5J9PA

Kcsa in vitro
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA02
1IM9D 2MQCA 5ID1A 5ICXB 5ADPL 3CX2A 2AXGB 4JVWA 5IHLB 4NQSB 4XCYA 2DLTA 4MCYB 3D87B 3QUXB 3M1BB 5F9OL 4XCFL 4HD9A 3L3DB 4R0LA 5CBEB 4QRSA 1NC4A 1YUHB 5KVDL 3HZVA 4K8RH 3RVTD 2VAAB 3VFRB 2AEPL 4J4PA 3X3GL 5HY9A 4LLYB 4EIGB 3QG6B 1CN4A 2I27N 4H0IA 3ARFC 5FO9A 3PNWA 43CAB 3MZTA 1S7SA 2NR6C 4PJCF 4OGXL 4FFWC 4Q2ZB 1I9IL 2FX7L 4HWZB 3VXRB 3ZE1E 4JKLA 3TF7C 4X83A 2IEPA 5HSFA 4JVUA 1OAKL 4HWBL 4FQXD 2QADD 3RWIA 4GJTB 4LVNB 5CEXB 4S1SH 3S36X 4WI3A 2A38A 4HJJL 1MHHB 3PXJA 1PYWB 3GJFA 2AK4B 2R56H 3OKOB 2V5MA 3RY6C 4PJBA 5D8JL 3JWOH 1FZMB 3CUPA 1U8MA 4F7PA 1N4XL 3GO1H 2FYYA 3MLXL 3BUYA 2P42B 2DLHA 3SDAB 1YYLL 3EIFA 1F2XK 2VQ1B 2WUCL 3CVHL 3LN5B 4M6MH 5DMGD 1D5MA 1QO3B 2LVEA 3H9HB 4HZLB 1HNGA 1LD9A 1TCRB 2A9ML 2B7DT 2YWYA 4R96B 1S5IL 1CICA 5SX5K 3TBWA 4KTEL 5I8EB 2NW3B 2VOTA 3QH3B 4X9FA 1WAAE 4M00A 2DBLL 5E6IA 5INDA 5EUOF 3UYOD 1SM3H 2IALA 4ESKA 3UZEA 5JO5A 1EX0A 2OP4H 3VRJB 2BVOA 2LTQB 3BQUC 1U91A 5CGTA 1QRNE 4ZS6D 5KVFL 2HMIC 3QPXH 1ITCA 3VWKB 4NN5B 4GMSL 1UCBL 5GS1B 1X5FA 4Z7WB 2C1OB 3ARFA 5IOPA 2B39A 3T0BA 5T3ZE 3PG2A 1YQ2A 5EOTA 3DSFL 5DJYB 1MFAH 4M61A 4EUPB 4WFGD 2EIBA 5DVOA 4HPYH 1U8OB 1T1XB 2WBJB 5CZVH 4ZNEE 2P44B 3TA3B 4LCYA 4D0DB 3JTSA 1J87A 5CGMA 2C4XA 3WO4C 1K4DB 5CP7B 3S4SA 3RVXC 3BP4B 1N0LA 5JHLH 2COQA 1VEMA 1JHKL 4QRTB 3QNYA 3IDMB 3W81A 3DUUA 4ZO8A 2FHBA 4MS8D 5GRXG 1C5CL 1Q72H 1WBZA 5DJ2A 3L7EB 3RY6A 1EGJL 1T66C 1WGOA 43C9B 3WNOA 3QWOB 1KTRL 1FFPB 2CKBH 4GQPH 1F3JA 1IC5H 2FX9L 1LEIB 4LLAA 3OXSB 1H3WM 5FHAH 1PKQE 1A6TA 3ZKND 4LLWA 3G9AB 2J8HA 5CP3H 1HH9B 3EO1A 3FQWA 3LQZB 4NC0B 5SWZA 4CKVX 4MNQA 3RHWK 2AVGA 4GBXA 2MSPA 2ICEB 1P7KA 3H9SB 4LBEA 5IEHA 3DIFB 1GHFL 3O11A 1F42A 4X98A 4QYOB 5F88A 2XTJD 5C0NC 4ZTOH 5JLZB 4FRWA 1N6UA 1YQVL 3OHXB 4G9FD 3HLAB 4CU7A 1UZ6E 4Y5VC 2OJEB 3BQUA 3VXTB 3VFTB 4P9ML 1JV5B 1S7XB 1M4KA 4HIEA 5DSCB 4JN2A 4OD3L 5F7DB 4WDIA 3HI5H 4TPRL 1OP5H 1WLHA 4YUEL 3MREA 4HBCH 2RCSL 4UQ3A 4NIKB 3IKKA 1N7ML 4NO2B 3P4MA 4UIMA 5DR5L 5KSBA 3NIDE 1HN1A 3QO0A 4CU8A 1F11B 4OQTA 5DEGB 5BVPH 4X7SH 3T3PE 1EMTH 5DQ9B 2BC4B 2XN9B 3MC0A 1BQHA 4QRRA 5I2IB 5BOPA 3CMOL 1XH3B 3Q5TA 5J1AA 2BSTB 4EZMA 1X5YA 2MKLC 3T2PA 2I9LB 3IDJA 3BIKB 5IMLB 4H26B 3MXVL 3HNVL 2WIIB 3BN9D 1FZJB 3CVIH 2A73A 4XNQA 5C0GB 3LZFH 5C6PB 5F89B 3VI3F 3CXDH 3WFHB 1U8PA 4X5XA 3BH9A 5DFWH 3NPSC 3QEQE 4LDOB 5DJXB 1WZMA 5T1KA 2ZCHH 5I1GL 4XBPA 2E8ZA 1SEBA 2ZKHL 2G2RB 4ZUWA 4HFUH 3HC0A 1KFAL 2X09A 3UPAA 4LSUL 3BKCL 3HZYB 4XVUD 3LEVL 3LEYL 4CADB 1J0JA 4JHBA 4KV5F 1KCUL 4XNXL 4ZUUA 1OGAB 5F1SA 2DN7A 2E9WA 2VIRA 4NQCD 3WIIL 4HKBA 3IXTB 3FTGB 4WV1C 2GJZB 4JY6A 1P5VA 4Y5VA 5D93C 3HE7B 3WHXB 3P77B 3TZVD 1O0VA 4G8IA 1KB5B 3IFOB 4QCIA 3TN0B 2GJJA 4MJIE 3OZ9H 4WUUE 2HLFC 4NO5B 4DEPB 3ULVE 1S7WA 3A67L 2BNRA 4NJ9H 5D96C 2NY3B 4P9HL 4F15C 1KIUA 2CR6A 1Q9OB 5LG1A 1TQBB 4JHAH 1GGBL 2X1XR 3VXSE 5J1SC 4MQ7B 3U9PH 5I0ZA 1PZUB 3QBTB 1CU4H 1T1ZA 4MJ4A 4PJAB 4NC1C 5HI4C 1FSKB 5KSVB 3VFSA 3O2DL 3QDJD 1ZANH 3TIDA 1QYGL 4DN3H 5C6WH 4PRDA 2NY2D 3LAFA 4I77L 3GI8L 2BP3A 2DMCA 4YE4H 1YEFH 3Q6GH 5DRXB 1FNEA 4TUKL 4RFEA 3INUH 5SWSD 1T2QL 1SY6H 3BPNC 2XI9A 2HN7B 4F7EB 5JW3H 2HJKB 5C7XH 2OL3L 5FGCE 4J6RL 5BJTB 1LO0L 6FABH 3KYKH 5FYJH 4NO3A 4JLRB 1FG2B 4AG4L 1U92B 3AGVA 3VGGA 3NOIA 3OGOE 1J0ZA 1F3DH 5GIRA 3TIEB 4X6CF 2BHUA 3VD5A 3SO5A 5D2LB 4PJIA 5HHOB 2BJML 1RZJC 1X5KA 1NGXB 4GG8B 3HMXA 2C7UB 3KHQA 3IB4A 3O45A 3FCTA 2J5LC 4OFYD 1MRFH 1DUZB 4WW2F 3UTSB 3OX8B 1CXHA 1LO3H 4LHUA 3BYYA 1F00I 1T80A 3BWAA 4WV1A 1NCCH 3G5YB 3C08L 4UV7H 4AEHH 1A9BA 1G0XA 4QT5A 1KOAA 2CJUH 2XV6B 3FQTA 1B2WH 2X4SA 3SOBH 1QFWH 4UT6L 3ZKMC 1IGTB 4JPIB 5SX5H 1JPTH 5D5MB 3IDXL 4OCWL 4FQCL 4GW1B 3TT3L 2OI9C 3BGMA 4U33A 1BF2A 3U0PA 2AW2A 3CH1A 1S3KH 4I0PC 3BWUC 1RHFA 3CX5K 1U95B 1DBAL 3BFOA 3D18A 5F3BA 1KJ2B 1H3PL 2Z92B 4Y89A 1WWBX 4H20L 3TO4D 4Y19E 3IRZA 2VC2L 3D9AL 3HPLB 2VB5A 3UTTA 4ZSOB 5I16B 4OZIB 1MIEL 1AD9A 1KULA 5CHNB 5IMMB 1CDJA 1YEIL 4CN6A 3GGWB 1I7UA 2EICA 4ISVB 3P73B 1NDGA 3QFDA 1S9VA 5DD3H 2Z8VC 3UJIL 5DUML 5DMJB 4OB5L 4YGVB 1IAKA 1QFWI 3GSXB 3G04A 3K0WA 4Z78A 3MPCA 4LIQE 4LEOB 5IB3B 1QUNA 1UM6H 3GHEL 1A7NH 1U58A 2LQRA 2JELH 3DROA 1DUYB 4S1QL 5TPWL 3FB5A 4OKVA 4NQCB 5C2BH 3RWGB 2X1WL 4P4RB 1FO0A 1B0RA 3V8CA 1KIPB 3MCG1 2P24A 4KU1A 5FCSH 3BKJL 1RI8A 4JFEA 4ORGA 1IAIH 1B90A 2EO1A 3VXUB 1X4XA 5ITBH 5D7LE 2XFXB 3O6KH 4O51A 1I8IB 5JQHC 1ULVA 1HK6A 1CFNB 5I1JL 3VXME 4HKZB 3SKJH 2NZ9C 3UTPD 1WEJH 5GRVL 2VLRB 2Z0BA 4LARH 3RNQB 4PJ5E 1JNJA 1YNLH 1GZQA 2P5EE 4I0PA 3HKFA 2CGRH 3L3OA 5BRZE 2R2EA 4NWUL 5ERWA 4JPWL 1Y6KR 5JOEA 1YEKH 1V3MA 1HHJB 5E2UH 2OK0L 3WFDL 5I15H 3ZYIA 4PP2A 4UTAH 1QLEL 5DD1H 3ARBC 5D1QC 1KPVB 1OSPH 1S9YB 1CFSA 3NH7L 2HVKA 2K3TA 4C56D 5F70A 5T5NF 2IFFH 1TVBB 4AEIH 3FAWA 4KFZC 4IIQB 1MY7A 3V4UL 1G7HB 2O5YH 4Z7NF 1CFVH 2EE2A 1QACA 4HDIB 1IAII 1RIHH 5T33H 3DX7B 4KDWA 1ZGLP 4PRID 1INDL 2CQVA 4YHKH 5C0FB 1F8TH 4CVZA 4L4TB 5FGRA 1OTSD 1VGEH 2FJHA 4OLYH 5ELIA 5C9JA 4U6XB 4BM7A 