5J9PA

Kcsa in vitro
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
molecule keywords Fab
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA02
1MLBA 2V5YA 2EDJA 5E08L 5DJCA 5IT2H 3FOLB 4X6FB 5E2VL 5I30L 4MMZC 3MACL 4PJBE 1MJ8H 1S7WB 2X4RA 3ZKMD 2AXJA 5KVGH 1I3RA 5C86A 1EO5A 3LV3A 5DA4A 1QG3A 5HVHB 1N59B 4JM2A 2BC4B 2R1XB 4I2XB 5D2NA 5E9DA 2AK4A 3EFDH 1JNJA 2ADJB 3MGOB 4NHUB 1OB1B 5DRNB 4KVCH 1ORSA 2VDMH 4WW1A 1YYMH 1M71A 3BVNB 1G6RB 2OTPA 2I60H 3VCLB 1NCCL 1Q94A 1MCBA 2DQUH 4ZODA 4LCWB 5BW7A 3FO2B 3HPJB 1AE6L 2VSCA 4WEBL 2ATKA 5DO2D 2IAMC 1BJMA 3LPWA 1I1AB 3QBTB 3X3GL 1CGSL 1TCRB 5BOZG 5F3HA 2ZSVB 1U6AL 1OAXH 3MLRL 1WV7T 4M8VA 4TNVF 4PRHA 5T1KD 4WFGD 5T5NG 4LLWB 4PJDB 3L9RA 4EEEA 5GS3A 2PTUA 2HWZL 1HH9B 2Q8BH 3K2UH 5FM5M 3D6GA 4X5LA 3KR3H 1V7NL 2R0ZH 2PN5A 3K1KC 3KYNA 3GKZA 4DQOH 5HPMA 3T0EC 2X9WA 4BH8A 2CGRL 3E3QC 2DQTL 1JI2A 3CAFA 2APBA 2R4SH 3GSNL 4OLUL 4PBVC 2EYTA 4PS4H 4L29A 5AYUH 5A2KH 1ZHNA 4YC2B 3U46B 1JV5A 4QRPB 5EWIH 2Z35B 2VLKD 2Q86A 4YR6A 5ADPL 4UQ2B 5DJ8A 1OT1A 5F21B 4HK3N 1DBKH 1CE1H 1EEYA 2OI9B 2DYPB 4GKSB 4PRDB 1B90A 4U1IA 2YUXA 4LLYB 3SDXA 3T0BA 1NANI 3C6LD 3O2VH 4WDIA 4PGBB 4WHTB 5ICXB 5C1MB 2WUBL 1HXYB 4P23B 2MOVA 5ITBH 2FEDD 1UB6B 4OKDA 3WLWC 4FQ1L 3UAJD 3KYNB 32C2B 3IDYB 3X3FL 4E5XB 5HI3C 5DD3L 3NCEB 1OM3L 2XG5A 1MF2L 4P23C 2ORBH 1QQDA 1DN0A 5L88L 1XGRA 1NL0L 4WO4A 3QDMB 3FN9A 1R3LA 1EZVX 4R0LC 1QSZA 3D69A 3SEPA 4IMKC 4ONHB 4WU7B 3RL2B 5F6IC 4MA8H 4ZYKB 3WFZA 1OWRM 2H8PA 4XPBH 5CWSA 5HHQA 1MPAL 5EB9A 1U3HD 5I2IB 3ET9F 1BECA 3TBYA 3VFTB 1CF8L 3SDXF 4PJXA 1N5AB 1AQDB 2IPKA 2PKDA 2JK5B 4Z7QF 4KXZH 1A6WL 3GI9L 1A3QA 5K93A 2DJ4A 4YC2C 4WHTA 4LVHB 5HHME 2VUYA 4KRPD 4R9HA 3MLTB 4Z7VF 2DQIH 1KTDB 2D03H 1G9EA 5DMJB 5GGRY 1AP2A 1FNSL 5IFHL 3O4LD 4TULH 4PJHA 3E8UH 4ONGL 1E6JH 4MB5A 3VMOA 2VC2H 3V4PH 2YZ1A 2EYSA 2K1MA 2PO6B 1FP5A 2Z31A 4QRPD 1XCQA 5AAWA 2J8OA 3VGBA 3QDGE 3L3OB 3MCKA 1LO0L 3BEWA 1CXLA 2YWYA 1FV1A 4EN3C 3HAEH 1TZIA 1RI8A 2VLMD 5TH2B 2D7MA 4PJ8A 5DJCB 4W6YB 5SX4H 4IIQC 5CS7A 2CLVA 4FQ2L 5EU6E 4PJEE 5DUBA 1JF6A 3QEHA 3KPSB 4PBXA 3SKMB 1UZ6E 3LQZB 1PYWA 3NIFE 1FSKB 2GFBA 4NZTH 4EXPX 2ARJB 2P43B 2CIIA 4RAUA 1HXMB 1OAZH 4ELKB 2YD3A 1AD0A 1U8PB 4LEXH 1BEYH 4JGMA 3BZFB 1HZHL 4LLMA 2QQKL 2UZIH 1DQLH 3H2WA 5GGTA 12E8L 4RGOH 4UT9L 5E6YA 2NNAB 3O6FD 3GIZL 4DOHE 4FP8L 2WBWB 3VXUA 1JNHB 5L6YL 1ADQA 4POZC 5F9JA 3IJSB 3KPRA 4JFPB 4H5SA 3RP1A 1XGPA 2YRZA 2NW3A 3V52H 1T0MB 4KGJA 5FM5O 5TQ2H 1DVFB 3OKKB 4YDVB 1WFTA 2CIKB 3MRHB 4XP5H 4PRHB 5TFSH 3I6GA 1X5HA 1J1XH 5HHOE 3VWKC 4FABL 2GUOB 5CLTA 2HJKA 1P1ZA 4L3AA 5CJOL 1LEIA 2NW2B 4Q6IC 1HHHA 4HJJH 4O2EA 4PRBB 3GI8L 1QOKA 4LQ1A 3DYMA 3ULVF 5H94B 4ZG1A 3IDMA 1AO7D 3RVXC 4NIKB 4OM1H 4LSTH 5JA8B 3O2DL 2Q7YA 3G6JA 2VIRA 3C60B 2HP4A 4JPVL 3FQUB 2FIKA 5ESAA 2CJUH 4XMKH 4XNYH 2EKJA 2OXGA 4NOFA 1MJJB 3CXDL 4XVSH 1DL7L 4L29B 4S2SB 3RQ3A 5KBNC 4WY7H 3S8WA 4PTUA 2D7NA 3SO5A 5DQ9A 4O9HH 1ZA3A 1HKFA 2V5MA 5EZOH 5F9OL 1MLBB 3BWAB 1OTSD 1VHPA 5IHZB 3NIDE 3LQAL 3JV0A 5AWNH 4FFZL 5FF6B 5JORB 3T2PA 1CD1B 3OXSA 2ICCA 3PDOA 4LLUB 4IJ3C 5HYEA 2BSTA 4X4XA 3MNVA 4HG4K 3MA9L 2ADJA 2IPTL 1KN4H 4Z7VE 5F89B 3NCJH 5E6ZA 3WS6A 1K5NB 5LCVL 3KPMB 1J8HD 4Z77B 1XGRB 4LCWD 3D39D 4MDJA 1T3FA 4H26B 3TA3B 3VXQB 2JCCE 5F3BB 5I9QC 5FK9B 3BOVA 2O5ZL 1IQDB 3THMH 3MZTA 4L8SC 1RUKL 3QHFH 3VA2C 4DKEH 4OCWL 4HXBH 2BNQA 1KJVB 5DT1L 4X8JA 4K7FB 1HQ4A 3FT2A 1CZ8L 1N5AA 2ZUSA 2W60B 5SWZA 1LE9A 1OQOA 5F71A 4A2LA 1I8KA 3L3JB 3H42H 1A1NA 4NZDA 2JB6B 2W0KA 2VZTA 3ILPA 1FH5H 1BFOA 3HR5B 3TN0D 5EU6A 4NM8H 4CBPA 3SCMD 5JDJA 3CLFL 2VLLA 4HIXL 5EULV 4H8WH 5D1ZC 1KYOK 1ZXQA 1KPVB 1RMFL 4GMTH 2WBKA 2DKMA 1F6AB 5I1GH 4UIMA 5HYJE 3VD4A 1S8DB 1WBZB 2AJYH 4IRZL 4OAWB 2UYLB 2WINB 5GRVK 2D9QB 3BFOA 1DUZA 3CZJA 1EK3A 3ARDB 1ZTXH 3X13A 4L8CB 3BPLC 5CBEA 3MJ6A 3MRNA 5EIVA 4KROB 4JN2A 1TJGH 1I3GH 1UM5H 1LE9B 3JWDL 4JFFD 4I3GA 3CSPA 3BZ4A 3ROOB 4BZ2L 3DURA 1JYVA 4HC1L 3L7FA 3DVGA 2CUIA 4P9ML 3ZT7A 2HYMA 3NN8A 3T09A 3OAUH 1J8HE 2JJUA 1LEGA 4MHHI 1ZANL 2D3VA 1ERNA 4Q9BA 1Q9KA 3CU7A 4X83A 3QDGB 2Y36H 5JOFB 1YEEL 4LNRB 3H7LA 2RJMA 2FZ3A 1AGFA 1S8DA 1NFDB 4ZAKA 2R2EA 4HLJA 4ZOBA 3V6FA 1UB5B 1BFTA 3BQUD 4Z95H 5EN2B 2G5BB 3VA6A 4WUKH 1QLRA 4WI2A 2A1WL 5E4IA 4KRPB 3DUUA 3EDEA 4HZLB 3NH7L 1ZHKA 4HJGA 3FN0H 7FABH 5JW4N 4GG6A 1FYTB 3B9KD 3IJHB 4O51A 1UKSA 4QY8B 5DRNA 3I84A 5D2LA 3J8F7 3U0TA 4TNWF 3QUZD 1CFNA 1A4JA 3B2UD 2DI7A 1G6RA 4PJGB 1XIWB 4KK5C 1S7TA 2ZG3A 3SKJH 4N0UE 3VFUB 1TCRA 3ARQA 1Z9LA 4U6YA 5C71A 1T2QL 4XNZC 1AO7E 5JZ7D 3TCLA 2W65A 5HGHA 4MNQD 4KTEH 1J87A 3EZ8A 1JK8B 5DHVA 5E8EA 3BP5A 1NGYB 2IAMA 2X7LA 3BWAA 4ZUSA 5IVXB 1DANU 4QRRB 1PZ5B 4EI6B 4UBDD 1RD6A 1FFQA 2PW2A 4OLXL 3LCYA 2G75B 4YDIH 9CGTA 3QP3A 1WT5C 5FUCC 1T1WB 2ED8A 3N1MC 3V6ZA 1PD6A 1LQSR 4WGVB 2WLZA 1UJ3A 3OGOE 3RHWK 3VFMA 2QSQA 4F7PB 5DJYB 2DQCL 4P3CL 4D0BB 4RIRA 3F8UB 1P4IH 4LHUG 3L3IB 1ND0B 1P4IL 1FVCA 4MQXC 1R5WA 3JV4A 4UQ2A 2DQCH 2NXZC 4OKVB 4P3CH 5CJBA 4O2CB 4BFIB 5IWLC 5KSBA 3R1GH 3JXAA 3MO1B 4PLOB 4HBCL 3LRGA 1TVHA 