5J8YC

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
69
structure length
69
Chain Sequence
MPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLKCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
molecule keywords Polycomb protein Scm
total genus 23
structure length 69
sequence length 69
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yC00
1JI7A 1SV4A 5L1MA 1PK3A 4PZOA 1V85A 1Z1VA 2EAPA 3K1RB 4IS7A 3SENA 1LKYA 3IDWA 2F3NA 1DXSA 2B6GA 3H8MA 2QB0B 2DKZA 1SXEA 1UQVA 1PK1A 3BQ7A 2K60A 1OXJA 2Y9UA 3TADA 2ESEA 2FE9A 5J8YA 2KIVA 3TACB 1SXDA 2E8OA 2QARA 1F0MA 2QARB 1OW5A 2ES6A 1LKYB 2L5YA 2E8NA 2F8KA 2EANA 4NL9C 3KKAA 2LPEA 5F3XB 2EAMA 1B0XA 3KKAC 2DKXA 3HILA 2EAOA 4NL9A 3BS5B 2KE7A 1SGGA 1UCVA 1SV0A 2D3DA 1B4FA 1X66A 2KMDA 2KSOB 1V38A 2LMRA 3BS5A 2KSOA 2JV3A 2GLEA 1WWVA 5KNIA 5JRTA 2QKQA 5JTIA 2YTUA 2QB1A 2F44A 2DL0A 2K4PA 2E8PA 4NJ8A 1X9XA 4RQNA 2D8CA 1X40A 2KG5A 3SEIA 2E8MA 1SV0C 1KW4A 1COKA 4PZNA 5J8YC 5JU5A 3TADC 2Y9TA 1RG6A 2QB0A 1WWUA 3BS7A 4MHVA 1PK1B 4RQMA
chains in the Genus database with same CATH superfamily
2K89A 5L1MA 5KL8B 8ICGA 4BGDA 3OSNA 3GIMA 4CE6A 1Z1BA 3RJGA 4QWAA 5AI8A 3PX4A 3SD7A 2NV3A 5KFXA 4UARA 4Y2SA 3HPOA 2OCEA 2YX8A 1CUKA 1ZQXA 4XRHA 2ASLA 1UQVA 3ZDAA 5AK4A 3F53A 4KLQA 2VA8A 3DDHA 5KFVA 3UPQA 5AI5A 2KVCA 2L5YA 1U45A 2EQYA 3N4MB 3MFIA 3KKAA 7ICQA 1DGJA 2K4EA 2JEFA 3E0FA 4AP9A 3Q8PB 1SWWA 2C2EA 4YXJA 4KLJA 4QZAA 7ICKA 1U4BA 2W55A 2DBYA 1HJPA 4RQ5A 4EYIB 5F9LA 3AL0B 1JXEA 4ECUA 8ICHA 3LYSA 2W8KA 5A0LA 1L3SA 4I2EA 4DLGA 5AK5A 4JWNA 2A3VA 5IINA 5AK3A 3Q8LA 3UXOA 2LKYA 4A8EA 2G06A 3SYZA 5AICA 4DFDA 5EWFA 2WHEA 3ZD9A 1ZQSA 4J9OA 5KT2A 8ICYA 2HBMA 3LVWA 5AKZA 1KL9A 1FEZA 2BGWA 2EDUA 2F77X 5AM1A 3M6KA 2HOIA 3C28A 3KHRA 4KLMA 3T3FA 1RXWA 3TANA 2W03A 4Y2QA 4EENA 3GV8B 3R9KA 2HBJA 2KZZA 5HHHA 4LZGA 3AM9A 2H5XA 2EAPA 9ICPA 2JEIA 4HAIA 2IMWP 2NRVA 1S0VA 4YMNA 3PMNA 1XSLA 1MA7A 2OH2A 2M0NA 4BXOA 2OYYA 3GDXA 4TQRA 5CB1A 5CEHA 3LDAA 5J2FA 2Y0SC 4EX6A 1WCLA 4NY8A 2FE9A 5C5JA 4F4KA 4PL1A 3RH5A 2DFLA 3TACB 2ISOA 3D2QA 3NVZA 9ICMA 4F92B 3BDPA 3HW8A 5IIMA 2ES6A 1SKSA 5KG5A 4I2DA 3WK9A 4EYHB 8ICKA 2PFPA 9ICLA 5L1LA 3WKDA 5ALRA 2H3IA 1NOMA 3ONNA 4JWMA 2NRXA 2DPJA 1IG6A 2V4QA 2QLTA 4PH5A 4DOAA 4OJ5A 4OJPA 1JN3A 8ICWA 3VC8A 1NK8A 3EPGA 5DBCA 2AQ4A 4NLNA 5DB9A 1TAUA 5DG7A 1DGSA 1BPYA 4DSIA 3PR4A 2H3VA 3TQ1A 4YQWA 1L8LA 3OPXA 4F4XA 4ELTA 4DOBA 5KT5A 4QWCA 3KOOA 5TISU 3G6YA 4F4ZA 1DK2A 4TUSA 4YR0A 3E2EA 2BCUA 2K4PA 4YMMA 4DO9A 4EEKA 5IILA 1KLNA 2WF8A 4B9UA 2XCPA 4IRCA 5ALZA 3M9MB 1D8LA 3C2MA 4HYKA 3GQCA 4KLOA 3BQ2A 2ATLA 5EWGA 3NVWA 4C8OA 4IR9A 1ZXIA 3TKAA 1Z1VA 3RBDA 4XUSA 4PL2A 2A1JA 1NJXA 1ZQHA 4M9JA 4Y2PA 4YCXA 5KFEA 2G07A 4ECYA 3RJKA 9ICQA 1K5OA 3MDCA 5DDYA 4UATA 1SXDA 5H2FU 2C28A 3PVXA 3RB6A 4DEZA 9ICSA 4ECQA 1SB3C 4YG2A 2E8NA 4G9BA 1HEKA 2H3QA 9ICWA 2M9NA 2W54A 3OJSA 1JMSA 3QE9Y 3RF9A 4Y2YA 4M0AA 3RJEA 8ICJA 4LJXA 5HR7A 4O3MA 1K1SA 4NM1A 2G0AA 3SI8A 4RQ8A 2KE7A 1ZQGA 3PNCA 3MGVA 1NK7A 5J0UA 2V9WA 3AQEA 7ICTA 1QQ5A 1PVQA 4MF8A 3N97B 3CRXA 2LMRA 4O9MA 3NTUA 4UB6U 1X42A 4JUZA 4CF4A 5AKYA 2F76X 3QEAZ 3SZ2A 3H4DA 3N7RC 2YTUA 4F5QA 4UAVA 2KKPA 4M04A 3L5KA 1IM4A 4OO1J 3PSFA 5ALWA 4YD2A 4AYBF 1XSNA 4FS1A 2VANA 1A6SA 2R18A 1DRGA 3QUTA 2HW3A 1L5UA 4I27A 4PZNA 2YMPA 8ICSA 1A76A 1Q8KA 3MR3A 2MSNA 1BNPA 5KT4A 4PHDA 4ECVA 4EZ9A 5J2IA 2UVUA 5C0YA 3PO5A 4MF2A 2WB1F 5J2GA 5ALDA 5AKKA 4YFKA 1DXSA 3VCBA 1NJWA 3LWMA 3MC1A 1NK5A 3PX0A 3KHLA 1S0MA 3PV8A 4U7CA 4F2RA 4GLXA 1ZQFA 5CRXA 5KG1A 1TFRA 4M6WB 8ICBA 1TE2A 2JEJA 2BCSA 8ICRA 2F8KA 4ACOA 4J9LA 2E1FA 2GOLA 1DK3A 1Z4OA 3MABA 2RQ5A 2W9MA 1ZJMA 2JEGA 1ZOLA 4QWDA 4ELVA 2G08A 5EE3A 4KITB 3Q8SB 2EAOA 2CRXA 2ZIUB 3BS5B 4J03A 1QLNA 3OTQA 4J9SA 3V6KA 5J0RA 1SGGA 5ALLA 3QU2A 3M7DA 4DQSA 4KLTA 3G6VA 2YB4A 3NUQA 5ALUA 4KLUA 3B0YA 5CJ7A 1RDFA 2VKQA 4GXKA 2KJ5A 2HOFA 2PFQA 2KK0A 4YR3A 4NM2A 2QB1A 4PGQA 3H8SA 4QZIA 3ORYA 2BCRA 5BPCA 4DQRA 1U47A 3TARA 3QU9A 3HWTA 1Q3UA 1QTMA 2UVRA 4P0PB 5J8YC 1N62A 2KFZA 4UB8U 5ALTA 1ZQJA 4I2AA 4M47A 4RQMA 