4HK0A 1BVZA 2J6EA 4HPOL 1YEDA 1VA9A 2UWEA 4N68A 4P2OB 5ISZE 3C5ZD 3MV9D 3ULVL 4XXCC 5AZ2L 3S37X 5E94A 2R9HD 3VGFA 4JPKL 2WWKO 2YD4A 4WWKB 1R3JA 1UH4A 3B9AA 5JPNA 3BZFA 2R0WH 4XI5D 1F90L 2CK0L 3RA7L 4OM1H 1FL6A 4N0YH 5ENWB 2DWDA 2VLJB 5TDNB 4EI5D 4FTVE 4M5ZL 1A6ZA 3VDAA 5MHSD 1BZ9A 4MQXD 4PJ8C 3U0TA 1KJVB 1QFPA 1RK1A 4LNRA 3HUJA 4Z7UB 3EFDL 3TO4B 4R97B 3QDGA 3B5HA 1PFCA 4NZTH 4XNMB 4XPAL 2ZWLT 3ROLA 1OD7A 1WCBA 3CFCL 3R8QA 2CIKA 5IHZA 3SKUD 4JRXB 4FQQB 3ZTJH 1DBKL 1FQ9C 4NFCA 2X4UA 4ZOBA 4ODVL 4OBSA 2P4AB 4EUPG 3ARBA 4FZEH 5D1QA 3IJHB 4NKIH 1P7QB 5LBSL 3L3GA 4HJ0C 2DJ4A 3I2CH 2IBZX 2YWZA 1UB6B 2XQBH 4NOBA 2R29L 3C09C 5CEZD 4IHOA 2NY6C 1JK8B 2VDKH 1IEAB 3F7PC 1G1YA 2DDQL 3GMNA 4OQTH 5T1MB 4YIQA 5DD0H 1P4LB 4YDVA 5MEOB 1NUFA 3L95A 1WTGT 1XF1A 1LO5A 4PJCA 2YA0A 5HBBA 4NWTL 4S11A 5DUPH 1MJJA 5D1ZC 5DFVD 3SCMC 1GIGL 1AE6H 1DQQA 1NDMA 3AVEA 3W9EB 1HHKA 3DGGB 4KAQL 3RGHA 5I17A 1WFTA 4XXCA 4HWBA 2R0KH 3MRPA 3QXAB 4LEXL 3R0MA 3IDNA 4KKCC 4EDXB 4E9LA 1NC2A 1A1MA 1MJUL 3WS3A 2QR0A 4W4NA 2VXUL 4XP6H 5E9DB 4ZNCD 3CNKA 1FLRH 3V4VH 1N6QL 3PJSB 1G7PA 3F6LA 1P69B 1X5JA 4YWGH 5I1HH 4Y4KC 3T0EE 3KXFD 3TVMC 3MX0A 4Y16D 4PJ8A 4NQEB 2E8YA 5E6ZA 3VG9B 4LPCA 3T08A 1HHHA 3RWJA 1UEYA 3AS3A 1C1EL 4OZHB 3G6DL 4JJ5B 4LAQH 2E9IA 3SDDD 1UH2A 3CVHA 2P8MB 4ONOA 3LMJH 4LIQL 3JUYA 1JYWA 2DI9A 3P9MA 4R7NB 5D7SL 3ZKXB 4M8QB 4X4MA 5C0CA 3QFJD 4A2MA 2YBRB 1KEGL 3FONA 3U36B 4RWYH 1JFQH 1EEZA 2ZUTA 3GSNB 4X4XB 4Y1AA 6CGTA 4RAHA 4HWEH 5K9OB 1S8DA 2HFFB 3O4OB 1HOCB 5C0BA 3AAZA 4OTXL 5GS2D 4JAMB 3FL7A 3NAAL 4WEBH 4P49A 5FM4A 5DVMA 5IT2H 4ODXA 5D1ZA 2VL4A 3SCMA 4YNYB 2B0SL 2XRAH 1EEYB 3TFKD 4HF5H 5MERA 5FHBH 4EI5B 1E28B 5LKNA 4JZNA 3QZWA 1MCFA 2BHYA 2DI7A 3B4NA 2E7MA 2PYEE 1AY1H 4APQD 1CQKA 4NZJA 1JBJA 1MJ7H 3NPZB 1XF5A 5HYEA 1JF6A 3U30B 4HS8H 4X6EB 5CJXC 3UTOA 4H88H 4G8EB 4D0CA 3MBEB 3KHOA 4WO4C 3OAZK 3HMXH 3RVUD 1E6OH 2DM4A 4Y4KA 1KIRA 4PTTA 4KI1A 1MAML 5CMAA 2A6IA 2YN5A 4XP5L 1BEYH 5E6YA 4ZFFA 5H94A 1ZA3A 4XXDB 1F6LL 4OFIA 4NZRL 4PY8J 1P9MC 4LRNL 4Z7QE 1GOGA 5I0DA 4HMEA 2CLRB 3TJEL 3IJYB 5EO9A 3D25B 1YECL 3RUGB 4FXGA 3EOBB 3T4AA 1CXLA 4LLMB 4N1CA 4RMVA 4OKDA 4WRLA 1ZOXA 3OXRB 1RZKL 4M3JA 1FVEA 1M7XA 4PLJC 3O0RL 2WIMA 4IRSC 4QXTA 4IDJH 4CVWA 5ECJE 1U8JA 2BY2A 4XCEA 2AJVL 3QEGH 2F5BL 2XXMB 2QSVA 4HFWB 2VR4A 2Z91B 4GG6A 5DMIL 2DI8A 3QDMA 3T2NH 3W0WB 4P9HC 3DBXB 5MEPA 3MRQA 1PX4A 2EDRA 3QQ3A 5ITFA 3TV3L 1QHPA 2HRPL 4K3DL 4XB7A 4M7LL 1YEEH 3MROB 1T3FB 32C2B 4QNPE 1K8DB 2VL5B 3N50A 4XP4L 4Y16B 4HIXH 1V7MH 3IDUA 4U1JA 3DYMA 4U1HB 4UOJA 1BZ7B 1G6RL 3CLEH 4LVEA 3AY4C 1A9EB 4Q6YA 1RZJH 4WO4A 2EC9T 3D2UD 3NFPA 1FO0H 1FHGA 1ZEAL 4UT9H 3Q6FB 4K8RD 3H3BC 2W38A 4PJHB 5IBUG 3MRHB 3TYFB 3LKQB 5GRZA 4DN4L 4HJGA 4UIKL 5I19L 4CVXB 4HXBH 3SPVA 5HDLA 1HKLL 1P9MA 3NTCL 1CLZL 1YN7B 1KXTB 3FQNA 1FRGH 4KK8C 1XIWB 4PJ7F 3W11D 1QA9B 4GKNA 1UXSB 5GGQL 3B5GA 3T8XB 1FV1A 1MUJA 4X99A 2ZUXA 1IFHL 3U7WH 3D1MC 3DRTA 1E4JA 1OTTD 4TOYH 3PWPB 4ALAH 4JY4B 1JNLH 1T7YA 4IRSA 1HQ4A 2VR5A 1FNSH 4KQ3H 4GW5A 1BGXL 1RUAL 5ESAB 4MA1C 4Y2DC 5I66A 2SEBB 1JZ4A 1NMCC 3KJ6L 5IUSA 4HUVA 1DN0B 1NCBL 4EN3C 4O5LL 4K9EL 4U6YA 3HRZA 4DZ8A 3GM0A 1FCGA 2GQHA 5MI0C 3LIZH 2XYCA 5FYLE 4IRJD 2VLLB 3MUJA 5L88H 4UUJA 4OCYL 3I6LE 3O2DA 4M6AA 1JGDA 2A6DA 4X80H 1U8LA 4CW1A 1JYNA 2J6EH 3GIVB 3VG0H 3NCEB 5FOBB 3MLZH 2QV2A 3AY4A 4WFGE 1AGEB 2OL3A 2BFVL 2YXFA 2P49B 5J11B 5TQ2H 1ZHBA 2DMBA 3CXHJ 1JGEB 3RTQD 5L9DH 2XZZA 3DUSA 1CTNA 1QSFD 2ZG3A 3R06A 4X6CA 3N06B 2AJ3A 1FL3B 3T77B 1TFHA 1EXUB 5EU3B 1I3RB 2IADB 5DQDH 3VE0A 3IFNL 1XT5A 3K2UH 1NGZA 3QHZH 5I18H 1H3XA 1YMMB 1BQHG 4XNUL 4K2UL 4LU5L 1BBJB 3BKML 5BV7H 4FNLH 4DZBB 3GMMA 5ADPH 1T20B 1CDCA 4RGND 5IIEB 3H3KA 5D1XD 1WIOA 3FFCE 1U8KA 5I1EL 2YPLB 1XGTB 5IB4A 4C58B 4MXQD 3KPSD 1RZFL 3DMMB 5F9OH 4XCFH 3EYVA 3MMEA 3ARDC 3IRPX 2JB5L 4JRYA 5KVDH 4Y2DA 4M7ZB 3HB3C 4QF1A 3SN6N 2AEPH 3FZUC 4EN3A 2ZSVB 1AR1C 3X3GH 2ZCKL 4GKSB 2UZYB 5DK3A 2XTJE 4E5XA 1XF4A 5GGTL 4G9FE 1HH6B 3D2UB 4X7CC 5DVLA 5GJSL 1FZOB 1C5DA 4NNYA 4OGXH 5CD3B 1LE5B 1IL1B 2Q76A 2VRAA 3OSKA 5FK9B 3TO2B 3NCYS 1I9IH 2FX7H 1JYVA 4RMWA 1ODAA 5IG7B 1ZGLM 1RZ8A 3GUTB 4GRMA 1A64A 3LRSA 3QIUD 1OAKH 4HWBH 1BQUA 2FHFA 5GISL 1R3LA 1FPTL 1EERB 4L8DA 1MNUH 1T2XA 3CDFA 3LDBC 4TTDC 3VMPA 1BQSA 4KK9C 1NCAL 4HJJH 1T0MA 1A4KA 4EJ1C 4HWUA 4JFQB 1XCTA 2BOBB 4IS6B 5JDJA 2BVTA 2CLZA 3VFWA 3ULVC 5D8JH 2WK2A 2ESVB 2F53A 2HH0L 2W9DL 3SKOB 1FL5B 4JDZB 2NXZC 3SDXE 1N4XH 2O26U 1ZV5A 3MLXH 4MSWA 4DQOL 1LILA 2GTZB 1HQRB 2YD9A 1YYLH 1JGVL 1CK0L 3CVHH 2WUCH 4PLOB 3O8XC 5INCA 4I3RL 1KYOJ 5DJAA 3MRFB 4CDHA 3ABZA 4ZG1A 2A9MH 1BAFL 4NSKB 4ELKB 1S5IH 3LRHA 4J3XA 4KTEH 2V7HB 3DHMA 3ARDA 1J8HA 2DBLH 2I5YL 2YK1H 2HG5A 4CJ0A 4GS7B 2X7LA 4DCQB 3DX8B 1FC2D 3HE6B 5F1KC 4IOIB 2JJUA 4C4KO 3KYAA 4XWOD 1UCBH 5GRWA 2BY3A 4CUCA 4K3GA 3L9RB 4O9HL 3DO7B 2XIDA 4HUXB 3RGVC 4CRPA 4JFPA 3DX9A 5B3NA 5EWIL 2CMRL 2VWEE 3DSFH 2DL2A 4K7FA 4ZO7A 2H2SC 3O9WD 2F54A 4OZGE 2P5WB 4FMFA 5F7LB 1G7IA 1ACZA 3CSBA 3RDTA 1OSZA 2OQJB 5E2WL 5C71A 5I1KL 