4LCUA 5HYFA 2B5IC 2GQHA 4G7VL 3ZTNH 5D7IA 2DYPA 4NO3A 4HWZA 5CGMA 5E4EC 4GAJL 4QF1A 3CVHA 1NGYA 2LU4A 1FORL 2ZKHH 4G9FA 4Y1AA 1KNOB 1LD9A 4YHKH 3P11H 4Q2ZA 1MRFH 2QQNH 4KTEL 1CD8A 3NACH 3ZYIA 3IDMB 4DAGH 3AFLA 1P5VA 4P59L 4U6VL 1OAQL 4CUCA 2X89D 3H3KA 2VZ3A 2Z31C 3RVVC 3EOBA 3Q6FA 1IT9H 4X9IA 4R26H 2VKWA 1HN1A 2QJDA 4OM0H 1P2CA 5IW6A 1XR8A 1IJ9A 2D4FA 3HE6A 4UDUA 1UH4A 1DR9A 5HJ3A 1R3IH 4QRUB 1KEMH 2H8PB 2XICA 5CWSB 5GXBB 3BP4B 4WU7A 1OPGH 4PYHA 3OXRA 4DCQB 4TOYH 3B9EA 1FRGL 1U95B 4QHUB 4LAJH 3NH7H 3BESR 5D1QD 1FAIH 4I77L 3C8KA 1I85C 5JNYB 2V9RA 2R2HA 3MLTA 3D5OF 3BKJH 4WHCA 1JWUB 2O5XH 3MNWB 1P4BH 4L9LA 4Z7QE 5CEYA 3QEQD 1PZUB 1T5XB 4Y19B 3PGFH 1I9RH 4OSUL 5D72L 3RWDB 4G42B 1F4XL 1YEEH 4W4OA 4BZ1H 1JYNA 1KGCE 4ZXBD 5AZEL 1SJXA 4UV7H 1S7QB 3RY4A 3CFEA 4NSKB 1NCNA 3OSKA 3D1MC 3C60C 3WE6A 1B6UA 2YSSA 2V9QA 1IFHH 2VISA 1NBVH 3BJLA 1NGPH 2RCSH 3QDJD 4P9MH 4DGIH 4ZAKB 4EUPH 4HC1H 5FIEA 3I9GH 4UDTB 3FZUD 4OFPA 3VXTA 3SDAC 5DZOA 3P73B 4NO0B 2FR4B 3OTTA 1F90H 3C8KB 1KEGH 4ZNEE 1RIHH 3HNVL 4GQ9L 4URTB 4YHML 1DLHB 3ARDC 4NKMA 2OK0H 4PGJA 2PCPA 2PYEE 3FRUA 3QXDB 1G7PA 2DTMH 2OJEA 3IB4A 5J11B 3AU1B 1VFMA 4P3DA 2I9LA 3VI4F 4PB0L 3KYKL 4OGXL 3TH4T 4PR5B 5HHOD 3MRIB 2E3VA 1VFBA 4HEPG 5BZWA 1FCCA 2B8OT 1CDYA 3DSFL 3IXAB 4N0CC 2L0DA 3PP3K 3TO2B 1MOEA 5FUOL 3L3KA 4NM8L 4YFDB 3ZZ1A 1JK8A 3V7MA 1PKQA 1LDPH 3Q3GA 3IT8D 4DW2L 1WAAF 5L2JA 3E0GA 4C4KO 1LEIB 2IFFL 1CZ8H 1KENH 2HTKC 4XAKE 5C0BE 1SJEA 3HC0B 4Y19D 2WQRA 4B7IA 1IVLA 2X89A 3BZ4B 4OCWH 3K2MC 4DKEL 4Q6IA 4OD1H 1RUKH 4EN3A 1T4KA 4U6HA 4F33A 3NIGF 1FNFA 2CH8A 4PP2A 5LWYH 4JANA 3KPSE 4OV5A 4QRTB 2EDRA 3UJIH 3F7PC 3QNZA 2ZSWB 3B8SA 3C6SA 2DQJL 2EO9A 4EOWH 1MAML 1F4YH 3HMXL 4PTUB 1M7IA 4JFYB 4YPGB 5F3HB 1KTKE 4M7KH 1A9BA 4FQHB 1PBYA 3DGGB 4MCYA 2VABB 4JRXE 3TV3H 4Y4HD 1GJIA 4PJ9C 1NC4A 3ZDXE 2DLFH 4B50A 3V6FB 4JDVA 3PHOA 5AWNL 3F7VA 3QNYB 4LLUA 3EJYC 4O4YH 3H7BB 2Y7QA 1MFBL 2GY7B 2BK8A 5T1DH 3D25B 4QGYA 1RZJC 4NNPH 5ICZA 5F89A 4GG6B 1HH6A 1UKQA 2X4TB 4HWBA 4J4PD 5I74C 1XIWD 1CL7L 4PP2B 3MRFB 4NCDA 4ZUWA 1I1FB 3SGJA 1JFQH 4HHAA 1P7HL 1X5ZA 3CXDH 4UQ3B 1T6WA 1YQVH 4ONFH 4XNYL 3C6SB 2CJUL 1NMAL 4HKBB 3G6JE 1HHJA 1ZAGA 5BV7C 3A6CL 4HUUB 1O5DT 4J4PC 1ZGLP 4HUVB 4DZBB 3A67L 4KJWC 1FQ9C 2A2QT 4NNYB 4OLYH 1WLHA 4HJJL 1C12B 1YEDA 2R1WB 1E6OL 5IF0B 1ZV5A 5CP3H 1Q1JL 3EJYD 3GIVB 4NO0D 4M62L 4WFHD 5IQ7H 1TTUA 2G75A 3OKEA 1JZ5A 3MV9D 5L7XL 3OR7A 1T80A 1YEHH 1NKOA 1TJIL 2V17H 4OLVH 3UJJH 5FYJE 4YHOL 1EERB 5IBLC 3QYCA 5SX5H 4RGNB 4P4RB 3TIEA 1JZ3A 5GGRB 5F88B 4K94C 4RAVA 5ALCH 3BIKB 1MCPH 1FVCB 3GSQB 1JHTB 4NZUL 1DQLL 5DYOA 5C0RH 1Q9WB 4OAWA 1HZHH 3IS0X 4LIQE 4HIJA 5I8OL 4LNVA 1OAZL 4XCCH 3HE7D 2LAAA 4GS7B 3QJFB 2QSVA 1NGZB 3QO0A 4JM2D 1QNZH 1G0YR 3QG6B 5HHPA 5A3IC 4H20L 3QO1A 3BGFB 1EHLL 2EZ0C 5D7JB 2BNRB 3VXSD 3NZHL 5TJWK 3S7GA 4YJZL 3EYQC 1EJ6A 5FKAA 2C3XA 3QUXD 5HYJB 3G08A 3JTTB 3QIWB 3CZFA 2FGWL 5IMKB 1DQJA 3CFBB 1LO0H 2BVOA 3J7HA 3Q5TA 4Q9QH 2R8SH 2KZ1B 5B38A 4KUCF 2FECL 4NQSB 1E28A 5DJ2A 4ELMF 2NLJB 3EYUH 2V5RA 1PKQB 1XF2A 5IFHH 1S5IL 2HH0H 4CVZB 2D03L 4Y4KD 4PY8J 4HIIB 2Y5EA 4P5TB 3FO2A 3HPJA 4LP4A 1EUTA 3KGRA 3V6OC 4QHUA 1J7VR 1EHAA 4H1LG 1A6WH 4PJXE 5D1ZA 5I1KL 1Y6KR 1CF8H 1T4KB 4G8GB 5EU7E 4JO3H 4M4RA 3SJVD 1JIBA 1JNNH 2UWEF 3U0TB 3ZE2E 3PDOB 2BC4A 4YQXH 4PJIE 1AI1L 3RWEB 3VD5A 3D85A 2HT4D 1DBBL 1E4WL 1LP9E 3KPRD 4LSSH 5HGDB 2EC9T 5DK3A 2XY1A 3WXWL 1MF2H 2XXCB 4NQVB 1EEZA 3C5ZC 3F6IA 2R23B 4NNXB 3X3FH 3B83A 3NIGE 5DK0B 4XI5D 2HN7A 5DMIL 4CKVX 1FZKA 1RUQH 1QD0A 4QRPA 2O5YL 35C8L 2IG2L 4AL8H 5C0JB 4Y8DC 2D0HA 2EZ0D 1CT8B 2JIXD 5A16A 3DO7B 4Z78B 3QFDA 1Z6JT 2E27H 2IALB 3WV0A 4YGVB 1JRHL 2WWKO 3ZL4H 3IKKA 5L8KB 5DZNA 5JIIA 3UZEA 3I75B 3SDYL 3PV6A 1JGLL 1J8KA 1X5IA 4PLJC 1CE1L 3P9LB 1OCWL 4UI2A 5ICYB 4MSWB 4NDMB 5TE4L 5C2UB 2HT2C 2AVGA 2KQNA 1UJ3B 4PRNA 1D6EA 3DYPA 1YNLL 2EO1A 3N9GL 4N0YH 4N0FA 2VLLB 1CFQB 4OLUH 4PS4L 2K9UA 3GSNH 4P2QE 2P5WB 4HH8A 3T0EB 1OP9A 1EUUA 3JV6A 3KLAB 3EDDA 2AXGB 4PLKD 1T5WA 1TVDA 3MJ7A 3AVEA 4KQ3L 4DJMA 1OTUC 2QV2A 3QWRD 2ERJC 3CC5B 2HWZH 1K3ZA 3BWUC 4UAOB 1KNOA 1EEYB 3CLEL 1H8SA 4OUUA 2WANA 3TVMB 3RDTB 1RURH 3ARSA 3UTQA 3TBYB 2BSTB 5F7DA 5D5MB 3SGKA 4DKFH 1KULA 25C8H 4ODBD 5ICXA 5GGTL 5HPMB 2HTLC 3E6HB 2BZDA 5C8JB 1AE6H 5B8CB 1RU9H 2HLAA 3FFCD 1T21A 2A6KA 4IRSC 1A6VL 5D93B 3B2VH 2XN9D 4F3FA 4KHXL 1VPOL 1KTRL 3OWEA 2H45A 1YA5A 3BP4A 2HRPH 1VACB 4MHHG 2QQQA 3IAPA 4BUGA 3KLHD 1YC7A 2QR0A 4ZUVB 5TF0A 3Q2CA 4UU9A 1YEFL 1Y0LB 3GHEH 2XACC 2YEZA 4X6BA 1MJ8L 5EO1A 3MACH 5ACLA 1NGZA 3U9PH 2X4UA 3FMGL 2NY6B 2IC2A 1OSZB 1FDLH 4TVPD 2NXYC 4G42A 1ZOXA 5EUOB 1QEWB 2GCYA 1U8OA 5IMKA 4I18B 1D5IH 1V3JA 5TPWH 3DPBA 2AEPL 5FUCE 4EKXA 1RUAH 4X5XB 2FD6L 3CZFB 2P5WD 1A7NH 2R4RH 2VTFA 1G0XA 1I7TA 2AAVA 4I4WB 4LHUA 3S37H 2VR4A 3UPCA 2Z31B 2F5AL 5BVJA 4AQ1B 2NYYC 3FONA 3UBXA 1OOAA 5FGSA 5I1JH 1BX2B 4OGZA 4ACPA 1A6TB 5HHQB 4OZFA 4OCXH 1XF2B 1I1CA 1AGBA 4PJ5D 3RWCA 3QQ4A 3Q48A 4JVPA 1ZS8B 4OF8A 4IIQB 1KJMA 4K3GA 5DHYA 3QRGL 1SYSA 3MJ9A 1C7TA 4NRYA 3DARA 