4ICAA 9ICUA 1N56A 5KAFU 1EXNA 5KFIA 1KQQA 5DLGA 3S6JA 4UB3A 9ICKA 1BGXT 1FO4A 2F3NA 3QXGA 2B6GA 4OCZA 3UXNA 2JMGA 2XY7A 2DKZA 5KG2A 3I28A 3GIIA 1PK1A 3KFUF 3QZ8A 3GFKB 3EYZA 3EW9A 2Y9UA 2W9CA 1NK4A 1J97A 3M8RA 2W43A 1U48A 1XNSA 1VJ5A 3ISDA 2ZG6A 1S0NA 1ZETA 4PGXA 1ZQIA 4BXOB 4RU9A 7ICSA 1ZQNA 2KKVA 4ED6A 2GH1A 1ZQQA 3KKAC 4ED2A 3D2NA 1TKDA 2W9BB 4BWJA 2ODGA 5J2EA 3RB4A 2RLTA 1X66A 8ICTA 1YZ7A 2KSOA 1RQLA 3AUOA 3CP8A 2KHQA 2PFOA 2Y1JA 5L1JA 5AI6A 3QYPA 2WF5A 1K1QA 2B0CA 3THVA 2AQ0A 1IIPA 1V9PA 3MR5A 3EPIA 3AEVA 4GXIA 3RR7A 4UAYA 1RYUA 4MFAA 2KJ9A 3NGDA 4QIWF 3K1ZA 3I1YA 5J0PA 2R8KA 2WFAA 2P6RA 2MA1A 2NRZA 4EBEA 5JU5A 4ED7A 1Z00B 5AM2A 3AU2A 3V7JA 1NKEA 5J2AA 1JXLA 3HT3A 3PW2A 7ICRA 3A0BU 4I2BA 4MFFA 7ICEA 2HHQA 1JX4A 2HVHA 5J0TA 1RZTA 3K1RB 4IQUA 2ZIUA 4DF8A 1ZJNA 4FO6A 4K4HA 1GO3F 2Y1IA 3BQ7A 1S0OA 2XIDA 4UB5A 5ALEA 1PVRA 2A1JB 2HMXA 1IXRA 4B9VA 3M1YA 4F8RA 5DB6A 2C2RA 3KBBA 3MDAA 4Y2UA 7ICGA 3UMGA 4F71A 4Z6EA 4QZFA 4Q8FA 4B9TA 5J2DA 4BX9C 5CWRA 5KFAA 4R8UA 3JPPA 1HUOA 4E0DA 4RPXA 2FI1A 4DQPA 4KLHA 5HR6A 2NYVA 1JIHA 1S97A 5ALYA 5EE0A 2OM6A 4Q43A 2KN7A 3IV6A 2KSOB 1V38A 2KIWA 5ALSA 2VJ5A 1AROP 2F1IA 3PO4A 1ZQVA 3C21A 5CP2A 3C2KA 4I2GA 5JTIA 3M8SA 3CW2C 2DL0A 4FZMA 2DUYA 2E8PA 1L7MA 2KG5A 4RNNA 3ZDBA 3GILA 3BZCA 5KG6A 5KG7A 1QSSA 8ICAA 5KFSA 2W11A 2JRZA 5AHXA 4BWMA 1KDHA 4IQTA 2HOQA 2YB1A 3U26A 2PMZF 2CN1A 1Z4NA 3K75D 1V85A 1COOA 2YN4A 4QZ8A 1LKYA 2ZTDA 1RPLA 5KFTA 3WK4A 4DCCA 4EX7A 5J2JA 4OD0A 5K4LA 5FP0A 1JRPA 4WJ3B 4Y2VA 1BPEA 1ZQ1C 4KMUA 1YZ6A 1M6YA 2WAQC 3IG8A 7ICFA 4RQ1A 2ZIXB 4JB3A 8ICZA 5F3XB 3UM9A 1S5LU 4O5KA 2E3TA 3RJHA 1J2MA 3QUCA 1QQ7A 3RRHA 3RJIA 4QZHA 1ZQZA 4KN4A 2R8JA 5KL1B 1BPXA 8ICLA 3WK7A 4IRDA 2EZYA 1ZD4A 2W3SA 2F1HA 3A0HU 2MUTA 2K8BB 1SZHA 4QJFB 1S10A 1KBUA 3HJEA 3RAQA 5ALIA 4DL3A 2ZIVB 2JR5A 3RAXA 4JV0A 2XY5A 3BQTA 3IN5A 3FAHA 1FIQA 2JH1A 1N2XA 4RPYA 2QB0A 3CYMA 1PUZA 4QZDA 5J0WA 2AGQA 1SV4A 4YP3A 1Y88A 2PXIA 2AGOA 1ZQRA 4IS7A 3SENA 3KZXA 2GO7A 2W7OA 4DL6A 4I2HA 2RP5A 3TFRA 4NLKA 2G5HB 1SZPA 1BPZA 3H4BA 5KAIU 4B9SA 3AQFA 4IL6U 1OXJA 4I2IA 5AM5A 2HI0A 2BKEA 2IOFK 4J9NA 2EANA 4KMOB 1T4GA 1D9DA 1RQNA 4EBDA 2O6KA 2HHSA 5KFJA 1T3NA 5KFZA 3WK6A 1MQ3A 3JPSA 5AK6A 3B9JA 3PMLA 2JZBB 3OJUA 1NZPA 4O3RA 4C7YA 1ZD5A 3UMCA 4DSFA 3RBEA 1S77D 4M9LA 8ICQA 3PSPA 7ICVA 5ALHA 1B4FA 1KN5A 4Y2RA 1X2IA 3NRWA 4O5EA 3H0MB 4QZ9A 2HBLA 3HP6A 2AU0A 1L3VA 3MR6A 1WWVA 1UA1A 2IOFA 2RRDA 2HHXA 5L9XA 4Q8EA 2ZIWA 4KLLA 4BUGA 4EZ6A 4K4IA 4UB4A 3SEIA 1N5WA 3OHBA 4ED3A 2HSZA 2OXOA 2VIXA 1J2NA 1L8OA 4OJLA 5CHGA 2FLNA 5DB7A 4C7ZA 3KHGA 3ZD8A 2FMQA 3E58A 2EH9A 1PZNA 4IRKA 4EBCA 4MEYA 3V7KA 2KOBA 1Z00A 5AIAA 4UBCA 4F5RA 1NKBA 4P0PA 4O3QA 2BDUA 4FBTA 5AKJA 4ED8A 3D6JA 3TAPA 2XC9A 4JV1A 4KX3A 2XICA 4O3NA 9ICNA 3WU2U 4KN7A 4AYBC 3G6XA 1WYGA 2KIVA 4RPZA 9ICXA 2I5HA 3ETRA 4DLEA 2BZFA 1ZQCA 2KNJA 3C5GA 3HKZF 5AI0A 4UAWA 5J2HA 4Y2XA 3C1YA 4EELA 4YD1A 2EAMA 1V97A 1ZYQA 1NK0A 2KP7A 5BOLA 4O3OA 3JPQA 1D8BA 1ZQYA 3BQ0A 1XO0A 9ICVA 4DL4A 3V6HA 8ICPA 5KFKA 2GWSA 2IBKA 3I76A 4NXZA 1KRPA 5ALPA 4QIWC 3IG5A 4RQ3A 3L3FX 7ICUA 2P35A 4RQ7A 3ALRA 1RYSA 1UCVA 5KG3A 5KFQA 2A1AA 2KEYA 3JPNA 4IR1A 4DSLA 3H8JA 2JV3A 4EEYA 3MR2A 3ZDCA 3O0FA 1TK8A 5AI4A 1QSLA 2K8AA 1X6IA 1ZQBA 2WF6A 4FBUA 4DWIA 1N48A 1SV0C 2RDJA 4C8MA 2HHUA 5HMLA 4F4YA 2C22A 7ICOA 2I9GA 3ZDDA 4FZLA 2Q4TA 1T94A 2FPKA 1TAQA 3SQIA 3QU5A 1PK3A 4PZOA 8ICXA 4FZNA 4QWEA 4B9MA 5KFLA 2DF4B 7ICHA 2JZBA 2W9AA 7ICMA 4Z6FA 1NJZA 4B9LA 4KLEA 5ALQA 4OJOA 1ZQWA 3N7PD 3SAGA 5DGBA 5AKXA 5EE1A 2JH7A 4R65A 4Q44A 4DF4A 3LWLA 2WB1C 1ECWA 4X5VA 2P6UA 3F5EA 5KG0A 2QARA 4DQQA 1F0MA 4I2JA 3PR5B 3H7IA 1MQ2A 3GU3A 1JROA 2LPEA 3NS1A 1WG8A 3SV4A 4F4WA 5KFFA 8ICMA 4TUPA 4RNOA 3WKEA 5CR0A 2DKXA 1PVPA 5J0XA 1VDVA 5KG4A 4KLFA 5KT6A 1ZQKA 4YN4A 2ZIXA 2K4IA 2LHTA 4JK1A 1U49A 3BQ1A 4F91B 4P4OA 2BPCA 3HRDD 3F2BA 2WAQF 4DSJA 1D8YA 1O03A 4YXMA 1ZQEA 4J9PA 5DLFA 2XI9A 2VA3A 4BDPA 5J0YA 4FFDA 2IHMA 2VA2A 3FDSA 4P4MA 9ICTA 4P0QA 4P2HA 4PHAA 1ZQLA 4Q45A 2KICA 3RJJA 5ALKA 5BOMA 2I1QA 3ED5A 3L4PA 3C5FA 