5J9PA

Kcsa in vitro
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
molecule keywords Fab
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA02
4FQJH 3HNVL 3MROA 3EFDH 3T2NL 4XH2B 4XWGL 2R0KL 3EHBD 1I1AB 1HSBA 2B8OT 1F2XK 4YR6A 2QKIB 2C7UA 4NDMA 5CIPH 5KVDH 3BDBA 1MQ8A 2EH8L 1GGBH 3GSNL 2Z0BA 3SGEI 3C9NB 3LV3B 1PEWA 1ZGLB 4R96B 3WUWG 1UZ8B 4LLUA 1JGUH 4P3CH 4WFFE 5D7JA 5CJOL 5F7EH 1KPUA 1I3VA 1P9MC 2HT3C 2NY4B 2XWTA 1S9XB 2VDQH 4Z7OE 1AGDB 5GZOD 5I1LA 3O45B 1P1ZB 4OM0H 1N6QH 3BKYH 4K7PL 2OK0L 4QHUB 3SJVA 4OLXH 1AO7D 4G8FA 4MA7H 5L2JB 1ZVYA 2YPLA 2XG5A 1CVSC 2EH8H 5I71B 2DTML 3JUZA 3VD7A 1I7ZA 5EO0B 3MR9A 4HUMB 1EJOL 5ID0A 2WW8A 2NXYC 1RZJH 2D7TL 1JRHL 1IGFL 2JCCF 2PW2A 4JDVA 4JVPA 1YY9D 1S7QB 2DQFA 5L0QB 1NUGA 4LFHG 4PBVC 3JTSB 5D71L 1NJ9A 1NGQL 3O3BB 1SYSA 3QUXC 5GS3A 4E41B 5IV2B 3NTCH 4WU7B 4KXZH 1A6UL 2H2SC 5GJSH 2Q8BH 3VFOA 1EHNA 5JNYA 2JKXA 4DTGL 5FO9B 2XWBB 2WUCL 2J8OA 4JAMB 2BRRL 4UI2A 2GSGA 2EDOA 4LARH 3HG1E 1KLGB 3O6FD 2BNRA 4Y4FC 3PJSA 3OAUL 1S9WB 3FL7A 1HXYB 3QHFL 1QLRA 1X5LA 3PQYD 3O0RH 5D71H 1QLEL 3CVIH 2Z35B 4JY5H 4JG1H 1WAAF 4OZFH 5BO1L 4FXKB 2AAVA 1M7DB 3O6MH 3BAEH 3WN5B 5KSBA 4YWGH 5IMLB 1XAUA 2R8SH 1NBYA 3PWUB 3A6CH 4X6EA 4WTZG 1S9KC 1XIWD 2P5EA 3GMRB 5A3IC 5F97E 4ZDHB 5IMOB 1MIEH 2QR0B 1F90H 3OKKA 3DI2B 3RY6C 4ONHB 4Q9CA 4LLDB 2IAMD 4NZJA 3FOLA 2ADFH 3SJVB 4OV5A 2HFGH 4JFDB 3X11A 1LE9B 3FB7B 5IWLC 4JG1L 3PF2A 2QADC 3P30H 5FV1L 4NWTL 3S7GA 4MNGE 4JG0L 4PRHA 5C07A 2IH1B 3TO4A 3QDGA 1M4KA 5ITBL 5KVEH 1YC8A 1KCUL 3IKCA 5DRWA 2I5YH 2EECA 1JHLL 3FQRA 3IGAB 3KPQA 3Q0HA 4G5ZH 3C08H 1QZ1A 1J0ZA 5C08D 2A6KB 4S2SA 1BM3L 2APTA 1WZ1H 5HYFA 1VACB 2VDRL 1EUTA 2IEPA 3MJ7B 3LDBB 4MGXA 1S7UA 2EIEA 1U8IB 4I18B 5FUZH 1QFHA 5DHYA 5J3HD 4HS6A 1G7LB 3BPNB 4LSSL 3N1FC 4HIJA 1JPSH 4IMKC 4PR5B 4RRPA 5EU5B 4WY7L 1UYWL 1DBJH 2I9LB 1ITCA 1S5IL 2EC9T 4YDJA 1CQKA 1PX3A 1VKXB 4KDVA 1FL6B 4PG2C 4XCNA 3MFFB 4C59B 2FIKB 4NN6B 2YOCA 1F2QA 1CS6A 1BLNA 1NPUA 5L2JA 1ACYH 4R6UA 3MBED 1FORH 5IEKB 4LRNH 4ZXBB 4NO5B 1IGJA 3RAJL 4DCQA 1Q1JL 3D25B 5A3ID 3G5VA 5JR1H 1JGEB 4DKFL 4HPYH 2F15A 2WP3T 5D72L 2BNRD 2HKFH 3L3JB 4QRRD 3THMH 3RWDB 4DN3L 5CD3B 3RVXD 3PG2A 4NZDA 5HHXH 2R56L 5IQ7H 1UXWA 5CZVL 1FBIL 1ZXQA 3IS0X 1Z9SA 4NQDE 3EFFA 3T8XA 4GW5A 2XKNB 2DM2A 3C5ZB 4I18A 4I9WE 1I3GL 3KJ4B 5KSUA 2YBRA 2J6EL 3MGTB 1FVDB 4JGMA 3RAJH 2HT2C 3C6LC 5JR1L 3IDNB 4JJ5A 1U8JA 3OBAA 2RFXB 3ZE0E 1WWBX 3LKQA 2FR4B 3OXRA 2R9HC 1TJGL 3B9AA 1IQDA 1J8HA 4OUUB 2EEBA 4G6AD 1T1XB 1J1OH 4ESKA 3BIKA 1FV1A 4P46A 2F5AH 4Y4HC 3TN0C 5C0NC 1PG7X 1NCCH 4RA0C 3REWA 1P4BL 4O2FA 5EU3B 5FGCB 1ZKAA 1KIUA 2FGWH 5J7CC 4KHTH 4MAYB 4LDOB 2BVYA 4ZOBA 9CGTA 1IC1A 2P24A 1E4XL 1YMHA 3L3JA 4LVOC 4XCCH 2UUDH 3VXNA 2BNRE 4G6AC 3MRMB 3WE6A 3LEYL 5B38G 5C0DB 2O5YH 4HJGB 5F7WC 1VGEL 4N0FB 4R90H 1JF5A 3OB8A 4Z18A 5ESQA 2VDMH 2DAVA 4H88L 5IB5B 3SDCD 3IDJB 3QNXA 2EEAA 5JO5B 4UDTB 4LGPB 5HDQH 2P48B 4G43A 2G5BA 5DJYA 4MQSB 3LN4B 3G5VB 2FGWL 3QWRA 1AGFA 2D4DA 1J12A 2CIKA 3VRIB 2V7HB 3GSRB 4MAUH 4O51A 1A7BA 3TIEB 3MA9H 2YMXL 2IGFL 4P5KA 1BZ7A 3MV11 2Z93B 3TBSA 1JI1A 2Y25A 4JZOA 3TP4A 4P4KC 3N06B 3BE1H 2VKXA 4LVEA 3WLBA 3WS6C 3L1OL 5C0CB 1DBML 4I77H 1UWGL 4MYWB 3H7LA 4ODBD 5D5MB 5HPMB 4XP1L 5F9JB 4N90E 1BQHA 3WFEH 4LVHC 5C6WH 1DBKL 4P9MH 1VESA 3JWDH 1BJ8A 4IRSC 1K9TA 5KSAC 3WIIL 4GXUM 5IT2H 4E5XA 1A4JB 1RJLA 4Y4KD 1NL0H 4LVNB 1T5XB 4AT6A 2WLZA 1FG2B 3P77B 4OJFL 4DZBB 2CO7B 3T3MF 2RFXA 1RIVL 4QRQA 2A6JA 5J57B 3QIWD 5D5MF 5F71A 3MLZL 3C8DA 1FL6A 3TGXA 5IB5A 1UB6A 1GPOL 2WSKA 4XVJL 2D0GA 3G6AB 5TPWL 1N7ML 3PV7A 5DJYB 3HG1B 2C1OB 3O4OB 4WI7A 4LBEB 2YUWA 3HNSL 4F8QA 4Y1AE 4LSTH 4L8CA 1OD9A 3GI8H 1Q72H 4TUKH 4WI9A 1YC7A 4QF1A 1IKNA 1G7IA 4XPFH 1ZSDB 1GSMA 4OF0A 4GH7B 4CL7A 2H32B 3K2MC 2AERT 2C5DC 4PJGB 1AH1A 4JY6A 1NC2B 3JV5A 3C8KB 1J86A 3R8BB 1I7TA 3P0VL 1T5WA 4Y5YB 2QKIA 4RFNC 4XP6H 4YIQB 3H2WA 4XPHL 3ZSSA 4G43B 3V4UH 5IB1A 3I6LD 3VGDA 4KK8D 1IEBB 2QSQA 1KB9K 3MUZ1 1NCBH 3GI8L 4JFFD 3RX5A 4U6HB 1W8NA 2KL6A 5CEXB 1IAOA 4ZO8A 3ZDZE 5F88B 1WTGT 4TQEH 1Z3GL 4JFZH 3KPNB 4HS3B 1MCWW 3ORJA 4RSVA 2NY2D 3B83A 4DEPC 3OKNA 4PREA 3E8UL 3HG1D 4JQVA 4YPGA 3WHE1 5EBWA 3BVNB 4XMPH 3FRUB 4IDLA 4RFOL 3NABL 4JFHE 5HHVL 2NXZB 5D2NE 1D5BB 4NSKA 1T22A 4FP8L 2HRPH 3ESUF 3MODL 1DEEB 5DS8A 2P8LA 4RGNC 5FYKE 3RPKA 2E7LC 2EC8A 4I0PA 4EUPA 1H3GA 5I73B 2RR3A 2HFEB 4GS7C 4IOIA 3T2NH 4OBRA 4PJXB 3QB7C 4Q7DA 3NIDE 3GMMA 4RDQG 4DVRH 5B39A 1N6UA 1BBDL 12E8L 3ARTA 2HJKB 1GGBL 3FO1A 3G6AA 3MXVH 2X89D 2ADGB 4H8WH 2FZ3B 2EC9U 5D2LF 1CFQA 3MV8E 1XGYL 3V2AR 4K71B 3VJ6B 1P6AB 4PJXF 2GFBB 4HGWB 4PRDB 1DDHB 1I3RA 1NGWB 3P11L 1OP3H 5IFJA 2X4QB 4ZFOB 4ZSOA 4PTUB 4JM4H 1CTNA 3IF1A 4X6FA 4JN1H 3B9VA 1OAZL 4D3CH 1L0XA 1RUML 4P2QE 3ROLA 2ESVA 3PGDB 3ULSA 3NPSC 3MV8D 1FG9C 4FQCL 1NANH 4IRSA 1H3PL 1A02N 1B2WL 3L5WA 4AEEA 4EDXA 2VUYA 1XGYH 1FVCB 2H6PB 2ERJB 1VSCA 3VG0L 1DQQA 3VFNB 2W1NA 3W81A 4EUPB 1KGCE 4UNVA 1MRDH 2BMKA 3P11H 4QTHB 4RX4D 4KFZC 4RZCA 5EZJA 1AHWC 5TGBB 7FABH 4DZ8A 5EBWB 2FRGP 1SY6L 1BIHA 3HRPA 