2WV3A 4XVTL 1MY5A 2HTKD 3SJVA 3ME0A 4K55A 3DURB 4KK6D 4N8VA 3QXVA 5IK3B 3SKUD 3LMJL 1N6UA 2XQBL 1XGUA 3BQUC 3MV9B 3WIIL 4XC1H 2R0KL 3CGTA 3N0PB 4EI6A 3VRLF 4N5ED 2HLFD 2ESVD 4XBGA 2HG5B 1OARL 3WJLC 1KB9K 3UYOD 3VD7A 5DVNA 3LH2L 3MRDA 3DHJA 4KK9C 1ZA6A 1J88A 4IMKA 2Y6SC 3WBDA 3TN0A 1VEPA 3BXNB 1PEWA 2XZAH 4D0BA 4EIGB 5FV2A 5DK0A 4U1MB 4FMFA 2GSIB 3S36L 5J9PA 4JO1H 2R69H 4WCYL 3K80A 1B0RB 2HFFA 3GMPB 3HCVA 3W11D 3HZKB 1BOGA 3JWOC 3GJFA 4KMTH 2R2BA 3WXVH 1Q9OB 2APWA 1J0KA 4Q6YA 4HH9B 4WV1B 1K2DB 4K3DL 4Y5YA 3RWIA 4KAQH 3EOTL 5D7SL 4KK8C 3IJHA 1X4XA 1K6QL 4O51B 4X9HA 1GGTA 3GB7B 4GG8A 1CGXA 4PPTA 1AFVH 2J6EH 3RGVC 3GSUB 1C5DB 1FG2A 1VFAB 3QIUA 4LCCB 5LVEA 1QRNB 3MV8B 4YHZH 4FS0A 3SGJC 3NFPA 1KB9J 3RY6C 4NM4H 3UBXI 1OGTA 5F93C 4MX7A 3T2OA 1H5BB 2FIKB 4YXLH 1AHWB 5JO5A 2FL5B 4NQDA 4ZXBC 4ZS7L 3ZKSD 1YN7A 3VRJA 4Z7OE 3UTSD 3EYVB 4X6DE 4I48A 1MFNA 3MGAA 3TO4A 2ZUUA 4IRJD 2DL9A 3U1SL 4P2OB 3FB5A 1EH9A 5D6DA 2A9NL 3UC0H 2H1PL 3BN3B 5D5MA 4U3XA 3GUTA 5GPRA 1W8NA 2XNAB 4G6KH 4NJAL 1B4JL 1FO0L 5C07D 4ZFFB 4M48H 2E6JA 4YHNB 1IQWH 5MEQA 3WS3A 32C2A 3N1GC 5HHVH 2B7DT 2I5YH 1TTFA 3D85D 3BDYL 4UT7L 3VXPA 4MX7B 4Z7NE 2EXWD 3GSXA 1JTTA 1EHNA 1KPUA 2C3HA 5CZVH 4G6JL 5DLMH 3DTXA 3F58H 4OIIH 2RHEA 2BVTA 5TDNA 4F9LC 1MCIA 1JNLL 1C12A 2DICA 3WIFB 1DSFL 2JLLA 5D7KD 4YPJA 4HCRH 1DQDL 4LSVH 1MCFA 2JIXB 3RVUC 2PXYC 4WUUE 1U8KB 4JG1H 4JHAH 1BQHB 4JKLA 4A6YL 3INUL 2OTUB 4XBEL 2UWEB 3GUTB 1A1NB 3CFJA 4G9DA 3GK8L 4OLWH 4PGDA 1FFPA 4OZHA 2X4SA 3GMMB 2YK1L 3GSQA 4K3EH 1RUPL 1ZLSH 1FL6A 4GMSH 1AGBB 1M05A 1FIGL 2FSEA 2QQLH 4GQPH 2FRGP 3DXAA 4BYHA 4K8RH 1BVKA 1HQ4B 3GBNL 1O7SA 3BN9D 3SDXE 1CFBA 5FO9B 1BIIB 1G7IA 1KLUA 2X1OA 4HLZH 5J8OA 4ORGB 4R7NB 3EAKA 2OJZL 3LS5H 1MEXL 1CL7I 1F4AA 4K07A 2GFBB 4KZDH 5C08B 1BWWA 4DGYH 2CLRB 1YNKL 5KSUA 5E8NA 4QYOA 4GOSA 5GGQH 1T89A 4IRSB 5DVOA 4PJ7F 3WDJA 2CPCA 4QY8A 4U1HA 4QXTB 2XY2A 4C56A 2BVOB 4N90D 4WO4D 2HJFB 1I7UB 4EI5A 4RWYH 2RFXB 4NN6C 1GZPB 4D3CH 1E28B 4U1GB 4XHJC 3G9VA 1EBPA 1SY6L 5EOCL 2OZ4H 1BFVL 2BNUB 5FB8A 1MLCB 4APQC 4RFEA 3DX8A 2FGZA 3MODH 4XXCC 4YPGA 3CPLA 4PRPB 2CQVA 5KZCB 3JTSA 1Q9OA 5DJ6A 3RA7L 4KY1H 3H9YA 4N5UA 3ARBA 2X4UB 4ELMB 1IL1A 4HGWA 3D3VA 1LO4L 2GY5A 1H3TA 4APQB 1MFDL 2VLJA 4DVBB 1N3NA 2XZZA 3ARTA 3RWFB 5BV7L 3KS0H 5KS9B 1ES0A 4LHUD 5DJ0B 2HMIC 1WZ1H 1AY1H 4OBSA 3RI5K 1MCCA 2NZ9D 3SE4C 1UA6H 1J05B 1B0GB 1BZ9A 5FV1L 3VFMB 3QEGH 4Y2DA 5TDOA 3C5JB 3QIBA 1KB5L 1ZHLB 2ED7A 1BX2A 5DEGB 1GH7A 2UY6A 1CGTA 2JJTA 3GSWA 4AENA 3ARXA 3VXMA 3PNWB 3DO3A 2ZOKA 4FQXB 1RJZA 4BQCA 3S88H 5GRWA 2PTVA 1FNAA 1SYSB 3FO0H 3U0PB 5GRUH 4HF5H 4ZMAT 2B5IB 2OTWA 3T0AA 4NGHL 4G6AC 5CINL 3MGTA 2D7TL 3IDJB 3V0VB 3QH3B 4JG0H 5EU4B 3WNMA 2WSKA 3DHMA 3PV7A 1T7XA 2VLRB 5TDPA 3MOAL 1IC5L 2A0LD 4KV5E 3CFCL 1MWAB 3H6JA 2XZQH 4I0PC 3DVNA 5DFWH 5I1LB 1DBMH 3UTPE 1JPST 1CGVA 3DROA 4AEFA 4JB9H 5IQ9B 2ATKB 5C0DA 4ZFZA 4QXGL 3UAJC 1RUML 5DRWA 4MNHB 1RAMA 1VKXB 2OL3L 1PG7L 1TCMA 5FCSH 2DLTA 3H7BA 4ELME 4HS3B 3LB6C 4PJGF 5GRYA 1U8MA 5IFJA 4AK1A 1G9ML 4BFEA 1X5FA 4X6DF 4EUPA 3STBA 3QCUL 4JVWA 4CADB 3VJ6A 4XNZB 1TQBB 4XWGL 1Z3GL 4XC3H 4FFYH 4EDWL 1IC7L 1EA9C 4RCAA 1I3VA 4RA3A 2Y5TA 1MHHB 3RI5F 2HMID 4J23A 4L4VE 2O61B 1SBBA 3EOBB 5FYJH 1U3HA 3HUJE 3WIHL 2LQRA 4PP1D 1I4FB 5AYQA 4FZ8H 2NZ9C 4I3RL 1XGYL 4WO4B 4QXUH 4P2RE 1KTLA 1ZWIB 3PJSB 5KVEH 4S1RL 4NKOA 1WFOA 3KYAA 4M7JH 2OL3A 5C0CA 1UACH 3B5GA 3D0VA 3GIVA 2CKBB 1D5BA 3MRNB 2V2WA 1XF5A 1JPFB 3LKNA 1P7QA 5J89A 1ODAA 1OSPL 2L7UA 1ZHBB 1LILA 3X14B 4OZGB 4HS8L 1AO7A 1IGIH 1KELH 2K3TA 1JGEB 4IOSD 4P2QA 2BOCB 3S5LG 4LSUH 4GKOA 1U8QB 3ALXA 1OP5H 5KS9F 4ZFGL 4TVPL 3UYRH 4PLNC 3TT3H 3G6JB 4NC2B 2HJLB 4H0HB 3QUMA 4DKAA 1BLNA 3FO9B 1KXVC 1YPZF 2NQCA 4LHUB 1DN0B 3UCRA 2F58H 5L2KB 2YPVH 3L5JA 2ADIA 3OPZH 3UXFA 4MQSB 4XB7A 3SGKC 2XWBB 1TVBB 3O3EB 3HAEG 3HMXA 1QFWH 4M1GL 5DXWA 3GNML 3ZYZA 4JDTL 1VCAA 3E2HB 1RZJH 3HMWH 2D31B 3KPNB 5GGUA 1KG0B 1MFCL 1CFSA 3JWOL 2X4PB 3TYGL 2PR4H 3ROLA 5ILTH 2V2WB 1BJ1H 3HE7B 1GAFL 4F58L 1ZGLA 1IEBB 2W9DL 3T3PF 1K85A 3V4VL 1IAOB 4Y19A 4Z78A 1NLDL 1UCBH 4ELKA 5I1EH 3ES6B 4BH7A 3SGDI 5ADOH 1YEKH 4HJ0C 2J2ZA 3RUGB 4X4ME 4PJIA 4DTGL 2H32H 4HFWA 2CDGA 4BQBA 3UMTA 2YMXL 2EYTB 3OGCA 3QIWD 3GMRA 3RKPA 3MLUL 1Q94B 2A9ML 1E4KC 5FDYA 1M6OB 3O6MH 3TCXA 3DSNA 1FV1B 1FYTE 1JPGB 1JGVH 3D87B 2ARJQ 4HPYL 2HTLD 3R0NA 4RRPA 3CVHL 3P73A 4NO0A 3RVUD 2W65B 2FEEI 4QRPE 1KJVA 2CO7B 4OF7A 2QHRH 4XPGL 1NLBH 3MX0A 1DJSA 1IKNA 3HS0A 4OQTA 5ACMA 4G8GA 3VDCA 4ORGA 1PZ5A 3JUYA 2FH8A 2VLME 1EIBA 1SEQL 2VDKL 5DD6B 3P4NB 4GAFB 1KCUL 5E8NB 4JKWA 1IM9A 1A64A 4FQQA 3PP4L 3S35X 3ALWA 3CK0L 1MQKH 1AGEB 1BMGA 5B8CA 5DEZA 4LASL 4X7DC 3G6DL 1A9EB 1W8OA 3JWNC 2NY2B 4ODSH 3KPLA 4KDTA 5K9JH 1DVFA 5HVHC 3HI6L 3BIBX 4PRPD 3QQ9D 4NHCL 2VLJD 3MLPA 2DI8A 3GSNA 1AQKH 3TYFA 3WO3B 4HUVA 3HUJA 2VAAB 2VDPH 3RVTC 1VFUA 3C5SA 1CG9A 3MBED 4POUB 3C2AL 4KRMB 5IG7A 5I8EB 5GJSL 1M7DA 2J7LA 4U1LA 3RWFA 3T3MF 3WDIA 2DWDB 1OAUH 5EU5A 2GCYB 2ATPB 1IC4L 4GKZB 2FB4L 2E5EA 3EYFB 4XWOC 3TJEL 3VXPB 4DUVA 4KJQC 