RQNA 1SGGA 5KFQA 2KHVA 1SKSA 1IXRA 4CDGA 4Y2PA 3BS7A 3DDHA 1RXWA 2HHSA 3MFIA 5ALSA 3QEBZ 8ICXA 3QU2A 2EAMA 2Y9TA 5HHHA 1J97A 2RDIA 1NK7A 1KDHA 1KFSA 2NRXA 2IHMA 2HVIA 4O3PA 2KP7A 4ECYA 3B0XA 8ICIA 4RQ7A 3RJGA 4MFFA 5ALUA 3BQ1A 2ISOA 4ECWA 3Q8LA 2HBLA 1MC8A 5AIAA 5ALXA 4AYBF 5KFJA 1S10A 2PMZC 3SEIA 4US8A 3CNHA 1UT8A 3I1YA 1BVSA 2E1FA 2ES6A 1KTQA 1L7PA 1P7DA 1SKRA 2YB1A 3MR3A 4YVZA 2BPFA 2OYYA 1QTMA 4QWDA 1OW5A 1Z1VA 1UA0A 2VKQA 4UB6U 3PMNA 2LYBA 4OJ6A 4F5OA 2H3QA 2F1HA 2JEIA 3BQ0A 3PX4A 2AQ0A 3ZDDA 5KG2A 4RQ6A 3V6KA 4BWJA 3RB4A 3Q8RB 4O5KA 9ICIA 2FLNA 4PGQA 5AKYA 4JK1A 1T3QA 3QU9A 3F2CA 1UA1A 3M9MB 2NRZA 4UAZA 2ZXIA 4NJ8A 3AUOA 1N2XA 4XUSA 2F76X 1JXLA 3OPXA 5KFFA 2Y1JA 3WKEA 1TKDA 4O0IA 5EE1A 5HP4A 1SWWA 5KFBA 5C5JA 5EE3A 1YZ6A 9ICUA 3MFHA 5KG0A 1RXVA 1ZQFA 3BQ7A 4C8KA 5DGBA 1IIPA 4XRHA 2Z7JA 3F53A 4RQ3A 4I2JA 2AGPA 2V4RA 2BPCA 2GWSA 3ZDAA 1RYRA 2JEGA 1LVHA 4YQWA 5ALOA 5AKLA 4K4IA 4I27A 3WK4A 5KFZA 3QU4A 7ICSA 3C21A 3D2NA 3PO4A 5DB8A 3IV6A 2AQ4A 3SAFA 9ICBA 1SXEA 4KMOB 3H0RB 4ELUA 4UB2A 4O9MA 4RQ5A 8ICTA 2Y1IA 5CA7A 1XWLA 3BJYA 4BX9C 3BZCA 2YQEA 3KKAA 5AIBA 4EYIB 2KJ8A 4OJPA 3C1YA 2FPKA 8ICJA 1TV9A 2KNJA 1KL9A 4JWMA 5CHGA 2HW3A 2N1RA 2PKEA 1QSSA 2W11A 2XY6A 8ICMA 1Q3UA 3ETRA 3PO5A 4Z6EA 4QZAA 3M7DA 3UXOA 2HBJA 1SXDA 5ALLA 2K8CB 8ICZA 3JPQA 3WK8A 9ICXA 2F1JA 5EE9A 4QWEA 1SZHA 2PFQA 1N48A 3RH4A 4RZRA 1ZD2P 3BQTA 2MUTA 1ZQTA 3HWTA 4OJOA 3PR4A 2KFNA 4P0QA 5AI6A 1A0PA 2A1JB 3SI8A 4TUPA 4I2CA 4M9GA 4PZNA 2LM1A 3TFSA 3HJEA 2OEHA 3HRDD 2OCEA 2W9BA 1RDFA 4BGDA 4DFMA 4RT2A 2KHQA 1WWUA 2DGZA 3LWMA 4F5PA 1U9LA 2IOHA 5BOMA 2CPRA 4YR3A 3KBBA 2D3DA 2LMRA 2E8MA 1N5XA 1DXSA 3AN1A 3I76A 4BXOB 3EPGA 3RJEA 2WF9A 4I2IA 4DLGA 1JXEA 1K1QA 4PPXA 2R8JA 4P0QB 1MA7A 4Y2TA 5D46A 3M1YA 5J2KA 2H3FA 4ED7A 3GV8B 2W9BB 2JH7A 4O5CA 1VLBA 4EENA 4R8UB 2D8CA 2QARA 1S8OA 2EZZA 4RUAA 1B43A 4UBCA 1Y88A 2E3TA 7ICRA 3NTUA 2ASLA 4Y2UA 3I28A 1D8LA 4QZGA 3OHBA 2AJQA 3GQCA 3HW8A 2BCUA 4PL1A 3KZIU 3M8RA 2K8AA 5HHIA 4QW9A 3FAHA 4PHPA 3TANA 4KX5A 2FLPA 3ZDBA 4K4GA 1PVQA 4EELA 1ZD5A 8ICSA 4J9SA 2XC9A 3H0LB 5J2EA 4NLKA 4F4WA 5AI8A 2YMLA 4ICAA 4DQQA 2JEFA 2ZIUA 4JB3A 3UM9A 2C2RA 4XQ8A 2QKQA 2WAQF 3RJIA 7ICGA 2DUYA 3TQ1A 3E0FA 1S97A 3NASA 2G5HB 3NVZA 2DPJA 3RRGA 1DK2A 2KFZA 5EWFA 4NLNA 5F9NA 2V4QA 5DKWA 2AXTU 3NGDA 2EAOA 4IS7A 3LVVA 2KVCA 9ICQA 2RQ5A 4C4TA 1NK0A 4F72A 5DQHA 1S77D 2HHVA 2BHNA 4AYBC 1ZQVA 2LYAA 5AKZA 4QZCA 4RQ4A 2W9CA 8ICOA 1L3SA 3V6JA 1A76A 1SZPA 1BPDA 2FPMA 1ZQKA 3H8MA 2ALZA 5KFEA 3RF9A 5J2CA 4Q44A 4ECVA 2RHFA 5ALFA 3WK5A 3M8SA 1K5OA 1X9XA 4M2YA 5KT2A 3PSFA 1URJA 1OUQA 4NLBA 4JMUA 5D49A 5J2DA 5DQGA 3UQ0A 1YZ7A 2BR0A 1TFRA 3IN5A 2J6UA 1D9DA 4EBCA 4I2EA 4Y2QA 2LYHA 2KZZA 4KN4A 3ETLA 4QWCA 2FLLA 5KT7A 7ICUA 1L5UA 4DL7A 4G9BA 1QCKA 4PL2A 4KLIA 3UPQA 2ZUCA 4UAWA 4Y2JA 2G08A 3GV7B 1NK9A 4P0PA 3HP6A 2BDUA 2P66A 2W9AA 4MEXA 4F4KA 2XGQA 4F5RA 1FFVA 5KFGA 4RPYA 3H8JA 3FC4A 2E1EA 1O03A 1L3VA 5J2BA 4RUCA 2HMXA 2XIDA 1V9PA 2ESEA 1ZQAA 2Q4TA 1FO4A 3EW9A 3IHQB 1QH9A 3H8WA 3KKAC 9ICAA 1MN8A 4MFCA 7ICJA 3BS5B 5D4BA 3K4GA 2BKEA 4YMNA 3GIIA 3IDWA 5AK3A 4F4XA 4BWMA 2W9MA 1DGSA 7ICHA 4KLMA 2PFNA 3MGVA 2KK0A 4ECSA 4UARA 2R8KA 2W3RA 1LKYA 4P0PB 4NWIA 2XCPA 3M6ZA 1Z1BA 2JH1A 4RQ2A 1TK5A 4MF2A 1VDVA 3JPRA 1F44A 8ICLA 4IR1A 4TQRA 5DB9A 1IG6A 5TZVA 3GFKB 3MGIA 2KG5A 2ZTEA 2WF5A 3JPPA 2ZIWB 7ICIA 2HBKA 1Z00B 1EXNA 3H8SA 3JPOA 1XSNA 4NLCA 4RPXA 2WHEA 3QYPA 3SAGA 4YG2A 2BGWA 3ZD9A 5L1JA 4O3SA 1ED1A 1BGXT 4IRKA 1XU4A 5KFDA 2OH2A 4ZOHC 3FDSA 2W54A 4C7YA 5KFXA 3GIKA 2FDRA 4GLXA 3UXPA 3ZDEA 1ZQEA 2PI4A 3C28A 2ZJAA 3RJHA 2HVHA 2NRVA 2PFOA 5ALRA 1ZQHA 3Q8PB 4IQVA 3RR7A 3RFAA 5KFCA 4UB8U 4UB5A 4I2BA 4PHEA 3N97B 2ZUBA 1Z3EB 1WG8A 4YFKA 4M9HA 4EEKA 4KTQA 2KSOA 5KFRA 5CJ7A 3NVYA 