3X13B 3FB7A 4IIQB 5JXAL 3NBNA 3WXWH 5HI3D 1HK6A 3QISA 1TLKA 1CBVL 1CFQB 4NNYA 4K94H 3LB6C 5E1HB 2DQJL 3FO0H 2XTJD 3WCYA 5I1IL 3HE7B 5D7IF 3QUYD 4TOYL 3OKEA 4EEEA 4NRYB 2UY6A 3ET9F 4K55A 5KVFL 1A5FH 1NUFA 3RWFB 2EXWC 2PYEE 4YHIB 2Z4QA 2XY2A 4X80H 1XZ0B 1TCRA 4PRPD 2A1WH 5L88H 1JGVH 1MUJB 1AD0A 2H8PA 2XKNA 1YQVL 3C5ZA 4PRNB 4EKXA 5JXAH 4QGTA 4Y4HD 3C5SA 3CZJA 4MJ5B 5J12B 5T3ZD 3C60B 1KEMH 3G6JA 4OZGB 1M7IA 1R6VA 4JQVC 3DWTA 5DJ0B 1WWAX 1KPUB 3VA2C 4L4JA 3RDTB 3UYRL 4GSDH 5ELIA 1KIRA 5FYJU 3S34H 5DD0H 5HI3C 3RWEB 1U8LA 3SDAD 5ADOL 3GBML 3RRQA 2H3NA 3C87A 5IUSA 5EZLA 2GSIA 4XP9L 1G7PA 1A6AB 2NY3D 3KR3L 4L3CB 3UTSD 1WT5A 3TEUA 5I6XB 4QCIA 2Q8BL 5GJSL 5IVXA 2EO9A 1YEJH 3DMMD 1CN4A 2P7TA 3HAEA 1UKQA 1D5BA 4Z77A 5EFIA 3QZWG 4U2ZA 4YHZH 1FVCA 5ITBH 4P4RB 5CJOH 4WO4B 4GQPH 3BT2H 4M8QB 3HTLX 3PGCB 1ZHLA 2AGJH 2BFVL 4OLZL 1T7YA 1PQZB 3MRGA 1A6WL 4GG8A 1R5VB 3BKCL 4NM4H 4JRXB 4Y0GA 3KYKL 2OS7A 3QIWA 4ERSH 4DVBA 5CIPA 4UUJB 4ENED 2H8PB 1LK2B 3V6OE 4PJHE 3TT3L 2H26A 5JPNA 4A2LA 2O93L 1P5UA 5KSUB 4PLKD 2X4OA 4QRPB 4QWWC 5D9SA 3GMQA 4KAQL 4CKVX 1FNSL 4Z78A 4ONOA 4OIIH 5IMKB 2DBLL 3KPPB 1FYTD 4P4KA 1ZWIA 3FT4A 5E9DA 5EZLB 3MROB 3PL6D 3JTTA 1FDLH 4L1DA 4V2CB 4N0CD 5E8OA 1IC5H 1X4ZA 2WWKT 4NZTL 2QSTA 1YN7B 5BVJB 2W07A 2A9MH 2OJZH 3MV9B 3VD3A 3K81A 4OCRH 1I9RH 4L8SC 5JZ7D 5KS9E 4HS8L 2CPCA 1K85A 3CZFB 3D6GA 4N8CH 1LMKA 4BH8B 1QR1A 4M8QA 2ID5A 3CDGA 3TZVA 1YMHB 1A14H 1EERB 2QHRH 4JE4B 3CH8A 1PY9A 4OTXH 4M93B 2I5YL 4Z0XA 3JV4B 1FNGA 5IG7A 1XIWB 3ELAT 4PRHB 5DD3L 4OLYL 1U3HD 4C83A 4OCRL 3NA9H 3REVA 1AO7A 4M02A 1A4KB 4F33A 4DGIH 2OL3B 4HT1L 5E0QA 1ES0A 4PV9B 4UNTA 3TO2A 1WISA 4AQOA 5KZCB 2UVFA 4NJ9H 1NH6A 2FWOA 4AEIL 3QEHB 3K4ZA 2ZCLH 4MQXD 4OQTH 3RWFA 3QO1A 1S7WA 2GKIA 1J05A 3GBLA 1HH6A 3K80A 1FYTA 1AD9B 3TH2T 1CFVL 1X5GA 2BSRB 4JFOB 1G7QA 3R06A 1YNLH 4FQLH 4IDJH 4N0UB 1B0WA 3MRHA 3BXNB 2NXZC 4MDJB 2PKDA 1VENA 4GQ9H 4EJ1C 2WMPA 3RA7H 4ODXB 3NCYS 2YD9A 3QXTA 4JFDE 4U1LB 4KKNA 1HYSD 5CCKH 1ZV5A 2F53A 3SE9L 1TXKA 3LH2L 2XN9B 1R5WA 1JPST 3MRFB 5HYIA 2ZCLL 3VXUE 3RTQA 1EEYA 4NHCL 1OWWA 3VD9A 4LGRB 4HIEB 4QHNB 4TNVK 2VDPH 5LG1A 2H2PD 5FECB 1M7DA 3P73B 5LKNA 4I48A 1BJMA 4FQLL 3LEVL 3B9KA 4HCRH 3W9DB 4MQXC 2E8ZA 1AJ7L 1MOEA 5HY9B 4WEBH 4I2XE 2D7NA 4GKZB 3QRFM 3HUJB 2MJWA 4LPVA 5F7DA 4BZ1L 2VLKE 1JF1A 4DGYH 2ICES 3KYMA 4IBLT 4NT6A 1QACA 3CXDH 4YUEH 3IAQA 3U4AA 1LDPL 5A2KH 4GBXA 4Q9RL 2YZ8A 2NCMA 4HBCH 4YIQA 1A6ZA 2BY2A 4P3DB 3ZKMC 2HH0H 4NQUA 2OL3A 3BPLC 5D2NA 1IQWL 1FVEB 1IEBA 2PYFA 4MWFB 3IDNA 2VZOA 1RIVH 4JJ5B 4LSPL 1L7TH 1MRCL 1I8LC 2HKFL 1VFBB 3RL2B 1IJ9A 2R0WL 4ZSOB 2P5WB 1EA9C 4NCDA 4ZO6A 2BOBA 2QQLL 4MNQD 2X42A 3LKPA 3LIZL 3S3PA 4CNIA 2BC4A 5ACZA 4KMQA 4JKLA 1T89C 2R0ZH 3OG6B 1MCEA 2B4CH 1OP5K 4YDKL 1MI5D 1N6VA 4XBGA 4G9FA 2A0LD 3MRPB 1SJEA 3BUYA 1WLHA 1BOYA 3ZE2E 5BRZE 1U6AL 4Z7WF 1G6RL 4ZUSB 3TNNB 2XZAH 3I9GL 2B1HH 1XR9B 4JKWA 4AM0B 5D7LD 1WGOA 3QWOB 3UJTH 2DM3A 1ZT1B 5EZJB 4JFPB 4FQ1H 4GW4A 3K7UA 1I4FB 4XZUA 4JZJA 35C8L 1EO7A 3O6FA 5GGVY 1MFDH 4F7TA 5IF0A 3LKRB 1KG0B 3D85B 5FYKU 3QEUB 2R69L 3ZL4H 1IGCL 1PYWB 1TFHA 2D7TH 3OB0K 1GGCH 1QFUH 4DN4L 4PG9A 4WDIA 1QLFA 5C08A 1QSEB 2GCYA 2ATKA 4OAWA 2DJ4A 4FZEH 1CDYA 4NFDA 2IANB 4YDIH 4CNIB 3NTCL 3B2UD 2BDNH 3D1MC 2XOTA 3IDMB 3EDJA 1JPFB 4RISH 4XVTL 5FYJL 32C2A 4G9FB 4MAYC 3L7EB 4APQA 4FP8H 3ULSB 1CLZL 4W4OC 1OWRM 1JHKH 3QEQD 3HLAB 3TBTB 5HHOD 3I3EA 3GJEB 3TYGL 4NPYB 1I85C 1NCTA 2JB5L 1ZT1A 2MSPA 5I8CA 1K3IA 3OKLB 5I1DB 4R7DA 2GSIB 5HYSA 3OMZA 4HBQA 4KHXH 4LSQH 3PIQA 4XC3L 1IZJA 2E6JA 4Y19A 1KPRA 4XP1H 1G9MC 4Z8FL 1KSRA 1A9BB 3DYOA 4QGYA 3O6ML 3IJYB 2W9DH 1XF3A 1NBQA 1ZEAH 2M8XA 4OZIA 1FN4B 1CLOH 4RAHA 5E2WL 1CR9L 5K59E 5HHMB 5D7IE 1HE7A 1MCPH 3PGCA 2A83B 3JVGA 3IRZA 3SOBH 1NC2D 3RNKB 5BJTA 5IK3A 1IT9H 2COQA 4FXLA 1VFOA 2IJ0C 3HUJA 3UTTD 4NYLB 2AK4A 4JHBA 3GK8L 5E8PA 4TVPE 1MWAA 2HT4D 4ZS6D 5DEFB 2D7OA 1MLBA 3GSWA 4LEOA 4WI4A 5MI0B 1JNLL 2C3VA 1WIOA 4JM2F 2IFFL 2XZCL 4RFOH 4BFBD 1C5DB 2BY0A 5JPNB 2G5BB 4LHUA 5I19H 3SE4A 1T2JA 4OLWL 5E5MA 1PAMA 4PV8B 3V8CA 3SY0B 3UZQA 4UTBL 3TIEA 5ADPH 3U0TA 5FUCC 4PJEB 3MLRH 3U2SA 5TF0A 1IGMH 1DLHB 2X44D 2W65B 5BVPL 1S8DB 2Y07L 1A0QH 4LKXA 3V5HA 2B7DT 1U8NB 4YBLC 1GGUA 1BBDH 4TN9A 1ZE3C 5CJBA 3A67L 3V4UL 1G0XA 2VDRH 3H9SD 3LPGA 5E99H 1HZHH 2MKWA 3L3DB 4LLQB 3UJIL 3LDBC 1V05A 4KUCF 3ESVF 4MSWA 4PJHA 5CEZH 4X83A 2VLKD 3HAEH 4DOHE 3SO5A 2HFFA 5ADPL 4JPWH 3WFDH 3I84A 4PJAF 4LLMB 4DK3A 3MUGB 4BK4A 1I9IL 1K5NB 1J18A 1MJJB 3UXFA 3O41B 2AK4D 1V7ML 4GKSB 5CUSL 3X3GH 4GO6B 2DMBA 3GRWH 3BZEA 5KVDL 3LKOB 3A67H 4Y2DD 3VXOB 4AL8H 4DCQB 3JWOL 1D9KD 1T0NB 3VXUD 4Z0BL 8FABB 3KPSE 5CKAA 3L5XH 3VI4F 4LAJH 3VG0H 3C2SA 4HUUA 3VWJB 1TIUA 3U7WH 2RCSH 4WUKH 1KEGL 2AKRB 1K4DA 5CD3A 3CSYA 4KMTL 4Y4FA 1W72B 2GCYB 4WCYH 4MXQD 3L7FB 4WIQA 2EE9A 4KV5E 3AREB 4ZTOH 3QPQC 1U8NA 4O5LH 1T3FB 3ROLB 5ANME 4OZGE 2VDKH 2OI9C 4HH8A 4L8BA 3MJ9H 1E4XI 5HJ3A 1L0YA 3QHTC 3MV7D 4LLUB 3U0WL 2VDOL 5E00B 3K74B 1EH9A 2AGJL 1OHQA 2Q7NA 3U2SB 1AXTL 1EHAA 4OZ4A 2HG5A 3RPIA 