1X9XA 3SR6A 1SL1A 1T3QA 3TI0A 9ICCA 1COKA 2AH5A 2YQEA 2Y9TA 2ZIVA 4RT2A 4YMOA 2AGPA 1ZQUA 9ICJA 4NLCA 5G5HA 3B0XA 4B6JA 1ED1A 4BJQA 4O5CA 2HDOA 4US8A 4QZEA 4ECZA 4IQVA 2R8IA 1Q46A 4ELUA 2K8CB 2W9BA 5ALXA 2FMPA 3H8MA 2Y0SF 3ISBA 1S9FA 8ICIA 1A0PA 4C8LA 2ASJA 1ZQDA 3C1ZA 1SKRA 1ZRMA 1ZQOA 2ZUCA 4M2YA 2XY6A 1LKYB 5KFBA 5J0OA 9ICBA 2ZJ5A 5DDMA 2BQ3A 3T5KA 2PKEA 5HP4A 3ISCA 4DL7A 2ISPA 4DL2A 2CPRA 3QU7A 2JGAA 2WF7A 1O08A 4KTQA 4TUQA 5KFUA 1NZBA 2UVVA 9ICRA 4F50A 2ZXHA 1U9LA 4M9NA 1BNOA 3PX6A 2ZTEA 2N1RA 5KFRA 8ICEA 2RDIA 3QUBA 2J6UA 2FMSA 2D3DA 1LB2B 3JPRA 1ZQTA 2HHTA 3AMZA 4QW8A 5D49A 3BS5A 1TAMA 5DBAA 3EWAA 5ALOA 2GLEA 7ICNA 3PW4A 2K4HA 4ECRA 4ZOHC 5JRTA 2E1EA 1QCKA 2AHOB 2IOHA 4PPXA 5AKEA 5CA7A 1KKXA 3UXPA 1NI3A 4R66A 1FFUA 3FM9A 5KFYA 5AI9A 5DB8A 1KW4A 2F1JA 2G09A 4RQ2A 2BR0A 1N61A 8ICCA 1TK5A 4YVZA 4Y2JA 1D9FA 1QSYA 2IA6A 2XVTA 5DQHA 3DV9A 3BZKA 2PMZC 2AXTU 2HHVA 4JMUA 2BCQA 4B9NA 4UASA 4CF3A 4G3IA 1YT3A 3IRUA 5B5EU 3GIKA 3TADA 5ALNA 2HBKA 2W04A 4R63A 2NRWA 5DKWA 2XGQA 2BDPA 4CRXA 5EE9A 4KLGA 2YMQA 4RQ4A 2W9CB 4QW9A 4I2FA 3HX0A 1B0XA 2YMMA 4C8KA 9ICGA 4M9GA 1VLBA 4XA5A 3MFHA 3T5LA 7ICIA 2Z7JA 3F2CA 9ICAA 4PGYA 3BJYA 2KV2A 4QZGA 2LI6A 1NNLA 3PSTA 3CNHA 3J81j 2DGZA 4JV2A 3FYHA 2F2AB 4RT3A 4CDGA 4IC9A 4QNLA 4OJ6A 5HHIA 2EZZA 1TK0A 1KFDA 2ZXIA 2BPGA 1CRXA 1XSPA 4KLDA 1ZQAA 9ICIA 2FJ6A 3LK9A 3QX7A 3GV7B 1SKWA 4UB2A 3PSIA 2FLLA 3V6JA 4NLGA 2I6XA 3MGIA 4RQ6A 3T5HA 1ZD3A 5DBBA 4F5PA 2DPIA 4K4GA 4QWBA 4ED0A 1ZQPA 3QNMA 1PK1B 1UT5A 3SAHA 1JALA 5J2KA 2ALZA 2VJ4A 4F72A 3RFAA 4FS2A 3NVVA 1XS9D 1RYRA 4F2SA 4O0IA 1X6JA 2B21A 2YMLA 1C20A 3IP4B 4ECTA 5F9NA 1QH9A 1F5SA 3UQ2A 2BQUA 4DSKA 4CF5A 1KSPA 3NRZA 4NLBA 4XQ8A 4GC7A 5AKHA 4J9QA 2H3FA 2LYBA 2PI4A 2E8OA 4J9KA 2QARB 4DFJA 2XO7A 2HHWA 4LVSA 5KFCA 4DS4A 1BVSA 3WK5A 2FDRA 3OGUA 2P66A 3JPOA 7ICLA 4NV0A 5AKLA 2LM1A 3K4GA 3NVYA 5KFDA 5IIOA 5ALVA 1N5XA 1XWLA 9ICHA 2Q0ZX 1IV8A 4FE3A 4O3PA 3KD3A 4C80A 1X9MA 2KMDA 1UPHA 3H0LB 1T7PA 3Q8MA 2PFNA 1KTQA 2LYAA 3HKZC 2KHVA 4RUCA 4F93B 1Z3EB 5TZVA 4P0QB 2G5IB 4U6PA 4PHEA 3GZFA 4UBBA 8ICNA 3MBYA 4DFKA 3JPTA 1CEZA 4USAA 5GTHU 1XO1A 1L7NA 1L7OA 1UHUA 4NLZA 1LV5A 4UAZA 3ZI4A 3PY8A 3OSPA 1SIJA 4US9A 1RG6A 3BS7A 4NWIA 4RUAA 3ZDEA 2FPLA 8ICFA 5KFHA 2ASDA 4ZH4A 1OUQA 7ICJA 3KTQA 1AQ6A 1A77A 2A19A 1L3UA 3H0RB 2AJQA 2BQRA 4DS5A 1MC8A 1RXVA 1HIWA 2XGPA 1TV9A 2OWOA 5ALFA 5J8YA 1KFTA 4ECXA 1X9WA 3SV3A 2W3RA 5KT3A 4DFMA 8ICVA 4ECSA 2NO5A 4NL9C 2UVWA 4RQ0A 1NK9A 1FFVA 4RZRA 1BPBA 1S76D 1B22A 1BPDA 4DFPA 4R64A 4CNQA 4ECWA 3HILA 2YY6A 3C23A 5KFPA 4NL9A 1ZD2P 5DG8A 2FPMA 3PW7A 2PI5A 2XCAA 3OHAA 2BCVA 3RRGA 3RJFA 8ICUA 4J9MA 2HCFA 3PW0A 3M9NB 2D6FC 4I28A 2BHNA 4GC6A 5AKIA 3RH6A 3H8WA 4TURA 5T14A 4YR2A 5AM4A 3RB0A 4Y2TA 1KEJA 5IIJA 5DQGA 4DL5A 3GIJA 4O3SA 5HMMA 4F3OA 3DEEA 4NJ8A 4PJ0U 4RQNA 5J2BA 5D46A 4DQIA 2HVIA 9ICEA 5EWEA 2JXJA 1C7YA 4F5NA 9ICFA 5DQIA 3TADC 5KFOA 3WK8A 5AKGA 5E79U 1WWUA 4MHVA 3SMVA 4UAUA 5G5GA 1JI7A 3EZ5A 5B66U 2NO4A 2J6TA 7ICPA 4KLSA 2FLPA 5ALGA 1UA0A 3IDWA 3D2SA 4Z6DA 4I2CA 2DWQA 5AIBA 5J29A 1SXEA 2R8GA 2KZ3A 4DOCA 2ZTCA 2K60A 3SAFA 1MSWD 3FC4A 1HUZA 2ZJ8A 2MU2A 2KTQA 5D4BA 4C0ZA 2KJ8A 5AM3A 1OW5A 3WKAA 2RHFA 4R8UB 2LYHA 3TAQA 1L6NA 2EZXA 4GXJA 3QEBZ 1KFSA 3RR8A 2J6SA 4KLIA 2ZJAA 4GFJA 3N28A 2W7PA 4Z6CA 1H38A 2C2DA 4DSEA 4ED1A 3Q8KA 3QUQA 1L7PA 1SV0A 2MRLA 5IIKA 5L1KA 5EOZA 3M6ZA 5ALJA 1Z19A 5DG9A 5ALMA 4QZCA 4LZDA 3C2LA 3MGHA 2BPFA 3T5JA 5GTIU 5J2CA 2KZMA 2F8LA 1WCNA 5DGAA 4GIBA 1N60A 2D8CA 4RNMA 2NRTA 5KFNA 2E5SA 1X40A 2WTFA 4I29A 1L3TA 1WUDA 1XC9A 5KFWA 4J9RA 1QQ6A 3RH4A 2OEHA 1Q3VA 4CCHA 8ICOA 1XU4A 2MAXA 4IQWA 1URJA 3C29A 5KFGA 1F44A 5HNKA 1TVAA 4C4RA 2KFNA 4UW9A 3AN1A 4M6WA 3WKCA 3RTVA 5J0QA 3F2DA 1UT8A 1DOQA 3KHHA 9ICOA 3PW5A 3H40A 1RM6C 2H3ZA 2OHFA 3M9OB 3V72A 1ZQMA 5JUMA 2QB0B 4UQGA 5KTQA 3QZ7A 3N7SC 2ZUDA 3ICXA 5IIIA 2ESEA 2DQNB 1SL0A 4F5OA 4C4TA 3KZIU 1S8OA 5AM0A 4C8NA 2IHNA 1CI4A 3F5AA 3V7LA 2V4RA 3AU6A 3LVVA 3ETLA 3T79A 3IM1A 1SL2A 3QU4A 3PZPA 4C4SA 4UB1A 3WKBA 3TFSA 1NJYA 3NASA 1MN8A 4TQSA 1LVHA 2MUTB 2CXYA 2ZIWB 2LM4A 3UQ0A 2WF9A 1P7DA 4MFCA 1ZRNA 4M9HA 1N63A 1T8EA 1JUDA 3Q8QB 1NKCA 5KFMA 4PHPA 2W8LA 3GV5B 5KNIA 1SWVA 2QKQA 2F44A 2LBOA 1X9SA 4MEXA 2ZUBA 4P4PA 3UMBA 1NK6A 2JHDA 3IHQB 2E8MA 2KD1A 3EUB2 1B43A 5L1IA 5KT7A 2KVSA 4QZBA 4CGZA 3RB3A 3Q8RB 2R8HA 5J0SA 4KX5A
