5J9PA

Kcsa in vitro
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pA02
4ORZC 3H0TA 3EGSA 2PYEB 3TZVA 4X5XA 4K71C 4XH2A 3V6OC 2ZUYA 4X7CC 4MQXC 3QXVA 3QCUL 2VAAA 1U8PA 4ZUVB 3CMOL 4LKXA 3LB6D 1ND0A 1NBYB 4I3SH 1B6UA 2WIIA 1WWAX 4U1GC 4B7LA 1AHWB 2D7MA 4JZOB 4DVRH 1CQYA 1V3LA 1NGQL 4D9QE 2C5DC 3RVWD 4EI6B 1LD9A 4TSCH 5DUML 2IAMA 4D9LL 5E4EB 1GGCL 4DEPC 2E7HA 4HG4J 1DUYB 4KQ4L 2AK4A 3FQRA 4LHUD 3PGFH 3WHE0 5DSCA 1DQLH 5DLMH 3JSSA 4U05A 4G8EB 1CXFA 1X5LA 4PJ9C 5CAYB 3CH8A 2R1XB 3DX7A 3T0ED 1NC4D 4ENEC 4CGTA 2R29L 4R26H 4XX1E 1DANU 2DBLL 3LEVL 4L3ED 4G9DA 4OCYL 3P4MA 1H3XA 3LS5H 2B1HL 3IXAB 2J1KA 1IARB 4GKNB 4YX2H 4PYGA 1GGTA 2OCFD 2VDRH 2XZCL 3RWDB 1VB9A 5F7MC 3CX2A 4EKXA 1S7UB 3LQAC 2JJTC 5ID0B 4LSUH 2FHFA 4LLQA 1RIVL 1BIIA 4KY1L 5GRJL 1JNNL 5DQDH 2AV7A 3MFFB 1G7LB 4IJ3C 3W5NA 3B4NA 4U1GB 3RTQB 1JF6A 2NY7L 3AXLB 2P5EB 5CEZE 5J13C 1L0QA 4OLXL 5EU6B 4N9GA 3S3JA 3M07A 1N5YL 1XH3A 4FQQA 1S7TA 4KI1A 3QA3A 4ZFGH 4V1DB 5DEGA 3H9SE 1PG7W 1W0VB 1T2JA 5GS2D 4EN3D 1A14L 2IQAB 1I9JH 4UMGA 1RFDL 1QO3B 3O3EB 2LTQB 3VFGL 3BD3A 2EEAA 1A1OA 3C08H 2GEEA 1BVLB 3W2DH 2Q6WB 3QIWD 5DVOA 3GO1H 4LL9A 3UC0H 3BP4A 4QHNB 5FYKD 3MREA 2X70B 2Q76A 1TNNA 4LLAA 4FQPA 3G6AB 4I9WD 4N0CD 4IMKC 2CRZA 4I4WA 3L5XL 1L0YA 2XY1A 1CFVL 4Q9QL 4JAMA 2XYCA 5ID1B 5IEHB 1V8HA 1KBGL 1UCBH 4R97C 2DYPB 4KHTH 1U9KA 4J1UB 3ARWA 1X5JA 4KKNA 4NP4L 1TZHA 3D87B 1T6VN 1IM3B 1MNUH 5HDBF 4WI4A 4FFZH 5MEOA 3QDGA 2OMBA 1WUNT 4OZFB 5SWSD 3T65B 1T4KA 2YPVL 3TVMC 1PVHA 2PKDA 2IH1A 2O5YH 3MGOB 1AIFB 1BOGA 3ARGC 3U4BL 2AXGA 4FQXD 5FF6B 1ZS8A 1U3HA 1BFTA 4ZUWA 2OQJA 5F96L 3QNXB 3B2UD 1ES0A 1UXWA 3L1OL 5KS9E 5C0ND 1EH9A 2PCPA 5E00A 1QEWA 3U0PB 5I1DB 5GGTL 3QUZA 4Q9RL 4X6DF 4Q2ZB 4LSTH 2V6HA 4NZDA 4H1LB 1MCPH 5E5RB 1AR1D 2AEPL 4CU8A 4N90E 4UDUB 3FB7B 2NY0B 3GMOA 3MV7D 2ITCB 1OPGL 1S5IH 5ALBL 1PQZA 3UTSB 2X4TB 4PJ5E 4KI5F 1EUUA 4UV4H 2H3NA 2VLRD 4BZ2L 3D1MC 