5CGYD 3VGDA 4NO0A 4PJEB 2BX5A 4PJFE 1OPGL 4LSTL 4PJXE 4UDUB 3V4PH 1JHKH 1YEJL 3ZHDA 3QDJE 4OCRL 1C5CH 2XG4A 4P5TB 4RGNB 4E41A 1EGJH 1ZKAA 5D1XB 2AEQL 4R6UA 3MUHL 5HI3D 4C57C 1MRDL 2XKNA 1I8LC 4NQVB 3KNBB 2FX9H 5FYLL 3F12A 3JXAA 1MLBA 5I71B 3EYFB 3QJFB 1YN6A 2MCPL 1DFBL 3O8XA 5DRNB 3WO3B 4QHKI 5HVFB 2YD3A 4ELMB 2R0ZL 5MENB 3DSNA 1JZ3A 4G80A 4NYLB 1ORQA 3OKNB 2BOCB 4AK1A 1GHFH 2DWEA 4RAUA 5GRVK 4HS3B 1ZT1B 1A8JH 2GSIB 4RMUA 5MP6L 3ARWA 3IKCB 2W60A 3H3PL 4RAVA 4LSVL 1YQVH 2JCCF 4F37F 3ETBF 2UY7A 1MCRA 3QQ4B 2ERJC 5FYJD 1LEKA 1MF2L 5EZJB 3VXOA 2FIRT 4P9MH 4HIJA 4FZ8L 3SDCD 2DTML 2VZVA 2EH7L 1RK0B 1FFQA 1NLBL 4ZPTA 4OD3H 4BKLA 1OLZA 3RGVA 3HAEA 4TPRH 2ARJB 4YUEH 5HYJD 4MHHG 5GGVY 1JN6B 5F7MC 2RCSH 1DLHA 4X6FA 1R3KB 3BI9X 3T04D 1F5WA 2WLZA 4CMHC 5DR5H 2J7LA 1WBXB 4ZUTA 3DYOA 1EVUA 1I7TB 3UMTA 3UAJD 3CMOH 3P4LA 3EGSB 4Q97A 1CF8L 4QO1A 2VISB 1JZ2A 1KJMA 2GFBB 5GZND 2R15A 4WW2B 3FB6B 3RP1A 3T1FB 1NC4D 1X7QB 5FM8A 2ILLA 5IJKC 1KIQB 3MXVH 3HNVH 4JFFE 1T5WB 4UU9A 1BBDL 3BD5A 3BEVA 3DX6B 3KPOA 2CIIA 4LCIL 5DURD 4MD5A 4J4PD 2CXGA 1I8LA 4J12A 3WIHA 2OTUA 1EAJA 3WKML 3QULB 5I1GH 2ZKHH 1W0VB 4ZS7L 2DOCA 1KFAH 4LSUH 3SY0A 3BKCH 1M6OB 3LEVH 3LEYH 3MGOA 1KCUH 3NIFE 4XNXH 5FO8A 4TSBL 4V1DE 4OIBA 3WIIH 2R4RL 2R8SL 1MFBL 3V5DA 3NCJL 1IAMA 2JIXA 4KJPC 5B4MC 2ITDA 1GGYA 1CDBA 3G6JF 1JWSB 3RWDB 8FABB 5E8EB 1FAIL 3T4YA 5KANG 4PGEA 3VGBA 2F58L 3A67H 4P9HH 2O5ZL 1RZKC 2DQDL 1GGBH 1Z3GL 2APXA 1ZS8B 1AP2B 3MV8A 1FZKA 1RUPL 4HGMA 3SKNB 3FO9A 3UTPE 3D39A 1DEEB 1Y0LB 1C5BH 3QO1A 1D5ZA 3MRKB 3BMWA 3O2DH 5HPMB 1T04B 4B50A 1QYGH 2X70A 3UEZA 2EE6A 1NCUA 3E6HB 4NCC1 2PCPA 3BPOB 4I77H 3MJ9L 3RWCA 5HYSA 3FQUA 5B8CC 1M7DA 1ZHLB 2OZ4L 3GSWB 3O41A 1T2QH 2E6QA 2NCMA 3LKSB 3SE9L 2QHRL 3HRPA 2OL3H 5IJKA 4X7TA 3FT3A 1IQWL 4PD4K 3LB6C 4J6RH 1LO0H 4XC1L 5EIIB 4AG4H 4CGTA 5C09D 4PRIE 2GUOA 1MOEA 2GTWB 4NFBA 2YKLL 4YBLC 3ARFD 3QEHA 3ULUE 2BJMH 4FFVC 1FVDB 2NR6D 5HHQB 4NHUB 2APVA 2R39A 4FFWD 2ZP0T 1UM5H 4PJDF 1NGYA 4U1IB 2H2PD 4U1SA 3RKDD 3PP3H 3LSOB 1NLDL 4Q9RL 3DGCR 3IT8D 1BJMA 3BZ4A 1SQ2N 2ADIB 2X2YA 3C08H 5HYJB 4EBQL 2NXYC 3FFDB 3RL1A 2I07A 5EUKB 1CLOL 2C26A 5FA4A 2VH5L 2PO6C 4UT6H 2F8OA 4PLNC 4ORZC 3IDXH 4OCWH 1ADQL 4FQCH 1DQML 3TT3H 2D7PA 4I2XB 5ISZA 5IMKA 1IKNC 4LASL 2L7UA 1H3PH 3BZEB 3KDMB 3MNWB 5EC2A 5C08B 2AS5M 4H20H 1EHNA 2VC2H 3D9AH 4BSWB 1YMHB 4H1LA 4JM2C 4JFYB 1MIEH 4PV9B 5SWZD 3I02B 5DURB 1IGJA 2L4OA 2QSTA 4PGZA 5BQ7A 1YEIH 4R4NC 1F4AA 3ZE1F 1H5BC 1BLNA 2A1WH 3GDBA 1R5WA 2Q6WA 5B8CA 1MQKL 4MNHA 4K9EC 1OAYL 4H5SA 4ZD3L 1ZLWH 3VJ6B 3UJIH 2RQ8A 4OB5H 1VADB 4UNUA 4JZJC 3ZDZE 5CEZE 3G5XA 2ZUQC 4WI7A 2Y36L 1OT2A 3BQUD 2HMID 1ONQA 3TNMA 1AIFA 2Q3AA 1BFSA 4S1QH 5TPWH 1K2DB 3ES6A 1XZ0A 5DZLA 2X4TA 1G6RA 3MRIB 5F44A 5IFJB 4NQDD 2IH3A 3K4ZA 4JGMA 3A6CL 4LLUB 3ESVF 3TCLB 5C6TL 3AMKA 5F7NC 5FDWA 5BS0B 4P3CL 4XP1L 1KJ3L 2G75B 4L8CA 3BKJH 4Y4FC 4JHZA 5GSRA 4WTZA 3RVXD 3QNZA 4L4VA 1WWCA 1NSNL 4F57L 5JZ7C 4LDLB 4LSPL 3VMOA 2AXFA 1RV6X 4QRRD 5JUEL 2IANE 2Z31C 3BHBA 4PJ7A 3BUYB 4YC2C 5D7KE 2PO6A 3KPRE 4E0RB 3FRUA 3L7FB 3H0TA 5D4QA 2BNQE 4YHPB 2Z93A 5JXEC 5I1JH 5FYKL 1BD2B 3QXVA 1M7IA 5GPRA 1T66D 1IKNA 3UTQA 1MELA 4NWUH 2QQLL 2ZUSA 3MRNB 4F33A 2OK0H 4JFHD 3WFDH 4BH8B 2LABA 1AR2A 4C83B 1QLEH 2X4NA 5D7JB 2XY1A 5DGQA 4R9HA 3NH7H 5T1KD 1MCNA 3FB8B 4JM2A 3MCKA 4O2EA 3QFJE 2BVOB 1U91B 1UJ3C 2Q20A 5C09B 3BOVA 3V4UH 1CD0A 5CCKL 1H5BA 1MFCL 3UC0H 5JW4M 1Z0NA 5DJZA 5C0ND 3ZLQC 4JZJA 3GSQA 3FT4A 3ARVA 1I1YB 1S7QA 3V7MA 5JNYB 4QTIL 1DDHB 3P9LA 3VFNA 3CK0L 4EVNB 3C60B 3G5ZB 4L9LB 4JEGB 5IVZA 3ULVH 1P6AB 2BNRD 5AZ2H 5EOQL 2WMPA 4RRPA 4UILL 5C3TA 4JPKH 1BVLA 4FXKA 1QBAA 4FQHB 4U7MA 3C5SA 1F90H 1YPZE 2CK0H 1MCKA 1U8NA 3RA7H 4FFZL 3MO1B 4LSQL 4KWUA 2YPKA 3HG1D 3BUTA 4M5ZH 2QTEA 4NPYB 3MLTB 4P48A 1NGQL 4PGJA 1XGRA 2Z31A 3R1GL 2W9EL 1D6EB 3EFDH 5ICZB 1DBBL 4NN7B 5JXEA 4XPAH 4DVBA 1OWRM 5T5FL 1QVOB 4HUMB 4LLWB 3CFCH 2EIZA 1UZ6F 2BZDA 1DBKH 3BAEL 4XGZA 5AUMA 2PYEA 2AP2A 3OTTA 4JVPA 4ONHB 1KPUA 2OSLA 4NN6C 4WFED 5FCUL 4Z0XB 1EUTA 1HSBB 1P7KB 4ODVH 3HZKA 1BECA 4TNWK 1KG0B 4HQQL 4GSDL 3RAJL 4XZUB 1F45A 1WITA 3ULUL 5D7IE 1F4YL 3HAEH 4KDVA 3NIGE 1AD0A 2F8VA 1T03L 3AU1B 1CLCA 1H0DB 1UJ3A 2DQFA 5IF0B 2R29H 1A6WL 2NLJA 1KTLA 5C0JA 4Z76B 1T1YA 2DDQH 1KLGB 4LHUD 4WNQA 1TQCC 4JRWA 4NQDB 5E03A 5GGTA 4GKOA 4MZ3A 4PRNB 5J56B 3DXAB 1CVSC 2BK8A 3L1OL 4F58L 1FFRA 4FQ1L 5EIVA 5KS9F 2IMMA 1A6VL 4NWTH 1C12A 3IXAA 1A4JB 1Z5LA 4ZO9A 4O2FB 1GIGH 3WIFA 4LSRH 3U2SB 2NNAB 3PQYA 4K71C 3WO4B 5D9SB 2BMKB 2HJFB 5FB8B 2HLFD 4CNIA 4KAQH 5CUSL 3DVGA 5ESQA 1E27B 4BQBA 4QRRB 4PRAA 1GRWA 4LEXH 2IBZY 4X9HA 3MLPA 4EKXA 3V0VB 3TH2T 3WIHH 1LEGA 1MJUH 4HHAA 2VXUH 4Z5RA 4OI9A 2X6MA 3CPLA 5HI4D 3CSYA 1N6QH 4D9QD 3UTTD 2EDLA 4QTHB 3D0VB 5SWQB 3HR6A 5DK0A 2IH1A 4F7MB 4XPGL 4BQCA 3QA3A 1NBYB 1OLLA 3BPLC 2CRYA 5IFAL 4R4BA 5BZWB 2YA2A 3A6BL 4LKCA 5E00A 1UJTA 2XWTB 4WEUD 1C1EH 3BVNB 3G6DH 3QI9C 3H9ZA 1FG9C 2EYRA 1RJZB 4EXKA 1QTYT 4LIQH 3ZE0E 2D9CA 2OTWA 5D7SH 3CFBB 3FMGL 1R5VA 4ZFOB 2RFXB 4P4KB 