4PH5A 3EPIA 2ZIVB 4F93B 2KKPA 2W7OA 8ICWA 4M9JA 5B5EU 2BCQA 4BJQA 4DQPA 2VJ5A 3JPNA 1NKEA 3C1ZA 3SYZA 1NZPA 3UMCA 1J2NA 5KFAA 2K4PA 9ICEA 3BDPA 2ZIXA 3FM9A 2Y0SF 5F9LA 2NO5A 2R8IA 1FIQA 1IM4A 5J0OA 8ICUA 2BCRA 5KFMA 3QU7A 2KSOB 3QXGA 1DK3A 2QB1A 3WK7A 3K75D 2WF7A 4UBBA 4RQMA 4C8NA 2KMDA 1SKWA 3F2BA 4EBEA 1X6JA 4KX3A 2VA3A 5K4LA 2NO4A 4ED8A 3ZDCA 5CR0A 4QWBA 1HIWA 8ICYA 5KTQA 1JUDA 4DL3A 2YB4A 5DB6A 4EX7A 1PUZA 4ED3A 3QUBA 2ZIXB 2P35A 3IG5A 3EUB2 4ECTA 2G06A 3QU5A 8ICBA 4QZ9A 1L7OA 2ISPA 1RZTA 1SL0A 3N7RC 4JV2A 2BQUA 1T94A 2F8KA 5KG4A 5ALPA 3QZ7A 4JUZA 1KEJA 1WWVA 3VCBA 9ICWA 4HYKA 5KFSA 3AEVA 2B21A 2BZFA 7ICEA 1XO1A 4ED1A 1YT3A 2FPLA 2WAQC 4FBUA 2K4IA 4C0ZA 4DQSA 7ICMA 4KLDA 1KFTA 4Y2SA 3PR5B 1CI4A 5AI4A 2C2EA 1Q3VA 2CRXA 1L8LA 4KMUA 3N7SC 1TAUA 4NL9A 2FMPA 2RLTA 3T5KA 4QIWF 3MR2A 2JHDA 2DL0A 5ALWA 4KLQA 5AI5A 1NKCA 3GIJA 8ICPA 4B9MA 1LV5A 4RNNA 2EZXA 5J0QA 2YX8A 2PI5A 3WU2U 4M04A 1U47A 1S5LU 2ATLA 3PW7A 4CCHA 4X5VA 5AM0A 8ICAA 3KHGA 3PX6A 4DL2A 5JTIA 5DDYA 4FFDA 1QQ6A 4OJ5A 4J9OA 5ALDA 2I9GA 3SD7A 3SR6A 3GDXA 3IM1A 1ZD4A 5IIIA 4ED0A 2IOFA 2XCAA 3ZI4A 3K1ZA 4C4SA 2W43A 3CYMA 2NRTA 1Z4NA 3E58A 2ZG6A 5ALQA 4RNOA 3SENA 3KHLA 4P4MA 2R8GA 2VJ4A 4QZDA 1WYGA 3HPOA 3TADA 1PVPA 1S0NA 4QZEA 2ZTCA 4BUGA 5E79U 4F4ZA 3V72A 5KFOA 2KICA 3J81j 4KLJA 4UW9A 3M9NB 1JIHA 4DF4A 3Q8KA 3F5EA 2AHOB 2WTFA 3KHRA 2F8LA 9ICFA 5EWEA 4F5NA 2L5YA 3IP4B 2F77X 1J2MA 1T4GA 3QUTA 2XICA 2YN4A 2R18A 2LHTA 1ZQJA 2LPEA 3QX7A 2B6GA 2BDPA 3K1RB 4GIBA 3OSNA 2H5XA 5AM2A 1NK8A 4IRCA 3CW2C 2VA2A 4FZLA 1NI3A 2LI6A 4F3OA 3PW2A 5IILA 5GTIU 4KLHA 4MF8A 3DEEA 2K60A 3PVXA 4B9VA 3VC8A 4GXJA 2E8NA 4DOAA 1ZQ1C 2OHFA 5EE0A 4F71A 4M6WA 4CF5A 5GTHU 1ZQNA 3NS1A 4TURA 2MUTB 1ZQSA 1H38A 3PW4A 5BPCA 1XC9A 3QNMA 3WK6A 1SWVA 5AKKA 1JX4A 2EH9A 3RTVA 2JZBA 2ZJ5A 5L1MA 2RP5A 5JU5A 7ICFA 4YXMA 2XY7A 3H40A 1ZJMA 3M9OB 4DCCA 3AM9A 4UAYA 2KJ5A 8ICQA 4M0AA 1PK1A 1TK0A 1T8EA 1A6SA 2H3IA 2BCSA 4ED2A 3OSPA 1XSLA 1KSPA 4F5QA 1ZQRA 2OM6A 4FO6A 2KN7A 1WUDA 1X66A 1MSWD 1C20A 3QUQA 1L6NA 1NNLA 3MDCA 3T5JA 5ALMA 1N63A 3HKZF 1ZQOA 4TUSA 5HMLA 1TE2A 4C7ZA 1SIJA 1ZD3A 4FZMA 1DRGA 1BNOA 4GFJA 4J9MA 4YCXA 5L1LA 5JRTA 3PZPA 3WK9A 5KFWA 1HEKA 4DFKA 2C28A 4KLEA 2A3VA 2YTUA 3PY8A 3LYSA 3N4MB 1ZOLA 3RH5A 3NVWA 1A77A 5J0PA 3G6XA 4F50A 4KLTA 5AK5A 4CGZA 2OXOA 1DOQA 4OD0A 5CB1A 4Y2VA 2QARB 4OCZA 3RAQA 2W03A 5KT3A 5FP0A 3OGUA 3BZKA 5KL8B 4NXZA 5JUMA 3ONNA 3EZ5A 3RBEA 3TACB 5TISU 8ICVA 4ECZA 1PK3A 3G6VA 7ICTA 3SV4A 3DV9A 1T7PA 9ICSA 2YMQA 4U6PA 3C2MA 5AKEA 4J03A 5DBAA 3L4PA 4B9NA 3G6YA 3UMGA 4EEYA 2UVVA 2Y0SC 5DBBA 2K4EA 8ICCA 1KQQA 1ZQUA 3S6JA 5J2GA 3RJJA 2KD1A 2ZIUB 4LZDA 5KFKA 4TUQA 5HR6A 4QZFA 5ALHA 2MA1A 3AQFA 7ICOA 1ZQMA 4U7CA 2IOFK 4RQNA 3NRWA 1UQVA 2EAPA 2ODGA 5IIJA 5J8YA 3OTQA 2W8LA 4ELTA 1L7MA 1KKXA 2QB0A 4PZOA 4OJLA 2C2DA 5KFHA 2VANA 4PGXA 4GC6A 1NJWA 5G5GA 7ICNA 4RPZA 4F4YA 4CF3A 3EYZA 5L1IA 1WCNA 2W9CB 1B0XA 3MR6A 4I2DA 2MSNA 4IQWA 1IV8A 4HAIA 4GXIA 4F92B 1O08A 3RJKA 3QUCA 4NL9C 3T5LA 8ICEA 4PGYA 4M9LA 2H3VA 2DKZA 7ICLA 1CEZA 3UMBA 1UCVA 4DFPA 3WKDA 2EZYA 2F2AB 1SL2A 3H4DA 3ORYA 1CUKA 1T3NA 1QSYA 3IRUA 3PNCA 5J0YA 2V9WA 3H7IA 7ICVA 1WCLA 4USAA 2K4HA 1ZQPA 3NVVA 5DBCA 1L3TA 2GLEA 2XO7A 2XI9A 4QIWC 1RYUA 1ZQQA 2IHNA 1PVRA 4LVSA 1ZYQA 5DLFA 2XVTA 4J9KA 4P4OA 4DOBA 4NV0A 4FZNA 1N62A 1NOMA 3TADC 3RBDA 4DL5A 4DEZA 1SB3C 5AKJA 1FFUA 3JPTA 1ZRMA 2MAXA 2HHTA 3FYHA 2LM4A 3F2DA 4DO9A 3C5GA 5J2JA 2HOIA 4E0DA 2BQRA 2NYVA 2YMPA 1B4FA 1F5SA 1X9SA 2JMGA 5CRXA 4FS1A 4IR9A 5DG9A 1V97A 2M9NA 3PSPA 4FBTA 4DFJA 1NJXA 4B9UA 4EYHB 2LKYA 2ASJA 5ALEA 1NK5A 3H0MB 5KT6A 5DDMA 2BCVA 1LKYB 5HNKA 3C5FA 1ZRNA 5KNIA 2ASDA 4CNQA 4KLUA 4UASA 4QNLA 4DSEA 4ED6A 3PX0A 4FS2A 3ICXA 1ZQXA 3C2KA 2F3NA 5DB7A 1D8BA 3BQ2A 