3P0GB 3WFDL 4O2FB 3EO9L 4BA8A 1Z9OA 4JY5L 4RAVB 5EOCJ 4ZO7A 5IVXE 1TZIB 3S96A 1MCOH 1WWWX 4NUGL 4MQ7A 4CGTA 3ARFD 2CLZB 5CEZH 4PV9A 5C0FA 3BQUA 4JO2L 1KN2L 5IMLB 4XPTH 1D5BB 4KK8D 1NEZG 5FOJA 4FQIL 4PGZA 5DHYB 4OZIE 3GGWA 4JFOA 3TVMD 2EDKA 3RDTD 5EZIL 3RAJL 3GM8A 1HYRC 2OR7A 1AP2B 3NCFB 3LAFA 5DQJA 4YNYA 1A1OB 5I16B 4MJ5B 2AABH 1INEH 3RUGF 3VXRE 4X7TB 4JPWL 4P2RA 4OCRL 4KJPC 4LEOA 1GCFA 5BO1H 5C2BH 1GVIA 3DVIA 5FFLA 4LSRL 1MCEA 4J12A 4WTZA 5I0ZA 1G7HB 1TDQA 5FK9A 2G9HA 5I1CL 1SBSL 3DRQA 4JAMB 4MAYC 1BAFL 3VXMD 3EUUA 4JFED 3S3SA 3BE1H 3EYQD 4N5EC 4W68A 4U33A 2AK1L 3BKYH 3IVKB 4PBWD 2XZCL 1IAKB 3KXFB 4JRWA 1L6ZA 1HHHB 4JFDD 1RSFA 2M2DA 5KSUB 1WBYB 4RBPK 3NPZB 3O8XA 1FJ1A 4I3SH 5J1AA 2ZCKL 1LK3H 1I7UA 1N64H 4CDHA 4Y16D 1NCDL 1ZEAH 5IVNA 1NGQH 3GSUA 4X7FC 5TE7L 4XNUL 1JNHA 4TVPE 5DMKB 2BVYA 4C83A 1K8DB 2WNGA 4DVRL 3TESA 3AY4A 4WJ5B 5T1LB 1UEYA 1RZFL 1IM3A 4CVXA 1MI5B 3OQ3B 1VEOA 2AEIT 3QJFA 5D6CB 3S4SG 4PJ5B 4YHYB 4TUOA 4FXLA 2VLJB 2XKNB 4K3JH 2ZJSH 3GSRA 4HW6A 5H94A 3H9SD 4F15C 4ZSOA 1CBVL 1B2WH 3IFLL 4R4FL 2DKUA 1KGCD 4UMGA 2KUTA 4JREC 5DJ0A 4MJID 1AHWC 1W72L 1QR1B 1BZ9B 1ZHNB 5L2KD 1CS6A 5C7XH 3EJZC 4K9EH 5IW3A 5DI8A 1K8DA 3FRPG 3C5ZB 3VXMB 1RZKL 3O2DA 3QIBD 2Y07H 1IZKA 3PWUB 1S7VA 5EBLB 4JHWL 3AAZB 1JUFB 4CVXB 5IM7B 4L1DA 4HUWB 5M95B 4YK4C 3S9DB 4LCWE 5CZKA 4O5LH 3LD8C 3MLXL 1EAJA 3KXFE 3PL6A 4BQ9A 3BP5B 2Q8AH 2CK0H 3WIFA 3LS4H 1QLRB 3L7EB 3OAYH 4RGNE 2A6IB 2R0LL 3CCHA 1P9MC 1CICC 4P46D 3L3JA 2F54B 1AXTH 3L5WB 2EKSA 5D2LB 4XTRC 3DX6A 1OTUD 2X44D 3P9LA 4JGJA 4FFVC 5JOEA 3BKML 3QPXL 1K5NA 2FL5A 4NQDB 3ZYJA 5E8OA 1CU4H 1PFCA 3IDNA 4HDIB 5I76B 4RA0C 2VDQL 5F3BA 4AYFA 2XN9A 4HKBA 2ZUXA 1EHXA 2R0WH 1BJ1J 5GS0H 3QULA 5I1IH 4G9FD 4Y1AD 3GBMH 4IRJA 2CLZA 3KYMA 3MLSL 4KGLA 5K9QG 5A2JH 3G5YA 1R3HA 4UIKH 3P4OA 5KSVA 5E9DD 2V6HA 3GGWB 4JFOB 5J13C 4PJHE 1GOGA 2CR3A 4KI5C 1A1OA 5HVWA 1CCZA 2F8XC 4XVUC 4H0GA 1FC2D 1PG7W 4WFFD 5FCUL 2P5EA 3RL1B 4DZ8B 2Z8RA 3O9WB 4X80H 3BEWB 3C5ZD 4XP9H 1NSNL 1OL0A 3X12A 4H0IA 3W2DH 4N1HB 3WO4B 2ZCLL 4I18C 2HT4C 3ESVF 4QOKA 1QVOA 4XXCA 5D1XB 2XTJE 1GPOL 1R5IA 5T3XD 3BPLB 4R90H 4RGNC 3FFCE 3L3GB 2WBJB 1RZGB 5E00B 5LGHH 1R3JA 1GC1H 5E70A 3MBEB 4XGZB 4LFHD 1N2RA 3KS0J 2R9HD 2ITCA 5D7JD 2DQFA 3VXSB 5I19L 4HQQH 3CFJB 1EGJH 3ZSSA 1NCWH 1WBYA 3GO1L 3FZUC 3U4BL 4JQIL 4L3EB 1FPTH 4XPAL 4DVBA 3VFOB 3DOSA 3H3PL 5CJQL 4NP4H 4X7EC 5DK2B 4NZRL 4PJFE 3O2WL 1T1ZB 2IJ0C 4KI5D 3K4ZA 5H2BB 4FNLL 4TPRH 3N85L 4AM0A 4PIRF 3VFSB 4WW1B 2H9GB 4WEUD 1KSRA 2NX5E 1A7OH 2HVKB 3BPNB 5E99L 5IIEB 4Z9KB 3TJHC 1MWAH 4JM2C 4Z76B 1MI5A 1MHEA 1S7XA 4NC1E 4LIQH 1IKFL 2X1PA 4MQ7B 3QG7H 5JXAL 4OUOA 4BFGA 1NAKH 4TUOB 3PNWA 1KJMB 1N2RB 2X4RB 5C07A 5I73C 3AS3A 1QA9A 5DZLA 2DQGH 1KCSH 4H88H 3NCBB 2NY3B 3GMLA 1NUFA 4GRLA 2FX9H 1K2DA 4IRSA 2W0FB 3DUSA 3M45A 3KJ6L 3OG6B 5I1HL 2W0LA 5CSZA 3QZWA 5D71L 1FBIH 3VFWB 1G7QB 3N1QC 2VH5H 2MKLC 4LPXA 2LVEA 4FQCH 3HE6C 2WW8A 2EIBA 4GSDL 3S34L 2B0SH 4H25B 1F13A 3OB0H 1ZA3B 5IBLD 3V7AE 5BRZE 3Q5YA 3SE8L 3GJFK 1MCWM 4WI9A 4XP4H 4XMPH 4ZFZB 3GMPA 5D7LE 4MJIE 5JPNB 4OFKA 1OT2A 4OLEA 1LP9B 4PRHD 1A14L 4KJWD 1UWGH 4EVNB 1L0YA 3VFPB 2MWCA 5ID1B 4LKXA 4G9FB 4Y1AB 1NFIA 2W9LA 1BBDH 4LPUA 4WFHE 2HAZA 4XPFL 4TYUA 3U48A 1T1XB 3O9WC 4YDJA 2PW1B 4L3EE 2IFGA 5J3HD 1IGCH 2N1KA 2BJML 2HKFL 1N5YL 4CAGA 4PJAF 4EUPB 4YBQC 3VDAA 2VQ1A 3R0MA 4XZUB 1ZT4A 1J8HA 5I71C 1JWSB 1LP9F 4PJBA 4PJCA 4WTXA 2EDYA 1HEZB 2CDFA 4MMXC 2YRLA 4M1DH 1ONQA 4K94L 1U42A 3LIZH 1J5OH 1JF5A 1J18A 2IF7A 4ZTOH 4RMSA 3HZKA 3TBVA 1CFVH 3RU8H 1EJOL 1F2XK 3TO2A 3HN3A 4M43H 5I1DA 4JO4H 5FO7B 3B43A 3S6CA 3DTXB 3O41A 5DUMH 4YDKH 1N4XH 4KV5F 1DVFC 4G8GE 4CMMA 2HKHH 3TWCH 3MMEB 1KACB 2WWKT 2AKRA 5CUSL 3SOBL 5EU6B 4MJ2A 3P0YH 1TZHA 1RULL 5IEHA 2J4WH 2FHCA 3HNSH 2NY7L 1QZ1A 3W9EA 4AMKL 5I1AB 2XOTA 3Q0HA 5DA0B 5GS1C 4XZUA 1G6RL 4K71B 2I27N 5BS0E 4PGDB 5JPMB 4JQXA 3UO1H 2HJLA 1HCVA 1ZK9A 4CU8A 1DE4A 1V3MA 5BVPL 1D5ZB 5LBSH 5IB5B 3KPPA 3RBSA 3TO4B 1II4E 2NY0C 1RZGA 3MV7D 2IQ9L 4Y4FD 1A6UH 4CVZA 5HVFB 1DBAL 3BGFC 2GK2A 5BOPA 3U30B 3M8OL 1JPTH 1CXKA 2VQTA 3GMQA 3FAWA 1U8IA 2B4CH 1WEJH 5LGKA 3SE3C 4PJEF 4UB0L 1MCSA 4R96B 3O0RL 5F72S 3JBG7 4LHQB 3H3BC 2P8MA 2YPKB 1S7RB 1C08B 4PJHB 3MFFA 3HZMA 3RY6A 4L8BB 4NQEA 4P2RB 1CR9L 4R4ND 3H9HB 1A2YB 4XCYB 1R3LB 4JCMA 5F6HJ 3RWGA 5HHXH 3MSPA 3H9ZA 1Z2KA 1UWXH 2C7UB 4PJFB 3HG1D 3SE9L 2C1OA 1G7HA 1CVRA 3GRWL 3QWOA 4F7TB 3FB8B 3NAAH 3REWA 4LPCA 5FYJU 2AJUH 2R9HC 2XRAH 4PFEA 1EO8H 1X9QA 3MZGB 3QUYB 2JK5A 4U2YA 2EIEA 5EU6D 2DBJA 3PWPE 5L2JB 5HYSB 3MNZB 1BGXH 4JFQA 3BEVA 4XBPB 4XCNB 5FO9A 3QO0B 3SKNB 1QLEL 2VDNH 2ZUWA 4P2OD 5F7EL 3E6FA 4OT1L 4Z0BL 2Z8WC 1XF3B 5EOQH 1NGXB 1A7QH 4KJQD 2XA3A 4XP1H 4YE4H 5E1HB 4L8BA 2GITA 4XBGB 3ZKQD 4KI5F 4U4BA 3T65A 1CLYH 5D96C 3QUXA 2M8XA 4NRXB 5EC2B 1OP3K 1L9MA 1WUNT 3SDAA 4IHOA 1CFQA 1VFBB 5DRZA 3WYRA 3DIFA 5FKPA 3U2SA 2DD8H 3IAGC 1TJHH 5T1LA 3MV7E 2VDRH 2VN7A 1NGWB 1FZOA 1WFUA 4ZPTB 5A3ID 1GHFL 2FX8H 2GAZA 5K9KB 2R29H 5I6XC 1FGVH 5D9SB 3X17A 4F57L 3PXJA 1KYOJ 1UM4L 4NO5A 