1O7SA 2X4QA 5GGVH 5I75B 4JM4L 1KEGH 4TQEL 3HZMB 1U8HB 2DQHL 3BP7B 3MFFA 3BXNA 2YOCA 4M7JL 1U93B 3O4LE 5EFIA 2R1XB 4G8IB 4YDKL 1JRHH 1HNFA 3H7BB 4M6OL 3QUZB 3BP5B 4QLRA 3L6FA 2CO7B 3CZFA 4JFED 4JREC 5CFHA 2LAGB 1ZMYA 4OTXH 5EU5A 3NAAH 3WYRA 2NY5L 3BGFB 5B21A 1S9WB 1O5DT 2R1YA 4KK6C 1TPXB 3ZKMD 1L7TL 2ATPA 1MI5B 1ES0A 5HGBB 1HHIA 3MYZA 1MFDL 2D7TL 2F74A 5DT1L 3SBWC 3HG1B 1AXIB 3G5VB 4W81A 2FL5B 2E7CA 3OKKB 4X6BA 3MQIA 3EDKA 4I0PD 5FKPA 3ARRA 4TSCL 1U3HC 3I3DA 3L3KB 1FGNL 4B0MM 3VA2C 1A3RL 1EAPB 2A74A 1NMAL 2XZAL 1I7ZA 3LKOA 2QBWA 4Y5XC 4P46B 3MLVL 4U49A 3QXDB 5I1CL 3V8OA 4I5BB 4JFDB 1FP5A 1MAMH 1ED3A 1ROWA 2IQAA 4XP5H 4QRPA 1HILA 3NPSB 2AV1B 3AB0C 2J1KA 5IWLC 4NZRH 5C0DA 4LRNH 2PW2B 3QI9A 2FR4B 4AM0B 4UZGA 3SJVE 4NQXA 3ZL4L 2XWBB 2J8UE 5L2JB 3UP1A 3TJEH 1KCKA 1ND0B 1QR1A 1UM4L 5H8DA 1OF2B 1J10A 4WFFE 1WT5C 4BSVA 1YECH 1S7UB 1X9QA 1JPFA 2H6PB 2WM0A 1SEQL 4MD4A 4PTUB 1JL8A 2Y72A 1RZKH 1KV3A 1I1AC 3O0RH 2F19L 4P2QB 2JCCA 5IR1B 5DRWA 4MGXA 4XTRC 3RPIB 2V7NA 2AJVH 5J13B 4KROC 1N26A 1YY8A 2F5BH 4UQ2A 2DQCH 2ZOLB 4HUWA 1SVZA 4H1LH 3BGMB 2O61A 4LCUA 4X8JB 5DMIH 3KPSE 3NFNB 4P2RA 2JKXA 1EDQA 5K59E 1EFQA 1KELL 2DF3A 4WEMB 5ID0B 5EU6B 3P40A 5D2NB 1XCQB 5TGBA 2WINB 4POYA 3QDGD 2HRPH 4K3DH 4M7LH 2NZ9D 4GQ9L 1I8MA 3SBWA 2Z35A 4HMDA 5DQJA 1AD9B 3IDIB 3ARUA 4XP4H 3BRDA 3VFPA 4KGLA 1S7TA 1HZHL 1U3HA 3FFCA 4PY7A 5GRJL 1TLKA 3U4BL 4NKMA 4WVRA 3VWJB 4S1RL 3MCLL 3D0LA 3RWHA 4FN0A 4X6DB 3VFVA 2Z4QA 3MNZB 1G6RH 4Y5XA 1RIUL 4M3KB 4OZFA 1IGYA 5EBLB 1ZEAH 2H26A 4AENA 4NOFA 3QUYB 3U46A 4DN4H 4NM4L 4UIKH 3SGJC 4JFOB 1JI2A 3QHTC 5I19H 5T5NG 4WHYH 5IWLA 1HKLH 2BSED 5IV2A 1UXWA 3NZHL 3EJJX 3NTCH 1CLZH 1ZT4B 2HFEA 1EV2E 3K7UA 2ZSWA 4XCCL 3VD9A 1IARB 5GGUA 4LL9A 2VWEC 1QNZL 1YYML 2LVCA 5GGQH 3S5LB 4KGJA 1U2CA 1WT5A 3C8HA 4KZEL 1J7VR 2HLAB 3GMPA 1IFHH 1LMKA 2EDBA 3V6BR 1G7MA 3QRFM 1D9KC 4G9DB 1I1AA 2OTPA 1NC2D 2PNDA 2XZCL 1N3NB 3EHBC 1BGXH 1RUAH 5C07A 1IQDB 2OI9B 3KYMB 1D5XA 1WZKA 2A9NL 1IGCL 4X4YB 4KY1L 4PJ8D 3KJ6H 4U2YA 1NCBH 5TH2A 4IMLA 4O5LH 4OGAC 5TDPA 1A6PA 4K9EH 4KHTL 4I0KA 1NFDE 1VGKA 4WENB 3VDCA 4J2XA 4OCYH 3PV7A 5H37H 1I9JL 2J4WL 2EIDA 5C0CD 3MJ9A 5HDBF 1GZPA 2XA3A 1PQZB 3TBYA 3QUML 4XHJC 4MYWB 4HJ0D 5C86A 4Y1AD 1S9XB 1CD1A 4FQLL 2BFVH 3EYSL 2BVQA 2PTUA 5DD6B 3L3HA 3BEWA 3D3VA 3SGJA 1LHZA 2NY6D 4IBLT 4R3SB 5DS8B 2QJDA 5DHVB 3EOYG 5C0BD 3LD8B 4OQ1A 5IVXF 3C8KA 1RY7B 2M26A 3AM8C 2DD8L 4WUKL 2VE6A 5A43C 1K3IA 5FEBA 1QSED 1R3JB 1X3DA 1ETZB 2QSCL 3IFNH 5D1ZD 1TJIL 2H41A 2JLLA 3O3EB 3SCMD 3SQBA 5JW5A 4XNUH 4K2UH 1YNTA 4LU5H 2NY0C 3BKMH 4K7PL 4BFGA 4XAWL 1GGIL 2AJZB 3CFKA 1A6ZB 5ESVA 1BZ9B 1IMHC 3TBSA 2VAJA 4MX7B 4KKCD 4MXVE 3F7VB 5I1EH 1KTDB 1RZFH 2E6PA 2MQ0A 1NJ9B 5LGKA 1ZLSL 5C0RL 4G8GB 5JIPA 3TNNA 1R6VA 2JB5H 3LPGA 4PJGB 1ADQA 3ZYOA 4Y4KD 1CDUA 2I60L 2VZSA 4NT6A 3TVMD 2JJSC 5L2KD 4YAQA 3LN9A 5TE4L 3ET9F 1V8HA 5DJDA 4HC1L 2ZCKH 4ETQB 1H9VA 1KCRL 4LVHC 3C9NA 2G9HB 5GGTH 1Y6MR 3QEUA 5FYJE 1BPVA 5GJSH 4LGPB 1OY3B 3DVNA 1BOGB 2Y5TB 3QCVL 4U0RB 5IM7A 1DL7L 4PJ9C 4PR5B 4HLZH 3WNKA 4DW2L 5JORA 5E5MA 1AKJA 3BMVA 3BPCB 5BZDB 5C0AB 3LPFA 4NZDA 1DQLL 4PRHA 2ICWA 1FIEA 4MLSA 4ODUA 3KPQB 4GUPB 1QEWB 2XN9E 3CFEB 5HHMB 1XR9B 2V2TB 5GISH 4H8WL 1KPRA 1FPTH 4IM8A 4ZMAT 4XCNB 1ZA6A 2YS4A 4HS6B 5DA4A 2OX5A 5B39A 1GPOL 2YEZA 3LKPB 1REIA 2NTFA 5ALBL 3I3EA 3S98A 5JXAL 4BA8A 4K94L 3IDNB 3QDMD 3AM8A 4V2CB 5D70L 4LVOC 4RBPH 3V6FA 5BOZG 2HH0H 4F7TB 4QY8A 2VUYA 4Y4HC 3LS5L 4LDEB 5IEKA 2HT2C 4DQOH 1KLUB 3AREB 1L9MA 4OM0L 3CX5J 3K1KC 1JGVH 2D7NA 1OP9A 1PVHA 3ZDYE 1G7JB 1CK0H 2GAZA 4YZFF 5J8OA 4PJ8B 4I3RH 2BSRB 3TJHC 5F9JB 3MJ7A 5CILL 1OGAE 4QRUA 5FYJU 3RWJB 4DOHB 2YRPA 5D6CA 1BAFH 3K46A 3REVB 1DBML 4OLUL 4YHML 4OLZL 2WBKA 1EFXB 3ILPA 4WO4D 4OAWA 3KLDA 4YO0A 1OOAA 2I5YH 1X6LA 1PZ5A 4G3YL 2JJSA 1OGTB 3M17A 2BVPA 4Z7VB 4NKDB 5J6GA 5C0CB 4O4YL 1NAMA 5EORL 1AGBB 3ESUF 1C7TA 2WANA 4G8FA 5DK2A 3T3ME 5DA0B 4O9HH 2V17L 3ARTA 3JTTA 2Q3ZA 3ULUC 4Y1AB 1JUFA 4L8SB 5EWIH 4JQVC 2CMRH 3DYPA 4PJ9A 4QHNB 4N90E 4PG2C 1FFNA 5E8OA 5ETUB 2IBGA 3B3IA 4ZQKA 4UAOB 3L5WA 5JDSA 2MFNA 4PJBE 3SHSA 1B0WA 4RMTA 4V1DA 1F4XL 5E8PB 5E2WH 4ZUSB 5I1KH 3EZ8A 4NQUA 2C4FU 5IESL 1QSEB 4PLJD 4IRSD 1HEZA 3O2WL 1OPGH 1X5IA 4LSTH 4PGBB 4LFHD 4XBGA 1CT8A 25C8L 4OCRH 5F6HI 35C8L 3FN9A 3QZWB 1YDPB 2AEQH 3UBXB 2VKWA 3RZCB 1ZGLB 1IZJA 1WJ3A 3JV6B 4Z7WF 4H1LG 1MRDH 4Y4HA 3E0GA 4CJ1A 4OZ4B 3MRRA 5FYLH 1SBBA 4AIZA 3MRLA 3CVIL 3IDGA 1JGLL 5H2BA 3ELAT 4TULL 4TUOB 3TVMB 2MCPH 1DFBH 2QQNL 5MEQA 2VMFA 5L2KB 3CC5A 2CLVB 3AS1A 2R0ZH 3QAZB 2LFGA 1QSVA 3PWLA 4YK4B 4YDJB 3HN3A 4ERSL 3ECBA 4KI5E 5F6IB 1CG9A 1WC7B 4ZFZB 3C2SA 5MP6H 4LSVH 1DSFL 5ANMA 5F1OB 4I4WA 1MF2H 2X4OA 1QRND 2JE8A 3IVKA 3OKLB 2YZ8A 2V5YA 4FZ8H 3CXHK 2DTMH 2EH7H 3X14A 2WP3T 3FOLB 1SYVB 2OR9L 3UPRA 4JQVA 2JK5B 5JHDB 4QXTB 4NBZB 4KKLC 4KKNA 4LCWB 3VRIA 4PG2A 5FF6A 1JZ6A 1XR8B 5F7UA 4GRLB 4LOUC 4M7LT 1TZHA 4ZSOE 1LK2A 1WUNT 4OZIE 1BX2A 3QISA 4XVJL 3WEXA 2XQYG 4LLDB 2G5BB 5FGSA 3FQRA 3VA6A 5FAAA 2EYTB 1WWAX 4EQ2A 3LKNA 