2W04A 2KVSA 2WB1F 4Y2XA 1BPXA 4PJ0U 1X6IA 1HUZA 2WF6A 2G0AA 4O3MA 4LZGA 1BPYA 4CRXA 4DL6A 3QE9Y 5J2AA 5KFTA 3C2LA 3GU3A 4OO1J 1Z4OA 2DPIA 1XNSA 1UHUA 3V7KA 4UB4A 5H2FU 3T5HA 2KOBA 2IMWP 3RB0A 4Z6DA 4I28A 1ZQIA 1HJPA 2BQ3A 3WKAA 4I2AA 3GIMA 4F2SA 2JR5A 1V38A 3LWLA 1KW4A 4C80A 4GC7A 4EX6A 4QZHA 1ZQZA 2IBKA 1BPBA 1U45A 1ZQBA 1N60A 1Q8KA 3F5AA 2FJ6A 2RRDA 2DBYA 4KLLA 3A0HU 5A0LA 4C8LA 3IG8A 3TAQA 4RQ1A 4R64A 3E2EA 1X2IA 1N5WA 9ICRA 3KFUF 2ZTDA 4QWAA 1UT5A 1QQ7A 4YR0A 3MGHA 2KEYA 2MU2A 3HKZC 4Q43A 2G09A 4NLGA 2WFAA 4DSIA 4UATA 1AQ6A 5KAFU 4DLEA 1NZBA 3HX0A 5J2HA 2G07A 2XY5A 4Q45A 1NK6A 3D6JA 1D8YA 3MABA 4YD2A 2B0CA 2EQYA 5ALIA 1JMSA 3MBYA 4DSJA 4EZ6A 5AI0A 3H4BA 2IA6A 2HI0A 2PXIA 4RNMA 5KAIU 5KFPA 4KLOA 2CXYA 1XSPA 2JEJA 5CP2A 5J0TA 4R63A 4B9TA 5KG7A 2J6SA 1L8OA 4YXJA 2Y9UA 4I2HA 3QZ8A 4YMMA 1SV0A 4QZIA 4UAVA 3CRXA 2MRLA 5AK6A 4J9PA 3MC1A 4NY8A 1U48A 3AU2A 1TAMA 3TKAA 5J8YC 5KL1B 2W3SA 1XO0A 2FE9A 9ICKA 1BNPA 3KOOA 5ALZA 4NM2A 3U26A 1ZQDA 3GV5B 2JGAA 3UXNA 4UQGA 4RQ8A 4DQIA 4CF4A 2DWQA 2DKXA 1ZQYA 7ICQA 1PZNA 3L3FX 9ICVA 5ALTA 4ECXA 1U49A 3ALRA 4O3OA 8ICHA 3B9JA 1S9FA 4K4HA 5AKXA 4B9LA 3O0FA 3WKCA 3V7JA 3V7LA 2FI1A 3ISCA 5HMMA 5AKGA 2VA8A 5ALKA 2KZ3A 2GH1A 3PSTA 8ICKA 9ICHA 3KD3A 2RDJA 1X42A 4DSKA 2E8PA 2A1JA 2DQNB 2ZJ8A 4ECUA 3GZFA 4AP9A 5DG7A 4F8RA 9ICJA 4F91B 4UB3A 3PW0A 3SMVA 3MDAA 4DL4A 9ICMA 1FEZA 4IL6U 4J9QA 4P2HA 4ZH4A 3N28A 2XGPA 3PSIA 4US9A 1VJ5A 2FMQA 3SQIA 1L7NA 1D9FA 2M0NA 4R65A 4BXOA 2UVRA 9ICCA 2AH5A 3HILA 3KZXA 4YD1A 4JWNA 4EZ9A 5AKHA 2KKVA 5AM1A 4Z6CA 4J9RA 3ISDA 5KFLA 5J0RA 3SAHA 1NKBA 4PHAA 1N56A 2W55A 5DQIA 5J2IA 3RR8A 2PFPA 5CWRA 4QZ8A 5J0WA 4DSLA 4R8UA 1S0MA 2NRWA 5DLGA 1C7YA 5AICA 5T14A 4KLSA 1COOA 5KG1A 4I2FA 1ZJNA 1L3UA 1ZQWA 3C29A 2ZUDA 5AK4A 5AM3A 1RM6C 8ICGA 5J0XA 3RJFA 4IQUA 4G3IA 3PW5A 2PMZF 4IRDA 5KFVA 3RB6A 1KLNA 2WF8A 1DGJA 1X9WA 3N7PD 1Q46A 4Y2RA 1ZQGA 3JPSA 5J2FA 3RH6A 4QJFB 1BPEA 4M6WB 3AL0B 5ALNA 2HSZA 1HUOA 3V6HA 2JV3A 3OJSA 1K1SA 2OWOA 2HHQA 2J6TA 5KFUA 5B66U 2CN1A 3ZD8A 2KJ9A 9ICNA 2I5HA 9ICGA 4KITB 3AQEA 1KFDA 2LBOA 4Q8EA 4DF8A 5AM5A 2JZBB 2O6KA 2WB1C 2P6UA 9ICOA 5EOZA 4DWIA 4B9SA 2NV3A 2G5IB 4TQSA 2GOLA 3MR5A 2VIXA 1PK1B 5AI9A 5IIOA 1F0MA 3B0YA 5KG6A 5ALYA 1M6YA 1GO3F 4UAUA 3ISBA 2H3ZA 4DQRA 4C8MA 2R8HA 2EANA 1RPLA 5IINA 9ICPA 4WJ3B 2BPGA 4DSFA 1N61A 3GILA 3OJUA 2ZXHA 1U4BA 4PHDA 2UVUA 4J9NA 4MEYA 3TAPA 3L5KA 3C23A 2EDUA 1MQ3A 5AKIA 3WKBA 4YN4A 1TAQA 7ICPA 5AM4A 4ECQA 4M47A 5ALGA 3AU6A 5KFYA 4MHVA 1TK8A 4C8OA 5KFNA 4KN7A 2KE7A 3KHHA 3Q8MA 4IQTA 2JXJA 1COKA 2QLTA 4EBDA 1SL1A 4J9LA 5KFIA 5KG3A
chains in the Genus database with same CATH topology
2ESEA 2YTUA 1LKYB 4NL9C 2L5YA 1WWUA 3KKAC 5KNIA 2DKZA 3BS5B 2E8OA 1UCVA 2KSOA 2LPEA 2B6GA 2D3DA 2LMRA 2E8MA 2F3NA 3K1RB 3SEIA 2E8PA 2EAOA 4IS7A 3IDWA 2ES6A 1SXEA 2JV3A 1DXSA 2QARB 1JI7A 1OXJA 1OW5A 4NL9A 1SV0C 1Z1VA 3KKAA 1SV4A 1LKYA 3TACB 2K60A 2DL0A 3H8MA 2K4PA 1PK3A 2GLEA 3BS5A 2E8NA 1RG6A 1V85A 1PK1B 1X9XA 1F0MA 2Y9UA 2D8CA 2KG5A 2QARA 1SV0A 1V38A 5JTIA 1KW4A 2KIVA 3HILA 2QB0B 2KSOB 2EANA 2QB1A 1SXDA 5L1MA 5F3XB 5JU5A 3TADC 5J8YC 4RQMA 4NJ8A 2KMDA 2FE9A 2F44A 1PK1A 3SENA 1SGGA 4RQNA 1UQVA 2EAPA 1X66A 2DKXA 3BS7A 4MHVA 3TADA 1B4FA 5J8YA 3BQ7A 2QB0A 4PZOA 2EAMA 2Y9TA 2KE7A 4PZNA 1COKA 2F8KA 1X40A 5JRTA 2QKQA 1B0XA 1WWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  2YTU A;  1LKY B;  4NL9 C;  2L5Y A;  1WWU A;  3KKA C;  5KNI A;  2DKZ A;  3BS5 B;  2E8O A;  1UCV A;  2KSO A;  2LPE A;  2B6G A;  2D3D A;  2LMR A;  2E8M A;  2F3N A;  3K1R B;  3SEI A;  2E8P A;  2EAO A;  4IS7 A;  3IDW A;  2ES6 A;  1SXE A;  2JV3 A;  1DXS A;  2QAR B;  1JI7 A;  1OXJ A;  1OW5 A;  4NL9 A;  1SV0 C;  1Z1V A;  3KKA A;  1SV4 A;  1LKY A;  3TAC B;  2K60 A;  