chains in the Genus database with same CATH topology
1JI7A 1SV4A 5L1MA 1PK3A 4PZOA 1V85A 1Z1VA 2EAPA 3K1RB 4IS7A 3SENA 1LKYA 3IDWA 2F3NA 1DXSA 2B6GA 3H8MA 2QB0B 2DKZA 1SXEA 1UQVA 1PK1A 3BQ7A 2K60A 1OXJA 2Y9UA 3TADA 2ESEA 2FE9A 5J8YA 2KIVA 3TACB 1SXDA 2E8OA 2QARA 1F0MA 2QARB 1OW5A 2ES6A 1LKYB 2L5YA 2E8NA 2F8KA 2EANA 4NL9C 3KKAA 2LPEA 5F3XB 2EAMA 1B0XA 3KKAC 2DKXA 3HILA 2EAOA 4NL9A 3BS5B 2KE7A 1SGGA 1UCVA 1SV0A 2D3DA 1B4FA 1X66A 2KMDA 2KSOB 1V38A 2LMRA 3BS5A 2KSOA 2JV3A 2GLEA 1WWVA 5KNIA 5JRTA 2QKQA 5JTIA 2YTUA 2QB1A 2F44A 2DL0A 2K4PA 2E8PA 4NJ8A 1X9XA 4RQNA 2D8CA 1X40A 2KG5A 3SEIA 2E8MA 1SV0C 1KW4A 1COKA 4PZNA 5J8YC 5JU5A 3TADC 2Y9TA 1RG6A 2QB0A 1WWUA 3BS7A 4MHVA 1PK1B 4RQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI7 A;  1SV4 A;  5L1M A;  1PK3 A;  4PZO A;  1V85 A;  1Z1V A;  2EAP A;  3K1R B;  4IS7 A;  3SEN A;  1LKY A;  3IDW A;  2F3N A;  1DXS A;  2B6G A;  3H8M A;  2QB0 B;  2DKZ A;  1SXE A;  1UQV A;  1PK1 A;  3BQ7 A;  2K60 A;  1OXJ A;  2Y9U A;  3TAD A;  2ESE A;  2FE9 A;  5J8Y A;  2KIV A;  3TAC B;  1SXD A;  2E8O A;  2QAR A;  1F0M A;  2QAR B;  1OW5 A;  2ES6 A;  1LKY B;  2L5Y A;  2E8N A;  2F8K A;  2EAN A;  4NL9 C;  3KKA A;  2LPE A;  5F3X B;  2EAM A;  1B0X A;  3KKA C;  2DKX A;  3HIL A;  2EAO A;  4NL9 A;  3BS5 B;  2KE7 A;  1SGG A;  1UCV A;  1SV0 A;  2D3D A;  1B4F A;  1X66 A;  2KMD A;  2KSO B;  1V38 A;  2LMR A;  3BS5 A;  2KSO A;  2JV3 A;  2GLE A;  1WWV A;  5KNI A;  5JRT A;  2QKQ A;  5JTI A;  2YTU A;  2QB1 A;  2F44 A;  2DL0 A;  2K4P A;  2E8P A;  4NJ8 A;  1X9X A;  4RQN A;  2D8C A;  1X40 A;  2KG5 A;  3SEI A;  2E8M A;  1SV0 C;  1KW4 A;  1COK A;  4PZN A;  5J8Y C;  5JU5 A;  3TAD C;  2Y9T A;  1RG6 A;  2QB0 A;  1WWU A;  3BS7 A;  4MHV A;  1PK1 B;  4RQM A; 
#chains in the Genus database with same CATH topology
 2K89 A;  5L1M A;  5KL8 B;  8ICG A;  4BGD A;  3OSN A;  3GIM A;  4CE6 A;  1Z1B A;  3RJG A;  4QWA A;  5AI8 A;  3PX4 A;  3SD7 A;  2NV3 A;  5KFX A;  4UAR A;  4Y2S A;  3HPO A;  2OCE A;  2YX8 A;  1CUK A;  1ZQX A;  4XRH A;  2ASL A;  1UQV A;  3ZDA A;  5AK4 A;  3F53 A;  4KLQ A;  2VA8 A;  3DDH A;  5KFV A;  3UPQ A;  5AI5 A;  2KVC A;  2L5Y A;  1U45 A;  2EQY A;  3N4M B;  3MFI A;  3KKA A;  7ICQ A;  1DGJ A;  2K4E A;  2JEF A;  3E0F A;  4AP9 A;  3Q8P B;  1SWW A;  2C2E A;  4YXJ A;  4KLJ A;  4QZA A;  7ICK A;  1U4B A;  2W55 A;  2DBY A;  1HJP A;  4RQ5 A;  4EYI B;  5F9L A;  3AL0 B;  1JXE A;  4ECU A;  8ICH A;  3LYS A;  2W8K A;  5A0L A;  1L3S A;  4I2E A;  4DLG A;  5AK5 A;  4JWN A;  2A3V A;  5IIN A;  5AK3 A;  3Q8L A;  3UXO A;  2LKY A;  4A8E A;  2G06 A;  3SYZ A;  5AIC A;  4DFD A;  5EWF A;  2WHE A;  3ZD9 A;  1ZQS A;  4J9O A;  5KT2 A;  8ICY A;  2HBM A;  3LVW A;  5AKZ A;  1KL9 A;  1FEZ A;  2BGW A;  2EDU A;  2F77 X;  5AM1 A;  3M6K A;  2HOI A;  3C28 A;  3KHR A;  4KLM A;  3T3F A;  1RXW A;  3TAN A;  2W03 A;  4Y2Q A;  4EEN A;  3GV8 B;  3R9K A;  2HBJ A;  2KZZ A;  5HHH A;  4LZG A;  3AM9 A;  2H5X A;  2EAP A;  9ICP A;  2JEI A;  4HAI A;  2IMW P;  2NRV A;  1S0V A;  4YMN A;  3PMN A;  1XSL A;  1MA7 A;  2OH2 A;  2M0N A;  4BXO A;  2OYY A;  3GDX A;  4TQR A;  5CB1 A;  5CEH A;  3LDA A;  5J2F A;  2Y0S C;  4EX6 A;  1WCL A;  4NY8 A;  2FE9 A;  5C5J A;  4F4K A;  4PL1 A;  3RH5 A;  2DFL A;  3TAC B;  2ISO A;  3D2Q A;  3NVZ A;  9ICM A;  4F92 B;  3BDP A;  3HW8 A;  5IIM A;  2ES6 A;  1SKS A;  5KG5 A;  4I2D A;  3WK9 A;  4EYH B;  8ICK A;  2PFP A;  9ICL A;  5L1L A;  3WKD A;  5ALR A;  2H3I A;  1NOM A;  3ONN A;  4JWM A;  2NRX A;  2DPJ A;  1IG6 A;  2V4Q A;  2QLT A;  4PH5 A;  4DOA A;  4OJ5 A;  4OJP A;  1JN3 A;  8ICW A;  3VC8 A;  1NK8 A;  3EPG A;  5DBC A;  2AQ4 A;  4NLN A;  5DB9 A;  1TAU A;  5DG7 A;  1DGS A;  1BPY A;  4DSI A;  3PR4 A;  2H3V A;  3TQ1 A;  4YQW A;  