4MJ5B 2J12B 5KS9A 1CF8H 4PJDB 4QOKA 4RA0C 4OI8A 2JB6A 1SJEB 1ZANL 4OZFH 5SWZE 2ATKB 3GMOA 3VI4E 1CTOA 1JPGB 4Y2DD 1WFUA 2JJWA 4MNQE 5I1LA 5ICYB 3Q3GB 4ZAKC 1XF3A 1BBDH 4YE4L 4LCIH 4KJQC 2KL6A 4EN3D 3AC0A 2B8OT 5GRYA 1OARL 2OR8A 1TTUA 5C7XL 3WKMH 1L0QA 3H9YA 6FABL 1LO4L 3V6ZA 1UACL 2R23B 3ARGC 2DIBA 5ACLA 4ZS7H 3Q5YA 4LQFL 3BD4A 1X44A 3MRCA 4X0KA 4PRPB 5B38B 5LCVL 1MHCB 2NY4C 4HGWB 3SKMA 2VSDA 1I1FA 5IQ7L 5I8CA 1DVFA 2R4RH 2R8SH 1MFBH 3NCJH 4GW4B 4GKNB 1JPSL 2ZOKA 1F02I 1LO3L 3EJYC 5DDHB 1NCCL 5KG9B 5KVEL 2CJUL 2ZUWA 4OLWL 4OFKA 5FO7A 1A22B 1XGYL 5F7WC 1AO7E 2F58H 2XPGA 3PIQA 2O5ZH 2F53D 2DQDH 1Z3GH 1FJ1A 4NP4L 3EOAA 1RUPH 4FQ2L 3STZA 1WBYB 1CGYA 1IJ9A 5GHWL 3MNVA 3VFUB 2MHAA 1G7QB 2CKNA 5FDYA 1CGSL 2C3XA 2FWOA 4G6AD 4RGOL 3VXPB 3MJ9H 2IANA 3WNLA 3I50L 4R8WL 5T3XE 1CD9B 1PG7L 3KPRA 2ADJB 3U7YL 1Z9LA 5J3HC 3ARDD 3RWFA 1J8HD 1CGTA 3SE9H 2QHRH 2VLKA 4HKJB 1WIUA 1IQWH 5IK3A 3HB3D 2NZIA 1KB5L 1NBZB 2P43B 3IDYB 5E0QA 3LY6A 1AR1D 3I6GA 4ZXBB 1VFBA 3U4AA 2YKLH 4QWWC 3RU8L 4OCLC 3S35X 1W0WB 3S5LG 4ZTPH 1RJLB 5LQBL 1BJ1H 3PHQB 3N1QC 3ARGA 1N8ZA 2QLVB 1MCHA 1J18A 4PJAF 5FECA 4Z77B 1QRNB 5CWSB 2F54D 1EJ6A 5KVGL 2YC1A 1UZ8A 3PHOB 5DJCA 1NLDH 4LNVA 4Q9RH 5DJ8A 2BNRE 1A6UH 2V2WA 3WUZA 1OB1B 3O6FB 4KTYA 2GJ6A 4EBQH 1UKQA 4U3CA 4OLXH 3I85A 1NGZB 4TTDD 1CLOH 1T4KB 4IJ3B 4KK9D 2VH5H 4FFYL 2DKSA 4YR6A 2YSSB 1MEXH 3IJSB 4PV8A 3IS1X 2PTTA 4WU5B 2ADFL 1ADQH 1DQMH 4E41D 4JR9L 3ULVD 3TPUA 5E8NB 4WW1A 4LASH 3C6LD 5D2LF 1LP9F 4N9GB 4DUVA 3QIBC 3LV3B 2H3NB 2A77L 1I75A 4PB0H 4HKXA 2Q86B 5HYIA 4GKZB 4Y2DB 2N1KA 5KTEL 3RJQB 1NMCB 2KZ1B 1T6VN 1L9NA 1I7RB 4EN3B 4MDJA 1S5HA 5HVHB 4PJIE 3D85B 5MI0B 1D5IL 2DQIL 3HI1A 3SDYL 3RL2B 1MQKH 4TUJB 1NEZA 4BH7B 1C16A 4ZD3H 2A6KA 1PKQB 3FN0L 5HDQL 1CFVL 2X42A 4RGMB 4EEEA 1PGRB 2NW2B 5F7HA 5D5MF 2Y36H 1VKXB 3O81A 2NX5A 1TTFA 2UVEA 4GMTL 4M1CC 2VSCA 3KPNA 1IM3A 3RGVD 3G08A 4OLYL 1EVTC 5EO0B 1KJ2L 5CSZB 2DLFL 4RNRB 2P7TA 4GAJL 2X4RA 3OKMB 3SDXF 1OCWH 1GCFA 3LVEA 3P3YA 5E9DE 2H2SD 3A6CH 1Y18B 4TNVK 2IBBA 4LQ1A 1MCEA 4P3CH 4XP1H 1ZLVK 1WK0A 3OR7B 4NQEE 4P0DA 4OIIL 1HWGB 2ICWI 4F57H 4LSPH 2X9XA 3U4EA 4D2NA 4NC1E 5JUEH 1RJYA 4OM1L 3FOMB 3UTTE 5C8JA 5FYKH 2IJ0C 1GH7A 1I9RL 1Z0MA 2Q7NA 4Z7OF 3IETA 3W5MA 2X1PA 2ED9A 3SO3C 1K4CB 3E2HC 1ZK9A 3KPPA 4QHKJ 3OMZA 1NAMH 3PDOB 1DE4A 4N0UA 3GFUA 3KLAA 2QQLH 1EZVX 4L8BA 5B22A 1Q94B 3QIBA 3FQXA 1UG9A 2ZZUT 4I18C 3ARDB 3K80A 2LAAA 1V3LA 3BDBA 4J1UB 4F3FA 5EBWA 3RRQA 1FH5L 2HFTA 2NY1B 4OF5A 5HXMA 5CCKH 1JVKA 1MFCH 3QEQB 4IOFC 4J3OC 1NEUA 4RWHA 3QJHB 5HGDA 2D0HA 4PG9B 2DTSA 4PJFF 5I73B 4PJXF 1FYTA 4I0CC 2JIXD 5DEFA 4M5YL 4QTIH 1MCWM 2NTSP 4JFEE 3CK0H 3LN4B 5DTFA 1I1RA 4ONGL 5EZOL 1ZLUH 3ZKQD 1OSZB 1FAKT 4S1DC 3TBVB 2DYPB 4LPUA 1LE9A 3STBA 3QUXC 5EOQH 4QGTA 4UILH 3LDBB 3O4LA 4H8WC 4DGIL 5IW6B 2W07A 3MV8D 4J8RA 4CU6A 1NMBL 3D39D 7FABL 1ZWIB 4OF7A 2DQEH 3RWEA 5FKAA 4MJIB 4WUUB 4FFZH 5FXCH 3VRLE 2UYLA 3FRPA 4OF0A 5TJWK 4MQTB 4MJ6A 5IVXA 4K94C 4F8QA 1NGQH 4MNGA 3C6LB 1AC6A 1N59A 4I48B 4F2MB 3C6SA 4PUBL 3VXSB 5I9QB 3GMRB 1DQJB 2H32A 3R1GH 1NQBA 2W9EH 5T3XL 4L3EB 4WCYL 3NABL 1DBBH 5EPMA 5GSVA 5T5FH 4R2GB 1JWUB 3X12A 1IAOB 1EO7A 5DYOA 3MUGB 4CMMB 5FCUH 3PP4L 2WBWB 3GMQB 4HQQH 4I18A 4GSDH 4QHLB 3RAJH 3ULUH 1F4YH 2FIKB 3QP3A 1T03H 5FGCB 1WFNA 4LVNC 4JFXB 4OLVL 5C0EB 1A6WH 1JFQL 2VO5A 2E27H 4HC1A 1I3UA 5SX4H 1DEDA 1U3JA 2HWZL 5DHYB 3MFGB 3HAEB 5F8QC 1SJHB 1FBIL 4Z7UF 3WHE0 5CIPA 3L1OH 4F58H 4FQ1H 5DJ0A 1A6VH 5KAQF 4KJPD 3BE1L 3ZTNL 3UBXG 5ICXA 3WE6B 2AXGA 2OXHA 3QXWA 4XVSL 5CUSH 5ISZD 4NQSA 3VGAB 3HUJE 4UBDD 4MCYA 3QUXA 3QDGE 5T1LB 1T7WA 4ZOCA 3M1BA 3PUCA 1KJMB 3L3DA 2D3VA 5CBEA 2CRMA 1IRAY 2ARWA 3U48A 1J0HA 2VAAA 2VDQL 3VFRA 4EOWH 4JO3L 5DVNA 2LTQC 3NVQA 4CN4A 4FTVD 5K33A 5SX4I 4GXUM 3VWKC 4LLYA 4NN5C 4H88L 5IFAH 4QGYA 3QG6A 5GS1C 1OTUD 3A6BH 3WV0A 3ZSTA 43CAA 4Y19B 2X1QA 2WZPD 2ZPKL 1FVCB 5HGAB 3LB6D 3V5KB 3F8UB 2WBJC 4HWZA 3ARZA 2E9JA 1FDLL 1YC8A 3L3JB 3KPMB 1CCZA 3TA3C 3FMGH 3VXRA 1TTGA 5DJ6B 1ZHKB 2DB8A 3EFFB 3Q0HA 4JM4H 4TQEH 1OT1A 4KZDL 2DQHH 4PJCE 1J05B 3RZWA 5CEXA 4M7JH 2YRLA 3PL6B 4AQOA 3MOBL 2FH6A 4YPJA 1MHHA 1PEWA 1VHPA 2AQ3A 3MRMB 3EOTL 4YDKH 5KSAB 1PYWA 1UKTA 2AK4A 3OKOA 4M6OH 2IFGA 1C08B 1QBBA 4PGEB 4WJ5B 3T2QA 1FZMA 4ZYKB 2NXYD 3QXUA 1OQOA 4NRXB 4PBVC 5E7FA 4OZHF 2ICES 3G6AB 2PO6D 4Q74A 3ZT6A 5LAXB 2VQ1A 4OCSL 2D7TH 3LN5A 5DT1H 4XC3L 4WU7B 1QO3A 3H9HA 4HZLA 3MUZ1 3JV5A 4F7CB 5D7LB 1INEL 4TSCH 4R96A 1KN2L 1I1CA 5I8EA 5HYSB 1FGNH 2NW3A 1A3RH 3QH3A 5BXFB 1NMAH 1KCSH 3GSNL 2XZAH 4XNZC 3VXMB 3MLVH 1NBQA 5B38G 4JM2D 3VRJA 8CGTA 5I1CH 4PJ5B 4X4ME 1Q9KB 2BVEA 2P5EB 3VWKA 4HXAL 5BRZB 1DANT 3VMNA 5GS1A 4JO1H 4R4ND 3VW3L 4Z7WA 2C1OA 5JOFB 1XGUB 3P4OB 5EUOE 3ZDXF 5DJYA 1E4WL 3RY4A 4EUPA 2HYMA 3ZL4H 4HV8B 1J5OL 3GSVB 1YMME 1U8OA 1NGYB 1T1XA 2WBJA 3GSOB 1UM4H 3TA3A 4D0DA 4U2ZA 4EI6B 3CDCA 4CVUA 1K4DA 5CP7A 5LVEA 5IW1B 2B1AL 3BP4A 1AHWB 1P84K 5B39G 4KC3B 1SEQH 4K55A 5LGHL 2QKIB 4QRTA 3IDMA 2F19H 5FA4B 1HIML 3CU7A 1LVEA 4YHNA 3CSPA 5CS7A 1Z9OA 1HCVA 