2DL0 A;  3H8M A;  2K4P A;  1PK3 A;  2GLE A;  3BS5 A;  2E8N A;  1RG6 A;  1V85 A;  1PK1 B;  1X9X A;  1F0M A;  2Y9U A;  2D8C A;  2KG5 A;  2QAR A;  1SV0 A;  1V38 A;  5JTI A;  1KW4 A;  2KIV A;  3HIL A;  2QB0 B;  2KSO B;  2EAN A;  2QB1 A;  1SXD A;  5L1M A;  5F3X B;  5JU5 A;  3TAD C;  5J8Y C;  4RQM A;  4NJ8 A;  2KMD A;  2FE9 A;  2F44 A;  1PK1 A;  3SEN A;  1SGG A;  4RQN A;  1UQV A;  2EAP A;  1X66 A;  2DKX A;  3BS7 A;  4MHV A;  3TAD A;  1B4F A;  5J8Y A;  3BQ7 A;  2QB0 A;  4PZO A;  2EAM A;  2Y9T A;  2KE7 A;  4PZN A;  1COK A;  2F8K A;  1X40 A;  5JRT A;  2QKQ A;  1B0X A;  1WWV A; 
#chains in the Genus database with same CATH topology
 4YR2 A;  5ALV A;  1ZXI A;  4O3Q A;  4M9N A;  1QSL A;  2HHU A;  3KTQ A;  3TI0 A;  3ED5 A;  2D6F C;  2E5S A;  1TVA A;  3LVW A;  1ZQC A;  4RT3 A;  4DS4 A;  1RYS A;  1ARO P;  4YMO A;  5HR7 A;  1ZET A;  3LDA A;  4CE6 A;  4ACO A;  2Q0Z X;  9ICL A;  3OHA A;  3A0B U;  1KBU A;  2I6X A;  2KZM A;  4MFA A;  1SV0 C;  1SV4 A;  1B22 A;  5J0U A;  5KT5 A;  5KT4 A;  1ZQL A;  4QW8 A;  2KIW A;  1S0V A;  1ECW A;  4KLF A;  3BS5 A;  4XA5 A;  2HCF A;  2YMM A;  2W7P A;  3UQ2 A;  1NK4 A;  5J0S A;  8ICF A;  4ELV A;  4Y2Y A;  4Z6F A;  3SZ2 A;  3D2Q A;  1QQ5 A;  1NJZ A;  2K8B B;  1KN5 A;  5IIM A;  3TAR A;  2FMS A;  3PV8 A;  2HBM A;  2P6R A;  2QB0 B;  4DFD A;  4UB1 A;  5F3X B;  2KV2 A;  1BPZ A;  3NUQ A;  5AHX A;  4O3R A;  1MQ2 A;  3SV3 A;  4O3N A;  4Q8F A;  3M6K A;  7ICK A;  1JN3 A;  1UPH A;  1X9M A;  4IC9 A;  4P4P A;  8ICR A;  1LB2 B;  2DFL A;  4A8E A;  5EWG A;  4NLZ A;  5DGA A;  2UVW A;  5G5H A;  5L1K A;  1RQL A;  8ICN A;  2ZIW A;  5KG5 A;  1Z00 A;  2A19 A;  4FE3 A;  4R66 A;  2W8K A;  4JV1 A;  4C4R A;  1S76 D;  4ECR A;  9ICT A;  2HHX A;  5C0Y A;  3EWA A;  3NRZ A;  1XS9 D;  3HT3 A;  4RU9 A;  1X40 A;  2HDO A;  4RQ0 A;  1KRP A;  2YY6 A;  4I29 A;  3RB3 A;  5BOL A;  1CRX A;  5IIK A;  4B6J A;  1JAL A;  4GXK A;  2E8O A;  1JRO A;  4DOC A;  2DF4 B;  3Q8S B;  3PML A;  4DS5 A;  4O5E A;  2I1Q A;  3R9K A;  1JI7 A;  3AMZ A;  1OXJ A;  3T3F A;  2JRZ A;  3TFR A;  2HHW A;  2GO7 A;  4YP3 A;  2F1I A;  1Z19 A;  3T79 A;  1RG6 A;  2K89 A;  1V85 A;  2A1A A;  5ALJ A;  3CP8 A;  2ZIV A;  4KLG A;  2HOF A;  1QLN A;  3D2S A;  1NJY A;  3THV A;  4JV0 A;  5L9X A;  5CEH A;  2KTQ A;  2KIV A;  3RRH A;  4NM1 A;  3QEA Z;  4BDP A;  2AGQ A;  1JRP A;  2AU0 A;  2AGO A;  2C22 A;  4F2R A;  3RAX A;  1S0O A;  4LJX A;  4I2G A;  4QZB A;  2F44 A;  3LK9 A;  5DG8 A;  3Q8Q B;  2HOQ A;  5J29 A;  1RQN A;  1SGG A;  5KFQ A;  2KHV A;  1SKS A;  1IXR A;  4CDG A;  4Y2P A;  3BS7 A;  3DDH A;  1RXW A;  2HHS A;  3MFI A;  5ALS A;  3QEB Z;  8ICX A;  3QU2 A;  2EAM A;  2Y9T A;  5HHH A;  1J97 A;  2RDI A;  1NK7 A;  1KDH A;  1KFS A;  2NRX A;  2IHM A;  2HVI A;  4O3P A;  2KP7 A;  4ECY A;  3B0X A;  8ICI A;  4RQ7 A;  3RJG A;  4MFF A;  5ALU A;  3BQ1 A;  2ISO A;  4ECW A;  3Q8L A;  2HBL A;  1MC8 A;  5AIA A;  5ALX A;  4AYB F;  5KFJ A;  1S10 A;  2PMZ C;  3SEI A;  4US8 A;  3CNH A;  1UT8 A;  3I1Y A;  1BVS A;  2E1F A;  2ES6 A;  1KTQ A;  1L7P A;  1P7D A;  1SKR A;  2YB1 A;  3MR3 A;  4YVZ A;  2BPF A;  2OYY A;  1QTM A;  4QWD A;  1OW5 A;  1Z1V A;  1UA0 A;  2VKQ A;  4UB6 U;  3PMN A;  2LYB A;  4OJ6 A;  4F5O A;  2H3Q A;  2F1H A;  2JEI A;  3BQ0 A;  3PX4 A;  2AQ0 A;  3ZDD A;  5KG2 A;  4RQ6 A;  3V6K A;  4BWJ A;  3RB4 A;  3Q8R B;  4O5K A;  9ICI A;  2FLN A;  4PGQ A;  5AKY A;  4JK1 A;  1T3Q A;  3QU9 A;  3F2C A;  1UA1 A;  3M9M B;  2NRZ A;  4UAZ A;  2ZXI A;  4NJ8 A;  3AUO A;  1N2X A;  4XUS A;  2F76 X;  1JXL A;  3OPX A;  5KFF A;  2Y1J A;  3WKE A;  1TKD A;  4O0I A;  5EE1 A;  5HP4 A;  1SWW A;  5KFB A;  5C5J A;  5EE3 A;  1YZ6 A;  9ICU A;  3MFH A;  5KG0 A;  1RXV A;  1ZQF A;  3BQ7 A;  4C8K A;  5DGB A;  1IIP A;  4XRH