5BZWA 4AH2B 3VGGA 2VLMD 1FIEA 1OAZH 4M5ZL 4ZUVB 1UA6L 4EDWL 4X4ZA 4MS8D 4PBXA 4O5LL 1F00I 3BVNA 2YWYA 4KKCC 4X9FA 2XTJC 4FQCH 4KY1L 1HQRB 3U36B 4OD1L 4CU6A 4GBXC 2EIBA 5EORH 5HHME 4BKLA 3REVB 5C1MB 4MLIA 4LMQE 1I9JH 4MMXC 4RGMB 3QIWC 4UTAH 4S1QH 1KENL 3HR5B 4UNUA 1FP5A 2O26U 5DHVB 3H3PH 5I18L 2AJ3B 4GSDL 5DK3A 3S34L 5JW4R 3DUUA 5E03A 3L7FA 5A2LH 2V5RA 1S7WB 3QO1B 5F9DC 2J4WL 5DJXA 1G6VK 5IHUH 2HRLA 2BNQD 1S7SB 4UINL 5EU6D 5E2UH 3SDYH 3BD4A 3GI9H 1MHPH 1MCRA 2XTJB 2CGRH 3VRLF 3TPKA 1T0NA 2NTSP 4KY1H 2CXGA 1EJOH 4Y8DC 1EFQA 3V6FA 3QUZA 2GY7B 1M7XA 5E8DL 4WHTB 1IGFH 1KJVA 1LWRA 4HKBB 3PV6A 3EO0B 1CLYL 3KPRB 3QAZB 4HFUL 1A6TA 4U1IA 7CGTA 3BDXA 3HC3H 3WLBB 2XN9A 2UY7A 3PWVA 3RVUC 1N0XH 5LGJB 3H9ZA 4OGZA 3HUJE 5C0CE 1OVZA 3BI9X 3OJDB 5I1EH 3P30L 3STBA 2CUIA 2WUCH 3O2DA 4CMMA 1LO0H 5K33A 1A4JA 1RJLB 2JCCA 2R4SH 5I1CH 2I60H 3TT1H 3MRRA 3G08B 2HT3D 1R3LA 1TQBC 2GUOB 4OCSL 4FQHB 5ITFB 3T0EC 5FM4A 4EN3B 3EYUH 5DUMH 4RZCB 4YBHA 2Z92A 4JRXA 4FRWA 2A6IA 3T65A 3TIDB 1TTFA 1QKZH 4K8RC 5T5NF 2IADB 4ZAKC 1T20B 1YNLL 3MGOB 3NGBC 3U9UB 4HUVB 3D9AL 5EULV 3MACL 3IB4A 3VFVB 2XQYK 1R3IL 2UZIH 2WAHA 2RQ8A 5EO0A 5MI0C 3LN4A 4BA8A 3CVHA 4HWBL 2QBWA 4QHLB 2PYFB 4MWFA 3MLTA 3PP4H 5EUOE 1QLFB 3OR6A 1Q0YH 2R1WB 3F7YA 3G04B 1J0JA 1KTRL 2ADFL 3C8KA 4G6KH 4EQ2A 2X2YA 2H1PL 2R2CA 1FAIH 4IMLB 2VIRB 4KKBC 3CFCH 1FH5H 3DMMC 32C2B 1Q9KA 5DK0A 3VMNA 4RAUB 4L9LA 4P2OB 2XWBA 3MACH 3GM0A 5C86A 4YBLB 1LO5B 3G6JB 4R0LA 5D6CB 3CDGB 1VEPA 5K59F 4M6MH 3INUL 3RUGE 1CXKA 2FX7H 3UZEA 5IBLC 2R1YA 4ZPVA 4P23D 2B1AL 2X89A 4M6OH 4OQTL 4QRUB 3BN9D 3VWKB 3DO3A 1YUHB 5F7FA 2LU4A 4XX1G 4JDTL 1I75A 2BNQA 1IQWH 4HS8H 3UPRA 2EDDA 2ZCKH 3BZFB 4IDJL 3VMOA 2ZUTA 4F7MB 4HHAB 3IRPX 3DI3B 4LOUC 2JLLA 1IAKB 1KB5L 2WM0A 4XNYH 4JLRB 5B4MC 5J6HB 3EJJX 4WENB 3INUH 4WW2A 4KVNL 2IG2L 2VE6A 4EN3C 5HDOA 3MV8A 3QNZB 1MFEL 3RU8H 3F6IA 5B21A 3MYZA 3KYOB 2ADGA 5HDBE 1C1EH 1FORL 5C9JB 5MEQA 4WNQA 3NAAH 4DAGL 4HCRL 5F70A 4OCMC 2LVEA 3AFLA 5D5ME 4L4VD 4YHKH 3V4PH 2MTPA 5ECJE 1XCTA 3MMEA 4P23B 2BJMH 5IVZA 1T89A 5H35A 3NA4A 5IIEB 3AU1A 3TESA 4IS6A 5LAXB 5DA4A 4EBQL 1CXFA 2OL3L 5I1JH 3MRKB 5HHXL 2R0KH 2X4SA 1UQSB 3QDMD 5KAQF 5FDWB 2E8YA 5FYLL 4ZD3H 2HT4C 3IFOB 5C70A 3RVUD 4H25B 1G9MH 1BEYH 4UB0H 5HDQL 1INEH 4UT6L 4JO1H 3CH1A 5DHYB 1WWWX 2DYPA 3IDXL 5D93C 2VOTA 1NBZA 4EIZC 3UX9B 4ETYA 1NUDA 3LEXB 3KNBA 5C0JB 1K6QL 3BWUC 2J2ZA 4JPVH 4NO3B 3RZCC 4ISVA 3SE9H 1RFDL 5K9QG 3AGVA 4M1DH 2GHWB 5I74B 1J5OH 2EDEA 1C5BH 3MGOA 1KNOB 4QXUH 1ZS8A 4P5TA 2A38A 5CZXC 4Z95H 3HHRB 1DBKH 5KS9B 4CDHA 3EKCA 4HXAL 2HKHL 3MPCA 4JO1L 1MREL 5GGRY 1NMBH 3QEQB 1MCOL 2PETA 5AWNH 4M7ZC 5D1QB 5C09B 4XCCL 4U6XB 2VE6B 4YHIA 1BWMA 2NX5D 3MREB 2I9TB 2X4UA 4I1NB 4RMQA 3B2VL 4JFFB 2VXVL 1UQSA 5A40E 1CD1A 1KULA 3DGGA 4K2UH 4V2BA 5I30L 1BZ9A 3WJLA 4WNQB 2NY1D 1Q8MA 3L3GB 4KJQC 4ORGB 1OP9A 3MNVB 4LF3B 1P69B 2BRRH 4GRWB 1RIHH 1F3DH 2KUTA 4X6BA 3DX6B 1J0KA 4S1DD 1HXYA 4HZLB 4TUKL 5DJ2B 4D0CB 1T0MA 4MJ6A 1SY6A 2Q6WA 1MF2H 5FM5O 5JW4Q 3B9DA 1CE1L 1BIIB 2Y36H 5DRZB 1A9EB 1OARL 2APFA 4ZFZB 4MQ7A 4F8TA 3VU2A 3DO7B 3VCLB 2GK0A 5IMLA 4YDKH 4P5TB 1EFXA 3QG6A 3LQMA 2R8SL 1EIBA 4L8CB 1NBZB 4KK8C 1CLZH 1KC5L 1LO3H 3T0DA 4GUPA 5E6IA 5CMAA 5ISZA 5JXEC 3OKKB 4PLOB 2UWEA 5D1QA 4ISVB 3FTGA 4QXGL 3GMNB 5T3ZL 3GHBH 1IGML 3ARBA 1QSEA 1KTLB 2R23B 1WZKA 3A6BH 2V5TA 4E41A 4MB5A 4U0QB 3UDWA 4ODVL 2Q1EA 3LRGA 1BVLA 5F21B 4O2EB 2E27H 2EDWA 2EDJA 2VSDA 4W6WB 4ZOAA 5DF0A 4XWOD 3UTPE 3DRQB 4CDGC 4NUJB 5J4MA 4CAGA 4EI5D 5E6ZA 5HYEA 1SBBA 5E9DE 5GZND 2HRPL 3MODH 3HC0A 4PD4K 5E2WH 4WHTA 1LGVA 1MH5A 1RJYA 1M7IB 1ZA6B 1QSFE 2CIIA 3ZT6A 4ELKB 3MOQA 1DLFL 3W39A 1KCUH 5I1GL 5FA4A 1BIIA 4JFFA 2VQTA 2F53E 2D0HA 1AIFB 1PKQA 5TF1L 1IGTA 5CJ5A 3OKMA 1OF2A 5DJ6A 1T6VN 5HHMD 4QHKI 4XBGB 1NGPH 3MNWB 3N9GH 3DVNB 2O61A 3L5XL 3MNZA 1B0RA 1X4XA 3SCMC 3HPJB 2E3VA 5FO8B 4YXHL 4UMGA 5EBMB 4OCWL 4LNRA 1NCDH 5J6GB 3O2VL 1FPTH 2VLME 5H94A 1LD9A 3MRNB 4WCYL 1I8LA 4Y5VC 4ZUUB 1Z3GH 4JFZL 3NCCB 4OTXL 1A6VH 1RZGB 4OCXL 3QA3B 4PGEA 4GG8B 4XC3H 4I0CC 1BVLB 1EK3A 1I4FA 4XZUB 5EC2B 1A0QL 2ZSWA 3L3OB 3ARGC 3WKNA 4PRPB 1ORQB 3S35X 5DR5L 1V5JA 1YNKH 4M7LT 3MV01 1DDHA 4FQXD 1I3RB 5HPOA 1DSFL 3F6LA 4PG2A 1P7QD 1YDPB 4M93C 5FA4B 5DYOB 2R23A 2ZOLA 5ANMB 4X4XA 2EYRA 3U83A 1S8DA 3WFDL 2B4CC 2HN7A 1N3NB 1JYWA 1YN6A 3L9RA 5C8JA 5IQ7L 1SY6H 4J8RA 2P45B 3MRHB 1F6AA 4KKLC 4BYHA 1I1CA 2AJSH 1E4KC 4R4BB 1NCWH 3ARDD 5KTEL 3MCKB 1RJZA 2W59A 4X7TA 1SQ2N 5T3XD 4TOYH 1LO2L 3BSZH 1MWAL 1LP9E 4UAOB 3U7WL 3B6SA 4D94A 3BEVA 5SX5K 4BUHA 1IARB 2YK1H 3GNMH 4NOFA 5LBSL 4PJ7B 2VQ1B 1JYVA 4LQFL 4X6DB 3C09B 4XP4H 5E2UL 3SDYL 1UEMA 3WL9A 2VXQH 2F5AL 2IBZY 2PTVA 1YECL 4I48B 1UFUA 3WD5L 1FFPB 2VAAA 1NCCL 5BOPA 3OR7B 5JHDE 5ICYA 3FAXA 4JHZA 3VW3H 1QBBA 2WBKA 2D3VA 4X4ME 3D25A 2WP3O 5EN2B 2F53D 2Y23A 3DYPA 3PWPD 1NCWL 4WEBL 5HGGS 2DYPD 2LAAA 5C0EA 5AZ2L 1DQJB 1F4YH 4JRWA 4X6DF 5JPMA 1U36A 4GXVL 2NTFA 3O3EA 5J06A 1TZIA 2AJUL 2AK4B 1ND0B 1FYTE 1P9MA 4I0PC 4PD4J 4ZUWB 1I8KB 3WUWB 4LCCB 4U4BA 5LQBH 4UV7L 2NY4D 