2WNGA 3L7EA 4MCZB 4Y4FD 1I9EA 2I26N 2VZUA 3WUWB 43C9A 3MV7B 5JZ7D 3QWOA 1FFPA 1DJSA 3F5WB 1UWEL 2Z31D 1TNNA 2ADGB 5GS3A 4M03A 1LEIA 1BFOB 3OXSA 4D9RE 2EDHA 5CJOL 1IEBB 4B41A 1OP5K 5JXED 2I9TB 5F9WC 1H8OA 1P7HL 1HH9A 3LQZA 2BXZA 4M43L 3B6SB 4FTVB 2PYED 2CUMA 1HZHH 1WFOA 2ICEA 3RUGF 3LIZL 1P4BH 3D5OF 3H9SA 5GRJH 3U4BH 3DIFA 5B8CB 4S1RH 3B2UC 3MCLH 2OYPA 4QYOA 3REWB 5JLZA 1RIUH 3OHXA 4DTGL 3HLAA 3MRGB 2H1PL 4LPTA 2OJEA 3G5XB 3HE7C 3VXTA 3VFTA 3X13B 5FA3B 1TVHB 1JV5A 1IT9L 3EUUA 5HYQB 3KGRA 1S7XA 5DSCA 3TN0C 4NM4H 3RIAK 4ODSL 5DMYA 2F9BT 5F7DA 4YXKL 1L0YA 3O3BB 4DEPC 3NZHH 1KN4L 2FD6L 2NY3C 5TDOB 3CSGA 1CGUA 4XCCH 4NO2A 3OG4B 3WFEL 1QLFB 3EYOA 1QNZH 2XNAB 3MJGX 1N5AB 1YYMH 4JCMA 4OV6F 1FSKC 4HH9B 2VLMD 1F11A 5DEGA 4GG6E 3VH8B 2FDBP 3QDME 4QKXB 4KZEH 4CDGC 3VD7A 5CJBA 1W8NA 2BC4A 4AY0A 4ZFGL 2XN9A 4U7SA 5I2IA 2MCG1 1XH3A 5I18L 3M8OL 2BSTA 4JQIL 3QIWD 4XRCB 3OKYA 3RVWC 5BV7L 2XZCH 3HS0B 4FNLL 1SYSB 4FABL 3GZKA 2I9LA 5FV2A 3BIKA 3HPJB 4H26A 2L7JA 2APBA 4PJHF 2WIIA 1A6AB 1FZJA 1M7IB 3J8F7 2PF6A 2Y23A 3I6KB 2Q7YB 5C0GA 3F7RA 4JDVB 2A9NH 1IGCH 5F89A 4ENEC 4KY1H 3WFHA 2RGSA 1CICC 2CSPA 2E9BA 5DJXA 4RIRB 5IQ9B 5E4EB 4KHTH 5E6IC 4DJMA 5E1AB 2G2RA 3S8WA 3VFMB 3PV6B 3T0EB 3HZYA 3VI3E 1A1NB 5JPMB 1I9JH 2J4WH 1OGAA 3T0VA 4AMKL 3T0XA 5IB5B 3LQAL 3IXTA 3FTGA 4KI5C 2GJZA 3QUMH 3EKCA 1AXTH 3EO9L 3GIZH 2I24N 3OBAA 4FOMA 1I4FB 3HE7A 2EDJA 3WHXA 3P77A 3NA4A 4FQLH 1S7QB 1KXQE 2FBJL 1W8OA 3EYSH 1KB5A 3IFOA 5AWNL 3EYQC 3TN0A 2W92A 1HXYB 4NO5A 5DGRA 2CXKA 3MLYL 1Q9OA 3P0YL 1JHTB 1MNUL 1T0NB 4MQ7A 5I30L 2DD8H 4WUKH 2OM5A 2P48B 4BUHA 5HGHB 2H32H 3EO0B 1H3GA 4PJAA 2QSCH 1ZVHA 1TJIH 1U8NB 5KSVA 3V79C 3H6JA 4Y4FB 1OP3H 5TFSL 4K7PH 2CR3A 4GRWH 3IGAB 4XAWH 2VKXA 1GGIH 4U1NB 5MENE 4G42B 2OXGA 4R4FL 5HHNA 3U6RB 2R2HB 4JG1L 5DRXA 1HHGB 4R26L 1VACA 5I1AB 3FN3A 2HN7A 1KB9J 1ZLSH 2HJKA 4F7EA 5C0RH 1OAXL 5BJTA 2UY6A 1XEDA 4JLRA 1FG2A 1U92A 3MOAL 2I60H 4GBXC 4LK4A 3UJJL 4YPGB 1CFTA 5TE4H 1TETL 4QRPD 4HC1H 4FMKA 5D2LA 2R0LL 5HHOA 1KCRH 1AQDB 4PD4J 1KNOB 4PGCB 2R2BB 2YK1L 5FYLD 1KCVL 3QI9D 4HAGA 1HINL 1NGXA 3EYUL 4GG8A 3SE8L 5IGXL 4XAKD 5CIPH 3CFDB 4YXHL 2HTKD 3I6LD 3QCVH 3DI3B 1DL7H 1DUZA 4DW2H 1QQDA 3UTSA 3OX8A 2A2QT 1CVRA 4X6CE 5F21B 1DQLH 2GYSA 4WNQB 5EOCJ 1X5XA 3G5YA 4NM8L 1II4E 4H8WH 4MVBC 1D7FA 3KYOB 1IGTA 4XMKL 4JPIA 5D5MA 1B4JL 4LRIC 4X8XA 1ERNA 2ZNXA 3WD5L 4GW1A 2XWJB 1GPOH 1FYHB 1GVIA 4OIAA 5ALBH 2K7PA 3BT2L 5JXAH 3DUHA 1U95A 4K94H 1PY9A 3V4PL 1KJ2A 5D70H 4P2RD 2Z92A 3QIWB 1IM9B 1U8IB 1AGDB 4KK6D 1FN4B 2HRLA 3GJFK 3CPLB 1RUQL 3LS5H 4JRYE 3HPLA 1UA6L 2P45B 5CLTA 4OM0H 4ZSOA 5I16A 4OZIA 1VFMA 4IIQC 5HJ3B 5CHNA 5IMMA 4XBEL 3FFCD 5CILH 4ISVA 3P73A 5E00B 1KUMA 1DBMH 4OLUH 4YGVA 4YHMH 1NGWB 4OLZH 4F9LC 5EZLB 4NUJB 2MPAL 2WSKA 3V0WL 2BNUB 4G6FD 5IB3A 2EDDA 4G3YH 2FX8L 4NN6B 3O6MH 1DUYA 5F3HB 3EDJA 4O4YH 4F8TA 5EORH 1YA5A 4P2OC 4NHCL 2ITCB 5E2JA 3RWGA 4P4RA 2V17H 4P5KB 1R5IA 1CL7L 4WWKC 4ZPVB 1KIPA 1KXVC 4P5MB 5GGRY 4KH2A 3DRQB 1Q9WB 4FQXB 2QADB 4TVSa 1S7VA 3RX5A 2CD0A 3N0PB 2F53E 3VXUA 1F4XH 2XFXA 1I8IA 5IESH 1I1AD 4MMXC 3O2WH 3TO4C 4R97C 1CFNA 2NY7H 3M45A 4LRIA 4XTRD 4HKZA 3MSPA 25C8H 2VLRA 4KROD 5C07D 2A6JB 35C8H 2F74B 3RNQA 4KTDL 1H3TA 4LKXB 4IEFB 1G84A 1AO7A 1HHJA 3MYJB 4BYHA 3QQ9C 1QP1A 2GW5A 5K93A 1J8HE 1KPVA 5A16B 2FLBT 1S9YA 3VXQB 5KW9L 4NBYB 1JGLH 5JMOC 4ODWB 4EUPH 5IB2B 2YMXL 4LLQB 1TVBA 3QNXB 2AKRA 3DV4B 4IIQA 4TULH 5FUZH 1NEZG 1G7HA 2QQNH 3JUZA 4BFBD 4G43B 5HTSA 4HDIA 1JNHB 1QPPA 3RIFK 1BIIB 3DX7A 4YFLI 1TZGL 3V5HB 1A3LL 1G6VK 5D72L 4ERSH 5C0FA 4HLJA 5C9KA 4L4TA 4HUKB 4PJEF 1UGNA 4F9LA 1F4HA 4Y88A 3UPCA 2F54E 4HGKC 4YHYB 4Q7DA 4Z7NE 1JP5A 4U6XA 1HE7A 1DSFH 3MV01 5BVJB 2RR3A 3D3VD 2B5IB 2RHEA 4GO6B 2LU7A 5EIQA 3QYCA 4P2OA 1CFQB 1QFWM 4JANB 3PDGA 3F7YB 3IFPB 4AT6B 4M48L 1AGFB 5EG6C 2OR9H 3V0AC 5IBLC 2VQUA 4WWKA 3SQOL 2HAZA 4GAYB 2DICA 3W82A 3MLRL 2W0LA 5ENWA 4E41E 2VLJA 2DKMA 1TENA 4ELMF 5TDNA 3TT1L 1W72B 4XVJH 1D9KD 3I75B 1GAFL 1KJVA 1HDMB 3PGCB 3VG9C 1M05B 4N8PA 5HGGS 3FT2B 4Z7UA 3K2MC 3QUKA 3TO4A 1C5BL 3BIAX 4JDTL 5CLWA 4OBRA 3W9DB 4JRXA 2CK2A 4FQQA 2EZ0C 3V52L 1S7TB 3ZKXC 4NKMB 1QLRB 2J3SA 3N9GL 4OGAD 3IJHA 1P7QA 3HCVA 1OARH 4WI6A 5CJ5A 3LEXB 1MCQA 4P57B 1LO4H 5BW7C 1UB6A 1UACH 3Q2CA 1JK8A 1NKRA 1CI5A 1IEAA 4LQFH 3AB0B 3WL9B 4PRHD 3O4OC 3VD4A 5T1MA 2XTJB 2YUXA 1LP9B 5LCVH 1AI1L 1J0IA 1P4LA 5MEOA 3C87A 4G9FB 1UM5L 5IQ7H 2ZSWB 5JQ6L 1OM3L 4X5WB 4M93B 1MRCL 1IAIM 5H35B 3WUWG 1JPSH 1X5GA 1XGQB 4YHIB 1BD2E 5C0IB 5KN5B 1CLYL 3W9EA 1KT2B 4EI5C 3DGGA 2VDPL 5HPOA 5KVEH 1JTOA 4OLWH 3QXAA 4PGDB 5J4MA 3MBXL 4EDXA 1XGYH 5EC1B 4JZOB 2ZCLH 3FRPG 4MLIA 4C55A 1A2YB 5E9DA 3HFML 2FB4L 4NP4H 1MCBA 5GGSY 1VPOL 4FQ2H 3MBEC 2BVUA 4KROB 5GHWH 2NY0D 3IS0X 3PJSA 3FO1B 5I74B 4DFHA 3WLBB 5JA9A 4NQEA 1CGSH 3ARSA 4POUB 5I1DB 2J88L 3L5HA 4RGOH 4DKDC 3MA9L 3SDXB 4DUXA 3I50H 4R8WH 4OZHA 5CEYB 1PG7H 4JJ5A 3AS2A 3U7YH 1VGKB 4HAFA 5FYKD 2P8MA 4HUUB 4R7NA 2FJFB 4JFFD 1KB5H 4M8QA 4N8VB 2A1WL 4R7DB 4M9OA 2C1PB 4TYUA 2YBRA 1JF1B 3ORJA 