5J8YC

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
MPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
molecule keywords Polycomb protein Scm
total genus 23
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yC00
1F0MA 1V85A 2D3DA 3BS5B 2E8PA 5JTIA 1B0XA 4IS7A 4NL9A 1UCVA 2E8OA 3BS7A 2LMRA 2EAMA 5JRTA 3TADA 2QB0A 3HILA 1OW5A 2K4PA 3TACB 2E8NA 2QARA 1OXJA 2FE9A 5F3XB 2KSOB 1COKA 2QB1A 1Z1VA 1PK3A 1SV0A 1SV4A 1WWUA 2KIVA 3TADC 1SV0C 2DL0A 2ES6A 2F3NA 2YTUA 1UQVA 1B4FA 5L1MA 1PK1A 3BS5A 2L5YA 4PZOA 1X40A 5J8YC 2LPEA 2QKQA 3SENA 2KG5A 1X66A 2DKXA 2F8KA 1PK1B 2JV3A 1SXDA 1KW4A 1V38A 2Y9TA 3K1RB 2DKZA 3KKAA 2KMDA 2B6GA 3SEIA 1X9XA 2EAOA 2ESEA 2GLEA 4NL9C 1JI7A 3IDWA 4PZNA 1RG6A 5J8YA 2EANA 1SXEA 2KE7A 1SGGA 1DXSA 2Y9UA 2F44A 5KNIA 3H8MA 1WWVA 2QARB 4RQNA 1LKYB 2E8MA 3KKAC 2KSOA 4NJ8A 3BQ7A 2EAPA 4MHVA 4RQMA 2D8CA 2K60A 1LKYA 2QB0B 5JU5A
chains in the Genus database with same CATH superfamily
1TK5A 1V85A 3K75D 4YCXA 5CA7A 4RQ5A 1RPLA 1X9SA 1NK9A 2BCRA 4AYBF 4M2YA 3H4DA 3TANA 1NJZA 1KLNA 1S0MA 4KLJA 2K89A 1NKEA 4M0AA 2G09A 4ED1A 1OW5A 4K4HA 5KFRA 2ZIVA 4J9MA 5KFQA 4Z6EA 2BQUA 2KNJA 3A0BU 3GIJA 3N4MB 1KSPA 1A77A 2FE9A 3G6XA 1S76D 1N5XA 5KT4A 8ICUA 5KG2A 4QZHA 3T3FA 4A8EA 3RH4A 1NK7A 2DL0A 4J9SA 3OTQA 5L1MA 2H3QA 3F53A 2R8HA 2PMZF 2P6RA 2LPEA 4QZAA 2W55A 5DB6A 4I2FA 3OGUA 1WYGA 5BPCA 4QJFB 4OJLA 4JWMA 5IILA 9ICHA 4F5PA 4YVZA 2AQ4A 2V4QA 3N7RC 1KKXA 1N62A 3SEIA 4WJ3B 5AKEA 8ICGA 4ELTA 4XQ8A 9ICUA 3AL0B 3Q8PB 2ZTCA 4CF4A 2GLEA 5CHGA 4BX9C 1RDFA 2XI9A 5ALPA 2G08A 4E0DA 1CUKA 4F71A 3JPPA 1LB2B 3PR5B 4I2BA 1TAQA 1F44A 1X9WA 3HX0A 3N97B 3NRWA 3QUTA 4DOAA 3LVWA 3HKZC 5ALOA 3WK5A 2BCUA 4C8LA 2QARB 3MFIA 1UHUA 5AKXA 4XUSA 4Q45A 9ICIA 2KSOA 1VDVA 4MHVA 8ICFA 1KL9A 1L3UA 3PR4A 2BPFA 2JXJA 5D49A 1JROA 2I1QA 4QZDA 2LM4A 3NASA 2KIWA 2AJQA 4YMNA 4Q8FA 5J2DA 2WAQC 3GV5B 5AI4A 3O0FA 1TFRA 4PL1A 3QZ7A 4M47A 1O08A 3N28A 1BPZA 3LWLA 4UAWA 2CRXA 4CF5A 5J0TA 2MSNA 4I28A 4JK1A 1NK5A 1Z00B 3BJYA 5KG1A 4ACOA 3RJHA 2PXIA 3UXOA 5DB8A 7ICPA 1D9FA 4JMUA 1ZRNA 7ICFA 3GV8B 3NTUA 2H3IA 3Q8RB 3BQ1A 2R8GA 3Q8SB 2UVRA 4Z6DA 4JV1A 1CEZA 2VJ4A 3MGIA 4RQ7A 2DKXA 4O3OA 2EZZA 3Q8QB 1TAMA 1DOQA 2Y9TA 1RXVA 5D4BA 3PSIA 4Y2QA 2OH2A 4NWIA 5KFXA 2PMZC 4UATA 3RJFA 4BXOB 5ALLA 4US8A 2LKYA 1N60A 2WHEA 2DPIA 4TQRA 4DFJA 5J8YA 3T5LA 2EANA 2KHQA 1FFVA 2ISOA 1T4GA 8ICZA 4KX3A 3H0MB 1WWVA 4UB6U 3QEBZ 4KLOA 2DQNB 2JH7A 4PJ0U 2OWOA 1J2NA 3JPQA 3NRZA 4B9SA 3GIKA 2G5HB 4GXJA 3NVWA 4QWDA 3PW7A 7ICVA 2KK0A 4O0IA 5J2AA 3TFRA 1JIHA 2EH9A 4J9OA 1RQLA 1SKSA 4RNNA 2WAQF 3H8JA 3HILA 4C4RA 4DL3A 1YZ7A 5J2IA 4DSKA 1L6NA 1SIJA 2K8BB 3N7SC 2XO7A 5AI5A 1Z00A 3RJEA 8ICIA 4RUCA 3HPOA 1NJWA 3H4BA 1N2XA 3ORYA 5J0OA 3C2KA 1U47A 1JMSA 1L3VA 3CYMA 7ICKA 3HKZF 5AKKA 3DDHA 2JZBA 8ICRA 2Z7JA 1A76A 2YTUA 1UQVA 2XIDA 5EOZA 2WF9A 4DOBA 2FLPA 4Y2TA 1ZXIA 9ICQA 4RZRA 9ICLA 2KV2A 4YD2A 1ZETA 1DK3A 3DEEA 4P4MA 1HEKA 2YX8A 2J6SA 3KZXA 4BXOA 4J9NA 3PX0A 4QZEA 1KFDA 2D6FC 1U9LA 3M9NB 2I6XA 2KE7A 3MGHA 4NV0A 5KFGA 3RR7A 4UB2A 4FBTA 2ZTDA 2VIXA 3SR6A 2DPJA 5KFNA 3UMCA 1LVHA 7ICEA 3BQ7A 1UT8A 5J2GA 3F2CA 1TKDA 3OSNA 4CCHA 2A1JA 4R65A 3Q8KA 5KT3A 9ICCA 5KFIA 3PMNA 3BS7A 3M8SA 4ED6A 3SV3A 1ZQFA 8ICPA 5DB9A 3MDCA 1ZQZA 4KN7A 3BQ2A 1ZQXA 4I27A 3RB3A 2KD1A 2HW3A 1ZD2P 4DSJA 4DL5A 5AI9A 4DFKA 3I1YA 2E3TA 4YXJA 1PK3A 3JPOA 4YG2A 1SV0A 3SYZA 4CE6A 4NLGA 5F9LA 5TISU 4UBBA 3V6HA 2C22A 3IN5A 2FPKA 1L3SA 2KKPA 3EUB2 4NLBA 3RFAA 4Z6CA 5DG9A 3GZFA 4NLKA 4Y2VA 1NOMA 2M0NA 2HI0A 2KMDA 1URJA 2VANA 5KFVA 1Z4OA 3RTVA 5BOMA 2BCQA 2AXTU 2I9GA 4O3PA 3M9OB 4YMOA 3D2SA 4EBDA 5HR6A 2YMQA 5ALNA 3LVVA 1T8EA 2JEJA 4UBCA 1Q3UA 3V6KA 1HIWA 1BPDA 1U48A 3RH6A 1MSWD 7ICGA 2HHSA 4EZ6A 4Y2UA 4NJ8A 1LV5A 3T5HA 1RM6C 5B66U 5KFTA 7ICOA 4BWJA 4UB5A 4YR2A 7ICMA 4ICAA 4MEXA 4I2AA 4BWMA 4MFCA 3F5AA 3BS5B 2KTQA 2E8OA 3GQCA 1QQ5A 4EENA 1BVSA 1KBUA 1ZQNA 1U45A 4RPXA 1PVQA 4M6WA 4F50A 5G5HA 2KJ8A 3UMBA 3MC1A 3AQFA 2K8CB 9ICTA 2KKVA 3WK8A 4M9HA 1KTQA 1NJXA 2DBYA 4RU9A 1SKWA 4LZDA 4M9JA 