3CSGA 3BP4A 5D1XC 1WQVT 2OP4L 2XNAA 2M26A 5I6XC 4PY7A 1PLGL 5DD5L 1C5CH 3TH4T 2UV3A 4NRZA 1ROWA 3EYUL 2P8MA 4TVPD 1AHWB 5FOBA 4BK5A 2G60L 4KGJA 3MJ9A 5DEGB 3UTTE 2BSSA 2ZKHL 2XYCA 3L5JA 1TETH 4XHJC 2EZ0D 3DBXA 1YUHA 1KB9J 4KRPB 1ORSB 3OZ9L 1J8KA 3VD4A 5FYKL 4X99B 4Z7QF 3DUHA 4XNXL 3NPSB 1J11A 3CXHJ 1JWMB 4FZ8H 4FFWC 2G5RA 2OMBA 3ARBC 5E5RB 4FQXA 1XCQA 2VRAA 3QHFH 5E8NB 3O2WH 4OFDA 3MRGB 4OSUH 2ZUSA 1QSFA 4FQIL 3X11B 3RQ3A 4XXDA 1H3VA 2XA8H 1WZMA 4G8GD 3AUVA 3BAEL 3LKSA 5TDPB 4LHUD 3U48A 5I1EL 2BSED 1CVRA 5E70A 4M00A 3U30C 5FYKH 1AY1L 4M5YH 3VFWB 2EDKA 1A7QH 3GSRA 1CGSL 5CWSA 3PQYE 4Y5VB 4PJ8B 1KCRL 1RV6X 3BESR 3MTRA 2XFXB 3PWVB 1HSAB 1A7NL 2H2PC 4L8DA 4JFXB 4QKXB 4P5MB 3L3GA 4OF6A 4XBEL 2B39A 1U91A 4Q9QH 3JSSA 3PP3H 4TPRH 4YHOH 5C0AA 4FTVE 1RMFL 2YS4A 4DKAA 2BHYA 1EEZA 4EUPH 3UYPA 3ZDXF 2ED8A 5LGHH 2IG2H 5GSRB 1Q0YL 1QA9A 5B3NA 2IALA 2JJWA 1IC5L 3CGTA 1I8IA 3RUGB 3E3QC 2X9WA 2VQ1A 3ARRA 3IU4L 25C8L 3GJFK 5FUCE 1RZKL 1FH5L 2ZUXA 1NBVH 3ALPA 1A7OH 5AUMB 2V2TA 3U30B 1LE5B 1I7UB 5D7LA 4KVCH 4KK5C 4H5SB 4OLEA 3W11D 1JPSL 3WYRA 4N8CL 4YFLI 3HZYA 4Y5YC 5DQDH 3U4BL 2ADJB 4FQQB 4JRYA 3TA3C 3SBWA 5C08B 5FGBC 2X40A 3ARFC 4XB7A 1FYTB 5I1AA 4L4VE 3H9SA 3DXAA 3SKMA 2I07B 5EU7E 4J2XA 5F8RC 4H1LG 4WFEE 2VB5A 4P5MA 1IAII 1ACYL 3FFCB 3KHOA 1KT2B 2CO6B 2ZZUT 4GRLD 4XP5H 4R96A 4KRPC 1UVQB 4PJCA 5I19L 1HILB 3TWCL 3FHAA 1MLCA 2GEEA 15C8H 1KJ2L 4XNQB 5TFSL 4Q2ZB 2C7UB 2WIIA 1PG7W 2XT1B 1A64A 4J12A 4D3CL 5A1AA 2BY3A 2ITCB 1LHZA 1I1FA 1YN7A 3CFDB 2PO6A 4IRSB 2WUBH 3IDYC 1PZ5A 1H3PH 1R5IB 5DLML 4LLVA 1MCOH 3DJ9A 4HIJB 3NFSL 2G2RA 4M6AA 2VR9A 4J3UA 4S1SL 3U1SH 2OZ4H 2B1AH 4UT9H 3WFHB 3BPCA 3FB6A 5FF6B 2FATH 2DLHA 5F7KC 2I07A 1MCLA 1T0PB 2VL4A 1ORQA 3O4OC 3X3GL 1LO4L 2GSGB 5ICXA 1G9ML 3EYVA 2BVOB 4UB0L 4K3DL 3BISA 1N0LA 4LCYB 3CUPB 4UIKL 4QYOB 2OTUB 2AJVH 1U8JB 5FYJE 4FQJL 4PJDA 3TFKD 3BDYH 1CICD 3RZCB 2OR8A 4XAWL 3BIBX 4KMTH 3GFUA 5FUOL 3RDTC 3V5KA 3ARSA 1HH9A 1OLZA 4MNGB 5D1XB 1AR1D 3EFFB 1BFOA 1YEHH 2DKMA 3GO1H 3O6LH 4ACPA 1NDMA 1B90A 4TNVF 2K1MA 3MRQA 5IB2A 5C0IA 4U3XA 4U1SA 3HMWH 4U1KB 3TN0B 3T3PE 5IM7A 1P53A 2DQCH 4JRYE 3RWEA 3AS0A 5HVGB 4JQXC 5IGXL 3I50H 1T4KA 5H37G 4MXWL 4AG4L 1A6AA 3ARWA 3T4AA 1IFHL 4FXKA 5IW1A 4WRLA 1I8IB 4HH9B 1NAML 1JRHI 8CGTA 2D4FA 3MFGB 1WAAA 3O3UN 4PLJC 5JHDA 3EJYC 2Z8WC 4P46D 4PGBB 3KWWA 1G9EA 5I2IA 3NIFF 4XGZA 2CLRA 3ARGB 1KV3A 1OGTA 2W91A 8FABA 3ULVF 5DMIL 1N5AB 3LZFH 3VA6A 3GRWA 5JUEL 1DQLL 4UAOC 3RY4A 3SQOH 3UBXA 3ZE1E 4OI7A 5SV3A 3LB6D 5MENE 3LN5B 4LL9A 2Z4QB 4JQXA 5DJXB 3RIFF 5JXEA 4QTIH 5D70H 3G5ZA 5FM8A 2GTWA 2GITA 3WIHL 3FB5A 4FNLH 1N7MH 1PGRB 3LQAH 4LSDA 2BVOA 2VR4A 5I17A 2CGRL 1UACH 1MVFA 3BQUD 1WFUA 4R3SB 1DN2A 1MCPL 5BS0D 1RJZB 5DMIH 3OPZL 4XI5C 5TE6H 2Y7QA 4QXGH 5KN5A 3HCVA 2X7LA 4BJLA 2A6JB 4XCNB 2A6KA 4D2NA 1MCIA 4PS4H 3PNWA 3QUZC 2XKUA 4YBQD 4LSVH 4P2RE 2VZTA 4MNGA 4PRHE 2F54B 4JRYD 2X4SB 1BMGA 4LFHD 1F4WL 5D6DA 5FYJH 3OHXA 5FEBA 4P2OC 2A9ML 4YGVA 2IFFH 2R29H 2AXGA 1JHKL 3H7BB 5T33L 3QUML 3BEWB 4M1CD 4LSSH 1HI6A 3ULUL 1F90L 5F9OL 1DP0A 2NY7L 1UYWH 4L5FL 4PB9L 3UTSE 3N1PC 2EH7H 3ARFA 4GKOA 2X1QA 1OARH 1ZVSB 2ITDA 4LIQE 3SCMB 5I73C 1JGLH 1MRFL 2ORBH 4JDZB 3VFPA 4F9PC 3WDIA 5EUKA 1QBAA 4NWTH 3TBVB 3MUJA 4PGBA 4EZMA 4U1JB 4Y2OA 1HZHL 2YBRB 4ZPTA 4NZUH 5IVXE 1LEIB 3TO2B 5F72S 2GJZA 4PJFB 3DSFL 1OTUC 3UCRA 3VGAB 4DEPB 3BSZL 3D69A 3A0OA 3NMEA 4NWUH 1KJVB 2NW3A 1E4WH 1MFNA 1IQDB 3HRZA 3F8UB 3QXDA 3EDFA 1A6VL 4ZMAT 5A43C 3O2DL 2F74A 1KCLA 3QWQB 1OF2B 1YECH 1J7VR 1XF2A 4ORZC 2QEJA 5F1IB 4PJIB 3VXQB 3DVNA 1QYGL 2HVJB 3S98A 4E0RB 6FABH 2D7PA 3CZFA 1QFWM 3DROB 2A0LC 5E2VL 1WUNT 1RU9H 3VI4E 3BWAB 1AGCA 3TCLA 1BD2B 5CP3A 3GMMB 5TF1H 1K5NA 3TA3D 1D5ZA 5EIVA 1CFNB 1FL5B 3W2DL 3FO1B 3F7RA 3LKOA 1OSZA 1NKOA 5C0GB 1RJCA 2BNQB 1P2CB 3BRGC 1P4BH 3BJLA 4ETQB 2DLIA 1KCVL 1K2DB 1HCVA 2EDNA 1NDGB 4UOJA 1NC4B 4AENB 5D72H 4WFED 3BP7A 4RIRB 1I1RA 5E2JA 4OCWH 5I15L 1N5YH 5IMMA 4NQXA 5E6ID 4GRWH 1YEKL 2BVQB 2VZ1A 3VFPB 5L0QC 4DGYL 5CHNB 3KVQA 2O5YL 4IMLA 4WI5A 1UXWB 2VDML 2XV6B 3QPXH 4JFXA 2QSCH 1HWGB 2VR5A 5KSAB 4S0SD 4OZIE 3TH3T 1X7QB 3ZDYF 4MA1C 1QHPA 2APBA 5L7XH 2ADIB 3QO0A 4Z7WA 3BXNA 3NAAL 1ZGLA 5LJYH 4K7FB 4I5BB 4QNPE 5F1NA 2X9XA 4XXCC 4N8VA 4MNQA 5JORB 5IJKC 3CXHK 1N5YL 4K7PX 3VXRD 3V6ZA 2E9WA 3V0VA 1D5IH 1INQB 1R0AL 3WSQL 3CC5A 4P23C 5KSBB 3EBAA 2XG4A 1R24B 4HF5H 3L5IA 2YWZA 3FRPA 4QT5B 2DQTH 4Q6IA 1DEDA 4PP2A 1INEL 2CDFB 4UT6H 4JFHD 3PABB 3OAUH 4KRMB 2B1HL 1ZHLB 4G6FB 1HEZA 2ICWB 1ZLUH 2JB6B 1F45A 1A7RH 1BZQK 1SHMA 5DFVD 4NQSB 4I0KA 3HNTH 4FQQA 4LLMA 4Y5XA 3S88H 5LGKA 1UJ3A 3QNYB 5F7UA 2H9GB 1NAKH 4BFIA 4TNWF 1RUQL 3VFOB 5FA3B 3D3VA 2CK2A 5C07B 4Y16C 2XIDA 2DQDH 5SWZE 1HN1A 5EOCL 3VXOA 2CXKA 4F58L 4HIIA 4Y4HB 3GBNL 4G8GE 2P8MB 3VWKC 3MLPA 3KJ6L 3QXVA 1KLUB 5DRWB 4UDUA 1Q9LB 4KTDL 4XMLH 5JIKA 1WC7B 3OKDA 4C56D 3IU3B 3ABZA 3CC5B 3IU4H 4N0UE 5F6HI 4U1HB 3S88L 2N7BA 3QDJA 4POUB 1NBVL 4KV5F 4TVSa 5FDWA 5HPMA 1TJHH 1OP3K 2FGZA 4XPHH 1G7MB 2Q20A 3E6FB 4RISL 4QRTB 1T22B 4OKVB 3WJJA 3HE6C 