3FZUD 3FQNA 1B4RA 1GXEA 5C2UB 5MEPB 5L8KB 4YHOL 2J4WH 3QDJA 3L3KB 4X98B 3ULVF 1VFOA 5L7XH 5GS1C 2CSPA 1AI1H 3GI8L 4YAQB 4M6MH 1OHQA 5HD8C 1XAUA 2CDFA 2PO6D 4WW1A 2OXHA 4XP6L 1QFUL 4GRLD 2C3HA 3LRSB 3LQZB 5DMKA 4TPRL 3FHAA 1CFNB 4RDQF 4G6MH 1MVFA 3O3AB 4Z95H 3CH1B 3B43A 3BP5B 1A3RH 3WUZA 4QXGL 4UNUA 5J11C 3B9KD 2YPLD 3FAWA 4PJIF 3QG7L 1V3KA 1IFHL 2DQFB 3HI1B 2ITDB 2FJFB 5C0FB 3DV6A 3BW9A 1F45A 1M1SA 4YDKH 5BQ7B 2NMSA 1FZJB 1D5ZB 4ODWB 1KCLA 1FORL 4G8GA 3KPOB 5IV2B 4Y4HD 1MJ8H 2OTUB 1YJDL 3RKDD 4KTDH 4P9HH 4GT7A 2GTWB 3U1SH 4DZBA 3DETC 1IAIL 2BRRL 2AQ3A 1FZKA 3FQXA 1EHXA 2ZCHL 1FNFA 2Q8AH 4Z7WF 4HLZH 4PJ8A 5DQ9B 2XA3A 5IB1A 4XAWL 3LH2L 3F7PC 3MCG1 1DBJL 2LAGB 3AS0A 5C09E 3ALWA 2J2ZA 3MUY1 5C8JA 3G6JB 2HJLB 1IC4H 4Z5RB 5BW7C 2VKXA 4GRMB 3TA3A 4L4TA 1MWAA 4H8WH 4NBYB 4FZ8H 1CS6A 2HWZH 4O02L 5CBAB 4X6CF 3BO8B 5DD0H 3NCMA 4PJGB 3FO1B 2PYFA 1DUZB 4DKDC 1YEGH 4APQD 2Z31B 3EZJB 3IT8D 4UZGA 3L3DB 4YPGB 4KZDH 3ARFC 1CICD 4NT6B 3UMTA 4OAWA 1ED3B 5CKGA 2DM2A 3RWHB 1TVDA 1LP9F 2APFA 2IF7A 4FFYL 3DX9B 4JVUA 4YDJB 3QCUH 5IG7B 5DS8B 1UYWL 1QLRA 2BVOA 1WZKA 3CMOH 4JY6B 5FA3B 1DDHB 4PJAB 4LEXH 4C56D 4ONHB 1KJVA 1FPTH 3HZKB 3M17A 3ZYJA 5C6TL 1LGVA 1RV6X 4YHKL 4XNQA 3REWB 3U4AA 3PV7A 4IOFC 3Q6FB 1S7WA 1NGQH 5H2BB 3WIFB 4J4PC 3VXSD 4WFFD 5HBBA 5F7EL 2OL3B 3MRRB 1FYTA 3GGWB 5DUMH 3VFSB 3H3PL 3PHQA 4D9LH 5JO5B 1GGCH 1HH6B 1B3JA 1MLBA 4KQ4H 4CVUA 1BIHA 3X13A 3ZHLA 2GYSA 2D03L 3CUPA 3SOBL 4DUXA 1YMMA 3MRLA 2NXZD 3KJ4B 1LE9B 1VGKB 5J9PB 4QTIL 4WVRA 3QRGL 5CMAB 4X80L 1BWMA 5EOCJ 2R29H 4MAYB 3JVGA 1CLOH 2DBLH 3LEVH 1T83A 4OCYH 2BHZA 3QWRA 4B5EA 2B1HH 1W0WB 3ARED 3PXJA 5TDOA 5IVOA 3EOBB 2XZCH 1AXSB 4UAOC 5IF0A 2V5YA 3PL6A 3SPVA 4WUKL 3O8XC 1BVKA 1LDPL 3QXAA 3L7EB 3HLAB 3C5JB 5E6YA 1PFCA 1DFBL 2XIDA 3QDJE 4ODTL 1A9BB 1XCTA 1OQXA 3MBEB 3MBXL 3ARRA 1RIVH 4KY1H 4XZUA 1JNNH 4H26B 5SWQB 1Z2KA 4NKMB 2VRAA 3GMNA 4BQBA 3OL2A 