1Z19A 2MU2A 3FM9A 5DLGA 4QWCA 4EYHB 3L5KA 4YQWA 3T5KA 2XY5A 5CB1A 4IR1A 2ZIXA 2ISPA 1KQQA 8ICCA 1SV4A 4ED8A 2XY7A 2W04A 2F3NA 4PL2A 3EZ5A 5JUMA 2R8IA 3NGDA 1QSSA 4C4SA 2LBOA 4IR9A 5AM1A 2R8JA 2EZXA 9ICOA 2Y0SC 2GWSA 3C2LA 1KFTA 2EAOA 2KZ3A 3PSFA 3AN1A 5D46A 2RQ5A 5B5EU 4O3SA 4YFKA 3PW4A 2FI1A 1NJYA 5AIAA 3PW2A 3SV4A 1BGXT 4IQUA 1XO1A 5G5GA 2HBJA 2NRTA 4EELA 2HHQA 1J97A 4KLIA 4C7YA 4I2HA 4ECXA 3OJSA 2D8CA 3WU2U 4ED2A 2K60A 4Q8EA 5DG7A 4IL6U 2WF5A 4R8UB 4KX5A 2F1IA 4RQ0A 1PUZA 2WF7A 5KAIU 5JTIA 5K4LA 3BQ0A 2LYHA 2BGWA 3HW8A 5AKLA 2HOIA 3C2MA 1Z3EB 5AK4A 3A0HU 3MFHA 2C2RA 3BDPA 2AHOB 2K4PA 4J9RA 1SL1A 5AICA 4B9LA 3KD3A 5HHHA 1ZQVA 4P4PA 4F4YA 1ZQTA 5F3XB 9ICEA 4CNQA 4RPZA 2FLLA 4QNLA 4KLLA 2HBKA 3UMGA 4UAVA 3UQ0A 1K1SA 8ICVA 4XRHA 1ZQYA 7ICTA 1IIPA 5J2CA 2VA3A 3NVVA 3FC4A 5KFYA 5KFWA 2WF8A 2KG5A 5IIMA 1NZPA 1ZJNA 3SAFA 1A6SA 1ZQRA 4DCCA 4KTQA 4B6JA 1S0VA 3ICXA 3KKAA 2XGQA 4MEYA 2ZTEA 2Q0ZX 4ECYA 3LDAA 4DF8A 2AGQA 1GO3F 5CRXA 3OSPA 4F72A 1S9FA 2W3RA 5KT2A 1L8OA 3MGVA 3MR3A 9ICBA 2W54A 1MQ3A 1T94A 4UB4A 2R8KA 3PW0A 1L5UA 2RDIA 3IP4B 2E8MA 4CDGA 4DF4A 2K4IA 3RAQA 4KLSA 1MC8A 1NK4A 2E1FA 5KG7A 3PSTA 3TARA 2G07A 4DSLA 1QTMA 1JUDA 4QZ9A 2HDOA 2VJ5A 4GLXA 4I2IA 5FP0A 5J2HA 4RQ3A 2GOLA 4NY8A 4IS7A 1JXEA 1F5SA 4NM1A 1ZQUA 3PX4A 2H3VA 3RJKA 1IG6A 3ISDA 2W7PA 3RH5A 3C29A 1JX4A 4JWNA 4RT2A 3KHRA 1RXWA 1KFSA 3RRGA 1XO0A 3RJJA 2OYYA 1QCKA 3ZD9A 4PHPA 1U4BA 1SWWA 2FMPA 2W7OA 4F2RA 1SV0C 2Y1JA 7ICIA 4Y2YA 4DSEA 2MUTA 4MF8A 1C20A 2KFNA 3BS5A 4YD1A 2ZIXB 2BCVA 4IQWA 2R18A 3SENA 9ICKA 1PK1B 1K5OA 4C8KA 3TKAA 3OHBA 1FEZA 3GIIA 1QQ7A 2RP5A 4QZFA 1NI3A 1U49A 5BOLA 1XS9D 3PO5A 4PHDA 3IDWA 4B9MA 2IHNA 3QUQA 5KFOA 5AI6A 1SZHA 2JH1A 2Y9UA 5L9XA 3J81j 1N63A 4US9A 3KHGA 1PZNA 2CPRA 1Q46A 5KG4A 4O9MA 5KG6A 1A0PA 2HHUA 2ASDA 2W9BB 3ZI4A 4JUZA 5ALIA 2KN7A 4PHAA 3CW2C 2ZJ5A 5KFAA 4C8NA 4F5QA 5ALUA 1WG8A 1IM4A 5A0LA 1CRXA 3BQTA 4BGDA 3RB4A 4JV2A 2C28A 1T3NA 3H40A 5CJ7A 4UAZA 1WCLA 3B0XA 5EWGA 4RT3A 2WFAA 5HMMA 2KVSA 4DLGA 5KFCA 4OJPA 5HMLA 2Y0SF 4B9UA 5KFUA 3TQ1A 4P0PB 5EWEA 3M6ZA 5J0SA 1WUDA 2YB4A 3G6VA 1ZQSA 3GILA 4PH5A 4UQGA 2ZIUA 4OJ5A 3UQ2A 3IHQB 1P7DA 4F91B 3M8RA 4J9QA 1PVRA 5L1IA 5AKZA 4QZCA 2DWQA 2UVUA 2I5HA 1ZQAA 1ZQKA 2ZIVB 1IXRA 4ECQA 4LJXA 2HHVA 4LZGA 4TUQA 3NVZA 1B43A 2IBKA 3QU2A 5J0YA 4B9TA 4EX6A 4QWBA 1L3TA 4Z6FA 3D2NA 3PY8A 3BZCA 2ZJAA 4QW9A 2LYAA 4RQNA 1ZQJA 4DEZA 1WCNA 1NK8A 3ZDAA 4UAYA 3F5EA 2F8LA 3QEAZ 1Q3VA 3KTQA 2FMQA 3PW5A 1D9DA 3MDAA 4F4XA 2BCSA 1QSLA 1F0MA 2D3DA 3HJEA 2IOFK 1UPHA 2W43A 5TZVA 1JN3A 5IIIA 2E8PA 1M6YA 5AM3A 4FZNA 5ALRA 4DL6A 1TK0A 2HHWA 3WK4A 5J0WA 4YP3A 3V7LA 2MA1A 2QB0A 5ALGA 2G5IB 2FMSA 2E5SA 1S0OA 4F3OA 2P66A 5C0YA 2AGOA 1JALA 4IQTA 3TACB 2ZUDA 2QARA 8ICYA 3U26A 3F2BA 4RQ6A 2KSOB 2QB1A 2HBLA 1RYSA 4NM2A 3IV6A 4NXZA 2XVTA 4KITB 1HJPA 3AM9A 3N7PD 1MQ2A 3RAXA 3RBDA 4J9PA 1BPXA 2P6UA 2CN1A 3KHLA 4B9VA 2FDRA 1RQNA 1ZD3A 5ALEA 1ZQWA 3RB0A 1X2IA 3QXGA 3TAQA 4ECRA 2Y1IA 1XU4A 4DL7A 3AUOA 2JEFA 2H3FA 4M9NA 2RLTA 2BQRA 2UVWA 4DQSA 4UASA 2W9CB 3IG8A 3UPQA 3T5JA 2IMWP 2F44A 3C5GA 3GV7B 4ED7A 8ICXA 1RYUA 3RBEA 2KFZA 3V72A 1C7YA 2YQEA 4ECWA 3DV9A 8ICWA 4F5OA 3CP8A 7ICLA 4QWAA 3EW9A 1ZQLA 5IIKA 4DFDA 1ZOLA 3AMZA 1ZQIA 4QZIA 5IIJA 4Y2PA 5KT7A 8ICTA 5EE1A 5HHIA 4GIBA 3IM1A 3V6JA 3FYHA 1JXLA 2W9BA 7ICJA 2B21A 8ICAA 2LI6A 4EYIB 4C8MA 5ALYA 4X5VA 4EZ9A 4FO6A 4O5KA 4HYKA 2V4RA 5EWFA 3QNMA 3ZDEA 5AK3A 2F1HA 4DS5A 4MFFA 3WK9A 4GFJA 1S97A 4F4WA 3HWTA 3L4PA 2FJ6A 2QLTA 3C1YA 3JPRA 2F2AB 3V7JA 3QYPA 4O5CA 2Q4TA 2BPCA 2ES6A 4QIWF 3TI0A 2XCPA 2KEYA 5KTQA 4USAA 2ZIWA 4P4OA 1T7PA 4IRKA 3H7IA 1L7MA 3KHHA 2O6KA 1D8LA 4R64A 3GIMA 4ED0A 1QH9A 3MR2A 3QU5A 5AK5A 5AM0A 5KG0A 5AHXA 4RQ4A 4U7CA 2LYBA 4JV0A 2YMLA 2JZBB 2DKZA 2B6GA 2FLNA 3KBBA 5ALXA 1SZPA 8ICKA 4I2GA 2ESEA 4C0ZA 2BDPA 4PHEA 5KFPA 4P2HA 1ZJMA 1RG6A 1SB3C 1NKBA 4I2JA 3IRUA 2W9MA 3ED5A 4EBCA 1B22A 4DQRA 3F2DA 4EX7A 2G0AA 3ONNA 5J0QA 3OHAA 2IA6A 4ECVA 1XSNA 3FAHA 2NRXA 1X42A 3NVYA 2KVCA 2DGZA 3M9MB 4DSFA 2UVVA 3RJGA 5JU5A 5ALKA 