3TN0A 3D0VB 1R3IH 4F58H 3C5ZD 3OF6D 5DK2A 1FO0L 4OIIL 4ZDHA 2J8UE 3VXPB 5GGRB 4EN3A 5B8CA 1CLYH 4YQXH 3V0VB 4UV4H 4PJXA 4TSBL 1AGCB 4MJIE 3T4AB 1YEEL 1CU4H 3U79A 4YHNB 3CSBA 2GK0B 4OV5B 5IG7B 5C0FA 1WFNA 2RIKA 1W0WB 1YJDH 5I1KH 2LU7A 1PG7L 5KSBF 3C8HA 4JRXD 4NSKB 3IXAB 2WZPD 1D5XA 2IANE 2IPTL 4QEGA 1O7SA 1LO0L 1YEDB 3ARQA 4ZFFB 2CDFA 3QUMB 2JJVA 1VDGA 1OAYH 3VJ6A 5JIHA 4BZ2H 4G9FE 4LKCB 4NN6C 3S4SG 1N5AA 4L4VB 1YEFL 5DUML 2FX7L 1MIMH 5HYQA 2XA3A 3BX7C 1PQZA 3T0EB 3VGBA 3ARPA 1EFXD 1TQBB 5FKAB 2GTWB 4F37K 3WUZA 3VXTB 3S8WA 4UUJA 4TTGA 1QBLH 5JQHC 3O8XC 5I1KL 1JWUB 4NP4H 1OSPL 3PHSA 5CSZA 5EU6E 3MRDA 3T1FB 1JZ5A 4V1DA 3K46A 5C0AB 3V6FB 4HPYL 5MHSD 4X5WB 2YXFA 1CGSH 5CBEB 3GJFA 3CVHL 3WNKA 5GGTL 4MJ6B 4R7DB 1IGTB 3TZVC 2CDGA 2KQMA 5CZVH 4G8FB 3PP3K 1WVZA 5EZIL 4Z7UF 2ESVB 4UOW1 3S5LG 2PYEA 1BX2B 3NGBB 2J1KA 2J6EH 4EOWL 2OSLB 1B2WH 3NCBB 1ZK9A 3N9GL 3RKDC 1F13A 1MCDA 5GGRA 1KXVC 4P3CL 4F57H 5BV7L 2GUOA 1GC1L 3MO1A 3PUCA 3LH2H 2VDQL 3QR2A 5IEHB 5TFSH 2NYYD 2H45A 3D85D 5HGDA 1IKNC 2OJEB 1DUYA 4XXDB 1UWEH 1AD9A 3OGOE 3CFJB 4RGMC 5C2UB 2X10A 5I9QB 4P2RA 5FYLH 3OAZK 2IQ9H 3KS0J 4BFGA 4ZFFA 3FT3B 1GGIL 1C5DA 2GJZB 2XTLA 4EOWH 1H5BB 3WKML 4P2OD 3N1GC 3MLVL 5EO1A 5MEOA 4XNYL 1DSFH 2FHBA 5F3HA 5HYQB 1UM5L 5IVOA 4PJEA 2YPKA 3QIBD 4CUCA 3DNKA 1OT1A 1CZ8H 1S5HA 5HDBF 3BH8B 4OCNC 5EIQA 4ZTOL 2ITCA 2MQCA 4MA1B 3DRTA 4NGHH 1JWUA 1ACZA 2ZPKH 3IFOA 4QXUL 1DUZA 2PXYD 1BOGA 2WLYA 3BUYB 2YRPA 2OI9B 5HVHC 4QRTA 5KG9B 2VZ3A 3P77A 1XGUB 1UC6A 1ZAGA 5DJ0A 3P3YA 4IRZL 2CKBB 3Q5TA 4DQOH 3ARGD 1CI5A 4HK0B 15C8L 1KJ2H 2DMKA 5FB8B 3UDWC 3BEVB 3S9DB 3G5XB 4XVUD 4QRRB 2XPGA 1K8DA 5C6PB 2OL3H 3TZVD 5I1JL 2E7LA 2XQYG 4G8GA 5D7SL 1X5ZA 3L1OH 5ILTH 4IOFC 1A2YA 4M5ZH 2NW2A 2LU3A 3BPLB 4LQFH 3Q6FB 4HIEA 3VXMA 4EDWH 4FA8A 3HAEB 4POYA 3EUUA 4F7CB 1CBVH 1NGYA 2NY6B 1NEUA 1AXSB 2BSTB 4X4MA 1L0QA 1G6RH 5EN2A 3ULUE 4QRPA 1ADQL 4TTDD 5MEND 4F9PA 3HR5A 1KJ2B 4M43L 4BQ6A 3MO1B 2PW2B 4JDVB 4XHQA 5C0BA 5A16A 2D9QB 2VLRB 3QDGE 5DYOA 1HOCB 1EGJA 2BFVH 3BH8A 2LTQC 3EGSB 5DWUL 4DVBB 3T0EA 2YA0A 1D6EB 1K3ZA 3GB7A 4XCYA 5EC1A 4KI5F 2Y4SA 4KJPC 1U3JA 1MHPL 1VGKB 4JRXE 4QXWA 4P57B 4U6YA 1P4IH 2VISB 4GAYB 3KPLA 1RUAL 3AREC 3HI1B 5AWNL 1WK0A 4PB9H 5DJ2A 1GGCL 1QFUL 2HTKD 2DBLH 4U1IB 5SWQB 1M71A 5FKPB 3CCHA 1E6JH 1K8DB 1QLEH 1N59A 3CVIL 4HS3A 5IHLB 3VWJC 2Q86B 5KS9F 1EZVX 2BDNL 2VZUA 1MAJA 4NO0B 4R4ND 5EPMA 5F89B 3IXTB 1BM3H 3NCMA 1XIWA 2B0SH 3MV9A 3RL1B 1ZHNB 1YEHL 3T08A 4F7TB 4POZC 2YEZA 1I9RL 1S3KH 4XGZB 3HMWL 2QQKH 1R3LB 3HB3C 3TNNA 1NC4A 1RUAH 1XCQB 2Z91B 4FQXB 5E8NA 4QHKJ 4X6CA 4JM2D 1MFAH 2O5XL 4NQXB 3RKDD 1VEOA 3B5HA 1FJ1A 5D1QD 5GSVB 3CLEH 2AI0H 1T2QH 5GIRB 5CLTA 5FF6A 4O2EA 2CK0H 2R2HB 4Z7OF 3FB5B 1RY7B 3T0WA 1F42A 3EJZD 2A73B 3VFVA 1VPOH 1E6OL 1RHFA 4KZEH 1AO7B 3TT3H 1SJXA 1XIWC 3FT3A 1GOHA 4J3OC 4PJ5D 4XNMB 2HJFB 1OAUL 4HAGA 4PRIB 3QUZB 4GW1B 4KAQH 5CWSB 2PYED 1BBJA 1V8HA 5H2BA 1E4JA 1AP2B 1T7ZA 2Y5TB 2FR4A 1HNFA 4K8RH 5EH1A 5DVOA 1EDQA 1Q94B 1HOCA 2OTUA 1MEXH 1NCDL 2IQAA 1JUFB 1KYOJ 3HZKA 1CGUA 2IANA 2CLZA 5BQ7A 3W2DH 1T6WA 3OJ2C 3FJTA 2VABB 5EDXA 5ESVA 1ZHNA 4ZUTA 2XZCH 5IHZB 2VXUH 2VDLL 2NMSA 4RBPK 1E6OH 1KJ3L 4KZEL 2DN7A 3P0YH 1I3GH 1LO5A 4JO4H 4LASL 4X6DE 1F3DJ 3ZKMD 1G7LA 4RFEA 4FFVD 3NN8A 1MELA 2DM4A 3OPZH 5JOEA 2A77H 4L4TE 4K8RL 2VO5A 2HFEA 1KGCD 3H9YA 4X9BA 4YHNA 5D7LE 1BQLL 1NSNH 1SJHA 1WZLA 5GZNC 5F89A 3DUSB 4NRXB 1HINH 1FC2D 2MCG1 2BRQA 1O5DT 4E41D 4F9LC 1AGBA 1M6OB 4PBWD 2VDPL 4HKXA 3HR6A 3V52H 2VXTL 3CIQA 2EDXA 3C5JA 4RAVB 4ZS6C 3KWWB 1KJ3H 1EAPA 2X05A 5HYJE 3D87B 2VDNL 5IJVB 4GUPB 5IVNA 3GSUA 2JK5B 1RZIA 3L95A 2X4PA 5E2VH 1IM3A 1VFBA 3FZUC 4OD2A 3RL2A 4H0IA 4L5FH 4CN1A 3U0PB 5BZDB 2FCBA 3QEHA 3QI9C 3QIUA 5E6IC 3LEYH 1P7QA 1EHLL 1TNNA 5C0RL 1T3FA 3F12B 5D5MA 1GIGL 1BPVA 1HYRC 4KKAC 5ESVB 2I25N 1KT2A 4NUGH 3DRQA 3O4LD 5DR5H 3NCJH 4CN4A 4K94L 2FBJL 2BERA 5JW4M 1T80A 1F97A 4XP5L 4TUJB 3TFKC 4DZBA 1H8NA 3VRLE 2YD4A 3TC9A 5CCKL 1B88A 3X17A 1AGDA 5C2BL 3EOBA 3FCTB 1AIFA 1PKQB 2IALB 4TUOA 1X5JA 3M17A 4U49A 3DVIA 1ZLVH 1ZMYA 1GZPB 3DTXB 5INDA 2GJJA 4NZRL 3JZ7A 1BP3B 3T0EE 3LEVH 4U7SA 5C3LD 4PJ5E 4M7LH 4R4NC 1LNUB 4NKMB 5TDNA 3WJLC 3CNKA 2HWZH 3HI5H 1JBJA 3CFKA 5KTEH 2ZOKA 1Q0XH 4OF5A 1RZIB 3L95B 2W0KA 3I75B 4LKCA 2HAZA 3MUHL 2W0FA 5ADOH 1YPZE 3I2CL 4M7KL 3MA7B 4JFFE 1NFKA 5D7JD 2OZ4L 4UT9L 5C07E 1I7TB 4FQ1L 2F8OA 3G6DL 4PJAB 1RZ7H 4IRJA 4C4KO 3IDYB 1LILA 4EI6B 5EUOB 4U1GB 4UDTA 3MV7B 1KG0A 5BXFB 2DQTL 4NQEB 2JIXD 4JCMA 2MQ0A 4Y19E 1KLGA 3LCYA 5CINH 3BMWA 3IAGC 5I8EB 4PGCA 4BSVB 4LCYA 2YMXH 3BW9A 5CD5C 3ZL4L 4XMKL 2R0WH 1RD6A 3BZ4A 4RMVA 2EKSB 1YEKH 4HWNA 3N0PB 4Q2ZA 3SDAA 5DDHB 3KYKH 1A1OA 3RY6A 2V17H 3IDIB 2OR9L 3IAPA 5CEZD 4UINH 3WFZA 2VSCA 4QRPE 1RIUH 5K9JL 1PSKH 4Q6IB 4HS6B 3V7AE 2QQNH 4B50A 5EOCH 4CRPA 1DQTA 3DHMA 2VITB 1DBBH 5GGUA 3TV3H 5HGBB 4HK0A 2NZIA 4WTZA 3ULUF 2ZG3A 4LU5L 2QL1A 3JUYA 1J0HA 1S7XB 1IKFH 4ZFZA 5KOMC 5DURD 5I8KH 4N0CC 1N0XL 2BXZA 4K71C 2H9GA 4K3JH 3O9WA 4J3XA 4D9LH 2V17L 1EFXB 4XVJH 1MFDL 4L3EB 