1L8L A;  3OPX A;  4F4X A;  4ELT A;  4DOB A;  5KT5 A;  4QWC A;  3KOO A;  5TIS U;  3G6Y A;  4F4Z A;  1DK2 A;  4TUS A;  4YR0 A;  3E2E A;  2BCU A;  2K4P A;  4YMM A;  4DO9 A;  4EEK A;  5IIL A;  1KLN A;  2WF8 A;  4B9U A;  2XCP A;  4IRC A;  5ALZ A;  3M9M B;  1D8L A;  3C2M A;  4HYK A;  3GQC A;  4KLO A;  3BQ2 A;  2ATL A;  5EWG A;  3NVW A;  4C8O A;  4IR9 A;  1ZXI A;  3TKA A;  1Z1V A;  3RBD A;  4XUS A;  4PL2 A;  2A1J A;  1NJX A;  1ZQH A;  4M9J A;  4Y2P A;  4YCX A;  5KFE A;  2G07 A;  4ECY A;  3RJK A;  9ICQ A;  1K5O A;  3MDC A;  5DDY A;  4UAT A;  1SXD A;  5H2F U;  2C28 A;  3PVX A;  3RB6 A;  4DEZ A;  9ICS A;  4ECQ A;  1SB3 C;  4YG2 A;  2E8N A;  4G9B A;  1HEK A;  2H3Q A;  9ICW A;  2M9N A;  2W54 A;  3OJS A;  1JMS A;  3QE9 Y;  3RF9 A;  4Y2Y A;  4M0A A;  3RJE A;  8ICJ A;  4LJX A;  5HR7 A;  4O3M A;  1K1S A;  4NM1 A;  2G0A A;  3SI8 A;  4RQ8 A;  2KE7 A;  1ZQG A;  3PNC A;  3MGV A;  1NK7 A;  5J0U A;  2V9W A;  3AQE A;  7ICT A;  1QQ5 A;  1PVQ A;  4MF8 A;  3N97 B;  3CRX A;  2LMR A;  4O9M A;  3NTU A;  4UB6 U;  1X42 A;  4JUZ A;  4CF4 A;  5AKY A;  2F76 X;  3QEA Z;  3SZ2 A;  3H4D A;  3N7R C;  2YTU A;  4F5Q A;  4UAV A;  2KKP A;  4M04 A;  3L5K A;  1IM4 A;  4OO1 J;  3PSF A;  5ALW A;  4YD2 A;  4AYB F;  1XSN A;  4FS1 A;  2VAN A;  1A6S A;  2R18 A;  1DRG A;  3QUT A;  2HW3 A;  1L5U A;  4I27 A;  4PZN A;  2YMP A;  8ICS A;  1A76 A;  1Q8K A;  3MR3 A;  2MSN A;  1BNP A;  5KT4 A;  4PHD A;  4ECV A;  4EZ9 A;  5J2I A;  2UVU A;  5C0Y A;  3PO5 A;  4MF2 A;  2WB1 F;  5J2G A;  5ALD A;  5AKK A;  4YFK A;  1DXS A;  3VCB A;  1NJW A;  3LWM A;  3MC1 A;  1NK5 A;  3PX0 A;  3KHL A;  1S0M A;  3PV8 A;  4U7C A;  4F2R A;  4GLX A;  1ZQF A;  5CRX A;  5KG1 A;  1TFR A;  4M6W B;  8ICB A;  1TE2 A;  2JEJ A;  2BCS A;  8ICR A;  2F8K A;  4ACO A;  4J9L A;  2E1F A;  2GOL A;  1DK3 A;  1Z4O A;  3MAB A;  2RQ5 A;  2W9M A;  1ZJM A;  2JEG A;  1ZOL A;  4QWD A;  4ELV A;  2G08 A;  5EE3 A;  4KIT B;  3Q8S B;  2EAO A;  2CRX A;  2ZIU B;  3BS5 B;  4J03 A;  1QLN A;  3OTQ A;  4J9S A;  3V6K A;  5J0R A;  1SGG A;  5ALL A;  3QU2 A;  3M7D A;  4DQS A;  4KLT A;  3G6V A;  2YB4 A;  3NUQ A;  5ALU A;  4KLU A;  3B0Y A;  5CJ7 A;  1RDF A;  2VKQ A;  4GXK A;  2KJ5 A;  2HOF A;  2PFQ A;  2KK0 A;  4YR3 A;  4NM2 A;  2QB1 A;  4PGQ A;  3H8S A;  4QZI A;  3ORY A;  2BCR A;  5BPC A;  4DQR A;  1U47 A;  3TAR A;  3QU9 A;  3HWT A;  1Q3U A;  1QTM A;  2UVR A;  4P0P B;  5J8Y C;  1N62 A;  2KFZ A;  4UB8 U;  5ALT A;  1ZQJ A;  4I2A A;  4M47 A;  4RQM A;  4ICA A;  9ICU A;  1N56 A;  5KAF U;  1EXN A;  5KFI A;  1KQQ A;  5DLG A;  3S6J A;  4UB3 A;  9ICK A;  1BGX T;  1FO4 A;  2F3N A;  3QXG A;  2B6G A;  4OCZ A;  3UXN A;  2JMG A;  2XY7 A;  2DKZ A;  5KG2 A;  3I28 A;  3GII A;  1PK1 A;  3KFU F;  3QZ8 A;  3GFK B;  3EYZ A;  3EW9 A;  2Y9U A;  2W9C A;  1NK4 A;  1J97 A;  3M8R A;  2W43 A;  1U48 A;  1XNS A;  1VJ5 A;  3ISD A;  2ZG6 A;  1S0N A;  1ZET A;  4PGX A;  1ZQI A;  4BXO B;  4RU9 A;  7ICS A;  1ZQN A;  2KKV A;  4ED6 A;  2GH1 A;  1ZQQ A;  3KKA C;  4ED2 A;  3D2N A;  1TKD A;  2W9B B;  4BWJ A;  2ODG A;  5J2E A;  3RB4 A;  2RLT A;  1X66 A;  8ICT A;  1YZ7 A;  2KSO A;  1RQL A;  3AUO A;  3CP8 A;  2KHQ A;  2PFO A;  2Y1J A;  5L1J A;  5AI6 A;  3QYP A;  2WF5 A;  1K1Q A;  2B0C A;  3THV A;  2AQ0 A;  1IIP A;  1V9P A;  3MR5 A;  3EPI A;  3AEV A;  4GXI A;  3RR7 A;  4UAY A;  1RYU A;  4MFA A;  2KJ9 A;  3NGD A;  4QIW F;  3K1Z A;  3I1Y A;  5J0P A;  2R8K A;  2WFA A;  2P6R A;  2MA1 A;  2NRZ A;  4EBE A;  5JU5 A;  4ED7 A;  1Z00 B;  5AM2 A;  3AU2 A;  3V7J A;  1NKE A;  5J2A A;  1JXL A;  3HT3 A;  3PW2 A;  7ICR A;  3A0B U;  4I2B A;  4MFF A;  7ICE A;  2HHQ A;  1JX4 A;  2HVH A;  5J0T A;  1RZT A;  3K1R B;  4IQU A;  2ZIU A;  4DF8 A;  1ZJN A;  4FO6 A;  4K4H A;  1GO3 F;  2Y1I A;  3BQ7 A;  1S0O A;  2XID A;  4UB5 A;  5ALE A;  1PVR A;  2A1J B;  2HMX A;  1IXR A;  4B9V A;  3M1Y A;  4F8R A;  5DB6 A;  2C2R A;  3KBB A;  3MDA A;  4Y2U A;  7ICG A;  3UMG A;  4F71 A;  4Z6E A;  4QZF A;  4Q8F A;  4B9T A;  5J2D A;  4BX9 C;  5CWR A;  5KFA A;  4R8U A;  3JPP A;  1HUO A;  