4AP9A 3HRDD 4I2EA 1V97A 2JGAA 3BZKA 2H5XA 4QZGA 3QU9A 1NZBA 1BPEA 3G6YA 2VA2A 1XSPA 3Q8LA 8ICJA 4KLUA 1S5LU 5KFEA 2GH1A 4I2DA 4P0PA 3PNCA 1Y88A 3OPXA 2HMXA 4KLDA 2E8NA 1ZQCA 1YT3A 2ZIUB 4C80A 9ICNA 1DGSA 9ICSA 4G9BA 5CR0A 4FS1A 1Z1VA 4DS4A 2XICA 3B9JA 5ALWA 2EDUA 4IQVA 4O3QA 4UW9A 5DBCA 2KIVA 2AQ0A 2A3VA 3WKAA 1B4FA 2ZIWB 4LVSA 4F5RA 1X40A 1YZ6A 5AM2A 4BDPA 4YXMA 2F76X 4QZBA 4ED3A 5DQIA 4PGYA 4M9LA 1Z1BA 3KZIU 3MR6A 2K4HA 5KT5A 5J0RA 3CNHA 4FZMA 7ICRA 5KAFU 5DGBA 5ALQA 5T14A 3C28A 2ZUBA 4PZNA 4F5NA 4KLGA 1EXNA 3WK7A 2GO7A 2JHDA 3M6KA 2EQYA 1FO4A 4RPYA 4DFMA 4ECUA 3R9KA 1NK6A 1H38A 1BNPA 2YMPA 4O3RA 5ALSA 1TK8A 7ICHA 5L1LA 5KG5A 3M7DA 5J0PA 3ZDDA 1XSLA 1AROP 2QB0B 3ISCA 4KMUA 4M9GA 2WF6A 2LHTA 2KJ5A 2BZFA 4IRCA 4DQPA 3HT3A 5DLFA 1L7OA 4RQ2A 1UCVA 2LMRA 1OUQA 2BR0A 3QX7A 5JRTA 4YMMA 4YR0A 2KICA 3H8SA 2BQ3A 5F9NA 4KMOB 9ICJA 3Q8MA 3ETLA 2AGPA 1X6IA 5H2FU 8ICBA 5DQGA 5KFBA 2JEGA 4Q44A 4QW8A 2PI4A 2P35A 1PVPA 1ED1A 1ZQMA 3CRXA 1VJ5A 4YR3A 3D2QA 3MBYA 1XC9A 3TADC 4KN4A 3E0FA 5ALFA 2PKEA 2ALZA 1TE2A 2KZZA 2OEHA 4RUAA 8ICQA 5KG3A 5ALVA 3AU2A 2LM1A 2WTFA 2JRZA 4P0QB 5DDYA 2QKQA 3MABA 3SD7A 4NLZA 4MFAA 2IOHA 1S0NA 2FPLA 1FIQA 1SXDA 3PZPA 4DL4A 2HCFA 4HAIA 4RQ1A 3K1RB 1D8YA 3WKDA 3ZD8A 2F77X 5AIBA 3PV8A 3OJUA 4TUPA 2YY6A 5AM5A 1X6JA 4ELUA 3GDXA 4F93B 1KEJA 2XCAA 1MN8A 4FZLA 5J0UA 4F92B 4DQQA 1SGGA 5AKIA 2A1JB 4ECTA 4UARA 1NKCA 5KFLA 3H8MA 8ICEA 4DWIA 2DF4B 4ZH4A 1LKYB 3KKAC 2PFQA 4CRXA 4AYBC 2NYVA 8ICNA 2ZXIA 4YN4A 5IIOA 5AI0A 3QUCA 8ICHA 4UB8U 4I29A 5EE0A 4PPXA 4ELVA 5HP4A 3THVA 2AU0A 3EYZA 4RQ8A 1COOA 1TV9A 5DDMA 3QU7A 1B0XA 1SKRA 4DSIA 4KLFA 3QZ8A 2ZXHA 4R63A 3TFSA 5J2EA 2MRLA 3TAPA 1UA1A 5L1KA 4C8OA 4IC9A 3H8WA 1L7PA 1ZRMA 1L8LA 4PGQA 4CF3A 5KFDA 2C2EA 3D6JA 1L7NA 2G06A 2OM6A 2KP7A 2ODGA 1COKA 4TUSA 2C2DA 3SQIA 1ZQDA 2W03A 1QLNA 5J2KA 2NRVA 3SAHA 4R66A 2JR5A 2ASLA 2DUYA 1T3QA 4R8UA 1PK1A 3VCBA 3T79A 2HOQA 4PZOA 2K4EA 1KN5A 3I28A 3QU4A 2NO4A 4KLQA 1DRGA 2JEIA 2RRDA 4GC7A 2RDJA 2HSZA 5EE3A 2JMGA 2KHVA 1DK2A 2B0CA 1Q8KA 2W9CA 4FS2A 2IOFA 3ZDBA 4F2SA 4RNOA 9ICMA 1JI7A 2W3SA 4FFDA 5DBAA 1S10A 4EEKA 4KLEA 1V9PA 1MA7A 1SXEA 3ISBA 5HR7A 3AEVA 5ALMA 8ICMA 5AKYA 5AKGA 1ZD5A 1ZQOA 3UXNA 4OO1J 7ICSA 5DBBA 4B9NA 2EAPA 2N1RA 4EEYA 2VKQA 5ALZA 5ALHA 4M6WB 2KZMA 1S8OA 2J6UA 1ZYQA 4IRDA 4O3MA 4GXIA 2YN4A 3SI8A 5J0XA 4O5EA 4NLNA 2BPGA 3KOOA 4ZOHC 3TADA 2WB1F 5KFMA 5KFJA 4F4KA 1XNSA 7ICQA 5AM4A 1TAUA 1X9MA 1NNLA 3C1ZA 1UA0A 4QWEA 4F4ZA 2YMMA 4XA5A 4PGXA 2ZUCA 3FDSA 4DL2A 3WKCA 2V9WA 5KFZA 3AU6A 3WK6A 2NRWA 2CXYA 1JRPA 1KDHA 1XWLA 1CI4A 2NV3A 1KRPA 1ZQGA 2H3ZA 3RB6A 5J8YC 1X66A 4KLMA 4UAUA 5AI8A 2ATLA 3QE9Y 1KW4A 1V38A 5KFFA 1ZQQA 1SWVA 2EZYA 2MAXA 1X9XA 2E1EA 3JPSA 2XC9A 4FBUA 3RJIA 4CGZA 4NL9C 2A19A 2OCEA 4KLHA 3GU3A 4F8RA 5AKJA 4U6PA 4MF2A 2F1JA 5CP2A 1D8BA 5KNIA 9ICRA 4DLEA 1UT5A 3E58A 5GTIU 4Y2SA 1ZD4A 4J03A 4TURA 1TVAA 2PI5A 1LKYA 3MR5A 5GTHU 5EE9A 1HUOA 5DQHA 5ALDA 4QZ8A 8ICLA 5KFHA 2YB1A 5HNKA 4UB3A 4DOCA 3RF9A 1SL2A 2M9NA 3JPTA 4BUGA 2EAMA 5CWRA 8ICSA 2FPMA 4I2CA 1HUZA 4G3IA 3JPNA 3GFKB 3L3FX 2NO5A 4GC6A 4JB3A 2XY6A 4NLCA 3ALRA 5J2BA 4EBEA 3I76A 2BHNA 1N56A 1OXJA 1QSYA 5KFKA 3H0LB 1RYRA 2ASJA 2OXOA 4C7ZA 3PO4A 1DGJA 1WWUA 2ZJ8A 9ICPA 2HOFA 4UB1A 2KJ9A 2HVHA 2BKEA 3UM9A 7ICUA 5DGAA 1N48A 3EWAA 2JV3A 4TQSA 3M1YA 5KL1B 9ICXA 3NS1A 2HVIA 3H0RB 9ICWA 4GXKA 3SMVA 4J9KA 2XGPA 1FFUA 5L1JA 5ALJA 3HP6A 4RNMA 1BPYA 9ICVA 1BNOA 5KT6A 2J6TA 2K8AA 2BDUA 4OD0A 2WB1C 1BPBA 2DFLA 1K1QA 3ETRA 3EPGA 5DKWA 9ICGA 3UXPA 2AH5A 3V7KA 2W8LA 5DB7A 5KFSA 4RQMA 7ICNA 3WKBA 3K4GA 2W11A 4ECZA 3SZ2A 1ZQ1C 3PSPA 1J2MA 3K1ZA 3SAGA 4O3NA 4P0QA 3WKEA 4NL9A 1SL0A 2OHFA 4FE3A 2W9AA 8ICOA 4Y2XA 4DFPA 3AQEA 2KOBA 1ZQEA 2MUTB 4J9LA 3C23A 3RR8A 5CEHA 3B0YA 1S77D 4BJQA 5AKHA 2HHTA 1ZQBA 2PFPA 3KFUF 2PFNA 1N61A 3PMLA 5IINA 4OJOA 4Q43A 5DG8A 4OJ6A 2ZG6A 2NRZA 2VA8A 3ZDCA 3E2EA 1RZTA 4ECSA 3RRHA 1ZQHA 1AQ6A 5J2FA 2L5YA 5ALTA 3LK9A 2HBMA 4DQIA 5AK6A 2F8KA 4DO9A 4C4TA 5J29A 1Z4NA 3PX6A 2W8KA 5E79U 4M04A 2A1AA 1ZQPA 4OCZA 3IG5A 3LYSA 3C21A 1QQ6A 5J2JA 3C5FA 1ECWA 3S6JA 1VLBA 4Y2RA 4KLTA 1NK0A 4K4IA 3LWMA 9ICAA 2HHXA 3PVXA 1DXSA 3VC8A 3NUQA 4Y2JA 3EPIA 3QUBA 5KL8B 1IV8A 2RHFA 9ICFA 4K4GA 1N5WA 2PFOA 2IHMA 4QIWC 5C5JA 1O03A