A;  2Z7J A;  3F53 A;  4RQ3 A;  4I2J A;  2AGP A;  2V4R A;  2BPC A;  2GWS A;  3ZDA A;  1RYR A;  2JEG A;  1LVH A;  4YQW A;  5ALO A;  5AKL A;  4K4I A;  4I27 A;  3WK4 A;  5KFZ A;  3QU4 A;  7ICS A;  3C21 A;  3D2N A;  3PO4 A;  5DB8 A;  3IV6 A;  2AQ4 A;  3SAF A;  9ICB A;  1SXE A;  4KMO B;  3H0R B;  4ELU A;  4UB2 A;  4O9M A;  4RQ5 A;  8ICT A;  2Y1I A;  5CA7 A;  1XWL A;  3BJY A;  4BX9 C;  3BZC A;  2YQE A;  3KKA A;  5AIB A;  4EYI B;  2KJ8 A;  4OJP A;  3C1Y A;  2FPK A;  8ICJ A;  1TV9 A;  2KNJ A;  1KL9 A;  4JWM A;  5CHG A;  2HW3 A;  2N1R A;  2PKE A;  1QSS A;  2W11 A;  2XY6 A;  8ICM A;  1Q3U A;  3ETR A;  3PO5 A;  4Z6E A;  4QZA A;  3M7D A;  3UXO A;  2HBJ A;  1SXD A;  5ALL A;  2K8C B;  8ICZ A;  3JPQ A;  3WK8 A;  9ICX A;  2F1J A;  5EE9 A;  4QWE A;  1SZH A;  2PFQ A;  1N48 A;  3RH4 A;  4RZR A;  1ZD2 P;  3BQT A;  2MUT A;  1ZQT A;  3HWT A;  4OJO A;  3PR4 A;  2KFN A;  4P0Q A;  5AI6 A;  1A0P A;  2A1J B;  3SI8 A;  4TUP A;  4I2C A;  4M9G A;  4PZN A;  2LM1 A;  3TFS A;  3HJE A;  2OEH A;  3HRD D;  2OCE A;  2W9B A;  1RDF A;  4BGD A;  4DFM A;  4RT2 A;  2KHQ A;  1WWU A;  2DGZ A;  3LWM A;  4F5P A;  1U9L A;  2IOH A;  5BOM A;  2CPR A;  4YR3 A;  3KBB A;  2D3D A;  2LMR A;  2E8M A;  1N5X A;  1DXS A;  3AN1 A;  3I76 A;  4BXO B;  3EPG A;  3RJE A;  2WF9 A;  4I2I A;  4DLG A;  1JXE A;  1K1Q A;  4PPX A;  2R8J A;  4P0Q B;  1MA7 A;  4Y2T A;  5D46 A;  3M1Y A;  5J2K A;  2H3F A;  4ED7 A;  3GV8 B;  2W9B B;  2JH7 A;  4O5C A;  1VLB A;  4EEN A;  4R8U B;  2D8C A;  2QAR A;  1S8O A;  2EZZ A;  4RUA A;  1B43 A;  4UBC A;  1Y88 A;  2E3T A;  7ICR A;  3NTU A;  2ASL A;  4Y2U A;  3I28 A;  1D8L A;  4QZG A;  3OHB A;  2AJQ A;  3GQC A;  3HW8 A;  2BCU A;  4PL1 A;  3KZI U;  3M8R A;  2K8A A;  5HHI A;  4QW9 A;  3FAH A;  4PHP A;  3TAN A;  4KX5 A;  2FLP A;  3ZDB A;  4K4G A;  1PVQ A;  4EEL A;  1ZD5 A;  8ICS A;  4J9S A;  2XC9 A;  3H0L B;  5J2E A;  4NLK A;  4F4W A;  5AI8 A;  2YML A;  4ICA A;  4DQQ A;  2JEF A;  2ZIU A;  4JB3 A;  3UM9 A;  2C2R A;  4XQ8 A;  2QKQ A;  2WAQ F;  3RJI A;  7ICG A;  2DUY A;  3TQ1 A;  3E0F A;  1S97 A;  3NAS A;  2G5H B;  3NVZ A;  2DPJ A;  3RRG A;  1DK2 A;  2KFZ A;  5EWF A;  4NLN A;  5F9N A;  2V4Q A;  5DKW A;  2AXT U;  3NGD A;  2EAO A;  4IS7 A;  3LVV A;  2KVC A;  9ICQ A;  2RQ5 A;  4C4T A;  1NK0 A;  4F72 A;  5DQH A;  1S77 D;  2HHV A;  2BHN A;  4AYB C;  1ZQV A;  2LYA A;  5AKZ A;  4QZC A;  4RQ4 A;  2W9C A;  8ICO A;  1L3S A;  3V6J A;  1A76 A;  1SZP A;  1BPD A;  2FPM A;  1ZQK A;  3H8M A;  2ALZ A;  5KFE A;  3RF9 A;  5J2C A;  4Q44 A;  4ECV A;  2RHF A;  5ALF A;  3WK5 A;  3M8S A;  1K5O A;  1X9X A;  4M2Y A;  5KT2 A;  3PSF A;  1URJ A;  1OUQ A;  4NLB A;  4JMU A;  5D49 A;  5J2D A;  5DQG A;  3UQ0 A;  1YZ7 A;  2BR0 A;  1TFR A;  3IN5 A;  2J6U A;  1D9D A;  4EBC A;  4I2E A;  4Y2Q A;  2LYH A;  2KZZ A;  4KN4 A;  3ETL A;  4QWC A;  2FLL A;  5KT7 A;  7ICU A;  1L5U A;  4DL7 A;  4G9B A;  1QCK A;  4PL2 A;  4KLI A;  3UPQ A;  2ZUC A;  4UAW A;  4Y2J A;  2G08 A;  3GV7 B;  1NK9 A;  4P0P A;  3HP6 A;  2BDU A;  2P66 A;  2W9A A;  4MEX A;  4F4K A;  2XGQ A;  4F5R A;  1FFV A;  5KFG A;  4RPY A;  3H8J A;  3FC4 A;  2E1E A;  1O03 A;  1L3V A;  5J2B A;  4RUC A;  2HMX A;  2XID A;  1V9P A;  2ESE A;  1ZQA A;  2Q4T A;  1FO4 A;  3EW9 A;  3IHQ B;  1QH9 A;  3H8W A;  3KKA C;  9ICA A;  1MN8 A;  4MFC A;  7ICJ A;  3BS5 B;  5D4B A;  3K4G A;  2BKE A;  4YMN A;  3GII A;  3IDW A;  5AK3 A;  4F4X A;  4BWM A;  2W9M A;  1DGS A;  7ICH A;  4KLM A;  2PFN A;  3MGV A;  2KK0 A;  4ECS A;  4UAR A;  2R8K A;  2W3R A;  1LKY A;  4P0P B;  4NWI A;  2XCP A;  3M6Z A;  1Z1B A;  2JH1 A;  4RQ2 A;  1TK5 A;  4MF2 A;  1VDV A;  3JPR A;  1F44 A;  8ICL A;  4IR1 A;  4TQR A;  5DB9 A;  1IG6 A;  5TZV A;  3GFK B;  3MGI A;  2KG5 A;  2ZTE A;  2WF5 