1YYMH 1QFWI 4B7IA 1S9YB 3MXWL 3MYJB 4OKDA 5IF0B 1XH3B 5ISZD 1TZGL 3GMOA 1WT5C 3QH3B 3RWCB 1R3KB 1LO3L 5ERWB 1Q72L 2FJHB 3QEUA 4KGLA 5GGTH 1TTUA 4NYLA 2JIXA 2M2DA 4GRLB 4GS7B 3RIAK 5I1HH 3JTTB 3IETA 2XQBL 5CJXC 5JHDD 2OMNA 5D70L 4XVTH 2FNBA 4XNZB 3W9EB 4ELMF 3P4NA 2DQDL 4L8SB 3CX2A 4NQEA 2UZIL 5E4EB 4PPTA 4HMEA 5D6CA 4HK3N 3VFNA 4HX1B 1VB9A 3K1KC 4I5BA 3DX6A 1KB5A 5F1SA 5B3JE 2AJZA 3BH9B 5BRZB 4G6KL 1A6TB 4QRRA 4Q9BA 1TVBB 1YNTA 4HQQL 2IAMC 3KPMB 3CFCL 2JF1A 3VH8B 4MB4A 4HIHB 3LD8C 1HDMB 4JFYA 1A9BA 1UH2A 3MNWA 1HQ4A 4YFLF 1XH3A 3QFJB 4F7CA 4RFNB 4OGAD 2A6DA 5DUPL 3MRRB 4IRJC 5DURB 3ULUH 1MRDL 4AK1A 4TSBH 5T1DH 3ARBB 3MRCA 1QSFB 1FNEB 5BCAA 2EXWD 2EYSA 1E0OB 1UJ3B 4GKSA 25C8H 2IPUK 4NGHL 3BZEB 2APVA 2ILLA 5DHXB 4MNHA 1FO0A 4C55A 2VZVA 4S10A 4IRZH 4UT7H 3MGTA 4NOBA 1FYHB 2PR4H 3KAAA 5CJ8A 4Z0BH 4X98A 5DQDL 3GJFB 5IIEA 4HUKB 1N26A 2VLJD 5BV7H 1EO8H 2X4QA 4XWGH 3HS0B 2EKSA 4OZFA 4UQ2A 4MDIB 1J8HB 4YUEL 5GS2H 2PCPB 1ZGLP 2EDYA 4JKKA 4JPIA 4B5EA 1HQRA 1RAMA 1OD7A 3GSQA 5EOCJ 3QDJD 3O4LA 3UPRB 3V4PL 4AZ8A 4ELMA 1JZ8A 5CEZL 3BUTA 1FFOB 2AEIT 1YMMD 2Y9RT 1CQYA 4WUUE 3G6JF 4ZXBD 3MUY1 4MVBC 5J9PA 3UTSA 2YD8A 4OT1L 3R0MA 3OF6A 2ATPA 4D9RE 4LIQL 3CFJA 4JDZA 3HE7C 1AGBB 2AV7B 1O0VA 3ZDZF 2DICA 4MA8H 5JTWA 5E24E 3L5HA 4JEGB 4ZD3L 1U3ZA 1P2CA 3QRGL 5FCUL 4ENEC 4DKEH 4R97B 2ZPKL 1P4IL 4J1UA 2H26B 4WWKD 4OD1H 1DQDH 3C09C 4JFQA 4JZJC 1CFTA 2C3HA 4E42B 1I9JL 4PJFA 4WI8A 4LCWE 4QYOA 1XF5B 2FX8H 3EO0A 4WEUD 2DQCL 5H2BB 1RHHB 3TA3A 1UWXH 3MREA 2I9TA 3H3PL 5I18H 1BWWA 2UYLB 4S2SB 1FE8H 3KGRA 1QO3B 1A6WH 3HA0A 1T5WB 4Y5YA 3WXVL 5F9WB 1I8KA 3EYQC 5D1XA 1OL0A 1JGVL 1RZ8B 4YXLH 5J12C 4JY4A 3RJQB 2IQ9L 5C0IB 5HXMA 1J0YA 4BH8A 2J7LA 1QR1B 2VDOH 1XGPB 1C5CL 3ULVE 3FN9A 3WIHA 2BXYA 4HLJA 4C56E 4KQ4H 1QPXA 4MD4B 2A6IB 2H3NB 2P5WE 3T65B 1KBGL 3ILQD 4XP9H 2X4TA 3FB8B 5GS1B 1B4RA 3M17B 1AFVL 2AV7A 2Y6SD 3RVWD 1B6UA 1BLNB 4ZFOL 5HHQA 2F9BT 1TETL 1HHKB 1JN6B 3G5YA 3CMOL 5IP4A 3C5ZC 3QEQE 5JW5A 3AM8C 3KHQA 3TJEL 5J1TC 2AXHA 1W2KT 4Y1AB 5DJAB 1ETZA 4IIQC 1DEEA 3S3SA 1RIHL 3AMLA 2NZ9D 4ETQA 3OJVC 3NFNA 3GMRA 3TYGH 5CEYA 2ICEB 3VXRA 1HEZB 4BM7A 2JB5H 5ITFA 1DBAH 3VDBA 5LCVL 2AXFB 2CRIA 1T7WA 3WHE0 5D7SH 2ZCHH 2VLJA 4FQIH 5DVMA 3G5ZB 2DTSA 1CGXA 3M1BB 4G9FD 5GJTH 3U9UA 3I6LE 1ZLUK 4ZOCA 5IBTL 5ALCH 3QQ9C 1JNNL 4JQIH 4NC1C 4U6YB 3TJEH 5DMKA 1F11A 1BVKA 3VRJA 4LF3A 1T1ZB 2X4OB 4NJAH 5D9SB 1EHXA 1K4CB 5AAWA 4U1LA 5T3ZH 3GBNH 2V9TA 3RTQC 3J8F7 5LCVH 3GSXA 1T04A 1UM6H 2YC1B 3LVEA 4UILH 5DJCB 4WW2F 2H1PH 1HH9B 1IBGH 1ZOXA 3OJDA 5DHVH 4I18C 3EAKA 3CPLB 4XTRD 4APQC 1NFIB 3O3DB 3IJYA 4OBSA 1VFAA 5IFHL 4KUZH 2DB8A 2A9NH 1A3RL 1I8MB 1X5IA 3VI3E 1JWMA 5I76A 3BFOA 1EEZB 5FK9A 4NJAL 2ARJA 4NQCD 5T5FL 1BFVL 1E6JL 1N2RB 4YQXL 2UVEA 1FZJA 4LCWD 4NKDB 4OF7A 5BVPH 2XPGB 4QOKA 4LSVL 4UILL 4WGVB 3X14B 4EQ3A 1MCQA 4MVBD 2B0SL 3E2HB 2NW2B 2HJKA 4N5ED 5D2NC 5JW5B 3KLDA 4G9DA 3F65A 4AIZB 3O3AB 1CDBA 3VRJB 4F80A 1A4KA 4DKFH 3GZKA 3D39B 4D9RD 1BBJB 2YKLL 2JCCE 1BZ7B 5GRJH 4FS0A 1JGDA 4DN3H 2O5XH 5HVWA 4ZFOA 1HKFA 3ULVC 3CLEL 2XFXA 3HE6D 3RWHA 3UO1L 1HSBB 1XZ0A 4X6CF 1HINL 3BD5A 3JV6A 3QDJE 4OD3H 2AS5M 4JFOA 4X7CC 3KPSB 3U6RB 1V3JA 3FQTB 3CFBA 3V0AC 2ZSVA 1VGKA 4LVHB 3FQWB 2VXTH 5EU6B 5JIIA 3EYFB 4DAGH 4N1CA 1MLCB 4LQ1A 2H6PA 4ODXA 1UGNA 5GGUB 4OB5H 2BJML 2YKLH 1XGQB 3UPAA 4JO2L 2VLJE 2DJSA 3IFPB 2DMCA 3DXAE 5H94B 5D1QC 1MJ7H 2CUHA 4LMQI 1QEWB 2OX5A 1N8ZA 4HPOH 2PUQT 5B39G 3GSOA 4S0TD 3BPOC 3LIZH 5C0RH 4ZO7A 3PL6B 4XC1L 3TVMA 3R4DA 4JR9H 4V1DD 3CFEA 2OSLA 4GRWE 4KQ3H 4W70A 5I74C 5L7XL 1MHHB 4O02L 1RK1A 5I66B 1G7IB 2XZAL 1RU9L 3ARZA 3NIGF 1IAKA 5EO9B 3G9AB 1DJSA 1XFPA 4NRYA 1KXTB 4PJ7F 3ARED 1RFDH 1P7QB 5LBSH 1A1MB 2OR9H 1ZA3A 3GMPB 1LDPH 2NXYB 2ZUWA 3X12B 5D93B 2G9HA 3SPVA 1LQSR 2VXSL 2IFGA 2VXQL 5I75C 5DC9B 5DZNA 4DUXA 5JHLL 4I9WD 1FO0B 1F02I 1TVHA 3DPBA 1AD0B 3E3QE 4HG4J 3SDDB 5J11B 4OZHA 3T0VA 4M62H 4G42A 1CK0H 4X7FC 5EORL 5J3HC 1QNZH 2AVGA 2VN7A 3DMMA 4KQ3L 4L29A 1U3HB 1CG9B 1L7TL 3SN6N 4P5KB 1AP2A 3RDTA 4Z7VA 5EOTA 4XNQA 5CLWA 2QQLH 3I2CH 3T77B 4D0BA 1GAFL 3LKPB 1TVBA 1MFCH 2MHAA 4PJ9D 3WL9B 5DI8A 1OP5H 3ZE0F 3T2OA 4M3JA 3KJ4C 4YDLB 5KG9A 5MENA 5IQ9B 1EBAA 1ED3A 4CVWA 2CMRH 3I75A 4NQDA 4H1LB 4XTRC 1P5VA 3QWOA 4HFUH 4BUGA 5KSVB 3JV4A 2HVKA 3I50L 5E5UB 4TSAL 3TIDA 2NTFB 1CE1H 1TJIH 3QUYB 4X7SL 2XQBH 1D5MB 1YEIL 5E9DD 2DF3A 6CGTA 1RQ5A 5IROC 3CFIC 2W9DL 3PHOA 1J87A 4XVSL 5DUBA 2I60L 3SGKA 3S5LB 1OPGL 1IGCH 2VLLB 4H20H 3HPLB 2JK5A 4ELME 2VLRA 1BQHG 3IKCB 4PJBF 4R8WL 3PXJA 3RZWA 3OKDB 1WC7A 3GIVA 3MZGB 2R2BA 3I6KB 3LS5H 1IKFL 4OQTA 2GJ6D 4M8VA 4M61B 4XNUH 5GHWL 3F12A 4GAFB 4LHJB 3BPNC 3PGDA 4XPBH 3NCFB 1MJ8H 3V5DA 4QRPD 5I17B 5ID1B 5K9KB 3ARDA 1MPAH 2IPTH 3F7QA 3DMMB 5TQ0L 5DUPH 1M05B 2VITA 3QO0B 4Z7WB 4PJBB 2Z31C 1PD6A 3EOTL 4R3SA 5B4MD 3WFCH 3W0WE 3QCVH 3QHZL 4N5UA 2X7LB 3NPZB 1E27A 3EDDA 5CEXA 4OUUA 2K3TA 1A9EA 3MV7E 1JNJA 4Z9KB 2WNGA 4Y19B 5DJ6B 3WFBL 2YUVA 5SWSB 3PL6A 3Q3GA 1FLRL 2BK8A 4W6XB 1JV5A 5T1KB 4X99A 3MNZB 2LV4A 1JZ7A 4ZAKB 3UBXG 2IPKA 