chains in the Genus database with same CATH topology
1F0MA 1V85A 2D3DA 3BS5B 2E8PA 5JTIA 1B0XA 4IS7A 4NL9A 1UCVA 2E8OA 3BS7A 2LMRA 2EAMA 5JRTA 3TADA 2QB0A 3HILA 1OW5A 2K4PA 3TACB 2E8NA 2QARA 1OXJA 2FE9A 5F3XB 2KSOB 1COKA 2QB1A 1Z1VA 1PK3A 1SV0A 1SV4A 1WWUA 2KIVA 3TADC 1SV0C 2DL0A 2ES6A 2F3NA 2YTUA 1UQVA 1B4FA 5L1MA 1PK1A 3BS5A 2L5YA 4PZOA 1X40A 5J8YC 2LPEA 2QKQA 3SENA 2KG5A 1X66A 2DKXA 2F8KA 1PK1B 2JV3A 1SXDA 1KW4A 1V38A 2Y9TA 3K1RB 2DKZA 3KKAA 2KMDA 2B6GA 3SEIA 1X9XA 2EAOA 2ESEA 2GLEA 4NL9C 1JI7A 3IDWA 4PZNA 1RG6A 5J8YA 2EANA 1SXEA 2KE7A 1SGGA 1DXSA 2Y9UA 2F44A 5KNIA 3H8MA 1WWVA 2QARB 4RQNA 1LKYB 2E8MA 3KKAC 2KSOA 4NJ8A 3BQ7A 2EAPA 4MHVA 4RQMA 2D8CA 2K60A 1LKYA 2QB0B 5JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F0M A;  1V85 A;  2D3D A;  3BS5 B;  2E8P A;  5JTI A;  1B0X A;  4IS7 A;  4NL9 A;  1UCV A;  2E8O A;  3BS7 A;  2LMR A;  2EAM A;  5JRT A;  3TAD A;  2QB0 A;  3HIL A;  1OW5 A;  2K4P A;  3TAC B;  2E8N A;  2QAR A;  1OXJ A;  2FE9 A;  5F3X B;  2KSO B;  1COK A;  2QB1 A;  1Z1V A;  1PK3 A;  1SV0 A;  1SV4 A;  1WWU A;  2KIV A;  3TAD C;  1SV0 C;  2DL0 A;  2ES6 A;  2F3N A;  2YTU A;  1UQV A;  1B4F A;  5L1M A;  1PK1 A;  3BS5 A;  2L5Y A;  4PZO A;  1X40 A;  5J8Y C;  2LPE A;  2QKQ A;  3SEN A;  2KG5 A;  1X66 A;  2DKX A;  2F8K A;  1PK1 B;  2JV3 A;  1SXD A;  1KW4 A;  1V38 A;  2Y9T A;  3K1R B;  2DKZ A;  3KKA A;  2KMD A;  2B6G A;  3SEI A;  1X9X A;  2EAO A;  2ESE A;  2GLE A;  4NL9 C;  1JI7 A;  3IDW A;  4PZN A;  1RG6 A;  5J8Y A;  2EAN A;  1SXE A;  2KE7 A;  1SGG A;  1DXS A;  2Y9U A;  2F44 A;  5KNI A;  3H8M A;  1WWV A;  2QAR B;  4RQN A;  1LKY B;  2E8M A;  3KKA C;  2KSO A;  4NJ8 A;  3BQ7 A;  2EAP A;  4MHV A;  4RQM A;  2D8C A;  2K60 A;  1LKY A;  2QB0 B;  5JU5 A; 
#chains in the Genus database with same CATH topology
 1TK5 A;  1V85 A;  3K75 D;  4YCX A;  5CA7 A;  4RQ5 A;  1RPL A;  1X9S A;  1NK9 A;  2BCR A;  4AYB F;  4M2Y A;  3H4D A;  3TAN A;  1NJZ A;  1KLN A;  1S0M A;  4KLJ A;  2K89 A;  1NKE A;  4M0A A;  2G09 A;  4ED1 A;  1OW5 A;  4K4H A;  5KFR A;  2ZIV A;  4J9M A;  5KFQ A;  4Z6E A;  2BQU A;  2KNJ A;  3A0B U;  3GIJ A;  3N4M B;  1KSP A;  1A77 A;  2FE9 A;  3G6X A;  1S76 D;  1N5X A;  5KT4 A;  8ICU A;  5KG2 A;  4QZH A;  3T3F A;  4A8E A;  3RH4 A;  1NK7 A;  2DL0 A;  4J9S A;  3OTQ A;  5L1M A;  2H3Q A;  3F53 A;  2R8H A;  2PMZ F;  2P6R A;  2LPE A;  4QZA A;  2W55 A;  5DB6 A;  4I2F A;  3OGU A;  1WYG A;  5BPC A;  4QJF B;  4OJL A;  4JWM A;  5IIL A;  9ICH A;  4F5P A;  4YVZ A;  2AQ4 A;  2V4Q A;  3N7R C;  1KKX A;  1N62 A;  3SEI A;  4WJ3 B;  5AKE A;  8ICG A;  4ELT A;  4XQ8 A;  9ICU A;  3AL0 B;  3Q8P B;  2ZTC A;  4CF4 A;  2GLE A;  5CHG A;  4BX9 C;  1RDF A;  2XI9 A;  5ALP A;  2G08 A;  4E0D A;  1CUK A;  4F71 A;  3JPP A;  1LB2 B;  3PR5 B;  4I2B A;  1TAQ A;  1F44 A;  1X9W A;  3HX0 A;  3N97 B;  3NRW A;  3QUT A;  4DOA A;  3LVW A;  3HKZ C;  5ALO A;  3WK5 A;  2BCU A;  4C8L A;  2QAR B;  3MFI A;  1UHU A;  5AKX A;  4XUS A;  4Q45 A;  9ICI A;  2KSO A;  1VDV A;  4MHV A;  8ICF A;  1KL9 A;  1L3U A;  3PR4 A;  2BPF A;  2JXJ A;  5D49 A;  1JRO A;  2I1Q A;  4QZD A;  2LM4 A;  3NAS A;  2KIW A;  2AJQ A;  4YMN A;  4Q8F A;  5J2D A;  2WAQ C;  3GV5 B;  5AI4 A;  3O0F A;  1TFR A;  4PL1 A;  3QZ7 A;  4M47 A;  1O08 A;  3N28 A;  1BPZ A;  3LWL A;  4UAW A;  2CRX A;  4CF5 A;  5J0T A;  2MSN A;  4I28 A;  4JK1 A;  1NK5 A;  1Z00 B;  3BJY A;  5KG1 A;  4ACO A;  3RJH A;  2PXI A;  3UXO A;  5DB8 A;  7ICP A;  1D9F A;  4JMU A;  1ZRN A;  7ICF A;  3GV8 B;  3NTU A;  2H3I A;  3Q8R B;  3BQ1 A;  2R8G A;  3Q8S B;  2UVR A;  4Z6D A;  4JV1 A;  1CEZ A;  2VJ4 A;  3MGI A;  4RQ7 A;  2DKX A;  4O3O A;  2EZZ A;  3Q8Q B;  1TAM A;  1DOQ A;  2Y9T A;  1RXV A;  5D4B A;  3PSI A;  4Y2Q A;  2OH2 A;  4NWI A;  5KFX A;  2PMZ C;  4UAT A;  3RJF A;  4BXO B;  5ALL A;  4US8 