A;  3JPP A;  2ZIW B;  7ICI A;  2HBK A;  1Z00 B;  1EXN A;  3H8S A;  3JPO A;  1XSN A;  4NLC A;  4RPX A;  2WHE A;  3QYP A;  3SAG A;  4YG2 A;  2BGW A;  3ZD9 A;  5L1J A;  4O3S A;  1ED1 A;  1BGX T;  4IRK A;  1XU4 A;  5KFD A;  2OH2 A;  4ZOH C;  3FDS A;  2W54 A;  4C7Y A;  5KFX A;  3GIK A;  2FDR A;  4GLX A;  3UXP A;  3ZDE A;  1ZQE A;  2PI4 A;  3C28 A;  2ZJA A;  3RJH A;  2HVH A;  2NRV A;  2PFO A;  5ALR A;  1ZQH A;  3Q8P B;  4IQV A;  3RR7 A;  3RFA A;  5KFC A;  4UB8 U;  4UB5 A;  4I2B A;  4PHE A;  3N97 B;  2ZUB A;  1Z3E B;  1WG8 A;  4YFK A;  4M9H A;  4EEK A;  4KTQ A;  2KSO A;  5KFR A;  5CJ7 A;  3NVY A;  4PH5 A;  3EPI A;  2ZIV B;  4F93 B;  2KKP A;  2W7O A;  8ICW A;  4M9J A;  5B5E U;  2BCQ A;  4BJQ A;  4DQP A;  2VJ5 A;  3JPN A;  1NKE A;  3C1Z A;  3SYZ A;  1NZP A;  3UMC A;  1J2N A;  5KFA A;  2K4P A;  9ICE A;  3BDP A;  2ZIX A;  3FM9 A;  2Y0S F;  5F9L A;  2NO5 A;  2R8I A;  1FIQ A;  1IM4 A;  5J0O A;  8ICU A;  2BCR A;  5KFM A;  3QU7 A;  2KSO B;  3QXG A;  1DK3 A;  2QB1 A;  3WK7 A;  3K75 D;  2WF7 A;  4UBB A;  4RQM A;  4C8N A;  2KMD A;  1SKW A;  3F2B A;  4EBE A;  1X6J A;  4KX3 A;  2VA3 A;  5K4L A;  2NO4 A;  4ED8 A;  3ZDC A;  5CR0 A;  4QWB A;  1HIW A;  8ICY A;  5KTQ A;  1JUD A;  4DL3 A;  2YB4 A;  5DB6 A;  4EX7 A;  1PUZ A;  4ED3 A;  3QUB A;  2ZIX B;  2P35 A;  3IG5 A;  3EUB 2;  4ECT A;  2G06 A;  3QU5 A;  8ICB A;  4QZ9 A;  1L7O A;  2ISP A;  1RZT A;  1SL0 A;  3N7R C;  4JV2 A;  2BQU A;  1T94 A;  2F8K A;  5KG4 A;  5ALP A;  3QZ7 A;  4JUZ A;  1KEJ A;  1WWV A;  3VCB A;  9ICW A;  4HYK A;  5KFS A;  3AEV A;  2B21 A;  2BZF A;  7ICE A;  1XO1 A;  4ED1 A;  1YT3 A;  2FPL A;  2WAQ C;  4FBU A;  2K4I A;  4C0Z A;  4DQS A;  7ICM A;  4KLD A;  1KFT A;  4Y2S A;  3PR5 B;  1CI4 A;  5AI4 A;  2C2E A;  1Q3V A;  2CRX A;  1L8L A;  4KMU A;  3N7S C;  1TAU A;  4NL9 A;  2FMP A;  2RLT A;  3T5K A;  4QIW F;  3MR2 A;  2JHD A;  2DL0 A;  5ALW A;  4KLQ A;  5AI5 A;  1NKC A;  3GIJ A;  8ICP A;  4B9M A;  1LV5 A;  4RNN A;  2EZX A;  5J0Q A;  2YX8 A;  2PI5 A;  3WU2 U;  4M04 A;  1U47 A;  1S5L U;  2ATL A;  3PW7 A;  4CCH A;  4X5V A;  5AM0 A;  8ICA A;  3KHG A;  3PX6 A;  4DL2 A;  5JTI A;  5DDY A;  4FFD A;  1QQ6 A;  4OJ5 A;  4J9O A;  5ALD A;  2I9G A;  3SD7 A;  3SR6 A;  3GDX A;  3IM1 A;  1ZD4 A;  5III A;  4ED0 A;  2IOF A;  2XCA A;  3ZI4 A;  3K1Z A;  4C4S A;  2W43 A;  3CYM A;  2NRT A;  1Z4N A;  3E58 A;  2ZG6 A;  5ALQ A;  4RNO A;  3SEN A;  3KHL A;  4P4M A;  2R8G A;  2VJ4 A;  4QZD A;  1WYG A;  3HPO A;  3TAD A;  1PVP A;  1S0N A;  4QZE A;  2ZTC A;  4BUG A;  5E79 U;  4F4Z A;  3V72 A;  5KFO A;  2KIC A;  3J81 j;  4KLJ A;  4UW9 A;  3M9N B;  1JIH A;  4DF4 A;  3Q8K A;  3F5E A;  2AHO B;  2WTF A;  3KHR A;  2F8L A;  9ICF A;  5EWE A;  4F5N A;  2L5Y A;  3IP4 B;  2F77 X;  1J2M A;  1T4G A;  3QUT A;  2XIC A;  2YN4 A;  2R18 A;  2LHT A;  1ZQJ A;  2LPE A;  3QX7 A;  2B6G A;  2BDP A;  3K1R B;  4GIB A;  3OSN A;  2H5X A;  5AM2 A;  1NK8 A;  4IRC A;  3CW2 C;  2VA2 A;  4FZL A;  1NI3 A;  2LI6 A;  4F3O A;  3PW2 A;  5IIL A;  5GTI U;  4KLH A;  4MF8 A;  3DEE A;  2K60 A;  3PVX A;  4B9V A;  3VC8 A;  4GXJ A;  2E8N A;  4DOA A;  1ZQ1 C;  2OHF A;  5EE0 A;  4F71 A;  4M6W A;  4CF5 A;  5GTH U;  1ZQN A;  3NS1 A;  4TUR A;  2MUT B;  1ZQS A;  1H38 A;  3PW4 A;  5BPC A;  1XC9 A;  3QNM A;  3WK6 A;  1SWV A;  5AKK A;  1JX4 A;  2EH9 A;  3RTV A;  2JZB A;  2ZJ5 A;  5L1M A;  2RP5 A;  5JU5 A;  7ICF A;  4YXM A;  2XY7 A;  3H40 A;  1ZJM A;  3M9O B;  4DCC A;  3AM9 A;  4UAY A;  2KJ5 A;  8ICQ A;  4M0A A;  1PK1 A;  1TK0 A;  1T8E A;  1A6S A;  2H3I A;  2BCS A;  4ED2 A;  3OSP A;  1XSL A;  1KSP A;  4F5Q A;  1ZQR A;  2OM6 A;  4FO6 A;  2KN7 A;  1WUD A;  1X66 A;  1MSW D;  1C20 A;  3QUQ A;  1L6N A;  1NNL A;  3MDC A;  3T5J A;  5ALM A;  1N63 A;  3HKZ F;  