4MWFB 1KBGL 2ZOKB 4LGSB 3NABH 3VFRA 3UTQB 3CDFA 2VE6A 4F80A 3V6ZB 1IL1B 4BSVB 1OAKH 5JW5B 1NGXA 1FO0A 3P0VH 1GXEA 2VLKE 1ZLWH 5A2IH 4CJ1A 4YEFA 4M7LL 4TQEH 4GBXB 3AMLA 1J8HB 4OCSH 3LKPA 1G9NH 2H41A 5EORH 4JKMA 5DK2A 1HK6A 4ZOCA 3LKOA 2FBJL 3JV5A 1AHWA 4NQSA 5H37H 5JHDB 5IBTH 4JRXA 4LQFL 1NFDE 4M9OA 4K71C 2V5TA 3DX8B 1A3LH 2GUOA 4YH6A 5GSRA 2Y06L 3I6LD 1HYSD 3BSZL 3PWPB 3O6KH 1A21A 3DECA 1FVDB 2H3NA 1U93B 4GW1A 3U0WH 2A73A 4E0RB 4EJ1C 2E7MA 4QRSB 3NVQA 4AH2A 3T4AA 4RFOH 3PL6C 3F62A 3D25A 4HS3A 2NXZD 1BQLH 3EGSB 3S5LA 4X6CF 1VB9A 2ESVA 4EI5C 3WKMH 1HHKB 3IRZA 3SDCD 1KIRA 5DMGC 1P2CB 5IW6B 5FYKL 1DQQB 5T33H 2JF1A 1FLRL 3ECBB 1XFPA 3RZCB 5KANI 3D9AL 4JPKL 4L4TA 2PNDA 2YD8A 5I76A 1DLFL 4M1CC 4Y5XA 3O6LH 1BQLL 4B41A 4QNPE 5EU7C 3GSWB 4AENB 4Q9CA 3FCTA 1KT2B 2VXVL 3FFDB 5EFIA 4RFOL 1H0DA 1FL5A 3VXUE 4D9LL 2RB8A 4PJ9D 3WD5H 4M5YL 4RZCB 3RTQC 1AH1A 1DCLA 2NR6C 1M7DB 5DC0A 1UM6H 4IOFC 1I8LC 3WFBL 4JLRB 4HWNA 4WW2C 1TMCB 4XXDB 1AR1D 4LAQL 3ROOA 3TF7C 1H9VA 3OX8B 4HAFA 2C7UA 5EORL 3WFHB 4EUPG 1UWEL 3ULVH 2A6KB 1U8HA 4KI5E 1QBLL 1X3DA 1YEGH 3I2CL 3OJDA 2CK2A 1OD9A 1V5JA 1YMMD 4UUJA 1KB5A 1QYGH 5DJAA 1JZ2A 3OKMA 4K7FA 1JN6A 4QWWC 4P9HC 4YBQD 3QUZC 1IAIH 5HBBA 5FO7A 1WTGT 5IW1A 2OP4L 2C26A 2MPAL 2R29L 4YLQT 5ANMA 5HGAB 3KPSA 4MNQE 3KPNA 4RX4D 5GGUB 1PGRB 2FX8L 2OBGA 4K9EC 3S98A 4G3YL 3BKCH 2DMKA 5IEKA 2VDRL 2BXYA 5EC2A 2NX5D 2J8UB 4MAUL 4PRAB 4HUXB 3QUKB 3VDBA 2H6PB 1DQJB 3CFBA 4MYWB 4FTVB 5GS0D 2VDLL 5EOTB 5FYKE 4XAWH 3IFOA 5HGBA 1N6QL 1JJUA 1T04B 2I25N 5LQBL 3G5ZA 4XP1L 3K81A 1GZPA 1QSEB 4NQXB 5IB2A 4Z7NF 1WC7A 3C8DA 3VXUB 1U92A 4OT1H 3UEZA 1A6TA 2AV1B 1QLEH 2VDNL 5F7EH 2XYCA 3HC4L 2OX5A 4I48B 1URLA 4ZUVA 1TZGH 3IU3A 3W9DB 5MP6H 2HVJA 4LLQA 5FO8B 1JPFA 3JTSB 5KTEH 3DUUB 1ORQB 3TGXA 4E9LA 4ZS6D 4JDZB 3ZKXB 3MJGX 2XRAL 1S9VB 1E4XH 3NAAL 4W4NA 1T0NA 3B9KA 2P8MB 1G1CA 5E2TH 1IEBA 2PYEA 4I2XA 1FE8H 5D2NB 4X6CB 4N8CH 3MR9A 4JANB 3VRIA 1N59A 5EBMA 5E2UL 4P2YA 4IDJL 1TIUA 3HPLA 3LKRA 3CDYA 3HG1B 4G8EB 1YMME 1CLCA 2WIIB 4OGYH 1V3LA 2AK4E 1DBJH 2CO6B 4WFED 2P5WA 4PRHE 5DQDL 4JRXD 2DMBA 1OTTD 1MJ7H 3E1F1 3PIQB 4QT5B 1FFNA 5F1OB 4FFWD 5B39G 1GOHA 3CNKA 2NY4B 1WEJL 4TRPH 2B4CL 3W9DA 2N4IA 2GSGB 4PJEB 4YWGL 1YY9D 1J0ZA 2OZ4A 2BFVH 5D7JC 3I3BA 3ELAT 5I6XB 4MD0B 8FABA 4LPWA 4CU7A 1JMZA 1RHHA 2WP3T 3EO0A 4HC1A 5ITFB 4JZNA 3UO1L 5GS1A 1JZ7A 1PQZA 3VWKB 5KN5B 2CRIA 1MQ8A 4OKVA 1T7YA 3MV9E 3HNSL 4HT1L 1YY8A 3QDMD 2KL6A 1ETZA 3MRLB 3O11B 1EDQA 4LCUB 1RULH 1VEMA 4ZD3H 4PY8I 2X1XR 4KDWA 2VZ1A 1T5WB 3MJ7B 3T0ED 5SWSB 4LLDA 1HKLL 2E9JA 4JJ5A 4GAYB 2GJ6A 4MLSA 1WAAA 3RGHA 5B3JE 5BZDB 3C09B 3KG5A 4JN1L 1N4XL 1N26A 2V9TA 4U31A 4YDKL 5DUML 1T1YA 4R3SB 3ULUF 4XXDA 4MDIB 3CMOL 2YD4A 1OTSC 1QFUH 5F6IB 3LIZL 4PGBA 4GBXD 5I8KL 3O6FA 4M1DL 5IV2A 4LVEA 1X44A 2F53D 2H2PD 3D39E 4WO4C 3OX8A 5HHMB 3WFHA 4KHTL 5JR1L 2GK0B 5DUPH 2Y5TB 5FECA 1E4KA 2P42B 4HJ0D 3D39A 1VGKB 5ESVB 2EDEA 3FQNA 4KJYB 1RK1B 4G8FA 1GGUA 3Q6GH 1IE5A 4PRIA 5JTWA 4JY4A 5DJDA 2FATH 2FLBT 5EG6C 2VNCA 1BBDL 4UV4L 4U7MA 3ARZA 2PO6C 1ZS8A 5F9WC 4YHIA 3C5SB 2LE9A 2AJSH 3AUVA 3SJVE 2BRRL 4JKPL 3ZKMC 2WLYA 1JZ4A 4FXGA 5CILH 1QO3A 5HGAA 5F1NA 2D0GA 3MFFB 1RVFL 2YPKA 3L5HA 5GRVL 2OMBA 3UX9B 2AK4B 3HTLX 4OCMC 4DWHA 5IVZA 2H6PA 3MJ8A 3B2UC 3B3IA 5EOTA 1MREL 5FECB 1XCQB 4P3DB 3CDCA 1WIOA 3QWOB 4POZD 1BLNB 2YD6A 2YSSB 1I1YA 4FQJH 5I1HH 3LY6A 3KJ6H 3BXNA 3MXWL 4NQXA 2FJGB 1F8TL 1KJ2B 5F7YC 2IEPA 4CNIA 1YJDL 1K8IA 4LU5H 5LJYH 5K9QI 5JOFA 3V0WH 2DQGL 2AGJH 1H8NA 3BQUB 3UZQA 4LVNC 2XG4A 4HPOL 3EOYG 3L3KB 1CXHA 3BRFA 1RJZB 1NAKL 4OZ4A 2E7LC 5DRXB 1F58L 4L9LC 1I9JH 4FQLH 1IKFH 1KLUB 4N8VB 3MLYL 1XGUB 3MV9A 1A7RL 1TPXB 4OCLC 5HHMD 1A7OL 4L8SB 3STLB 2R2CA 4G9DB 3MGTB 2P7TA 2PETA 3GSRB 4M6MH 3L6FA 1YMMA 4FNLH 5GHWH 1MFAL 4C56D 3CSGA 3RIFK 3HZVB 4HWBL 1JRHI 5FYLL 2EH8L 4NP4L 2VQ1B 1FPTL 3KYOB 3UPRB 1NCWL 3GO1H 2MHAA 5DJ8B 3WLBA 5DWUL 1PEZA 1VESA 3IJSA 5C3LD 1GGIL 2XWTA 4RISH 2VO5A 1RZ8B 1TNMA 4LLYA 3QFDB 5LGHL 2CIKA 4GKNA 3ARFB 5HYSG 3UTSE 1JWMA 3F5WB 4R90L 1CXFA 3EYOA 3ARBB 2CLRA 5DD5H 3ZE0F 4I0PD 2NY3D 3G04A 5IESL 2X05A 1PLGL 2JCCF 3OKOB 5ICZB 4L5FL 5LXGL 3U7WH 3WUZA 1O0VA 4PJCE 1A6AA 1KV3A 2J8HA 4MXWH 1UC6A 4Y2OA 4M8QB 5JQ6H 4XCFL 1ND0A 1G7JA 1RZIA 1N0XH 3AXLA 2BNUA 5DR5L 5DD0L 3I50H 1ZLVH 4EZMA 3NFSH 4S1QH 5E95B 5IGXL 4DGVH 1B0WA 1NAMH 1DTUA 2FEDC 4AG4L 4UOJA 2EDFA 3RDTC 2W38A 3MLSH 4PJXB 3ZDZF 2VDOL 4GRWE 4XMLH 3DLQR 2CXKA 2DQHH 5TF1L 5KSAA 3K74B 2BNRE 3RKDC 2ZP0T 1T20A 2DM2A 2HLAB 4WUUD 3ARFC 3FT3B 2XN9E 5JORA 3BHBB 1OY3B 1JVKA 1U9KA 1VGKA 4H8WC 5ESVA 5HYIA 2EYSB 1I9IH 1FFRA 3QPXH 3T1WA 2ATPA 2IQAA 4D94A 2HLFC 5GGSA 1T03H 3C5ZA 1INDL 1FL6B 5K59E 1MIEH 1AXTL 2QR0B 5GZND 5JUEL 5KVFH 4UT6L 2XA8H 5HJ3B 1IGJA 3KPOA 3UYPA 4LMQE 2Q8AL 1UKTA 5I73B 5F1NB 2VZUA 4FXGB 4O5LL 4I1NB 1BQHA 4NWTH 4KVNL 3U0PA 2ZUTA 4F7MA 3AB0B 4HWEL 3DX6B 3FKUS 4K9EL 4BH7B 5E4EB 2PYFB 1G7LB 1S5HB 1W72A 2Y4SA 3L1OL 2FO1A 2EDXA 5KN5A 4U1KB 2GITB 5KVDH 4R7DB 4C56B 2IQAB 1YPZB 4MD4B 4QTIL 2B20A 2D0FA 3OKMB 2R1YB 