A;  2LKY A;  1N60 A;  2WHE A;  2DPI A;  4TQR A;  4DFJ A;  5J8Y A;  3T5L A;  2EAN A;  2KHQ A;  1FFV A;  2ISO A;  1T4G A;  8ICZ A;  4KX3 A;  3H0M B;  1WWV A;  4UB6 U;  3QEB Z;  4KLO A;  2DQN B;  2JH7 A;  4PJ0 U;  2OWO A;  1J2N A;  3JPQ A;  3NRZ A;  4B9S A;  3GIK A;  2G5H B;  4GXJ A;  3NVW A;  4QWD A;  3PW7 A;  7ICV A;  2KK0 A;  4O0I A;  5J2A A;  3TFR A;  1JIH A;  2EH9 A;  4J9O A;  1RQL A;  1SKS A;  4RNN A;  2WAQ F;  3H8J A;  3HIL A;  4C4R A;  4DL3 A;  1YZ7 A;  5J2I A;  4DSK A;  1L6N A;  1SIJ A;  2K8B B;  3N7S C;  2XO7 A;  5AI5 A;  1Z00 A;  3RJE A;  8ICI A;  4RUC A;  3HPO A;  1NJW A;  3H4B A;  1N2X A;  3ORY A;  5J0O A;  3C2K A;  1U47 A;  1JMS A;  1L3V A;  3CYM A;  7ICK A;  3HKZ F;  5AKK A;  3DDH A;  2JZB A;  8ICR A;  2Z7J A;  1A76 A;  2YTU A;  1UQV A;  2XID A;  5EOZ A;  2WF9 A;  4DOB A;  2FLP A;  4Y2T A;  1ZXI A;  9ICQ A;  4RZR A;  9ICL A;  2KV2 A;  4YD2 A;  1ZET A;  1DK3 A;  3DEE A;  4P4M A;  1HEK A;  2YX8 A;  2J6S A;  3KZX A;  4BXO A;  4J9N A;  3PX0 A;  4QZE A;  1KFD A;  2D6F C;  1U9L A;  3M9N B;  2I6X A;  2KE7 A;  3MGH A;  4NV0 A;  5KFG A;  3RR7 A;  4UB2 A;  4FBT A;  2ZTD A;  2VIX A;  3SR6 A;  2DPJ A;  5KFN A;  3UMC A;  1LVH A;  7ICE A;  3BQ7 A;  1UT8 A;  5J2G A;  3F2C A;  1TKD A;  3OSN A;  4CCH A;  2A1J A;  4R65 A;  3Q8K A;  5KT3 A;  9ICC A;  5KFI A;  3PMN A;  3BS7 A;  3M8S A;  4ED6 A;  3SV3 A;  1ZQF A;  8ICP A;  5DB9 A;  3MDC A;  1ZQZ A;  4KN7 A;  3BQ2 A;  1ZQX A;  4I27 A;  3RB3 A;  2KD1 A;  2HW3 A;  1ZD2 P;  4DSJ A;  4DL5 A;  5AI9 A;  4DFK A;  3I1Y A;  2E3T A;  4YXJ A;  1PK3 A;  3JPO A;  4YG2 A;  1SV0 A;  3SYZ A;  4CE6 A;  4NLG A;  5F9L A;  5TIS U;  4UBB A;  3V6H A;  2C22 A;  3IN5 A;  2FPK A;  1L3S A;  2KKP A;  3EUB 2;  4NLB A;  3RFA A;  4Z6C A;  5DG9 A;  3GZF A;  4NLK A;  4Y2V A;  1NOM A;  2M0N A;  2HI0 A;  2KMD A;  1URJ A;  2VAN A;  5KFV A;  1Z4O A;  3RTV A;  5BOM A;  2BCQ A;  2AXT U;  2I9G A;  4O3P A;  3M9O B;  4YMO A;  3D2S A;  4EBD A;  5HR6 A;  2YMQ A;  5ALN A;  3LVV A;  1T8E A;  2JEJ A;  4UBC A;  1Q3U A;  3V6K A;  1HIW A;  1BPD A;  1U48 A;  3RH6 A;  1MSW D;  7ICG A;  2HHS A;  4EZ6 A;  4Y2U A;  4NJ8 A;  1LV5 A;  3T5H A;  1RM6 C;  5B66 U;  5KFT A;  7ICO A;  4BWJ A;  4UB5 A;  4YR2 A;  7ICM A;  4ICA A;  4MEX A;  4I2A A;  4BWM A;  4MFC A;  3F5A A;  3BS5 B;  2KTQ A;  2E8O A;  3GQC A;  1QQ5 A;  4EEN A;  1BVS A;  1KBU A;  1ZQN A;  1U45 A;  4RPX A;  1PVQ A;  4M6W A;  4F50 A;  5G5H A;  2KJ8 A;  3UMB A;  3MC1 A;  3AQF A;  2K8C B;  9ICT A;  2KKV A;  3WK8 A;  4M9H A;  1KTQ A;  1NJX A;  2DBY A;  4RU9 A;  1SKW A;  4LZD A;  4M9J A;  1Z19 A;  2MU2 A;  3FM9 A;  5DLG A;  4QWC A;  4EYH B;  3L5K A;  4YQW A;  3T5K A;  2XY5 A;  5CB1 A;  4IR1 A;  2ZIX A;  2ISP A;  1KQQ A;  8ICC A;  1SV4 A;  4ED8 A;  2XY7 A;  2W04 A;  2F3N A;  4PL2 A;  3EZ5 A;  5JUM A;  2R8I A;  3NGD A;  1QSS A;  4C4S A;  2LBO A;  4IR9 A;  5AM1 A;  2R8J A;  2EZX A;  9ICO A;  2Y0S C;  2GWS A;  3C2L A;  1KFT A;  2EAO A;  2KZ3 A;  3PSF A;  3AN1 A;  5D46 A;  2RQ5 A;  5B5E U;  4O3S A;  4YFK A;  3PW4 A;  2FI1 A;  1NJY A;  5AIA A;  3PW2 A;  3SV4 A;  1BGX T;  4IQU A;  1XO1 A;  5G5G A;  2HBJ A;  2NRT A;  4EEL A;  2HHQ A;  1J97 A;  4KLI A;  4C7Y A;  4I2H A;  4ECX A;  3OJS A;  2D8C A;  3WU2 U;  4ED2 A;  2K60 A;  4Q8E A;  5DG7 A;  4IL6 U;  2WF5 A;  4R8U B;  4KX5 A;  2F1I A;  4RQ0 A;  1PUZ A;  2WF7 A;  5KAI U;  5JTI A;  5K4L A;  3BQ0 A;  2LYH A;  2BGW A;  3HW8 A;  5AKL A;  2HOI A;  3C2M A;  1Z3E B;  5AK4 A;  3A0H U;  3MFH A;  2C2R A;  3BDP A;  2AHO B;  2K4P A;  4J9R A;  1SL1 A;  5AIC A;  4B9L A;  3KD3 A;  5HHH A;  1ZQV A;  4P4P A;  4F4Y A;  1ZQT A;  5F3X B;  9ICE A;  4CNQ A;  4RPZ A;  2FLL A;  4QNL A;  4KLL A;  2HBK A;  3UMG A;  4UAV A;  3UQ0 A;  1K1S A;  8ICV A;  4XRH A;  1ZQY A;  7ICT A;  1IIP A;  5J2C A;  2VA3 A;  3NVV A;  3FC4 A;  5KFY A;  5KFW A;  2WF8 A;  2KG5 A;  5IIM A;  1NZP A;  1ZJN A;  3SAF A;  1A6S A;  1ZQR A;  4DCC A;  4KTQ A;  4B6J A;  1S0V A;  3ICX A;  3KKA A;  2XGQ A;  4MEY A;  2ZTE A;  2Q0Z X;  4ECY