3KS0H 5T33H 1IM9D 3OKEB 1KTDB 5ETUB 3V7AG 1OAXL 3U82B 3MLXL 4OCYL 3ZE2F 4Y5VA 3FN0L 3PGFL 1RZGA 4YHPB 5E8EB 5ENWA 3GUTA 1QHOA 3DX7A 5AYUL 1MY5A 4KJYA 1FCCA 2XWJB 1HSAA 4YR6B 3DLQR 4E9LA 2CK0L 2P5ED 2CLVA 4C56B 1A7OL 3QIBB 4JHWH 3ARDB 4NCC1 1FLRH 5C6TL 1GH7A 1FVEA 1NEZA 2BNRB 1OAYL 4DKDC 1IRAY 3LS4H 1BREA 4BZ2L 3UTZA 2I26N 3EDKA 5T1LB 1DLFH 4IS6B 5DRNA 3QAZC 3BP6A 2XWTB 2IQAB 4B41A 4EN3D 3ZHDA 1QBML 5GRXG 2NYYC 5I1HL 1KELH 2DM7A 4UU9B 1FNAA 3Q48A 2VWEC 3CU7A 4LKXB 3BIKB 1UWEL 3QRGH 5FCUH 3IXTA 4PJAE 4LLYA 1CL7L 4BSJA 5ID1A 1HHIA 5K9KA 3FOMB 5E99L 3WMSA 3OR7A 2PF6A 3E6FA 1H3WM 2VXUL 2X4NB 4G3YL 2QADB 1IC7H 2X6MA 3KNBB 3W9DA 1AI1L 2EDHA 4Z7NE 5DK2B 3WKMH 3PQYA 5IHBA 4P2QD 2ARJB 4ONHA 2DQEH 5GRZA 1DANU 2EDQA 4JLRA 3QUXB 3BPCB 1MWAH 2WK2A 4ZYKB 4HFWB 2VH5L 3DX7B 2OQJB 1I9IH 3QIWB 2ITDB 3GNML 5HYJD 4U2YA 2IMNA 3P9MB 1U8QA 1NLDL 4GBXB 2VAAB 2GYSA 2WUBL 3M8OL 1IEAB 4GJTB 5I71C 4PJ7E 3W0WA 2HTLD 1DVFC 4G7YL 4LLWA 1NCAH 3S5LA 1AI1H 2AV1A 2VDNH 5T1LA 5C09A 3D69B 5GRVL 1KENH 3NFPA 3QDAA 4L4TD 4OAWB 3H3KA 4WW2C 3FQRB 3IGAA 5HHOA 5AG8A 5ANMA 4FFYH 3U4EB 3HRZB 4LHQB 5D2LE 2KZ1B 2NY4C 2YC1A 3ZSTA 2R2BB 2PCPA 1CXLA 2CLZB 1D3CA 3QIBA 1AR1C 2FJFB 1U8IA 1OGAA 3BGFC 3O11A 2PO6B 4Z95L 1MCFA 3G9VA 4YX2H 3ARVA 5HJ3B 3ILPA 3BRFA 3G08A 1FRGH 4R4BA 4K23H 1BJ1H 3H6JA 3IKKA 1I1AC 1RUKL 3OKLA 5I1DA 1CD9B 1ADQA 1SEQL 1UM5H 2ZJSH 5ESAB 3OAZH 3LKNB 1QTYT 3VXSB 3KPTA 3QP3A 3STZB 3ZKXC 3QUKB 1U8QB 2D31A 5J1SC 5H8DA 5EU4A 5SWZB 2MKLC 1PW3A 1XF3B 3WD5H 4NM8L 1U0QA 3TBYB 5CILL 1M6OA 2LVCA 1YPZA 4CMHC 2N1KA 1KIQB 4XNXH 4G8EB 3RI5K 2A6DB 2UWEB 2KKQA 1TITA 3BRDA 5BJTB 1RHHA 2V5MA 1X3DA 1F4YL 5C3TA 4HFWA 4OT1H 1RUKH 5D7KE 2V9QA 2Y36L 1MJUH 1J0IA 2JJTA 5JW3H 1CICB 3RZCD 1JP5A 1RZ8A 4MA8L 4N5EC 1CD8A 3T8XB 3ES6A 1E4KA 5K9QI 1S7TB 2FECL 3U6RA 1KN2L 2VERN 1CDCA 4L29B 5HGAA 2YD1A 2N7AA 1N64H 1AY1H 3ZYZA 3UJJL 4XPTL 2QQKL 4UDUB 3LKQB 3KPPA 2VQUA 1F4XH 4PYGA 4O58L 2JELL 4OGAC 5F88A 3MRJA 1T1XA 2A74A 1FE8L 4NO0A 1MJUL 4W68A 3R0NA 3ALXA 3DO7A 4XWOC 4M1GH 1C16A 5EA0H 1OGAB 3OZ9H 4HH9A 3HZVA 1J1PL 1UH3A 2FDBP 2N56A 2PTTA 3MJ7A 1TJHL 1DUZB 1UG9A 1I7ZB 5DJAA 1AR2A 4NO2B 1QSVA 1JNNH 1HKLL 5DS8B 3R8QA 3FZUD 3U7YL 4Z7NF 1FO0H 4CU7A 3QYCA 2X4RA 3QIUC 3QI9A 3O2WL 5T1MB 1WIUA 4LAQL 4KQ4L 1OTTD 1QQDB 2DWEB 4U3CA 5C0BD 1QSED 3STZA 1QKZL 1AFVH 3QULB 3IDJA 3QNXB 2WINB 4M48L 4PGZA 3PWPE 4PGDB 5DVKA 4OLYH 1MCBA 5F7LB 1NGPL 4LRIC 5EUOA 1WSST 1HWHB 3QH3A 3RWCA 5F93C 4P48A 3O6KH 4JO4L 4YPJA 4DWHA 2Q7YA 4PY8J 5DO2C 5F9OH 1MAMH 2UWEF 1FPTL 2F54D 3P4LA 4JRYB 3BGAA 4HAFA 4X5XA 1BFVH 4JZOB 2G75B 4OGXL 4P49A 3DV4B 1QRND 3ULVD 5CGMA 1A1OB 4MZ2A 1C16B 5EZOH 2OXHA 3ZHKA 4KJPD 4PRNA 3VXME 3UZVB 3B43A 4XCYB 4PJIA 3VXQA 3EOYG 2YD7A 3MRDB 3PE9A 4PRBB 5BW7C 4HD9A 5D1ZD 1R5IA 5D6DC 4OFVA 2PXYC 3RA7L 5HVFB 4NFCA 3HPJA 5IJKA 1MEXL 3JBG7 4W81A 1CLCA 2F53B 1QQDA 4OI9A 3HCVB 1C8PA 2WIIB 4M1CC 3MRMA 4OGXH 5DTFB 1UB6B 2NR6D 4I3RL 5IVXB 1W0VA 3KXFE 3CFDA 1OSZB 5CSBA 5TE4H 3PWUA 3S4SA 4P3WA 2MOVA 4FFVC 3C5JB 4RAVA 1AE6L 1OAKH 2YEZB 3TO4B 4EI5B 4LP5A 4AEFA 4YEEA 2DL9A 4LCIH 4DUWA 1G0DA 1LEIA 4QLRA 3DARA 4HHAA 3TVMC 3WIFA 1K6QH 1FFRA 3QUZD 4YBQC 3JTSA 2Z8RA 4UBDC 3KPQB 1F58L 2J8UA 5D1XD 1H8OA 4N0YH 3TYFB 4G5ZL 3KPSD 3SCMA 1QFPA 4Y8AA 4BQBA 5L9DH 3BHBB 1II4E 3RY5A 4K3EH 1X5YA 1KYOK 5DFWH 2ICWJ 3VXMD 5AG9A 1PKOA 3V4VL 4KRPD 4FG6C 5CBAB 1ZTXL 4LSUL 3MA9L 4LCIL 3J7HA 4UT7L 4HKBA 2I9LA 4WY7H 4RBPH 1ZHBB 2LFGA 2G75A 2Q76A 1U8LB 4FTVB 5CZXD 4UU9A 4OLUH 1BD2A 2IBGA 4LPYA 1VACA 4PJ7A 1R24A 1CL7I 3FOMA 1E28B 1J10A 4QWWD 4OLVL 4NQTA 5I30H 3WJJC 2JCCB 4YHYB 2P7TB 1OPGH 2HVJA 1EVUA 3NOIA 4WU5B 2DYPB 5AYQA 3WS3A 2Y5EA 4YC2C 4XPAH 4R2GD 3AB0C 4JPVL 1U41A 2DQUH 1I7RB 1MJ7L 3OQ3B 1NLBH 3V6BR 1ZANL 3GEWB 4KZDL 1T20A 2G9HB 4WW1A 2GJ6B 3S4SB 4J3SA 1MFCL 5JHDB 2CLVB 4XCFL 1DN0A 1IGJB 3WUWA 2RBLA 4EIGB 3O3AA 3D48R 4K3DH 2OYPA 3SY0A 1CG9A 5TE7L 2NX5A 2ZNWA 5E7FA 3B8YA 1F8TL 4AQ1B 1AXIB 1H0DB 4M43H 1ZWIB 3LZFL 1TQCB 5KJRL 3BMVA 4AMKL 1HH6B 5AZEL 4FFZL 3ECBB 2J5LB 3QQ9D 5DWUH 2DKUA 2DI8A 4F2MB 2P1YA 1H15A 4YPGB 1T66C 5BVJA 2C4FU 3MLUL 1ZLWK 4ODHL 5GGSB 4P57A 3CFBB 3BKJH 1X7QA 3MRLB 3PWPA 3MNVA 4QHMA 3TPUB 1CGVA 1QP1A 1L6ZA 4LP4A 4JGJA 3IVKA 2SEBA 3LPWA 3A6OA 3OWEA 3QUXA 1ZVSA 1OLLA 1X6NA 3W11C 3IFNL 2C3XA 3E8UH 3PIQB 5D2LA 5CD5D 2Y06H 5C0ND 1A2YB 3IXAA 2FX9L 3FQUA 3DVGB 2DRUA 4W4NA 5DMJB 4PRPE 4O2CB 3O9WD 3WEXB 3W5NA 1T1YA 2CMRL 1QSEE 3WS3B 3GSVA 1DFBL 1WITA 5C7XL 1S7QA 2DQFB 1KJMA 3WIFB 4UV4L 1XGTA 2ZOLB 3QHZH 1JF1B 1Z9MA 4ZG1A 1CYGA 2VLJB 1KELL 1CU4L 3RGVB 5L6YH 1S9VB 1J8HD 3ES6B 4YHML 3T3PF 1VADB 5DMKB 4QNPF 4OZGA 3ME0A 1DVFD 3DX8B 4RMWA 1NL0L 4KKLD 5E00A 2DQEL 3HKFA 5I8EA 1L6XA 3U4BH 1C7SA 3TCLB 1T04B 4MZ3A 3I6GA 4NHUA 2Q76B 5JDSA 4P0DA 3CU1A 4NNXA 1DLHA 1U2HA 2AQ1A 4M6NH 2B20A 4RQQB 3KPMA 3VH8A 4MXQC 4H26B 2Q86A 1ONQB 2DLGA 4WFFD 3DSNA 4ZUTB 5IHZA 4XPBL 1BJ1J 2P44B 5EU4B 4NP4L 5SWZA 3UJIH 3OG4B 3WO4C 5KVGH 4ZUSA 1W72L 1FFQA 4KUZL 3TWCH 4KK6D 5KVMC 3LQAC 5HHNB 2V7NB 4GKNB 1XGTB 1FZKB 4XPFL 