2K1MA 5IW3A 3U36A 3PHSA 2OMBA 1QFOA 1MLCB 4M8VA 3RU8H 1S78C 3GSNA 2X44D 2Y5EA 5BW7A 5LQBH 4XMLL 3HC3L 5EBGA 4W6WB 4PJ9D 1QHOA 5K9OA 3O3AB 3QWRA 3GJFH 2HFFA 1NCNA 5KVGH 1HOCA 2YD1A 4G5ZH 3RI5K 1WWWX 1BMGA 4JAMA 3GSUB 4V1DD 5FUCE 4Y5YB 3FB7B 2AXHA 3MV8E 3TZVB 1UCTA 3D39E 1MIML 1T22B 4YNYA 4OZGB 3BDYL 2RJMA 3PABA 1EEYA 1A7OL 4FFYH 2M8XA 4EI5A 1E28A 4XVTL 2IQ9H 5IJVB 3RNKB 5F1NB 1D9KB 5ESVB 2ADFH 2M2DA 4HW6A 4JR9H 3BRFA 4LCCB 4HIIB 5KSUB 4PJFB 4X6EA 4PJXB 4G8EA 1X4ZA 3MBEA 4FQIL 5BV7C 2HT2D 4LMQI 3QDJB 2A77H 3NN8B 5CKGA 1YY9C 4HULB 2NY2B 5KTEH 3J7HA 4AH2B 3UTZB 4UINH 3TJHD 4XXDA 5SWSB 1XGPB 2D7QA 1D5IH 2DQIH 3SDYH 3DXAE 1ZVSB 5CBAB 2EXYC 2CLRA 1J11A 1XIWC 2PR4L 3FN0H 2L0DA 5HDQH 3P0GB 4FHBD 3IJYA 5E5MB 5F7EL 1RU9L 3OG6B 4MA8L 3UC0L 1V3JA 3D25A 3RUGA 5JW4N 1CBVL 3TBTB 3EOBA 5AD0B 4GMTH 4LLMA 2P8LB 4LGRB 1P1ZB 4NGHL 3VDBA 1TNMA 3LQAC 3OXRA 3ULUD 2G60L 2GSGB 3UJTL 1KJ2H 4M62L 2DLFH 4GAJH 1R24B 1VEPA 3IF1B 5E95B 2VDRL 1MCPL 3TFKC 2IPUG 3CDGB 2YEZB 5F6HJ 4HFWA 1SHMA 2Z91A 4ZUVB 5GGRB 3WKNA 4RMQA 4OIIH 4RFNC 2D31B 3W0WA 4Q9CA 3DBXA 5HHPB 4QOKD 3MROA 2YUZA 1T3FA 32C2A 1K8DA 1W2KT 2VL5A 3S36L 1I9RH 2CDGB 4YFDB 4Y16A 3K81A 3TP4A 4HG4K 1T7ZA 4KK5C 4U1HA 3QG7L 4QRUB 3O2VL 1QOKA 1BZ7A 5D6CB 3ILQD 1YEHL 1A9EA 1QKZL 4GAFB 4ZDHB 1IGIL 1JE6A 3PWVB 4OF8A 3VCLB 2GCYB 2GK0B 1NCWL 3Q6FA 4PJHA 3MRHA 4JFFB 5J11C 2BERA 3LKQA 4A6YL 5J6GB 1FH5H 4U3HA 4CVXA 12E8L 5TF1L 1FFOB 4G8FB 3PWJA 4KXZH 1J1OL 5LWYL 1T5XA 1Q8MA 3GB7B 3GJEB 1XIWA 3G9VA 1QA9A 3S96B 1B0GB 1UXSA 2C3GA 1JHLL 3T8XA 4N1HB 4M5YH 3MUY1 4L4VE 1EZVY 3EDDA 4ONGH 3T0WA 5EZOH 3PWPA 4PJ7E 1KGCD 1VEOA 4NDMB 3RHWF 3E6FB 4KKLD 2AJXL 4XBGB 4DGIH 4LSRL 3DMMC 4LOUD 2H8PB 1NMBH 2Y4SA 7FABH 5BO1H 5ESAA 2SEBA 4M7ZC 4CBPA 2V2XB 1U3ZA 2GT9B 1DN0A 3WIHL 3KJ4B 2A83B 4KXZI 2A0LC 3DPBA 4PUBH 1T1WB 1VFUA 2IAND 2W9LA 1XF2A 5T3XH 5D7KD 3KPRD 3OJDB 4P23D 4WCYH 3NABH 1AGCB 2VLLA 3MRLB 2BNQD 5E1HB 1N0XL 2AV7B 2W91A 4ZAKD 1F4WL 4W4OC 4KJQD 5EULV 3GIVA 3PP4H 5FOBA 4PYHA 4BFIB 4C56B 3PGDB 1AGEA 1XAUA 1P2CB 5C3LD 3S88L 4AJ0A 1CE6B 1M71B 5J12C 3ARGD 4S10A 3CJJA 1GGTA 5GGVL 5ACMA 3UXFA 3AFLA 4PRIB 4OLVH 1J0KA 1G7LB 4JHWL 1IGML 2HWZH 1S9KC 1FL3A 2NY4D 3T77A 5E8DL 1EXUA 5EU3A 5EUOA 1I3RA 2IADA 2IPKB 4ZOEA 1FBIH 2GJ6D 1JRHL 4MXWL 1C7SA 1J9CT 4RMSA 3VRIB 3KWWB 1QD0A 1YMMA 4QHMB 1OHQA 2XICA 3BE1H 1BBJA 1FNGA 3EJYD 3ZTNH 3WDIA 3MRJA 3C5ZB 4DZBA 3MV9B 1T20A 2NPLX 2Q1EA 4IDLA 4N8CL 2K7QA 4KPHL 5IIEA 2FSEB 4XVSH 1RPQA 2YPLA 1XGTA 2KDGA 4Y8AA 5HYFA 3W39B 3ZMRA 1LDSA 3DMMA 4NJAH 3HNTL 1FCCA 5J6HB 5D71L 5GGSB 4GS7C 2VDQH 5AYQA 4KRPC 4DFIA 4FG6C 4JO3H 3HE6C 2ZSVA 3RJDA 4GKSA 4IMKC 3L3IB 3GHBL 4NZUL 3ROOB 1HH6A 3D2UA 5J3HD 1FZOA 5IB1B 2ZPKH 5CD3A 1LE5A 1IL1A 5F7FA 4OGZA 5FK9A 3F58L 3U9UB 3TO2A 1MAKA 5KSBF 3WNPA 1JPST 3OGCB 4W4OA 5IG7A 2FZ3B 3T2OA 1FDLH 3GUTA 4MDIB 4QWWD 4KZDH 1T0PB 4MD0B 2XOTA 2N7BA 3DURB 1RD6A 4WHTB 4XMPH 4J3UA 4YX2L 2VLME 3C8DA 4PREB 3PQYE 3MOBH 3GNML 2OCFD 2OJZH 1HWHB 3EOTH 2C4FT 1B3JA 4JFQA 1BP3B 2VR9A 3LPWA 2BOBA 4IS6A 4P5TC 5LXGL 4RGNC 3OR6B 5EH1A 2ESVA 1RZ7L 3GBML 3PIQB 4HIHB 4XPFH 1FL5A 4JDZA 3V7AG 3V9FA 1UVQB 2GTZA 1BJ1J 2DQCL 5I71C 1RZGB 1HQRA 5EB9A 4LPVA 4U6VL 4OCSH 5F7KC 4XC3H 3UYRL 3MRFA 1WZ1L 4ZFOL 1U9KA 1UEMA 3IU3B 4NUGL 4NSKA 4ELKA 1JZ7A 1INEH 1GSMA 2IANB 2WAHA 1KN2H 2W0FA 3T65B 2V7HA 3KPRB 3QIBD 4P23B 4XH2B 1EIBA 3GSNH 2BNQB 5KOMC 2OS7A 3KXFB 3HNSL 1A7BA 4DCQA 5ACZB 3DX8A 4ZAKB 5E08L 1RVFL 3HE6A 3THML 4IOIA 4HXAH 4IMKA 3VW3H 3L9RA 2ID5A 3LHPH 3DO7A 3KYNA 4HUXA 2AABL 3SDDB 1T6WA 4Z6AT 4X9IA 4QXGH 3BH8B 1E4WH 4E42B 4J7RA 3QFJB 1J5OH 2EDNA 3B9KC 4MA7L 2P5WA 1F6AB 4XPHL 4MWFB 2X4PB 3ARPA 5K9KA 4M1CD 1CYGA 5DJ8B 5EBMB 2OQJA 2B1AH 3I9GL 4OV5B 3OWEA 2ICWJ 4KDTA 4PJEA 1T2JA 2EEDA 5LGHH 2EDKA 2EKSB 4UDUA 2R4SL 3O4LD 2VXSL 1HIMH 1PD6A 3VFOB 2V5TA 3FO2B 4WW2C 1NBVL 5TQ0L 4P5TA 1KSRA 5D1XA 5GRUL 1VFOA 1BVKB 3LKRB 3VXNB 4MA3B 4NQVA 1MPAL 1UWEH 3KNBA 3OAUL 1EJOL 5DFTA 1WZLA 4RZCB 1L4IA 3RI5F 3EYFA 1UB5B 4N8VG 5DRZB 5CJOH 1YPZB 4D0BB 3QJFA 4HT1L 4LLVB 5TE7L 2FJGB 4APQB 4I8DA 4K3EH 1GC1L 5DRNA 4M43H 4ELMA 2D2OA 4JKWA 4MHHI 1A1OB 4QRPE 2X1OA 5MENA 4ONFL 3WXVH 1F97A 3SEPA 3CCHB 4NYLA 3NCYP 3OKNA 1Z6JT 3HI1B 2BOCA 1T21B 1MCCA 5HHME 4S2SB 4XAKE 4HS3A 1ZT1A 2A6KB 2GSIA 3BP6B 3IKCA 5J89A 4QRQB 3WDJA 3BO8B 3QQ4A 4DTGH 2H1PH 3NGBB 3OB8A 5EZJA 4TTGA 3OKEB 2AGJL 1IT9H 4YH6A 3B9VA 4WI4A 4LPWA 3TESA 1MVUB 1RK0A 4ODSH 3ZE2F 4IOFD 5M94B 4YXKH 1BFTA 5GS0L 4RISH 1CR9L 5D7IB 1KN4H 2ARJA 2FD6H 1HI6B 1TMCB 2P8PB 1QFUL 2JCCE 1JN6A 2P7TB 2X4RB 3SJVD 5DMKB 1R3KA 3B9KA 3WFEH 1NFIB 4NKOB 3D69B 1S7RB 4WFFD 2ORBH 3QCTH 1I7TA 4XNYL 1JYXA 3O3DB 4P2RE 4S1DD 1LNUB 4ZFGH 4NNPL 2EDXA 4DOHE 3BPOC 3EGSA 3H8NA 3MOQA 4X6DF 3QUXD 2VXVL 3M8OH 2VISA 4JQIH 2GFBA 3MR9B 4FABH 5LGJB 4WW2A 3FB6A 2C5DC 2Q8BL 3T1FA 1X7QA 5DI8B 2CDFB 2IMNA 1KIQA 1MSPA 3T1WA 1T5WA 3WFBL 4AIOA 3P11L 3DX6A 3PWNB 4NNXA 4OCNC 3UYPA 4L3CB 5IKCB 1INQB 1J8KA 2AAVA 3QULA 5KANI 5DWUL 2KBGA 1W0VA 1KENL 2QQQA 5I76B 1M6OA 2APWA 2B20A 4H25B 