A;  3LDA A;  4DF8 A;  2AGQ A;  1GO3 F;  5CRX A;  3OSP A;  4F72 A;  1S9F A;  2W3R A;  5KT2 A;  1L8O A;  3MGV A;  3MR3 A;  9ICB A;  2W54 A;  1MQ3 A;  1T94 A;  4UB4 A;  2R8K A;  3PW0 A;  1L5U A;  2RDI A;  3IP4 B;  2E8M A;  4CDG A;  4DF4 A;  2K4I A;  3RAQ A;  4KLS A;  1MC8 A;  1NK4 A;  2E1F A;  5KG7 A;  3PST A;  3TAR A;  2G07 A;  4DSL A;  1QTM A;  1JUD A;  4QZ9 A;  2HDO A;  2VJ5 A;  4GLX A;  4I2I A;  5FP0 A;  5J2H A;  4RQ3 A;  2GOL A;  4NY8 A;  4IS7 A;  1JXE A;  1F5S A;  4NM1 A;  1ZQU A;  3PX4 A;  2H3V A;  3RJK A;  1IG6 A;  3ISD A;  2W7P A;  3RH5 A;  3C29 A;  1JX4 A;  4JWN A;  4RT2 A;  3KHR A;  1RXW A;  1KFS A;  3RRG A;  1XO0 A;  3RJJ A;  2OYY A;  1QCK A;  3ZD9 A;  4PHP A;  1U4B A;  1SWW A;  2FMP A;  2W7O A;  4F2R A;  1SV0 C;  2Y1J A;  7ICI A;  4Y2Y A;  4DSE A;  2MUT A;  4MF8 A;  1C20 A;  2KFN A;  3BS5 A;  4YD1 A;  2ZIX B;  2BCV A;  4IQW A;  2R18 A;  3SEN A;  9ICK A;  1PK1 B;  1K5O A;  4C8K A;  3TKA A;  3OHB A;  1FEZ A;  3GII A;  1QQ7 A;  2RP5 A;  4QZF A;  1NI3 A;  1U49 A;  5BOL A;  1XS9 D;  3PO5 A;  4PHD A;  3IDW A;  4B9M A;  2IHN A;  3QUQ A;  5KFO A;  5AI6 A;  1SZH A;  2JH1 A;  2Y9U A;  5L9X A;  3J81 j;  1N63 A;  4US9 A;  3KHG A;  1PZN A;  2CPR A;  1Q46 A;  5KG4 A;  4O9M A;  5KG6 A;  1A0P A;  2HHU A;  2ASD A;  2W9B B;  3ZI4 A;  4JUZ A;  5ALI A;  2KN7 A;  4PHA A;  3CW2 C;  2ZJ5 A;  5KFA A;  4C8N A;  4F5Q A;  5ALU A;  1WG8 A;  1IM4 A;  5A0L A;  1CRX A;  3BQT A;  4BGD A;  3RB4 A;  4JV2 A;  2C28 A;  1T3N A;  3H40 A;  5CJ7 A;  4UAZ A;  1WCL A;  3B0X A;  5EWG A;  4RT3 A;  2WFA A;  5HMM A;  2KVS A;  4DLG A;  5KFC A;  4OJP A;  5HML A;  2Y0S F;  4B9U A;  5KFU A;  3TQ1 A;  4P0P B;  5EWE A;  3M6Z A;  5J0S A;  1WUD A;  2YB4 A;  3G6V A;  1ZQS A;  3GIL A;  4PH5 A;  4UQG A;  2ZIU A;  4OJ5 A;  3UQ2 A;  3IHQ B;  1P7D A;  4F91 B;  3M8R A;  4J9Q A;  1PVR A;  5L1I A;  5AKZ A;  4QZC A;  2DWQ A;  2UVU A;  2I5H A;  1ZQA A;  1ZQK A;  2ZIV B;  1IXR A;  4ECQ A;  4LJX A;  2HHV A;  4LZG A;  4TUQ A;  3NVZ A;  1B43 A;  2IBK A;  3QU2 A;  5J0Y A;  4B9T A;  4EX6 A;  4QWB A;  1L3T A;  4Z6F A;  3D2N A;  3PY8 A;  3BZC A;  2ZJA A;  4QW9 A;  2LYA A;  4RQN A;  1ZQJ A;  4DEZ A;  1WCN A;  1NK8 A;  3ZDA A;  4UAY A;  3F5E A;  2F8L A;  3QEA Z;  1Q3V A;  3KTQ A;  2FMQ A;  3PW5 A;  1D9D A;  3MDA A;  4F4X A;  2BCS A;  1QSL A;  1F0M A;  2D3D A;  3HJE A;  2IOF K;  1UPH A;  2W43 A;  5TZV A;  1JN3 A;  5III A;  2E8P A;  1M6Y A;  5AM3 A;  4FZN A;  5ALR A;  4DL6 A;  1TK0 A;  2HHW A;  3WK4 A;  5J0W A;  4YP3 A;  3V7L A;  2MA1 A;  2QB0 A;  5ALG A;  2G5I B;  2FMS A;  2E5S A;  1S0O A;  4F3O A;  2P66 A;  5C0Y A;  2AGO A;  1JAL A;  4IQT A;  3TAC B;  2ZUD A;  2QAR A;  8ICY A;  3U26 A;  3F2B A;  4RQ6 A;  2KSO B;  2QB1 A;  2HBL A;  1RYS A;  4NM2 A;  3IV6 A;  4NXZ A;  2XVT A;  4KIT B;  1HJP A;  3AM9 A;  3N7P D;  1MQ2 A;  3RAX A;  3RBD A;  4J9P A;  1BPX A;  2P6U A;  2CN1 A;  3KHL A;  4B9V A;  2FDR A;  1RQN A;  1ZD3 A;  5ALE A;  1ZQW A;  3RB0 A;  1X2I A;  3QXG A;  3TAQ A;  4ECR A;  2Y1I A;  1XU4 A;  4DL7 A;  3AUO A;  2JEF A;  2H3F A;  4M9N A;  2RLT A;  2BQR A;  2UVW A;  4DQS A;  4UAS A;  2W9C B;  3IG8 A;  3UPQ A;  3T5J A;  2IMW P;  2F44 A;  3C5G A;  3GV7 B;  4ED7 A;  8ICX A;  1RYU A;  3RBE A;  2KFZ A;  3V72 A;  1C7Y A;  2YQE A;  4ECW A;  3DV9 A;  8ICW A;  4F5O A;  3CP8 A;  7ICL A;  4QWA A;  3EW9 A;  1ZQL A;  5IIK A;  4DFD A;  1ZOL A;  3AMZ A;  1ZQI A;  4QZI A;  5IIJ A;  4Y2P A;  5KT7 A;  8ICT A;  5EE1 A;  5HHI A;  4GIB A;  3IM1 A;  3V6J A;  3FYH A;  1JXL A;  2W9B A;  7ICJ A;  2B21 A;  8ICA A;  2LI6 A;  4EYI B;  4C8M A;  5ALY A;  4X5V A;  4EZ9 A;  4FO6 A;  4O5K A;  4HYK A;  2V4R A;  5EWF A;  3QNM A;  3ZDE A;  5AK3 A;  2F1H A;  4DS5 A;  4MFF A;  3WK9 A;  4GFJ A;  1S97 A;  4F4W A;  3HWT A;  3L4P A;  2FJ6 A;  2QLT A;  3C1Y A;  3JPR A;  2F2A B;  3V7J A;  3QYP A;  4O5C A;  2Q4T A;  2BPC A;  2ES6 A;  4QIW F;  3TI0 A;  2XCP A;  2KEY A;  5KTQ A;  4USA A;  2ZIW A;  4P4O A;  1T7P A;  4IRK A;  3H7I A;  1L7M A;  3KHH A;  2O6K A;  1D8L A;  