1N2RA 4JPWL 4QTHA 3AY4C 3HN3A 1FNEA 3E0GA 4WO4C 2XZQH 1QBMH 4HUXA 1JGLL 1BQLH 1MRFH 2ORBL 5I1AB 4ZUWA 1MJJA 2AEQH 3L3KB 4HGMA 4PGDA 3WFBH 3WXWL 4MNHB 4UZGA 1TCRB 1BD2E 5FOJA 3D2UA 4KKBD 5C0AD 3EYVB 4TSCH 3VW3L 3DVFA 2YRZA 2J8HA 3MBEB 3DSFH 3UTZB 3NFSH 4POZD 3T04D 3PWJB 3SKOA 3UBXI 3U1SL 2YPLE 5HTSA 1L7IH 1WCQA 3ZT5A 5FYKD 1Y0LB 3Q6GH 5B8CC 4OM1H 5AYUH 4Z76B 1F6FB 4JM2C 3KYNA 1EHLH 3RVTD 1PKQE 3C60C 5E4IA 1IGIH 5KSAA 2X09A 2NNAA 4OD3L 1IMHC 3QPXL 1LO4H 5HHVH 1KEML 4S1RL 4DKEL 3DX9B 2J8UF 4PR5A 1PZ5B 1XF1A 4WO4D 2IH3B 4X5WA 4MNQB 3B2UC 3BDYL 5HYJB 3BWAA 3L3HA 2F8XC 1X5XA 1EGJL 2NY0D 3MFFA 3ZKQD 5FUOH 3L6FB 1JVKA 1MVUB 1ONQA 4HPOL 2ZKHH 1H9VA 4D8PA 3FO9B 2FSEA 3QFJE 4JR9L 2I27N 4PP2B 4DFHA 2RAMA 4YHZL 4LLWB 3G6JE 1KCVH 3VFGH 5AD0A 5J56B 4MHHG 1AKJB 1JFQH 2W38A 4E42A 4HJ0C 4E41E 5IJVA 3K2UH 1Q0XL 1TENA 1Z6JT 4O4YH 4WWKA 1AGEB 4XBPB 3MA7A 3UBXB 4GXVH 2AJYH 2ZJSL 4NM4L 1RULL 2HTLC 1UH4A 5B38A 2ERJC 1KBGH 2GW5A 2OJEA 3LQZA 3ZTNH 3V5KB 3GB7B 3CDCA 1S7SA 4HXBL 3GI9L 3GSNA 5C9KA 3WLWD 3M8OH 3KXFA 2GIYA 5F7NC 4NM8H 3OX8B 4YEFA 1CT8B 2VISA 4GAYA 1DQDL 3NIGE 4P2RD 3DGCR 5D4QA 5JIPA 3FONB 4X98B 5C0CD 4YLQT 3VXSD 4NC0B 2FYYB 4ZPVB 1RZKC 4Z5RA 1OCWL 4FFYL 3IF1B 3I6GB 1QFOA 4NHUB 5FHBL 4OV6F 3FAWA 3SE4C 5DJDB 2CRZA 2E7BA 2FO4A 2FIKA 3QJFA 4L9LC 3DRTB 2V9RA 4HXBH 2F58H 2P5EE 3TF7C 4YX2L 3F7PC 2VLRD 2ICCA 2AW2A 2X4NA 4RMTA 3RBSA 1LNUA 4NQDB 2BMKB 4K23L 1FHGA 2BNQE 4K9EL 3QFDA 1RMFH 4WI6A 1WBXB 4MA3A 5E1AB 1FZKA 1NGQH 1JIBA 1MCHA 2JELH 2C9AA 4GLRI 5B39B 4RGNB 3LMJL 1JPGA 5C0FB 2R2HA 3S97C 1MWAB 3JV0A 5K9OB 3GSNB 3CMOH 3P9MA 4ZNCD 1AC6A 5DJ8B 2QHLA 1FGNL 2D0FA 4ODSH 4TULH 5DT1H 1S7TA 1PG7H 1N4XL 5GS0D 1J1PH 2F58L 4GW5B 1BVKB 2AABH 5IFHH 4O51B 2E9IA 3VFWA 2KBGA 4KTEL 2DIJA 3VI3F 5FGCE 1X5HA 5DD1H 2NY7H 3VWKD 1DBAL 2OBGA 4K9EH 2Z93A 4H20L 1BQUA 3D5OF 2EYTA 3BQUA 4XT1C 5BMFL 5HHOB 4BSWA 1JMXA 1QO3A 2PXYA 3PDGA 5D96C 3WN5A 3NZ8B 4IMKA 1KCSL 4NCC2 1VPOL 1U42A 4H1LH 5DI8B 3REWB 1P7KB 1JWSA 1SM3H 3NIFE 3UJJH 1DL7L 4KC3B 5CP7B 1FC1A 2KH2B 2QR0A 1YYLH 5JOPD 4PTTB 4M6ML 5DD1L 3RX8A 5T1MA 5HYSG 5JXED 5T3XH 4MD4A 1R3JA 4PJ5B 2HFGL 2K7QA 4PY8I 5L9DL 1YJDL 5CS7A 5EZIH 3BP5B 4JDTH 5DA0B 1HQ4B 1U58A 2XI9A 2VDLH 4NQDD 4OUOA 4V1DE 5LXGH 2A73A 4PRPA 2EKJA 1S9YA 3O6FC 1NQBA 4CN6A 3GSVB 1RPQA 4JKPL 1R3KA 1NMCB 5ERWA 4R2GC 3DXAD 4PG9B 1WEJH 4NN5B 3ISWA 4QRRE 2BVQA 1OAXH 2YPKB 5HGDB 4I0PD 4I4WB 3CSYB 1GGTA 1GOFA 1ND0A 1UENA 4G6FD 4D0DA 2YD5A 3HZKB 3VXSE 4Y2DB 4LVNC 3W82A 1YY8B 5GZOC 4KKAD 1NEZG 4J4PA 5HGHA 3KYOA 4R7NB 4GT7A 1Y18A 1U92A 2OJZL 4YO0B 2ZSVB 1NEZB 4P3DA 4U6VL 3FMGH 3X3FH 2M1KA 3VGHA 4K7FA 1IAMA 5EU5A 5EO1B 5MEOB 3PWNB 1SEBA 4O02H 1HILA 4PJ9B 4P4KB 5F7MC 5J13B 3IFPA 4RGOL 1KIRB 4UIKH 1F5WA 1WEJL 4AEHL 4QXTB 3CAFA 2YA2A 4LCWA 4HGKC 4PJEF 2X1XR 4PJGE 2QSCL 3AAZA 1EV2E 5KOVC 5C0GA 3MV9D 5I2IB 5TE7H 3SKNB 3V4VH 5EWIH 4CADA 1EMTH 3KXFD 2JE8A 3RNKA 4F7PA 4WO4A 4F57L 3UJTL 5DQ9A 4IOIB 1EX0A 1GC1H 4KJWD 3THML 4LVOB 4AEIH 4RGOH 5C2BH 4J3TA 4O00A 3AXLA 3WSQH 1CDHA 1R3JB 1TPXB 4K07A 3NZHH 5GRYA 1KLFA 4WFGD 4JFDA 3W5MA 4WWID 3LHPL 5TE4L 5HGHB 1U58B 4HJJH 1T1WA 4FQ2L 4EXPX 3IT8D 1T83A 1P84K 2EDLA 1ADQH 1KLUA 2IC2A 1MQKH 4NPYA 1NMAH 3RVWC 1CGTA 4TNWK 4U6HA 5F7YC 5I0ZA 5BZDA 2X41A 5JDSB 1NLBL 3C6LB 1MFBL 4KRNA 1J1OL 4NHCH 2F54A 3G6DH 3NZHL 1JZ6A 1Q9KB 2MHAB 2R0LH 3RL1A 4X6CE 2BP3A 1WWCA 3NZ8A 2CR3A 3GO1L 3RGHA 1CK0L 3FQNA 3AS2A 3LQAL 4OZIB 1QRKA 3ILPB 1P7KA 3P0GB 2ZUYA 1KOAA 1FIGL 3FQWA 1A7PL 5HY9A 1Q9OA 1XF4A 3QZWA 2HA1A 1KN4L 2P8PA 5TDNB 4KROB 5CJXA 2NY3B 1P7HL 3RVTC 4PTTA 3P40A 4LPUA 5DGQA 5I1LB 4QXTA 3ARXA 4UQ3B 3VXSA 5L6YL 5TGBA 1IFHH 1QEWA 1BGXL 1QUNA 5ILTL 3CXDL 3O8XD 3RWIB 4RWYH 4ZXBC 1F4WH 4TVPH 3DHJA 4MD5A 4HBCL 1PSKL 4Y1AA 1PVHA 2VWEE 3PHOB 3TLRA 1JJUA 2DQHL 1CE6B 1CR9H 2BSTA 4PV9A 5E5MB 5D8JH 4QHLA 4NQED 4LU5H 4GRLA 2JIXB 1EZVY 3O3BA 3N50A 3SJVD 1JUFA 2CKNA 3H9SB 1ZANH 3U4EA 4R9HA 4X7SH 2EXYC 2RB8A 3TYFA 3SDAB 2AI0L 2V2XB 1PFCA 3C2AL 3RP1A 5F3BA 4FNLL 3VMPA 2YZ1A 5FO9A 1NGZA 1D6EA 2FEDD 5CSZB 1D6VH 4YFEA 4XNMA 4PLNC 4UOW0 4KU1A 4OZHB 4PJIE 2DDQH 1XGRB 5IT2L 1XCTB 3MMEB 2B2XH 5B22A 4NNPL 1U3HA 4JFED 1J8HE 1SEBB 2O5ZL 2P4AB 1DFBH 3KDMB 3SKUD 5LAXA 5KJRH 3CDFA 4HJ0D 1U8MA 4FFZH 1UM4L 3T0BA 4XNUL 1B9ZA 1P1ZA 3KLHD 5GGVL 3V0WL 2D03L 3GMLB 3QJHA 4EVNB 35C8H 4PYHA 3OKMB 4WV1C 1QR4A 4YGAB 1JV5B 1OM3L 1JN6A 3G5YB 5HDLA 1OSPH 4Z77B 2V5SA 1MPAL 1D9KB 3UTQB 1D5XB 1I8MA 1LEGB 2QQQA 4J6RH 3OXSA 3LS4L 5DHVA 5T5NG 2FJHA 2E6QA 2MPAH 4WWKB 4XBPA 3K3QA 2Q87A 2EH7L 2JTDA 3AY4A 2J12B 4Y4KB 3VGFA 2LE9A 1YMME 2GT9B 4LAQH 4KJYB 1W72A 3CX5K 4IJ3B 1UM4H 3EYSH 2ZP0T 4L4TB 3O9WB 1NGZB 2GJ6A 4R26L 3TO4C 1VADA 5IROA 3TVMD 3WN5C 4JREB 1A8JH 3SKJH 2PO6D 5FAAA 2AEPH 4CVUA 1QVOA 5F1KC 5F3HB 3Q2CA 4ZSOE 3VWJA 1KEGH 5H35B 1MAML 1R3HA 1SYVB 3LN9A 4LCUA 3RZCA 5T1DL 2PW1A 5HSFA 1FFNB 3KPNA 3UC0L 3OGCB 3VXRE 4JFEA 4RNRA 4Y4FB 1PJ9A 1JK8A 3CLFH 1HHHB 1YQ2A 4NN7C 4JB9H 5IR1B 4F2MA 2Y1VA 1EVTC 1O7VA 1Q9WA 5ACZB 5JW4N 1BFOB 2XY1A 4YHMH 1BQHB 3O8XA 4RRPG 2Z9TA