5D70H 4XPHL 4R4FH 2Z0BA 3IFLH 3QDMA 2NW3B 4DK3A 1RV6X 4FRWA 2VLKA 4YDLC 2YD9A 1MLCA 5F7WC 3BRGC 3NIDF 1HSAA 3G5YB 1IEHA 2Q3AA 4YHYC 5E8DH 4G8GD 3SO3B 4QHKJ 3AROA 3VXTB 5ID0B 4ELMA 2F5BH 3MLWL 4HAGA 1I3RB 1SM3H 4JN2B 5C0CD 5DD6A 3ZHDA 2RGSA 5DTFA 2Z9TA 4KUCD 3TH2T 1NEZA 1DLHA 4P4RA 3TIEB 2BOCA 3OAYK 4GRLB 4MNGE 3WO4C 4XNUH 4DN3L 5FOBB 3MLZL 3MOBL 5HHOB 4HKXB 2QTEA 5EUOE 3LN5A 4IRSD 4U3CA 1KJ2H 3B6SA 3QDJE 3G5ZB 5GGSY 1Z5LA 3UP1A 3HLAB 3BMWA 1LK3L 3M07A 1M71B 1UYWL 3QIWC 1G7QA 4KH2A 4M6OH 2WWMC 4HFUL 4LCCC 1LO3L 4QRQA 5IBUG 1VA9A 4ODVH 3AB0C 3OJVC 3QUYA 1NCBL 2R23A 4MNQB 5MERB 4WJ5A 1X5KA 3KHOA 5ECJE 2R2EB 1KFAH 1ORQA 2XZCH 4HH9A 4PJAE 4UTAL 3NFNA 5IMMB 1NFDA 3BKYL 5FO8A 2GJ6D 1CDCA 4Y4KB 5DC9B 5KSAD 5IHZA 5CD3B 2NTFB 4L9DA 1YDPA 3LEYL 2AK4D 1ZHKB 4HJGB 3QIUD 3QXWA 5TE6L 5HI5D 1YEJL 5FA3B 1IAOA 1LO2L 2PO6D 4X4XB 1SEBA 5C0BA 5ENWB 5MHSD 1JBJA 5ALBH 2VRAA 5HHOA 4KTDL 1FCGA 1V05A 3F7YA 4NDMA 3S5LB 4OF6A 4EXKA 3IF1A 4WI7A 4Y4FA 1CFNB 1Q0XH 2P49B 4K8RC 2HVKA 4QRTA 4O2FA 3QIBB 3MRCA 5CHNA 1D9KA 1T83C 2YPLD 4Z0XA 4A2MA 4Q9RH 2ZUVA 1X5LA 1J0YA 5IM7A 3MJ9L 4OFVA 5F7NC 4JO2H 3VXNB 2VABA 1G84A 3FQWB 2WBJD 1XH3A 3I75A 2PW2B 3L7EA 3OB0K 3VFPA 1JGUL 5ID1A 5AUMA 4Z7UA 2IGFH 3RZWA 4JY5H 4MD0A 2VXSL 1X4ZA 3EO9H 4MNGB 5EU4A 3V8OA 4U1NA 2X1WL 4TSBH 1I8MA 4YUEH 1J1OH 1JGUH 1QRND 1CLOL 4Y0GA 5A43C 3DBXB 4LDOB 4ZO6A 4LRIC 3RKDD 4M3JA 4U0RB 2AJ3B 3MJ9H 1KTLB 4TNWK 1FNLA 4ZSOE 5BZDA 3C2AH 2GJ6B 4LKXB 4L8DA 4YGVA 4YHPA 4J3WA 1AQKL 3T8XB 5FYJD 2DOCA 2XPGB 4U1JA 4Y5YC 4PGEA 1Q0XL 5E1AB 2ZUYA 2WAHA 5J6GA 4N0RA 4H1LH 3ZKXC 5ALBL 3K8LA 5I75B 2QADB 1TFHA 1F3JB 1LO2H 4M6NH 3RZCA 3DV6A 3MTRA 4OF0A 1U8OB 1Q0YH 3LEYH 1RK1A 3CK0H 4G8FB 4S1DC 3KPQB 1T2XA 2NY3C 4OBRA 3CX5K 4IDLA 3QDGA 3CVIH 3RX8A 3VH8A 3UTTB 4R2GB 4JQVA 3I6KB 1I8IB 1L9NA 4LCYA 2VDKH 2X09A 1YN6A 4QOKB 4E41E 4I5BB 1NCBH 2R56H 4K7PY 3TVMA 4M4PA 5A2LH 4HFUH 4DEPC 5D6DC 5C6WH 1E27A 2N56A 1HOCA 1UYWH 4L4VB 2IAMD 2R2HB 1I3UA 1DP0A 5FUZH 4UAOC 1NEZB 1JGVL 4IBLT 1KJ2L 3ZKNC 2BSSA 3MOBH 1FYTA 3ULUC 3O6ML 1X5JA 2NYYD 2A9MH 2JCCB 3V5DB 5M94B 4NUJA 5GRJH 1SJVA 5I16A 2F74B 4K2UL 1SM3L 3HC3L 4OTXL 2AS5M 4W6XB 4JM4L 1RIVL 1XZ0A 1J11A 2X4QA 5ADOL 3QNXA 4KUZH 1OAYH 3RWJA 1RJCA 1ZA6B 5DI8B 1QPXA 3RIFF 2W9DH 4X6DB 2Y25A 3OKKA 4YDVA 2IMMA 2E6PA 2W0PA 4IIQA 3B5TA 4JVUA 4Z76A 3BGAA 4HUWA 2PR4L 5ILTL 3FOLA 4PJXF 4NWUH 2YPLB 2Q20A 2EDHA 1NDMB 4YFLF 4KXZI 4JDTH 4RNRA 3JWDC 1MELA 3BH8B 2QADD 5KVDL 1BPVA 5E5UB 2P7TB 3L1OH 4OIBA 3OPZL 3QUKA 4IEFB 5C0BB 4PJ7B 4U1SB 1WFNA 1L7TL 2YPVL 1SVCP 5A2FA 2PYFA 2PO6A 4RIRB 1P6FA 2P5ED 5J13B 1QLFA 2F8OA 1ZMYA 5FXCH 4ZFGH 4XP6L 2ZNWA 4LSUL 3WNNA 2R1YA 5HGDA 1BD2D 4ONOA 3BW9A 4PJDF 1HIMH 2E8YA 4Y4HB 5JXEC 1WBXB 2C3VB 5BRZA 5DMYA 2XA8L 3V5HA 1X5GA 3KYMB 2Y1VA 1UACL 4UILH 1MIEL 2YR3A 2AJVH 5JPNA 3MRGB 1CE6A 4M7JL 3QHZL 5T3ZE 3MFGB 4M93B 4U7KA 4OFDA 1J0IA 4QXUL 3SDDD 4HXAH 5F1IA 4V1DE 5F7LB 3BO8B 4FN0A 2MCPH 5J1AB 2X40A 2X2YA 1DEEB 3QISA 1FC1A 3QDGD 5IUSA 1QFHA 3DIFB 4P4KA 4M1CD 5IB1B 4FFYL 4JFDE 2P24A 1B9ZA 3PIQA 4XC3L 5DFVD 1XF4B 4QRUA 2X9YA 1JV5B 3HI5H 4DN4H 5FA4B 5T1MB 4AG4H 2OXHA 3U7YL 3WUWG 2XTJD 2GTWA 2DM3A 3QCUH 4DGVL 4S1QL 5LKNA 1G9MH 1A9BB 3I50L 4JRXB 5DD0H 1EVUA 1DDHB 2BY1A 4K23L 4QOKD 4JZOA 2XV6B 1JHLH 4GS7C 3LHPH 1NMBL 1RUMH 2NY5C 5DD1L 2BY2A 5C0BD 3UZVB 5F9WB 1IGYB 1F3JA 3TP4A 5CEYB 1ROWA 3MV8A 1PLGH 3BX7C 4E5XA 2GIYA 3BYTA 4JREB 1HSBA 2EKSB 5CEZD 2P5EE 5B3JF 5DD5L 1WWCA 3CFKA 3MOAH 1CIDA 3EYSH 1I8IA 2F8VA 3DX9B 1A4KA 5INCB 4U6XB 3DRTA 4MS8D 3FL7A 3OZ9L 3IGAB 4GAGL 4JG0L 5CINH 4JJ5B 3K0WA 1NCAH 1HHJB 4RISL 1OGAE 2DM7A 1NUNB 5HHNB 2YUVA 3ZE0E 5DWUH 4UDTA 3MC0A 3VFGL 2HFGL 3AGVA 5BS0B 3WFEL 1G9NC 4LLAA 2ICEB 3FQWA 4WFGE 1WGOA 4FFWC 2OTUA 3KXFA 1IAKA 2IH1A 1IGMH 3WIHA 3VXME 4OZ4B 2F53A 4GW5B 4X6FA 5FYLH 2Z91A 1KXQE 1KLFA 1MFAH 1OF2B 2OQJB 2ARWA 1EAPA 4PJGE 1FYTD 4W81A 1J1PL 1A7RH 5DS8A 3TM6A 1XZ0B 3G9AB 2DQDH 3LZFH 3TNNA 4JY4B 1I9JL 2I9TA 4I4WA 3PF2A 1T3FB 1MVFA 5A1AA 3MUZ1 2AGJL 5KZCD 1DEDA 3TIDA 2PXYA 3C08H 4LU5L 1NC2D 3RGVD 1UG9A 1YJDH 1UCTA 4KY1L 2GTZA 1U95A 2GI7A 4OB5H 3LVEA 1IMHC 4AIOA 1FGNH 2W60A 4Q74A 5E5MB 5C0ND 5ID0A 2OZ4L 1SY6H 4ZPVA 3MRJB 3LEVL 3DV4B 3LEVH 4HMDA 4B0MM 4Z7UE 3L9RB 3JSSA 1R3KA 3B3IB 5HYJA 5FOBA 1EAPB 3VWJB 3JTTA 3KDMA 3TPKA 3RVVD 4D8PA 1RVFH 1UH2A 5IB4A 4OB5L 1PDKA 2NY1C 3C08L 2BRRH 1GIGH 1YECL 2DN7A 3CSYB 2BY0A 4WW2B 1YNKH 1W0VA 5ISZA 5IB2B 3DMMD 4KZDL 1BIIA 5IIEA 4NBYB 2HJKB 2FATL 1SJHB 1XCTA 3LZFL 1XGQB 1H3WM 1HI6A 5C3TA 1J1PH 1B0RA 3GFUA 5KJRH 3ARGC 3SDDA 3GSOA 3BO8A 2NY6C 5JR1H 4LKCB 4FQQB 3V9FA 2QQLL 5E6IC 4NKMB 4U2ZA 4Y2DC 1CGUA 1FIGH 3W39A 1FO0B 1YNTB 4DFIA 2CD0A 5I8KH 2BX5A 3OL2A 5LG1A 4KKLD 3IF1B 3PUCA 3MV11 5EO9B 3P4MA 1WWAX 3CDGB 3G5XA 3IDJA 4QLRA 5F7KC 3V0VA 1QFUL 1U91B 2AXFB 3CMOH 3KLDA 3VFGH 4TUKL 1LE5A 1AR1C 4PJBF 3GK8H 2AV7A 4OLWL 4O2CA 4BFIA 4JRYD 3QUZA 1MWAA 4IOFD 3UTZA 4PJAA 3KJ4C 2EDBA 3IU3B 4A6YH 3BD4A 3OZ9H 2D7QA 3PWPD 3HUJB 5T3XL 1F6FB 2J8UF 4LSVL 3FO1A 5JZ7C 2IALA 5EA0H 4FQXD 1BZ7B 3GSOB 