4R64 A;  3GIM A;  4ED0 A;  1QH9 A;  3MR2 A;  3QU5 A;  5AK5 A;  5AM0 A;  5KG0 A;  5AHX A;  4RQ4 A;  4U7C A;  2LYB A;  4JV0 A;  2YML A;  2JZB B;  2DKZ A;  2B6G A;  2FLN A;  3KBB A;  5ALX A;  1SZP A;  8ICK A;  4I2G A;  2ESE A;  4C0Z A;  2BDP A;  4PHE A;  5KFP A;  4P2H A;  1ZJM A;  1RG6 A;  1SB3 C;  1NKB A;  4I2J A;  3IRU A;  2W9M A;  3ED5 A;  4EBC A;  1B22 A;  4DQR A;  3F2D A;  4EX7 A;  2G0A A;  3ONN A;  5J0Q A;  3OHA A;  2IA6 A;  4ECV A;  1XSN A;  3FAH A;  2NRX A;  1X42 A;  3NVY A;  2KVC A;  2DGZ A;  3M9M B;  4DSF A;  2UVV A;  3RJG A;  5JU5 A;  5ALK A;  4AP9 A;  3HRD D;  4I2E A;  1V97 A;  2JGA A;  3BZK A;  2H5X A;  4QZG A;  3QU9 A;  1NZB A;  1BPE A;  3G6Y A;  2VA2 A;  1XSP A;  3Q8L A;  8ICJ A;  4KLU A;  1S5L U;  5KFE A;  2GH1 A;  4I2D A;  4P0P A;  3PNC A;  1Y88 A;  3OPX A;  2HMX A;  4KLD A;  2E8N A;  1ZQC A;  1YT3 A;  2ZIU B;  4C80 A;  9ICN A;  1DGS A;  9ICS A;  4G9B A;  5CR0 A;  4FS1 A;  1Z1V A;  4DS4 A;  2XIC A;  3B9J A;  5ALW A;  2EDU A;  4IQV A;  4O3Q A;  4UW9 A;  5DBC A;  2KIV A;  2AQ0 A;  2A3V A;  3WKA A;  1B4F A;  2ZIW B;  4LVS A;  4F5R A;  1X40 A;  1YZ6 A;  5AM2 A;  4BDP A;  4YXM A;  2F76 X;  4QZB A;  4ED3 A;  5DQI A;  4PGY A;  4M9L A;  1Z1B A;  3KZI U;  3MR6 A;  2K4H A;  5KT5 A;  5J0R A;  3CNH A;  4FZM A;  7ICR A;  5KAF U;  5DGB A;  5ALQ A;  5T14 A;  3C28 A;  2ZUB A;  4PZN A;  4F5N A;  4KLG A;  1EXN A;  3WK7 A;  2GO7 A;  2JHD A;  3M6K A;  2EQY A;  1FO4 A;  4RPY A;  4DFM A;  4ECU A;  3R9K A;  1NK6 A;  1H38 A;  1BNP A;  2YMP A;  4O3R A;  5ALS A;  1TK8 A;  7ICH A;  5L1L A;  5KG5 A;  3M7D A;  5J0P A;  3ZDD A;  1XSL A;  1ARO P;  2QB0 B;  3ISC A;  4KMU A;  4M9G A;  2WF6 A;  2LHT A;  2KJ5 A;  2BZF A;  4IRC A;  4DQP A;  3HT3 A;  5DLF A;  1L7O A;  4RQ2 A;  1UCV A;  2LMR A;  1OUQ A;  2BR0 A;  3QX7 A;  5JRT A;  4YMM A;  4YR0 A;  2KIC A;  3H8S A;  2BQ3 A;  5F9N A;  4KMO B;  9ICJ A;  3Q8M A;  3ETL A;  2AGP A;  1X6I A;  5H2F U;  8ICB A;  5DQG A;  5KFB A;  2JEG A;  4Q44 A;  4QW8 A;  2PI4 A;  2P35 A;  1PVP A;  1ED1 A;  1ZQM A;  3CRX A;  1VJ5 A;  4YR3 A;  3D2Q A;  3MBY A;  1XC9 A;  3TAD C;  4KN4 A;  3E0F A;  5ALF A;  2PKE A;  2ALZ A;  1TE2 A;  2KZZ A;  2OEH A;  4RUA A;  8ICQ A;  5KG3 A;  5ALV A;  3AU2 A;  2LM1 A;  2WTF A;  2JRZ A;  4P0Q B;  5DDY A;  2QKQ A;  3MAB A;  3SD7 A;  4NLZ A;  4MFA A;  2IOH A;  1S0N A;  2FPL A;  1FIQ A;  1SXD A;  3PZP A;  4DL4 A;  2HCF A;  4HAI A;  4RQ1 A;  3K1R B;  1D8Y A;  3WKD A;  3ZD8 A;  2F77 X;  5AIB A;  3PV8 A;  3OJU A;  4TUP A;  2YY6 A;  5AM5 A;  1X6J A;  4ELU A;  3GDX A;  4F93 B;  1KEJ A;  2XCA A;  1MN8 A;  4FZL A;  5J0U A;  4F92 B;  4DQQ A;  1SGG A;  5AKI A;  2A1J B;  4ECT A;  4UAR A;  1NKC A;  5KFL A;  3H8M A;  8ICE A;  4DWI A;  2DF4 B;  4ZH4 A;  1LKY B;  3KKA C;  2PFQ A;  4CRX A;  4AYB C;  2NYV A;  8ICN A;  2ZXI A;  4YN4 A;  5IIO A;  5AI0 A;  3QUC A;  8ICH A;  4UB8 U;  4I29 A;  5EE0 A;  4PPX A;  4ELV A;  5HP4 A;  3THV A;  2AU0 A;  3EYZ A;  4RQ8 A;  1COO A;  1TV9 A;  5DDM A;  3QU7 A;  1B0X A;  1SKR A;  4DSI A;  4KLF A;  3QZ8 A;  2ZXH A;  4R63 A;  3TFS A;  5J2E A;  2MRL A;  3TAP A;  1UA1 A;  5L1K A;  4C8O A;  4IC9 A;  3H8W A;  1L7P A;  1ZRM A;  1L8L A;  4PGQ A;  4CF3 A;  5KFD A;  2C2E A;  3D6J A;  1L7N A;  2G06 A;  2OM6 A;  2KP7 A;  2ODG A;  1COK A;  4TUS A;  2C2D A;  3SQI A;  1ZQD A;  2W03 A;  1QLN A;  5J2K A;  2NRV A;  3SAH A;  4R66 A;  2JR5 A;  2ASL A;  2DUY A;  1T3Q A;  4R8U A;  1PK1 A;  3VCB A;  3T79 A;  2HOQ A;  4PZO A;  2K4E A;  1KN5 A;  3I28 A;  3QU4 A;  2NO4 A;  4KLQ A;  1DRG A;  2JEI A;  2RRD A;  4GC7 A;  2RDJ A;  2HSZ A;  5EE3 A;  2JMG A;  2KHV A;  1DK2 A;  2B0C A;  1Q8K A;  2W9C A;  4FS2 A;  2IOF A;  3ZDB A;  4F2S A;  4RNO A;  9ICM A;  1JI7 A;  2W3S A;  4FFD A;  5DBA A;  1S10 A;  4EEK A;  4KLE A;  1V9P A;  1MA7 A;  1SXE A;  3ISB A;  5HR7 A;  3AEV A;  5ALM A;  8ICM A;  5AKY A;  5AKG A;  1ZD5 A;  1ZQO A;  3UXN A;  4OO1 J;  7ICS A;  5DBB A;  4B9N A;  2EAP A;  2N1R A;  4EEY A;  2VKQ A;  5ALZ A;  5ALH A;  4M6W B;  2KZM A;  