4E0D A;  4RPX A;  2FI1 A;  4DQP A;  4KLH A;  5HR6 A;  2NYV A;  1JIH A;  1S97 A;  5ALY A;  5EE0 A;  2OM6 A;  4Q43 A;  2KN7 A;  3IV6 A;  2KSO B;  1V38 A;  2KIW A;  5ALS A;  2VJ5 A;  1ARO P;  2F1I A;  3PO4 A;  1ZQV A;  3C21 A;  5CP2 A;  3C2K A;  4I2G A;  5JTI A;  3M8S A;  3CW2 C;  2DL0 A;  4FZM A;  2DUY A;  2E8P A;  1L7M A;  2KG5 A;  4RNN A;  3ZDB A;  3GIL A;  3BZC A;  5KG6 A;  5KG7 A;  1QSS A;  8ICA A;  5KFS A;  2W11 A;  2JRZ A;  5AHX A;  4BWM A;  1KDH A;  4IQT A;  2HOQ A;  2YB1 A;  3U26 A;  2PMZ F;  2CN1 A;  1Z4N A;  3K75 D;  1V85 A;  1COO A;  2YN4 A;  4QZ8 A;  1LKY A;  2ZTD A;  1RPL A;  5KFT A;  3WK4 A;  4DCC A;  4EX7 A;  5J2J A;  4OD0 A;  5K4L A;  5FP0 A;  1JRP A;  4WJ3 B;  4Y2V A;  1BPE A;  1ZQ1 C;  4KMU A;  1YZ6 A;  1M6Y A;  2WAQ C;  3IG8 A;  7ICF A;  4RQ1 A;  2ZIX B;  4JB3 A;  8ICZ A;  5F3X B;  3UM9 A;  1S5L U;  4O5K A;  2E3T A;  3RJH A;  1J2M A;  3QUC A;  1QQ7 A;  3RRH A;  3RJI A;  4QZH A;  1ZQZ A;  4KN4 A;  2R8J A;  5KL1 B;  1BPX A;  8ICL A;  3WK7 A;  4IRD A;  2EZY A;  1ZD4 A;  2W3S A;  2F1H A;  3A0H U;  2MUT A;  2K8B B;  1SZH A;  4QJF B;  1S10 A;  1KBU A;  3HJE A;  3RAQ A;  5ALI A;  4DL3 A;  2ZIV B;  2JR5 A;  3RAX A;  4JV0 A;  2XY5 A;  3BQT A;  3IN5 A;  3FAH A;  1FIQ A;  2JH1 A;  1N2X A;  4RPY A;  2QB0 A;  3CYM A;  1PUZ A;  4QZD A;  5J0W A;  2AGQ A;  1SV4 A;  4YP3 A;  1Y88 A;  2PXI A;  2AGO A;  1ZQR A;  4IS7 A;  3SEN A;  3KZX A;  2GO7 A;  2W7O A;  4DL6 A;  4I2H A;  2RP5 A;  3TFR A;  4NLK A;  2G5H B;  1SZP A;  1BPZ A;  3H4B A;  5KAI U;  4B9S A;  3AQF A;  4IL6 U;  1OXJ A;  4I2I A;  5AM5 A;  2HI0 A;  2BKE A;  2IOF K;  4J9N A;  2EAN A;  4KMO B;  1T4G A;  1D9D A;  1RQN A;  4EBD A;  2O6K A;  2HHS A;  5KFJ A;  1T3N A;  5KFZ A;  3WK6 A;  1MQ3 A;  3JPS A;  5AK6 A;  3B9J A;  3PML A;  2JZB B;  3OJU A;  1NZP A;  4O3R A;  4C7Y A;  1ZD5 A;  3UMC A;  4DSF A;  3RBE A;  1S77 D;  4M9L A;  8ICQ A;  3PSP A;  7ICV A;  5ALH A;  1B4F A;  1KN5 A;  4Y2R A;  1X2I A;  3NRW A;  4O5E A;  3H0M B;  4QZ9 A;  2HBL A;  3HP6 A;  2AU0 A;  1L3V A;  3MR6 A;  1WWV A;  1UA1 A;  2IOF A;  2RRD A;  2HHX A;  5L9X A;  4Q8E A;  2ZIW A;  4KLL A;  4BUG A;  4EZ6 A;  4K4I A;  4UB4 A;  3SEI A;  1N5W A;  3OHB A;  4ED3 A;  2HSZ A;  2OXO A;  2VIX A;  1J2N A;  1L8O A;  4OJL A;  5CHG A;  2FLN A;  5DB7 A;  4C7Z A;  3KHG A;  3ZD8 A;  2FMQ A;  3E58 A;  2EH9 A;  1PZN A;  4IRK A;  4EBC A;  4MEY A;  3V7K A;  2KOB A;  1Z00 A;  5AIA A;  4UBC A;  4F5R A;  1NKB A;  4P0P A;  4O3Q A;  2BDU A;  4FBT A;  5AKJ A;  4ED8 A;  3D6J A;  3TAP A;  2XC9 A;  4JV1 A;  4KX3 A;  2XIC A;  4O3N A;  9ICN A;  3WU2 U;  4KN7 A;  4AYB C;  3G6X A;  1WYG A;  2KIV A;  4RPZ A;  9ICX A;  2I5H A;  3ETR A;  4DLE A;  2BZF A;  1ZQC A;  2KNJ A;  3C5G A;  3HKZ F;  5AI0 A;  4UAW A;  5J2H A;  4Y2X A;  3C1Y A;  4EEL A;  4YD1 A;  2EAM A;  1V97 A;  1ZYQ A;  1NK0 A;  2KP7 A;  5BOL A;  4O3O A;  3JPQ A;  1D8B A;  1ZQY A;  3BQ0 A;  1XO0 A;  9ICV A;  4DL4 A;  3V6H A;  8ICP A;  5KFK A;  2GWS A;  2IBK A;  3I76 A;  4NXZ A;  1KRP A;  5ALP A;  4QIW C;  3IG5 A;  4RQ3 A;  3L3F X;  7ICU A;  2P35 A;  4RQ7 A;  3ALR A;  1RYS A;  1UCV A;  5KG3 A;  5KFQ A;  2A1A A;  2KEY A;  3JPN A;  4IR1 A;  4DSL A;  3H8J A;  2JV3 A;  4EEY A;  3MR2 A;  3ZDC A;  3O0F A;  1TK8 A;  5AI4 A;  1QSL A;  2K8A A;  1X6I A;  1ZQB A;  2WF6 A;  4FBU A;  4DWI A;  1N48 A;  1SV0 C;  2RDJ A;  4C8M A;  2HHU A;  5HML A;  4F4Y A;  2C22 A;  7ICO A;  2I9G A;  3ZDD A;  4FZL A;  2Q4T A;  1T94 A;  2FPK A;  1TAQ A;  3SQI A;  3QU5 A;  1PK3 A;  4PZO A;  8ICX A;  4FZN A;  4QWE A;  4B9M A;  5KFL A;  2DF4 B;  7ICH A;  2JZB A;  2W9A A;  7ICM A;  4Z6F A;  1NJZ A;  4B9L A;  4KLE A;  5ALQ A;  4OJO A;  1ZQW A;  3N7P D;  3SAG A;  5DGB A;  5AKX A;  5EE1 A;  2JH7 A;  4R65 A;  4Q44 A;  4DF4 A;  3LWL A;  2WB1 C;  1ECW A;  4X5V A;  2P6U A;  3F5E A;  5KG0 A;  2QAR A;  4DQQ A;  1F0M A;  4I2J A;  3PR5 B;  3H7I A;  1MQ2 A;  3GU3 A;  1JRO A;  2LPE A;  3NS1 A;  1WG8 A;  3SV4 A;  4F4W A;  5KFF A;  8ICM A;  4TUP A;  4RNO A;  3WKE A;  5CR0 A;  2DKX A;  1PVP