2HA1A 4I0PA 3MNVB 4Z7UB 4S10A 1T1YB 5B3NA 4F9PC 3OR7B 4ZO9A 5CZVL 2DI9A 4X4YA 5DD1H 1NMBH 2G5RA 5CIPB 3LEXB 3UTOA 1P6AB 1QSFD 5TDOB 2HFTA 3IDNB 1A4KB 2OLDA 5CGTA 3BUYA 3BT2H 4L4TB 4PG2C 4YXKH 4MDJB 1W0YT 1Z0NA 4R7DA 2DDQL 5IHUH 4NYLB 1CICA 4FG6D 1FHGA 4MA1C 2BOBB 1KT2A 3FFDA 3I02A 1SVZA 4GRMB 2H1PH 3PQYB 5CKGA 2GSGA 5I8CB 5EZJA 4IM8A 4NN7C 3D3VE 5I1DB 4I0KA 3PWLA 5DQDH 4P2CG 3JVGA 3B5HA 1IM9D 2NY6D 4M9PA 1DBJL 4CRPA 4ZUSB 3GMOA 5IVXA 5K9OB 1JE6A 2MCPL 4F8QA 3VJ6B 3SKMA 3ARGD 1BWMA 5KANG 4IDJH 4WWKC 3RNKB 2GT9A 4ZS7H 2E7BA 5FGCE 3VXRA 4YEEA 3V5KB 5F7DB 1EEQA 1N7ML 4P4KD 1KIPA 3QIWA 2WZPD 3QR2A 1J86A 3QJHA 3LRSA 1AGCA 4LLMB 1G6VK 4OZGE 3HHRB 3X12B 4YHZL 1GGCL 5IVZB 5B38B 4NBXB 3BH9B 3RZCC 3LN5B 3D69B 3RNQB 5KTEL 4ZQKB 1HIML 1WVZA 4D0CB 3REVB 4RMWA 2EE6A 1K6QH 3D0LA 4XCEA 4XP6H 2YHGA 3ALPA 4PJ8D 4R4BA 3ARDA 3BISA 4QF1B 1I85A 5IW1B 5LQBH 4CMMB 5C0AB 4X9FA 4KMTL 3GRWA 2VR9A 1CFTB 1L7TH 1B3JA 5C0NC 4XAWL 1QA9B 4WCYH 3BAEL 2VDLH 4KKAD 4M61A 2V2TA 3S36H 5JW5A 4MAUH 1G7LA 5JHDE 5LGJA 2XZAL 2B39A 3QDHA 1ED3B 3AU1A 2FO4A 2HT3C 1NBZB 1XT5A 4NWUL 3SCMC 3C60A 2FCBA 1OARH 2FH6A 3RHWF 2IMNA 5BZWB 4HFWB 1ZKAA 3VXSE 3PQYD 1D5ZA 3VXUD 3C9NA 4D0CA 2HN7B 4XC1L 3P77B 2XQBH 3ARED 3UDWC 1D3CA 2LU7A 2VXTH 3EBAA 1SJHA 1CK0L 3EO1B 1XF5B 4JM4H 5GIRB 3RWCB 3BH8A 4OTXH 4K2UH 4LKCA 4EVNA 1QBLH 3I2CH 2OR9L 1TXKA 4P2OC 2ID5A 3CPLB 4PRPA 2GHWB 1MFEL 4OCXL 3KXFD 3ULVL 1UWEH 2DIJA 4KMQA 5HDOA 4GW5A 2AEQL 1XF3A 1ACZA 4RGND 2PYEB 4ZO8A 4LAQH 5FUZL 1CD0A 3IU4H 2W91A 4CW1A 1ZT4B 1UM6L 4KC3B 3FHQA 1A7NL 4NQED 4P4KC 2FD6H 4NRXA 2C4XA 2ZPKH 1RUAL 4TNVK 1TQCB 1T0PB 4ZTPH 2R56L 1OP5K 3VFUA 5DDHA 3UTSA 1D5IL 3WD5L 1GRWA 1T7VA 5EFIB 1WWBX 1NC2B 4R4NC 3RGVB 1FDLL 3C5JA 3P30H 5HGHB 5T1LD 1S9WA 4X9GA 4B7LA 2XWJA 5IHBA 5ETUB 3MUGB 2GEEA 4KZEH 4OFYD 5JXEA 3ULSA 1YEFH 2X4OB 4QCIB 3VRLE 2Y7QB 3D9AH 1TITA 3ZHLA 3QXUA 3AM8C 3L5WA 5FYKH 3VFRB 1A0QL 2FYYB 4Z7VB 3SO3C 1JZ6A 2HRPL 1CDGA 5F1IB 5ESAB 1ZVSA 1C5DA 1FG2B 1VFAA 3QIUB 3MBXL 4CN4A 3JV4B 3TBTB 3B2VL 2XTJC 3T0XA 1OVZA 3VCLA 5E2JA 5IB4B 3OHXA 5B4MD 1V8HA 5FM8A 2C3GA 4MD5A 5JO5B 1YY8B 5GGTH 3FOMA 5CFHA 3HKFA 5EZJB 1EFXA 3O6KL 2D2OA 5DQ9B 1JI1A 2JJSA 5BCAA 5L8LB 4XTRD 4NO3B 5GSRB 5IBTL 4C55A 2F19H 1J1OL 4NO5B 4YUEL 1DUZB 3WUWA 1LD9B 1DFBH 3IDGB 2PYED 4QRSA 4OCSL 5IEHB 4U1LB 2IGFL 3FAXA 4TQEL 5GSVA 1LO5A 3PGDA 3IKCB 4NQEB 3C2SA 1A7PL 2Z8VC 4N0YL 1XR8B 3HE6B 4UDUB 5C0EB 3P4MB 3V8CA 1YNLH 1UWXK 3N9GH 1GOFA 3W0WD 2IADB 4POYA 2YN5A 1QFPA 3EJZD 3BIKA 2Z35A 4ODTH 5TE4H 5MEQB 2WP3O 4Z8FL 5FEBA 4Q9RL 4MVBC 1JGLH 1R5IB 3PWJB 1W0WB 3QXAB 4PRIE 1VDGA 4D9QE 3ZL4L 4L8DB 4YHPB 3TO4D 3UJTL 4XVJL 2Q76A 5J3HC 2EE3A 3L3DB 1TJHL 4ZUTB 1PW3A 4JFQB 5IK3A 1ZGLM 4NN6B 2O5YH 1MRDH 5T1KB 2N7BA 4GXUN 1YEJH 3MPCA 5TE6H 5FKAB 3VFVA 4YE4L 1BM3H 1MHCB 3U4AA 1JYWA 1FZJB 2YUZA 1A7QL 4LSSL 4P2RD 1S9YA 5CJXC 4Z0BH 3IDXL 4PGCB 3H9SE 3VH8B 3P40A 1AI1H 4NCC1 4UTAH 4YQXL 1KFAL 5JOPE 1U3YA 1H3XA 3CFEB 5D7LA 2EYRB 1AR2A 1S7TB 2MQ0A 3FCTB 3AREA 5ELIA 1VGEH 4Y16C 3U6RA 1U8LB 2R15A 2ITDB 5SV4A 4QRRE 3PQYA 3RPKA 3CIQA 4YXHH 1E27B 1MUJB 2DLEA 4JEGB 3ARGA 4ZPVB 2I24N 3TJHD 1CD9B 2BHUA 3GMOB 3E6FB 1KG0A 2IPUK 3QZWG 4JZJC 1CE6B 3R8QA 4P23D 1R3KB 2ZG1A 1LEGB 2UVEA 1M4KA 2CUMA 3MRIA 1I9EA 4OFIA 4ODWA 3W82A 3QJHB 3VG9C 4NFCA 3O0RH 2HRLA 4L1HA 4OQTL 6FABH 3WLWD 1QR1A 1W0VB 4RMTA 1CDIA 3MA7A 4MAYA 4QXTA 3BI9X 4S1DD 3HA0A 4Y5VB 5EUKA 3C87A 2YPLA 3QI9C 4H20H 5HVGB 1C5BH 4V1DB 2H32A 3PABB 4J3TA 2AW2A 2XKNA 3G6AB 4LARL 5D7IB 2VYRE 4WENB 1T22A 2NPLX 3M1BB 4NKDA 5C09E 3RJDA 1MNUL 1K4CB 1AGDB 1GZQB 1G6RH 4MB3A 2ERJB 4BSVA 1MHPH 5C0RL 2VXQL 3EOAA 4PJ7E 4HWEH 3ABZA 4AMKH 4OJFL 3G5XB 2HFEA 2NY7H 4OI7A 2AXFA 5KAQG 4KVNH 2FO4B 5DMKA 4R2GC 2VLJE 4HIHB 4NN5C 4CDGC 4ETQA 3TWCL 5DHVH 1OGAB 4MLIA 1NBZA 2V17L 4CMHB 4U6YB 3RIAF 4DKDC 1X7QB 4E42B 3BDBA 4PY7B 4Z7OF 5JUEH 5KVFL 3IYLW 4GLRI 4PB9L 4M62H 3WEXB 4QT5A 4FQHA 1NFDF 2IH3B 1INDH 1D9KB 1T03L 1CFVL 3RU8L 4ZTOL 2WUCL 1PY9A 1J5OL 1IGFL 3QEUA 1S9XB 4K94H 3BP6A 1I9IL 4TTDC 4BELD 3LD8B 4RRPG 5T3XE 4AH2B 3BP7B 3A67H 1Q72L 2WBJC 3T4YB 2VR5A 4K8RD 4LSPH 2DQHL 1I1FA 2HKFH 5TF1H 2G2RA 1N5YH 5F7FA 1VSCA 1YQVL 1V7MH 2BHYA 1OQXA 1ZE3C 1UZ6F 2K7PA 4FQPA 4N1CA 4PJCF 1T5XA 2CXGA 5J1TC 1NAML 3OR6B 3DGCR 5ANME 4QHLA 5FGRA 5KG9B 4NQVA 3SDDC 4ALAL 5DR5H 4J8RB 4XP4L 5T1DL 5EIQA 4R97C 3QAZC 4V1DD 4XCFH 1KLGB 1H3PL 1FN4A 1MFBH 1RJYB 1VERA 2B4CC 3I6KA 4LCYB 4ZFOL 4O4YL 5IQ9A 3OKLA 2OI9C 2ICWA 3KPOB 4MXWL 3S34H 3U7WL 5JLZA 2DLFL 2BNQD 4L5FH 5IROA 5LXGH 1XMWA 4PJ9B 3TV3L 3MXVL 5JXED 5IESH 4R3SA 1S7WA 5IFJB 1C08A 4M7KL 4PGEB 2AI0L 1JHKH 2WWMD 3HMXH 3FJTA 1U41A 3RRQA 4OGAD 5MEND 1U8MB 4EOWL 5E9DB 2AJXH 2G2RB 4J6RL 4LOUD 3OAZH 3SCMA 4EDXB 4GJTB 4H88L 2H2SD 1KCSL 1Q8MA 1ORSB 2VXUL 1GGIH 1MIML 3QG7L 1QSEA 5JXAH 5DHXB 4IRJB 3IDUA 1JN6B 5TDNB 3BD5A 4LIQL 3MCKB 2H9GA 3CX5J 1FFOB 3U30C 3BJ91 1D5MA 5E99H 2FZ3B 2JB5H 2CDEB 3LKQB 2E7CA 2NY0B 3A0OA 1MAJA 2UUDH 5C09A 43C9A 5D7JA 4L4TE 4Z7WA 1FNGB 3QG6A 1CDUA 3ULVD 4M6ML 1NDGA 5FUOH 3MYZA 