1S8O A;  2J6U A;  1ZYQ A;  4IRD A;  4O3M A;  4GXI A;  2YN4 A;  3SI8 A;  5J0X A;  4O5E A;  4NLN A;  2BPG A;  3KOO A;  4ZOH C;  3TAD A;  2WB1 F;  5KFM A;  5KFJ A;  4F4K A;  1XNS A;  7ICQ A;  5AM4 A;  1TAU A;  1X9M A;  1NNL A;  3C1Z A;  1UA0 A;  4QWE A;  4F4Z A;  2YMM A;  4XA5 A;  4PGX A;  2ZUC A;  3FDS A;  4DL2 A;  3WKC A;  2V9W A;  5KFZ A;  3AU6 A;  3WK6 A;  2NRW A;  2CXY A;  1JRP A;  1KDH A;  1XWL A;  1CI4 A;  2NV3 A;  1KRP A;  1ZQG A;  2H3Z A;  3RB6 A;  5J8Y C;  1X66 A;  4KLM A;  4UAU A;  5AI8 A;  2ATL A;  3QE9 Y;  1KW4 A;  1V38 A;  5KFF A;  1ZQQ A;  1SWV A;  2EZY A;  2MAX A;  1X9X A;  2E1E A;  3JPS A;  2XC9 A;  4FBU A;  3RJI A;  4CGZ A;  4NL9 C;  2A19 A;  2OCE A;  4KLH A;  3GU3 A;  4F8R A;  5AKJ A;  4U6P A;  4MF2 A;  2F1J A;  5CP2 A;  1D8B A;  5KNI A;  9ICR A;  4DLE A;  1UT5 A;  3E58 A;  5GTI U;  4Y2S A;  1ZD4 A;  4J03 A;  4TUR A;  1TVA A;  2PI5 A;  1LKY A;  3MR5 A;  5GTH U;  5EE9 A;  1HUO A;  5DQH A;  5ALD A;  4QZ8 A;  8ICL A;  5KFH A;  2YB1 A;  5HNK A;  4UB3 A;  4DOC A;  3RF9 A;  1SL2 A;  2M9N A;  3JPT A;  4BUG A;  2EAM A;  5CWR A;  8ICS A;  2FPM A;  4I2C A;  1HUZ A;  4G3I A;  3JPN A;  3GFK B;  3L3F X;  2NO5 A;  4GC6 A;  4JB3 A;  2XY6 A;  4NLC A;  3ALR A;  5J2B A;  4EBE A;  3I76 A;  2BHN A;  1N56 A;  1OXJ A;  1QSY A;  5KFK A;  3H0L B;  1RYR A;  2ASJ A;  2OXO A;  4C7Z A;  3PO4 A;  1DGJ A;  1WWU A;  2ZJ8 A;  9ICP A;  2HOF A;  4UB1 A;  2KJ9 A;  2HVH A;  2BKE A;  3UM9 A;  7ICU A;  5DGA A;  1N48 A;  3EWA A;  2JV3 A;  4TQS A;  3M1Y A;  5KL1 B;  9ICX A;  3NS1 A;  2HVI A;  3H0R B;  9ICW A;  4GXK A;  3SMV A;  4J9K A;  2XGP A;  1FFU A;  5L1J A;  5ALJ A;  3HP6 A;  4RNM A;  1BPY A;  9ICV A;  1BNO A;  5KT6 A;  2J6T A;  2K8A A;  2BDU A;  4OD0 A;  2WB1 C;  1BPB A;  2DFL A;  1K1Q A;  3ETR A;  3EPG A;  5DKW A;  9ICG A;  3UXP A;  2AH5 A;  3V7K A;  2W8L A;  5DB7 A;  5KFS A;  4RQM A;  7ICN A;  3WKB A;  3K4G A;  2W11 A;  4ECZ A;  3SZ2 A;  1ZQ1 C;  3PSP A;  1J2M A;  3K1Z A;  3SAG A;  4O3N A;  4P0Q A;  3WKE A;  4NL9 A;  1SL0 A;  2OHF A;  4FE3 A;  2W9A A;  8ICO A;  4Y2X A;  4DFP A;  3AQE A;  2KOB A;  1ZQE A;  2MUT B;  4J9L A;  3C23 A;  3RR8 A;  5CEH A;  3B0Y A;  1S77 D;  4BJQ A;  5AKH A;  2HHT A;  1ZQB A;  2PFP A;  3KFU F;  2PFN A;  1N61 A;  3PML A;  5IIN A;  4OJO A;  4Q43 A;  5DG8 A;  4OJ6 A;  2ZG6 A;  2NRZ A;  2VA8 A;  3ZDC A;  3E2E A;  1RZT A;  4ECS A;  3RRH A;  1ZQH A;  1AQ6 A;  5J2F A;  2L5Y A;  5ALT A;  3LK9 A;  2HBM A;  4DQI A;  5AK6 A;  2F8K A;  4DO9 A;  4C4T A;  5J29 A;  1Z4N A;  3PX6 A;  2W8K A;  5E79 U;  4M04 A;  2A1A A;  1ZQP A;  4OCZ A;  3IG5 A;  3LYS A;  3C21 A;  1QQ6 A;  5J2J A;  3C5F A;  1ECW A;  3S6J A;  1VLB A;  4Y2R A;  4KLT A;  1NK0 A;  4K4I A;  3LWM A;  9ICA A;  2HHX A;  3PVX A;  1DXS A;  3VC8 A;  3NUQ A;  4Y2J A;  3EPI A;  3QUB A;  5KL8 B;  1IV8 A;  2RHF A;  9ICF A;  4K4G A;  1N5W A;  2PFO A;  2IHM A;  4QIW C;  5C5J A;  1O03 A; 
#chains in the Genus database with same CATH homology
 1F0M A;  1V85 A;  2D3D A;  3BS5 B;  2E8P A;  5JTI A;  1B0X A;  4IS7 A;  4NL9 A;  1UCV A;  2E8O A;  3BS7 A;  2LMR A;  2EAM A;  5JRT A;  3TAD A;  2QB0 A;  3HIL A;  1OW5 A;  2K4P A;  3TAC B;  2E8N A;  2QAR A;  1OXJ A;  2FE9 A;  5F3X B;  2KSO B;  1COK A;  2QB1 A;  1Z1V A;  1PK3 A;  1SV0 A;  1SV4 A;  1WWU A;  2KIV A;  3TAD C;  1SV0 C;  2DL0 A;  2ES6 A;  2F3N A;  2YTU A;  1UQV A;  1B4F A;  5L1M A;  1PK1 A;  3BS5 A;  2L5Y A;  4PZO A;  1X40 A;  5J8Y C;  2LPE A;  2QKQ A;  3SEN A;  2KG5 A;  1X66 A;  2DKX A;  2F8K A;  1PK1 B;  2JV3 A;  1SXD A;  1KW4 A;  1V38 A;  2Y9T A;  3K1R B;  2DKZ A;  3KKA A;  2KMD A;  2B6G A;  3SEI A;  1X9X A;  2EAO A;  2ESE A;  2GLE A;  4NL9 C;  1JI7 A;  3IDW A;  4PZN A;  1RG6 A;  5J8Y A;  2EAN A;  1SXE A;  2KE7 A;  1SGG A;  1DXS A;  2Y9U A;  2F44 A;  5KNI A;  3H8M A;  1WWV A;  2QAR B;  4RQN A;  1LKY B;  2E8M A;  3KKA C;  2KSO A;  4NJ8 A;  3BQ7 A;  2EAP A;  4MHV A;  4RQM A;  2D8C A;  2K60 A;  1LKY A;  2QB0 B;  5JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...