A;  5J0X A;  1VDV A;  5KG4 A;  4KLF A;  5KT6 A;  1ZQK A;  4YN4 A;  2ZIX A;  2K4I A;  2LHT A;  4JK1 A;  1U49 A;  3BQ1 A;  4F91 B;  4P4O A;  2BPC A;  3HRD D;  3F2B A;  2WAQ F;  4DSJ A;  1D8Y A;  1O03 A;  4YXM A;  1ZQE A;  4J9P A;  5DLF A;  2XI9 A;  2VA3 A;  4BDP A;  5J0Y A;  4FFD A;  2IHM A;  2VA2 A;  3FDS A;  4P4M A;  9ICT A;  4P0Q A;  4P2H A;  4PHA A;  1ZQL A;  4Q45 A;  2KIC A;  3RJJ A;  5ALK A;  5BOM A;  2I1Q A;  3ED5 A;  3L4P A;  3C5F A;  1X9X A;  3SR6 A;  1SL1 A;  1T3Q A;  3TI0 A;  9ICC A;  1COK A;  2AH5 A;  2YQE A;  2Y9T A;  2ZIV A;  4RT2 A;  4YMO A;  2AGP A;  1ZQU A;  9ICJ A;  4NLC A;  5G5H A;  3B0X A;  4B6J A;  1ED1 A;  4BJQ A;  4O5C A;  2HDO A;  4US8 A;  4QZE A;  4ECZ A;  4IQV A;  2R8I A;  1Q46 A;  4ELU A;  2K8C B;  2W9B A;  5ALX A;  2FMP A;  3H8M A;  2Y0S F;  3ISB A;  1S9F A;  8ICI A;  1A0P A;  4C8L A;  2ASJ A;  1ZQD A;  3C1Z A;  1SKR A;  1ZRM A;  1ZQO A;  2ZUC A;  4M2Y A;  2XY6 A;  1LKY B;  5KFB A;  5J0O A;  9ICB A;  2ZJ5 A;  5DDM A;  2BQ3 A;  3T5K A;  2PKE A;  5HP4 A;  3ISC A;  4DL7 A;  2ISP A;  4DL2 A;  2CPR A;  3QU7 A;  2JGA A;  2WF7 A;  1O08 A;  4KTQ A;  4TUQ A;  5KFU A;  1NZB A;  2UVV A;  9ICR A;  4F50 A;  2ZXH A;  1U9L A;  4M9N A;  1BNO A;  3PX6 A;  2ZTE A;  2N1R A;  5KFR A;  8ICE A;  2RDI A;  3QUB A;  2J6U A;  2FMS A;  2D3D A;  1LB2 B;  3JPR A;  1ZQT A;  2HHT A;  3AMZ A;  4QW8 A;  5D49 A;  3BS5 A;  1TAM A;  5DBA A;  3EWA A;  5ALO A;  2GLE A;  7ICN A;  3PW4 A;  2K4H A;  4ECR A;  4ZOH C;  5JRT A;  2E1E A;  1QCK A;  2AHO B;  2IOH A;  4PPX A;  5AKE A;  5CA7 A;  1KKX A;  3UXP A;  1NI3 A;  4R66 A;  1FFU A;  3FM9 A;  5KFY A;  5AI9 A;  5DB8 A;  1KW4 A;  2F1J A;  2G09 A;  4RQ2 A;  2BR0 A;  1N61 A;  8ICC A;  1TK5 A;  4YVZ A;  4Y2J A;  1D9F A;  1QSY A;  2IA6 A;  2XVT A;  5DQH A;  3DV9 A;  3BZK A;  2PMZ C;  2AXT U;  2HHV A;  4JMU A;  2BCQ A;  4B9N A;  4UAS A;  4CF3 A;  4G3I A;  1YT3 A;  3IRU A;  5B5E U;  3GIK A;  3TAD A;  5ALN A;  2HBK A;  2W04 A;  4R63 A;  2NRW A;  5DKW A;  2XGQ A;  2BDP A;  4CRX A;  5EE9 A;  4KLG A;  2YMQ A;  4RQ4 A;  2W9C B;  4QW9 A;  4I2F A;  3HX0 A;  1B0X A;  2YMM A;  4C8K A;  9ICG A;  4M9G A;  1VLB A;  4XA5 A;  3MFH A;  3T5L A;  7ICI A;  2Z7J A;  3F2C A;  9ICA A;  4PGY A;  3BJY A;  2KV2 A;  4QZG A;  2LI6 A;  1NNL A;  3PST A;  3CNH A;  3J81 j;  2DGZ A;  4JV2 A;  3FYH A;  2F2A B;  4RT3 A;  4CDG A;  4IC9 A;  4QNL A;  4OJ6 A;  5HHI A;  2EZZ A;  1TK0 A;  1KFD A;  2ZXI A;  2BPG A;  1CRX A;  1XSP A;  4KLD A;  1ZQA A;  9ICI A;  2FJ6 A;  3LK9 A;  3QX7 A;  3GV7 B;  1SKW A;  4UB2 A;  3PSI A;  2FLL A;  3V6J A;  4NLG A;  2I6X A;  3MGI A;  4RQ6 A;  3T5H A;  1ZD3 A;  5DBB A;  4F5P A;  2DPI A;  4K4G A;  4QWB A;  4ED0 A;  1ZQP A;  3QNM A;  1PK1 B;  1UT5 A;  3SAH A;  1JAL A;  5J2K A;  2ALZ A;  2VJ4 A;  4F72 A;  3RFA A;  4FS2 A;  3NVV A;  1XS9 D;  1RYR A;  4F2S A;  4O0I A;  1X6J A;  2B21 A;  2YML A;  1C20 A;  3IP4 B;  4ECT A;  5F9N A;  1QH9 A;  1F5S A;  3UQ2 A;  2BQU A;  4DSK A;  4CF5 A;  1KSP A;  3NRZ A;  4NLB A;  4XQ8 A;  4GC7 A;  5AKH A;  4J9Q A;  2H3F A;  2LYB A;  2PI4 A;  2E8O A;  4J9K A;  2QAR B;  4DFJ A;  2XO7 A;  2HHW A;  4LVS A;  5KFC A;  4DS4 A;  1BVS A;  3WK5 A;  2FDR A;  3OGU A;  2P66 A;  3JPO A;  7ICL A;  4NV0 A;  5AKL A;  2LM1 A;  3K4G A;  3NVY A;  5KFD A;  5IIO A;  5ALV A;  1N5X A;  1XWL A;  9ICH A;  2Q0Z X;  1IV8 A;  4FE3 A;  4O3P A;  3KD3 A;  4C80 A;  1X9M A;  2KMD A;  1UPH A;  3H0L B;  1T7P A;  3Q8M A;  2PFN A;  1KTQ A;  2LYA A;  3HKZ C;  2KHV A;  4RUC A;  4F93 B;  1Z3E B;  5TZV A;  4P0Q B;  2G5I B;  4U6P A;  4PHE A;  3GZF A;  4UBB A;  8ICN A;  3MBY A;  4DFK A;  3JPT A;  1CEZ A;  4USA A;  5GTH U;  1XO1 A;  1L7N A;  1L7O A;  1UHU A;  4NLZ A;  1LV5 A;  4UAZ A;  3ZI4 A;  3PY8 A;  3OSP A;  1SIJ A;  4US9 A;  1RG6 A;  3BS7 A;  4NWI A;  4RUA A;  3ZDE A;  2FPL A;  8ICF A;  5KFH A;  2ASD A;  4ZH4 A;  1OUQ A;  7ICJ A;  3KTQ A;  1AQ6 A;  1A77 A;  2A19 A;  1L3U A;  3H0R B;  2AJQ A;  2BQR A;  4DS5 A;  1MC8 A;  1RXV A;  1HIW A;  2XGP A;  1TV9 A;  2OWO A;  5ALF