1ZQO A;  4TUS A;  5HML A;  1TE2 A;  4C7Z A;  1SIJ A;  1ZD3 A;  4FZM A;  1DRG A;  1BNO A;  4GFJ A;  4J9M A;  4YCX A;  5L1L A;  5JRT A;  3PZP A;  3WK9 A;  5KFW A;  1HEK A;  4DFK A;  2C28 A;  4KLE A;  2A3V A;  2YTU A;  3PY8 A;  3LYS A;  3N4M B;  1ZOL A;  3RH5 A;  3NVW A;  1A77 A;  5J0P A;  3G6X A;  4F50 A;  4KLT A;  5AK5 A;  4CGZ A;  2OXO A;  1DOQ A;  4OD0 A;  5CB1 A;  4Y2V A;  2QAR B;  4OCZ A;  3RAQ A;  2W03 A;  5KT3 A;  5FP0 A;  3OGU A;  3BZK A;  5KL8 B;  4NXZ A;  5JUM A;  3ONN A;  3EZ5 A;  3RBE A;  3TAC B;  5TIS U;  8ICV A;  4ECZ A;  1PK3 A;  3G6V A;  7ICT A;  3SV4 A;  3DV9 A;  1T7P A;  9ICS A;  2YMQ A;  4U6P A;  3C2M A;  5AKE A;  4J03 A;  5DBA A;  3L4P A;  4B9N A;  3G6Y A;  3UMG A;  4EEY A;  2UVV A;  2Y0S C;  5DBB A;  2K4E A;  8ICC A;  1KQQ A;  1ZQU A;  3S6J A;  5J2G A;  3RJJ A;  2KD1 A;  2ZIU B;  4LZD A;  5KFK A;  4TUQ A;  5HR6 A;  4QZF A;  5ALH A;  2MA1 A;  3AQF A;  7ICO A;  1ZQM A;  4U7C A;  2IOF K;  4RQN A;  3NRW A;  1UQV A;  2EAP A;  2ODG A;  5IIJ A;  5J8Y A;  3OTQ A;  2W8L A;  4ELT A;  1L7M A;  1KKX A;  2QB0 A;  4PZO A;  4OJL A;  2C2D A;  5KFH A;  2VAN A;  4PGX A;  4GC6 A;  1NJW A;  5G5G A;  7ICN A;  4RPZ A;  4F4Y A;  4CF3 A;  3EYZ A;  5L1I A;  1WCN A;  2W9C B;  1B0X A;  3MR6 A;  4I2D A;  2MSN A;  4IQW A;  1IV8 A;  4HAI A;  4GXI A;  4F92 B;  1O08 A;  3RJK A;  3QUC A;  4NL9 C;  3T5L A;  8ICE A;  4PGY A;  4M9L A;  2H3V A;  2DKZ A;  7ICL A;  1CEZ A;  3UMB A;  1UCV A;  4DFP A;  3WKD A;  2EZY A;  2F2A B;  1SL2 A;  3H4D A;  3ORY A;  1CUK A;  1T3N A;  1QSY A;  3IRU A;  3PNC A;  5J0Y A;  2V9W A;  3H7I A;  7ICV A;  1WCL A;  4USA A;  2K4H A;  1ZQP A;  3NVV A;  5DBC A;  1L3T A;  2GLE A;  2XO7 A;  2XI9 A;  4QIW C;  1RYU A;  1ZQQ A;  2IHN A;  1PVR A;  4LVS A;  1ZYQ A;  5DLF A;  2XVT A;  4J9K A;  4P4O A;  4DOB A;  4NV0 A;  4FZN A;  1N62 A;  1NOM A;  3TAD C;  3RBD A;  4DL5 A;  4DEZ A;  1SB3 C;  5AKJ A;  1FFU A;  3JPT A;  1ZRM A;  2MAX A;  2HHT A;  3FYH A;  2LM4 A;  3F2D A;  4DO9 A;  3C5G A;  5J2J A;  2HOI A;  4E0D A;  2BQR A;  2NYV A;  2YMP A;  1B4F A;  1F5S A;  1X9S A;  2JMG A;  5CRX A;  4FS1 A;  4IR9 A;  5DG9 A;  1V97 A;  2M9N A;  3PSP A;  4FBT A;  4DFJ A;  1NJX A;  4B9U A;  4EYH B;  2LKY A;  2ASJ A;  5ALE A;  1NK5 A;  3H0M B;  5KT6 A;  5DDM A;  2BCV A;  1LKY B;  5HNK A;  3C5F A;  1ZRN A;  5KNI A;  2ASD A;  4CNQ A;  4KLU A;  4UAS A;  4QNL A;  4DSE A;  4ED6 A;  3PX0 A;  4FS2 A;  3ICX A;  1ZQX A;  3C2K A;  2F3N A;  5DB7 A;  1D8B A;  3BQ2 A;  2W04 A;  2KVS A;  2WB1 F;  4Y2X A;  1BPX A;  4PJ0 U;  1X6I A;  1HUZ A;  2WF6 A;  2G0A A;  4O3M A;  4LZG A;  1BPY A;  4CRX A;  4DL6 A;  3QE9 Y;  5J2A A;  5KFT A;  3C2L A;  3GU3 A;  4OO1 J;  1Z4O A;  2DPI A;  1XNS A;  1UHU A;  3V7K A;  4UB4 A;  5H2F U;  3T5H A;  2KOB A;  2IMW P;  3RB0 A;  4Z6D A;  4I28 A;  1ZQI A;  1HJP A;  2BQ3 A;  3WKA A;  4I2A A;  3GIM A;  4F2S A;  2JR5 A;  1V38 A;  3LWL A;  1KW4 A;  4C80 A;  4GC7 A;  4EX6 A;  4QZH A;  1ZQZ A;  2IBK A;  1BPB A;  1U45 A;  1ZQB A;  1N60 A;  1Q8K A;  3F5A A;  2FJ6 A;  2RRD A;  2DBY A;  4KLL A;  3A0H U;  5A0L A;  4C8L A;  3IG8 A;  3TAQ A;  4RQ1 A;  4R64 A;  3E2E A;  1X2I A;  1N5W A;  9ICR A;  3KFU F;  2ZTD A;  4QWA A;  1UT5 A;  1QQ7 A;  4YR0 A;  3MGH A;  2KEY A;  2MU2 A;  3HKZ C;  4Q43 A;  2G09 A;  4NLG A;  2WFA A;  4DSI A;  4UAT A;  1AQ6 A;  5KAF U;  4DLE A;  1NZB A;  3HX0 A;  5J2H A;  2G07 A;  2XY5 A;  4Q45 A;  1NK6 A;  3D6J A;  1D8Y A;  3MAB A;  4YD2 A;  2B0C A;  2EQY A;  5ALI A;  1JMS A;  3MBY A;  4DSJ A;  4EZ6 A;  5AI0 A;  3H4B A;  2IA6 A;  2HI0 A;  2PXI A;  4RNM A;  5KAI U;  5KFP A;  4KLO A;  2CXY A;  1XSP A;  2JEJ A;  5CP2 A;  5J0T A;  4R63 A;  4B9T A;  5KG7 A;  2J6S A;  1L8O A;  4YXJ A;  2Y9U A;  4I2H A;  3QZ8 A;  4YMM