2AXHA 4ENED 5BJTA 4M6AA 2KKQA 5C07B 2JB5L 5E03A 3FFCB 3G6JF 2EC9U 3HAEB 2IAND 4ZDHA 3MLYH 4FQLL 1F58H 4BH8B 1EGJL 1U8PA 5J7CC 5EZLA 4L3ED 4PB0H 1MIMH 4HQQL 1P69B 2NXYB 5I19H 2IADA 3AS0A 2VXUH 2VISB 3MV8D 3WNLA 4Y5VA 5EUKB 4BJLA 3U46A 1OW0A 4JFHD 3V0WL 4ZPTA 3CX2A 1ZHLA 2OK0L 1HILA 1F8TH 1Y18B 2H32B 2MTPA 3PABA 4YHMH 4J6RH 4GQ9H 2AJXL 1GPOH 1K8IB 1FFOA 1KEGL 4NBZB 5IR1A 3BZEA 2ZCLH 4JFEA 1JHKL 1Y0LA 1MREH 4CJ0A 2AI0H 2DYPD 4QXWA 3EHBC 3I9GL 3MXVH 4XP9L 4J3XA 4X80L 2NTFA 5FCUH 1CDHA 1BIHA 5CMAB 1IFHL 2EXYD 1PX3A 5FYKU 2DTSA 3SY0A 4S0TD 2RIKA 1H3PH 4R0LA 1Q9KB 4JKPH 1IGTA 3HG1A 4G8EA 5T5NF 4BZ1L 4JQVC 4V2BA 4ALAH 5GZNC 1YUHA 5L0QC 1A7BA 3PGFL 4UV4H 3U36B 5DDHB 3BVNA 4D0DA 5JMRA 3B8YA 3GBML 1P4BL 2APTA 4XAKD 1V7ML 5ETUA 2UZYB 2J6EA 3C6LC 5FA4A 4LSPL 2ENSA 1QHPA 3AMKA 4OZFG 1G7MA 1WBXA 3ORJA 1Q72H 5DUPL 1H15A 2VDQH 4LMQI 4KHTH 1SMOA 4NT6A 3HZYB 3OF6A 4KROD 3EYOB 3BKMH 1IGFH 3WNOA 1ZVSB 5AUMB 2WUCH 1PAMA 3CFDB 1KTDA 3O81A 4D9RE 4OM0L 2LFGA 2CSPA 3VWKA 4PB9H 1TNNA 4YZFF 4PRNB 3BGMB 4LHJB 2VWEC 3O4LB 4JN1H 1IT9L 2MKWA 3SQBA 3TLRA 5IVXF 3BPCA 2C5DC 7CGTA 3LS4L 2D4DA 1AKJA 4X5WB 5CAYB 1OAQH 2AXGA 4U6VH 1MCQA 4ZXBA 3Q6FB 1FN4B 1HKLH 4DAGL 3L95B 4WNQA 4U6XA 1WF5A 3MBEC 5DEGA 1CQYA 4JHWH 3A6OA 4I13B 4HT1H 2YXFA 2Y07L 4OJFH 3TN0C 1D5XB 1O7VA 2VXQH 1MHPL 4FQXA 3HRZA 2CKBA 4GAJH 4YDJB 1MNUH 1HDMA 4HK3J 4AY0A 4LARH 4HBCH 1HH6B 3IFPB 3R1GL 3ILQD 1RJLB 3GDBA 4UOW1 4P2QB 1C5BL 2YC1A 1U36A 2BNRA 2E9IA 3K8KA 1B2WL 4YO0B 3S36X 4OQ1A 1MCNA 5LGJB 1CIUA 1WZLA 3PWNA 3O4LA 3ARRA 4NC0B 5K33A 4I9WE 4LFHG 4NO2A 1BQHG 4OQTH 6FABL 2P5EB 1I1YB 3QEQE 2QEJA 5HI5C 3UTPD 1MJ7L 3QUYD 2MMXA 2DLHA 4YDIL 3ULVC 3C9NB 3VGAB 5KSAC 2YS4A 3T0WA 3SPVB 4DVRH 4OGYL 3R06B 4HGMA 1TENA 4HIIA 5KAQF 2BCKA 1G0DA 1C7SA 5E5RB 2DLIA 5E2UH 5TE7H 5CD3A 3G5VA 4N8CL 3ZDYF 1FE8L 4RSVA 3ZSTA 1MHCA 5E2TL 1EVTC 4YXHL 2BSSB 3FT3A 1E4XL 4XT1C 4I3SL 3DVGB 1GYAA 3PG2A 1KCKA 2DM4A 4Y16B 3SKJL 1VGEL 3D48R 4JQXC 1AD9A 3MGOA 3OKYA 4XHJD 4BK4A 3L3HB 4GRWB 5MP6L 4RQQA 3S37X 2LTQC 4LEOB 1QSFE 1MCKA 2OM5A 4GXUM 2AP2A 1U0QA 4OGAC 1KJ2A 1UVQB 3IDXH 3D0LB 4XCEB 1BHGA 3BE1L 4HV8B 4WHYG 1BAFH 1BM3L 5INDA 2A1WH 1YC8A 1SBSH 4WUKL 5I1CH 3DI2B 4YK4B 4Z95L 3R06A 4GRWF 1HSAB 4F2MA 1MRDL 3NCYP 4BUHA 1WK0A 3IS1X 2DAVA 4LSRH 3W81A 3KAAA 5C2BL 4GO6B 1I8LA 4MWFA 1R24A 3ARWA 1L0QA 3BKCL 3MRPA 4XVJH 4NQUA 3UJTH 1OLLA 3HPLB 1U8QA 4NZJA 2Q3ZA 2MPAH 3T0EE 1ZANH 2OP4H 2J8UE 4Z8FH 4ODTL 4FQIH 2FBOJ 4YZFE 1WAAE 1IAIL 5CIPH 1FFNB 4MJIA 3LDBB 4U1MA 1A7PH 4H5SB 3JWDH 1A6PA 1IM3B 2WMPA 4I8DA 4WU5A 3KPSD 3EIFA 4RX4A 1B88A 1BVKB 1T22B 4NKDB 4V1DA 2CRMA 4YDLB 1QRKA 3RWIB 5E8EB 1JWMB 1DFBL 2BXZA 3MYJA 3EOAB 1NBYA 3OF6D 2FB4H 1N0LA 1FNGA 1IC4H 4O2EB 4PRBA 4JDVB 4Q58C 3SDDB 3VMNA 2F19L 3EO0B 3T65B 2IANB 3WFBH 4JJHA 3NFPB 2I9LB 3JZ7A 2PW1A 3QEQB 3LOWA 4LCCA 2DWDA 5EU5B 5GJSH 5BQ7A 1RMFH 5DRZB 3BGMA 4J1UB 3B9VA 4M5YH 4HWUA 4H8WL 4KRNA 3FQUA 2X4TA 3WDHA 3RFZC 4XX1E 3ZO0A 1U91A 4ZXBB 1R5WB 2P47B 4F3FB 2XTJB 2BVQA 1IEAA 4NHCH 3ISWA 2BERA 3MBXH 4MA3A 3H42L 5CEXB 1HI6B 2QLVB 3EDJA 1DLFH 5DRWB 4WU5B 1FVDA 2H3NB 1YY9C 5SWZE 4HUUA 2X4NB 5B21A 1A0QH 3ILQC 3RWHA 5T33L 4Y8AA 1SJEB 3HC0A 5I8CA 3OV6A 1HOCB 4L4VA 4HXBL 3QHFL 3BRDA 2ZOLA 3L3DA 4KZEL 5FF6A 4AJ0A 5FA3A 2ESVB 5K9OA 3PP4H 3P30L 2JCCA 4YNYB 3PHSA 3ZDYE 1KCUH 5J1SC 3T3ME 2A0LC 5LCVH 4YGAB 2GT9B 2ZSWA 3NCJL 3BSZH 1P4LA 2JKXA 4CVUA 4J3SA 4ZTPL 3MROA 5SX5K 3MA9H 2ZPKL 4K3HA 5MEPB 1F11A 1NLBL 1REIA 1WCBB 3FN3A 3IU4L 3CC5A 1OLZA 3TZVD 2VUOA 4LBEB 4FFZH 5CSGA 4ZS6C 2FBJH 2JTDA 4K7PX 4DCQA 4X6EB 4JFFA 2AEQH 2DWEA 5F9OH 5EZOL 3QEHB 1MFEH 5DGQA 3OXRB 1H15B 5ERWB 4C56E 3OJMB 2YMXH 2OR9H 2FNBA 1E4XI 1I7ZA 4M7LH 1R6VA 2IH1B 4X0KA 4HZAA 4KDVA 4MA1B 1CK0H 3VG9B 3T1FA 1DQQA 2AEWA 2VXTL 4OFYA 5T3ZD 1NPUA 3EKCA 1S5HA 1IZJA 3BIAX 5MEOA 3V4VH 5TDPB 2EE2A 2A83B 4WI4A 3TEUA 1GAFH 4JPVH 5DS8B 3EYFA 5FAAA 3PWJA 3JWOH 4J3VA 5DVMA 2C3WA 2C9AA 4X99A 3ARBC 2KQMA 4X4ZA 3WNKA 1RZJL 4Y89A 3L95A 4WNQB 5D1XA 1WQVT 4P5KB 3RTQA 5C09B 43C9B 4PJDE 3MRHA 4ZAKC 3W0WE 3OB8A 4KFZC 3BAEH 5B22A 4FABH 1NUDA 1P7QD 2DIAA 2FR4A 1CLYL 4XP5L 5TFSL 5EU3A 2F58L 2W59A 5ERWA 5DFTA 2Z92B 1HDMB 1ZGLB 1QEWA 4BK5A 5IEKB 1PKQE 4ZSOB 3V5KA 3M1BA 3L6FB 4XCNA 4I0CC 4X0KB 3MRPB 2UZXB 2DQFB 3TT3L 2OJEB 4FP8H 1A22B 3GIZH 1U8HB 4NUJB 2AERT 1KELL 4PG2A 4QWWD 4HS8H 4X6CA 4GRLD 3VWJA 4PJ5E 1CGYA 4RGOL 2A38A 2UZIL 2X42A 1EO8L 3REVA 1GGCH 2IWGA 1XF4A 1BEYL 2XKSA 3VH8G 4LCWA 1N7MH 1AGFB 3QPQD 5KVEL 3SE9H 3NFNB 5IMMA 3D2UB 4IMLB 5FDWB 5HHXL 1XGYH 3F5WA 5FYJL 5C0IB 4PJEA 4WFFE 3SY0B 2FIRT 1WITA 4BKLA 4PJDA 1LHZA 1N8ZB 2BVPB 5EH1A 1WICA 1TTGA 3MR9B 3VRIB 3R8BB 1IC7H 5ENWA 3OKOA 3BN9C 4FTVA 5CEZE 1PX4A 5JMOC 2JJVA 1Z3GH 3W5NA 1F97A 5IHUL 1KCLA 2DDQH 5ICYA 3TN0B 2M1KA 5L0QB 3BYYA 1JPTL 2BMKA 3M8OH 2VC2L 4X7CC 3BT2L 2VAJA 4YXKL 4ODXA 4ONGH 3VFWA 2NLJA 1DBAH 3QA3A 1FNSH 1A6UL 3TBTA 3IJYB 2IQ9H 4WI6A 3OR6A 3HCVB 4U49A 1NMCB 1ETZB 4X6DA 5LBSL 5BVPH 1JZ8A 4QXGH 1TVBA 3O3EA 3FB6B 4X98B 5ESQB 5GIRA 2PXYD 3MQIA 4XHQA 3V6OE 2QKIA