A;  5J8Y A;  1KFT A;  4ECX A;  1X9W A;  3SV3 A;  2W3R A;  5KT3 A;  4DFM A;  8ICV A;  4ECS A;  2NO5 A;  4NL9 C;  2UVW A;  4RQ0 A;  1NK9 A;  1FFV A;  4RZR A;  1BPB A;  1S76 D;  1B22 A;  1BPD A;  4DFP A;  4R64 A;  4CNQ A;  4ECW A;  3HIL A;  2YY6 A;  3C23 A;  5KFP A;  4NL9 A;  1ZD2 P;  5DG8 A;  2FPM A;  3PW7 A;  2PI5 A;  2XCA A;  3OHA A;  2BCV A;  3RRG A;  3RJF A;  8ICU A;  4J9M A;  2HCF A;  3PW0 A;  3M9N B;  2D6F C;  4I28 A;  2BHN A;  4GC6 A;  5AKI A;  3RH6 A;  3H8W A;  4TUR A;  5T14 A;  4YR2 A;  5AM4 A;  3RB0 A;  4Y2T A;  1KEJ A;  5IIJ A;  5DQG A;  4DL5 A;  3GIJ A;  4O3S A;  5HMM A;  4F3O A;  3DEE A;  4NJ8 A;  4PJ0 U;  4RQN A;  5J2B A;  5D46 A;  4DQI A;  2HVI A;  9ICE A;  5EWE A;  2JXJ A;  1C7Y A;  4F5N A;  9ICF A;  5DQI A;  3TAD C;  5KFO A;  3WK8 A;  5AKG A;  5E79 U;  1WWU A;  4MHV A;  3SMV A;  4UAU A;  5G5G A;  1JI7 A;  3EZ5 A;  5B66 U;  2NO4 A;  2J6T A;  7ICP A;  4KLS A;  2FLP A;  5ALG A;  1UA0 A;  3IDW A;  3D2S A;  4Z6D A;  4I2C A;  2DWQ A;  5AIB A;  5J29 A;  1SXE A;  2R8G A;  2KZ3 A;  4DOC A;  2ZTC A;  2K60 A;  3SAF A;  1MSW D;  3FC4 A;  1HUZ A;  2ZJ8 A;  2MU2 A;  2KTQ A;  5D4B A;  4C0Z A;  2KJ8 A;  5AM3 A;  1OW5 A;  3WKA A;  2RHF A;  4R8U B;  2LYH A;  3TAQ A;  1L6N A;  2EZX A;  4GXJ A;  3QEB Z;  1KFS A;  3RR8 A;  2J6S A;  4KLI A;  2ZJA A;  4GFJ A;  3N28 A;  2W7P A;  4Z6C A;  1H38 A;  2C2D A;  4DSE A;  4ED1 A;  3Q8K A;  3QUQ A;  1L7P A;  1SV0 A;  2MRL A;  5IIK A;  5L1K A;  5EOZ A;  3M6Z A;  5ALJ A;  1Z19 A;  5DG9 A;  5ALM A;  4QZC A;  4LZD A;  3C2L A;  3MGH A;  2BPF A;  3T5J A;  5GTI U;  5J2C A;  2KZM A;  2F8L A;  1WCN A;  5DGA A;  4GIB A;  1N60 A;  2D8C A;  4RNM A;  2NRT A;  5KFN A;  2E5S A;  1X40 A;  2WTF A;  4I29 A;  1L3T A;  1WUD A;  1XC9 A;  5KFW A;  4J9R A;  1QQ6 A;  3RH4 A;  2OEH A;  1Q3V A;  4CCH A;  8ICO A;  1XU4 A;  2MAX A;  4IQW A;  1URJ A;  3C29 A;  5KFG A;  1F44 A;  5HNK A;  1TVA A;  4C4R A;  2KFN A;  4UW9 A;  3AN1 A;  4M6W A;  3WKC A;  3RTV A;  5J0Q A;  3F2D A;  1UT8 A;  1DOQ A;  3KHH A;  9ICO A;  3PW5 A;  3H40 A;  1RM6 C;  2H3Z A;  2OHF A;  3M9O B;  3V72 A;  1ZQM A;  5JUM A;  2QB0 B;  4UQG A;  5KTQ A;  3QZ7 A;  3N7S C;  2ZUD A;  3ICX A;  5III A;  2ESE A;  2DQN B;  1SL0 A;  4F5O A;  4C4T A;  3KZI U;  1S8O A;  5AM0 A;  4C8N A;  2IHN A;  1CI4 A;  3F5A A;  3V7L A;  2V4R A;  3AU6 A;  3LVV A;  3ETL A;  3T79 A;  3IM1 A;  1SL2 A;  3QU4 A;  3PZP A;  4C4S A;  4UB1 A;  3WKB A;  3TFS A;  1NJY A;  3NAS A;  1MN8 A;  4TQS A;  1LVH A;  2MUT B;  2CXY A;  2ZIW B;  2LM4 A;  3UQ0 A;  2WF9 A;  1P7D A;  4MFC A;  1ZRN A;  4M9H A;  1N63 A;  1T8E A;  1JUD A;  3Q8Q B;  1NKC A;  5KFM A;  4PHP A;  2W8L A;  3GV5 B;  5KNI A;  1SWV A;  2QKQ A;  2F44 A;  2LBO A;  1X9S A;  4MEX A;  2ZUB A;  4P4P A;  3UMB A;  1NK6 A;  2JHD A;  3IHQ B;  2E8M A;  2KD1 A;  3EUB 2;  1B43 A;  5L1I A;  5KT7 A;  2KVS A;  4QZB A;  4CGZ A;  3RB3 A;  3Q8R B;  2R8H A;  5J0S A;  4KX5 A; 
#chains in the Genus database with same CATH homology
 1JI7 A;  1SV4 A;  5L1M A;  1PK3 A;  4PZO A;  1V85 A;  1Z1V A;  2EAP A;  3K1R B;  4IS7 A;  3SEN A;  1LKY A;  3IDW A;  2F3N A;  1DXS A;  2B6G A;  3H8M A;  2QB0 B;  2DKZ A;  1SXE A;  1UQV A;  1PK1 A;  3BQ7 A;  2K60 A;  1OXJ A;  2Y9U A;  3TAD A;  2ESE A;  2FE9 A;  5J8Y A;  2KIV A;  3TAC B;  1SXD A;  2E8O A;  2QAR A;  1F0M A;  2QAR B;  1OW5 A;  2ES6 A;  1LKY B;  2L5Y A;  2E8N A;  2F8K A;  2EAN A;  4NL9 C;  3KKA A;  2LPE A;  5F3X B;  2EAM A;  1B0X A;  3KKA C;  2DKX A;  3HIL A;  2EAO A;  4NL9 A;  3BS5 B;  2KE7 A;  1SGG A;  1UCV A;  1SV0 A;  2D3D A;  1B4F A;  1X66 A;  2KMD A;  2KSO B;  1V38 A;  2LMR A;  3BS5 A;  2KSO A;  2JV3 A;  2GLE A;  1WWV A;  5KNI A;  5JRT A;  2QKQ A;  5JTI A;  2YTU A;  2QB1 A;  2F44 A;  2DL0 A;  2K4P A;  2E8P A;  4NJ8 A;  1X9X A;  4RQN A;  2D8C A;  1X40 A;  2KG5 A;  3SEI A;  2E8M A;  1SV0 C;  1KW4 A;  1COK A;  4PZN A;  5J8Y C;  5JU5 A;  3TAD C;  2Y9T A;  1RG6 A;  2QB0 A;  1WWU A;  3BS7 A;  4MHV A;  1PK1 B;  4RQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...