3VXRD 1EO8L 5L0QC 5EO1B 1BQLL 4AMKH 1RZIB 3LQAH 4D3CL 3BJ91 3EO9H 1RMFL 1UADC 2MMXA 4JO4L 5IVOA 3QXTA 3TLRA 2FBJH 1JWSA 3RWDA 3BSZH 8FABA 2ZG2A 5AWNH 3MXWL 5E8EA 1V7NL 2AK4D 3RDTC 3ZSSA 2VITB 5F93C 3QUMB 2XACC 3MLYH 3P0YH 1V5JA 1ZS8A 5I30H 1AP2A 2EE9A 3SKNA 1DEEA 1Y0LA 3G6JE 4Q0XL 5C07E 3FHAA 3RWEB 4OGYL 4M7KL 3MRKA 3HC4L 1GL4B 5HPMA 1T04A 1OAUL 1UFUA 5TFSH 2UYLB 4OSUL 5KAQG 1CXEA 3IAPA 1MH5B 3E6HA 4R4FH 5HI5C 3E8UL 3PP3K 2HJLB 2GITB 3C2AL 4JG1H 2PYFB 4OFPA 1ZHLA 3WN5B 3GSWA 2CPCA 1CDHA 1HSAB 4R26H 4PRBB 4KHXL 4RFOL 3LKSA 1N2RB 1TJHL 1H8SA 1OAXH 4YDIL 3SO3B 5EIIA 1R3HB 4KJYB 3MOAH 1VFAB 3BW9B 3UJJH 2UWEF 3VWKD 4D8PB 2GTWA 4U1KB 2FO4B 2QL1A 1TETH 2WWKT 4IRJB 2IG2L 2R0LH 1FVDA 5HHQA 1KCVH 4NHUA 4DK3A 1HINH 3EYUH 1U8QB 3SE8H 5IGXH 4YBHA 4L29B 1VESA 4YXHH 3D3VE 4OD2B 5J0BA 4DK6A 2PW1B 1H15A 2WBJD 3CDYA 5E99L 3C5JB 3LSOA 1D5BB 1AJ7L 2ADIA 5HYJA 4NM8H 1U6AL 2QQKL 3FFDA 3SJVB 5EUKA 1E4KC 2J8UB 3RTQB 1LO2L 1RHHB 4XMKH 5ABDE 1QSFB 4LSSL 1ZLWK 1Q9LB 1B4JH 1H3VA 4PJGF 5F8RC 3WD5H 4I2XA 5I8OL 3BT2H 1ZT7B 4GLRH 3AUVA 2XY2A 3BZEA 3KDMA 3MNWA 3BGAA 3MLWL 5C08A 3KLSA 5D7JC 1K9TA 4JB9H 1RUQH 4BSWA 1YMHA 3RY5A 1UA6H 3WCYA 1L7IL 2N4IA 4JFYA 4PV9A 3I02A 3JVGC 4XBEH 3KPSB 2IC2A 2FEDC 3OKDB 1WSST 4PRPE 3OPZL 3X11B 5IHUL 3H9SD 4FXLA 5LJYH 3VJ6A 2C3VB 3STLB 4Q6IB 1VADA 1A21A 2G5RA 4GXVH 1GGCL 2MPAH 1IZKA 3V0WH 3CFJB 2H2PC 4PRHE 3DTXB 2FX8H 3RKDC 2CKBB 3GMLB 1K2DA 2DIAA 3C60C 5FUOL 4L9LC 1SMAA 3BIBX 1DANU 3MRIA 5IFJA 4HX1B 4GLRI 4NHCH 3RVVC 5M7QA 1ZSDB 4LLUA 4TVPE 1CL7H 3TCLA 4A6YA 5BS0A 5DUBB 3QIUB 2G75A 1ORSB 3FAXA 4JJHA 1ZHNB 2XN9D 1MCIA 1U0QA 3EJZC 5FUCC 1E4KA 4N0FB 4E0RA 3L7FA 3QCUL 4YHPA 4NN7C 5F1IB 1MWAL 2OBGA 1BD2A 2EO9A 4Z7VF 2ZJSL 4KTDH 3TGXA 4EDWL 1TITA 3MRNA 3VFGL 4BH8A 3NCMA 4C83A 5D7JA 2X10A 5FYKE 2EECA 2CH8A 5KW9H 1K5NB 1CL7I 3FB8A 2YMXH 2VABB 1CZ8H 1RUML 5C09A 3JVGA 2EKJA 2PUQT 3DV6B 1TZGH 4BZ2L 1OGAD 2GEEA 1A3LH 5D72H 3B2UD 4UDTB 4GAGL 3F65A 4XX1E 1NFDB 1I1YA 3HE7D 3MODL 5JNYA 3MRDA 5SV4A 1DDHA 4TRPL 3TN0D 3AXLB 3CZJA 4EVNA 3ZO0A 3C60A 3G5ZA 4L9LA 3UZQA 1N6VA 1PSKH 4I1NB 4U1MB 2Y7QB 3SE3C 3MJ8B 3NZ8B 2NY3D 4M48H 1K85A 3O9WB 4FQHA 3SQOH 1VENA 1MAJA 3HR5B 3UX9B 4YHNB 4N90D 4U6HB 2EDOA 1DBJL 3MO1A 3MLRH 3P4NB 4POZC 4O2CB 3CH8A 3TT1H 4NPYA 3MLTA 5FYKU 1GAFH 4KUZL 4C59B 2VN4A 1D6EA 2W59A 5ALCL 5L8JB 4YQXL 4P3DB 3RVWD 5ICZA 5DHXB 2EDEA 4JDTH 1QVOA 2CDEB 1KB9K 3KPLA 4D94A 3V52H 4ONHA 1JF5A 1I8KB 4TSAL 4Z0XA 4ENED 1HSBA 1CICD 4P4KC 3WMSA 1P53A 1CQYA 4UB0L 5I75C 1KG0A 3N9GH 4XNZB 1H8NA 4XZUA 1JZ5A 5HHOD 5E6ID 1JWMB 1GJIA 1TZIB 2O5XL 5ANME 3AU1A 1H0DA 4P59L 4QXWA 1MCDA 4HZAA 5IF0A 1MREL 3CFIC 3PWUB 2EH8L 3UTSD 4Z76A 3QUZC 1QSZA 1KLGA 5J06A 4GG6F 1F3RB 4ZTPL 4MMZC 3F6IA 4U1GB 4NQDA 4MB5A 4KI5D 1AI1H 4PRNA 3DXAA 2FGZA 4LF3B 3BGFC 5JQ6H 5DO2C 1OM3H 1MRCH 1TPXC 3R8BB 3S9DB 3EYOB 1A4JA 3SDCB 3EYQD 1OQXA 4O2FA 4NRZB 3U2SA 2NNAA 1A6UL 5D9SA 1QFHA 2BMKA 2HJFA 5EN2B 5FB8A 1CLYH 3MGTB 2BSSB 1BIHA 2VDPH 3SE3A 1E27A 4OLXL 4YBQC 3MBXH 5KS9E 4QOKE 1CXFA 3V0VA 5ID1B 1MEXL 3HFMH 2FB4H 3GKWH 1VPOH 1A5FL 4P46C 4QTHA 3D0VA 5SWQA 4XCYB 3A6OA 4F7MA 1NBYA 4G7VL 2APTA 1BWMA 5EZIL 2ZG1A 5BZWA 4W70A 5JW4Q 2J88H 2XWTA 3MA9H 4PB0L 4R0LB 4QRSB 1NC4B 4IRZL 2VNCA 3BVNA 5JIIA 3HZVB 1FNLA 5F9WB 4DKFL 2F15A 2VDNL 1RJZA 3OAYH 1MHEA 1GC1C 3E3QC 5HY9B 4MNQD 4GBXD 5CJ8A 3CFBA 4ZFOA 2RFXA 4P4KA 3RX7A 5FO9B 3PNWB 3HZMA 1U8HA 3V6OC 4DKAA 3BP7A 1S7SB 2H45A 2PKDA 4KKAC 3GBLA 2CO6B 1RUKL 1U93A 4DVRL 4XMLH 3B9DA 2BDNL 3HC3H 4TVPL 2R1XA 3H7BA 2R1WA 1B9ZA 2VERN 3QUZA 5J13C 3BP5A 1MCLA 1KGCE 3RWIB 3GK8L 3WFZA 1BFVL 1IKFH 3VXUD 5GS0C 1PLGL 1OCWL 1SBSL 1CS6A 1S9WA 4I3SH 3X3FL 4L3EE 4MVBD 2VZ1A 1MIMH 5D2NC 5CAYB 3T0DA 1MI5A 3GJFB 5HGBA 3BDYH 1A7OH 2VLRD 2R69L 2WQ8A 3HG1A 4PJBB 4XVTH 3G5VA 3ZHLA 2FL5A 3OKKA 3CUPB 1U8MB 4F7PB 2ENSA 5HHNB 4JCLA 2FYYB 1AO7D 2AERT 1F13A 3L3KA 3VWJC 1EAPA 1VACB 1WAAF 4FQIH 2VLKE 3O6LL 4P46A 3QXDA 1K6QL 4JO2L 1D5MB 1LD9B 4I5BA 1NAML 4JFDA 3QUYC 1CFTB 2AJSL 1CICB 3TBWB 2AV1A 3DETC 2KPNA 4PBXA 3R0NA 1G9NL 5E6IB 2LE9A 5INDB 2PW2A 5T3XD 5T3ZL 4AM0A 2FR4A 2IALB 4L4TD 5JO5B 2MKWA 2XWBA 1A0QL 5L2JA 2PR4H 1ND0A 1JZ8A 4NQTA 5E24E 1OF2A 1QQDB 5F7EH 1RU9H 4MA8H 3ARFB 1CXIA 5IOPB 1S7UA 1CBVH 5IBUB 3V6OA 4P2OD 3BKYL 2H6PA 5EOTB 1XFPA 2GJ6E 5L6YL 4M61B 5GZOC 4NGHH 4PTUA 2G60H 3UJTH 4M6NL 5FOJA 4P2QA 4M62H 2ENYA 4WWKD 5IR1A 4LCYB 2FEEL 3JTSB 2VDRH 3RPIA 1P84J 3OF6A 1KCLA 1MCPH 3S4SB 2ZOLA 3OQ3B 2VLJD 4X8JA 3DWTA 3N1PC 3Q48A 3NFNA 3QNYB 2W0KA 5ID0A 3DUUB 2EXWC 5EU6A 3QPQC 3N1GC 5D2NA 4UNVA 1XCQA 2WINA 2DQEL 4NRYA 1WBZB 5DJ2B 3LH2L 2ZNWA 3GEWB 3IFLH 4JRXD 3S36H 1FE8L 3IDIA 5I1IL 3MLUL 4M4RA 1F3JB 2XQYK 1IC1A 2FGWL 3QG7H 3VWJA 1Q38A 4KVCL 3O2VH 1JIBA 3QQ9D 4X6DA 3MNZA 1P7QD 1A6TB 1YEHH 1QKZH 1IGIH 4WHDA 2HT3C 1EHXA 3EO1B 3FQWB 1NAKH 5EBLA 5SWZB 1NCWH 3QUYA 4MNQB 4GBXB 2NX5E 4A6YH 2HVJA 4LBEB 4JGUA 4JFOA 5IEHB 2FECL 12E8H 3O11B 4X98B 5TF1H 1KLFA 5F88B 4G6ML 3LD8C 1J1OH 1ZT4A 5LWYH 1R5IB 4L5FL 1TDQA 3BQUB 3JBG7 5CSBA 2E27L 1JHLH