A;  1SV0 A;  4QZI A;  4UAV A;  3CRX A;  2MRL A;  5AK6 A;  4J9P A;  3MC1 A;  4NY8 A;  1U48 A;  3AU2 A;  1TAM A;  3TKA A;  5J8Y C;  5KL1 B;  2W3S A;  1XO0 A;  2FE9 A;  9ICK A;  1BNP A;  3KOO A;  5ALZ A;  4NM2 A;  3U26 A;  1ZQD A;  3GV5 B;  2JGA A;  3UXN A;  4UQG A;  4RQ8 A;  4DQI A;  4CF4 A;  2DWQ A;  2DKX A;  1ZQY A;  7ICQ A;  1PZN A;  3L3F X;  9ICV A;  5ALT A;  4ECX A;  1U49 A;  3ALR A;  4O3O A;  8ICH A;  3B9J A;  1S9F A;  4K4H A;  5AKX A;  4B9L A;  3O0F A;  3WKC A;  3V7J A;  3V7L A;  2FI1 A;  3ISC A;  5HMM A;  5AKG A;  2VA8 A;  5ALK A;  2KZ3 A;  2GH1 A;  3PST A;  8ICK A;  9ICH A;  3KD3 A;  2RDJ A;  1X42 A;  4DSK A;  2E8P A;  2A1J A;  2DQN B;  2ZJ8 A;  4ECU A;  3GZF A;  4AP9 A;  5DG7 A;  4F8R A;  9ICJ A;  4F91 B;  4UB3 A;  3PW0 A;  3SMV A;  3MDA A;  4DL4 A;  9ICM A;  1FEZ A;  4IL6 U;  4J9Q A;  4P2H A;  4ZH4 A;  3N28 A;  2XGP A;  3PSI A;  4US9 A;  1VJ5 A;  2FMQ A;  3SQI A;  1L7N A;  1D9F A;  2M0N A;  4R65 A;  4BXO A;  2UVR A;  9ICC A;  2AH5 A;  3HIL A;  3KZX A;  4YD1 A;  4JWN A;  4EZ9 A;  5AKH A;  2KKV A;  5AM1 A;  4Z6C A;  4J9R A;  3ISD A;  5KFL A;  5J0R A;  3SAH A;  1NKB A;  4PHA A;  1N56 A;  2W55 A;  5DQI A;  5J2I A;  3RR8 A;  2PFP A;  5CWR A;  4QZ8 A;  5J0W A;  4DSL A;  4R8U A;  1S0M A;  2NRW A;  5DLG A;  1C7Y A;  5AIC A;  5T14 A;  4KLS A;  1COO A;  5KG1 A;  4I2F A;  1ZJN A;  1L3U A;  1ZQW A;  3C29 A;  2ZUD A;  5AK4 A;  5AM3 A;  1RM6 C;  8ICG A;  5J0X A;  3RJF A;  4IQU A;  4G3I A;  3PW5 A;  2PMZ F;  4IRD A;  5KFV A;  3RB6 A;  1KLN A;  2WF8 A;  1DGJ A;  1X9W A;  3N7P D;  1Q46 A;  4Y2R A;  1ZQG A;  3JPS A;  5J2F A;  3RH6 A;  4QJF B;  1BPE A;  4M6W B;  3AL0 B;  5ALN A;  2HSZ A;  1HUO A;  3V6H A;  2JV3 A;  3OJS A;  1K1S A;  2OWO A;  2HHQ A;  2J6T A;  5KFU A;  5B66 U;  2CN1 A;  3ZD8 A;  2KJ9 A;  9ICN A;  2I5H A;  9ICG A;  4KIT B;  3AQE A;  1KFD A;  2LBO A;  4Q8E A;  4DF8 A;  5AM5 A;  2JZB B;  2O6K A;  2WB1 C;  2P6U A;  9ICO A;  5EOZ A;  4DWI A;  4B9S A;  2NV3 A;  2G5I B;  4TQS A;  2GOL A;  3MR5 A;  2VIX A;  1PK1 B;  5AI9 A;  5IIO A;  1F0M A;  3B0Y A;  5KG6 A;  5ALY A;  1M6Y A;  1GO3 F;  4UAU A;  3ISB A;  2H3Z A;  4DQR A;  4C8M A;  2R8H A;  2EAN A;  1RPL A;  5IIN A;  9ICP A;  4WJ3 B;  2BPG A;  4DSF A;  1N61 A;  3GIL A;  3OJU A;  2ZXH A;  1U4B A;  4PHD A;  2UVU A;  4J9N A;  4MEY A;  3TAP A;  3L5K A;  3C23 A;  2EDU A;  1MQ3 A;  5AKI A;  3WKB A;  4YN4 A;  1TAQ A;  7ICP A;  5AM4 A;  4ECQ A;  4M47 A;  5ALG A;  3AU6 A;  5KFY A;  4MHV A;  1TK8 A;  4C8O A;  5KFN A;  4KN7 A;  2KE7 A;  3KHH A;  3Q8M A;  4IQT A;  2JXJ A;  1COK A;  2QLT A;  4EBD A;  1SL1 A;  4J9L A;  5KFI A;  5KG3 A; 
#chains in the Genus database with same CATH homology
 2ESE A;  2YTU A;  1LKY B;  4NL9 C;  2L5Y A;  1WWU A;  3KKA C;  5KNI A;  2DKZ A;  3BS5 B;  2E8O A;  1UCV A;  2KSO A;  2LPE A;  2B6G A;  2D3D A;  2LMR A;  2E8M A;  2F3N A;  3K1R B;  3SEI A;  2E8P A;  2EAO A;  4IS7 A;  3IDW A;  2ES6 A;  1SXE A;  2JV3 A;  1DXS A;  2QAR B;  1JI7 A;  1OXJ A;  1OW5 A;  4NL9 A;  1SV0 C;  1Z1V A;  3KKA A;  1SV4 A;  1LKY A;  3TAC B;  2K60 A;  2DL0 A;  3H8M A;  2K4P A;  1PK3 A;  2GLE A;  3BS5 A;  2E8N A;  1RG6 A;  1V85 A;  1PK1 B;  1X9X A;  1F0M A;  2Y9U A;  2D8C A;  2KG5 A;  2QAR A;  1SV0 A;  1V38 A;  5JTI A;  1KW4 A;  2KIV A;  3HIL A;  2QB0 B;  2KSO B;  2EAN A;  2QB1 A;  1SXD A;  5L1M A;  5F3X B;  5JU5 A;  3TAD C;  5J8Y C;  4RQM A;  4NJ8 A;  2KMD A;  2FE9 A;  2F44 A;  1PK1 A;  3SEN A;  1SGG A;  4RQN A;  1UQV A;  2EAP A;  1X66 A;  2DKX A;  3BS7 A;  4MHV A;  3TAD A;  1B4F A;  5J8Y A;  3BQ7 A;  2QB0 A;  4PZO A;  2EAM A;  2Y9T A;  2KE7 A;  4PZN A;  1COK A;  2F8K A;  1X40 A;  5JRT A;  2QKQ A;  1B0X A;  1WWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...