2APBA 2NY7H 4JHZA 4Q97A 1Y18A 2V5RA 4OLXH 3IU3B 4EDWL 1N5YH 2B2XL 3CZJA 1RIUL 3DURA 3CFBA 3T2QA 5AG8A 4Y1AA 4X4XA 2BSRA 5HDBE 2W0FA 2Q8BL 4BKLB 1G7IA 5D5MA 2HAZA 1A14H 1MIMH 4X4ZA 1RFDH 4G8GE 2ZUQB 2BVUA 1TCMA 5DRNA 3VFGH 3QXWA 2EYRA 3U2SB 2P8PB 1OD9A 1CDIA 2A6DA 3ULUF 1Q9KA 2DQGL 1QACA 4PTTB 4G43B 5D6CA 1CK0H 3E2HC 4I0PB 4AK1A 3ZO0A 1NDGA 1JYNA 3WJLC 1TETL 1CFVH 5GSRB 4Q9QH 1D6VL 4PJ7F 1L9MA 2GTZB 4X6DE 4XNMA 1JYWA 1I3GL 1KBGH 3EHBD 1S7XA 5DJ2B 2X4SA 4NP4H 5A2JH 4L9DA 1VEPA 2DAVA 3KNBA 4YDVA 3FAXA 1QTYT 2QQQA 3SHSA 4QRPB 4P5TA 5BZWA 2NY4B 4EI5D 4ZXBA 2YPVH 3FRUA 1KIPB 1EFXB 5EC2B 4L4TE 3MUGA 1JF5A 5M95B 4BELD 5I19L 3QFDA 2CGRL 2NZIA 3U4BH 5T3ZE 1XGTB 5MERA 4PGBB 5F96H 3B8YA 1M6OB 1KLUB 5JZ7D 3GMMB 4OZHB 5DJ6A 3VJ6B 1J12A 5GGTH 4ZODA 1NBZB 2DS4A 2GJZB 4J3TA 1F3RB 4DFHA 1ZA6B 2AEPH 3MCKA 4W6XB 2ATPA 3VWJD 3CC5A 3VA2C 1T0NB 5LVEA 4ZFZA 3WL9A 3RAJH 3EOYG 2C3VB 1C5DB 1LEIB 1OPGH 5ALBH 3TZVC 1EPFA 3QQ4B 4PJIE 5DJDA 5IJVA 3D85D 2VSDA 1ZANH 5ISZD 5SX4I 4S0SD 2HTLD 2N1KA 4CRPA 4MWFB 4BZ2H 5CEXA 3VXRD 1FLTX 3TYFB 1FYTE 4X6FB 2HKFL 3DROA 3AAZA 3D6GA 3MRKA 3QIBA 2YPKA 4YHOH 4R4BB 3SO5A 3U46A 1YMHB 2VISB 1NL0L 1LO5B 1I7RA 3SKJH 4KRPD 2FECL 4M3JA 1OSZA 2HN7B 4HUWB 3L5JA 1YMME 3JV0A 4XP6H 2CLVA 3HA0A 5H35B 4TPRH 4WFGE 1ZLVK 4NO3A 3TFKC 3QFJA 5GSVA 4ELKB 4QXGH 4HZLB 4GW1B 5I1AB 1ZT1A 3TCXA 3QG7H 4XPFL 1IFHH 2DQHL 3X14A 3MLSH 1F11B 2B39A 4ZNEA 2VZVA 5DURB 4S1QL 1FORH 3NOIA 4PP1D 5KS9B 3IDNA 1MCOL 1XR9A 1YJDH 3ZKMC 4BUHA 4PJXF 4RA0C 4X4MA 1OAZL 4PJDA 1IAIH 2BRRH 4Y88A 5KANG 3H0TB 3DLQR 5TGBA 3EGSB 1ZVHA 4XVSL 2K7PA 2VABA 2ZCHH 4X5XB 4XH2B 3QO0A 3GKWL 1G0DA 3RL2A 4C55A 2VAAB 4HJGA 3W5MA 4LKXB 4HKBA 3ZYIA 1ND0B 2C4FU 4XAWH 1XGYL 3LH2H 3MRNA 2WIIB 5FOJA 4O9HL 3LN4A 3VFWB 3QWQB 1F58L 1LP9E 2CUIA 3ZT6A 2VXQH 3NAAH 5I66A 5D5ME 1MCHA 4LOUD 4WENB 4OQTA 5HYSG 3H9YA 1LD9B 4OLVL 5D7LA 2IAMB 2W60A 1YY8B 4NDMB 2QHRH 3R8QA 1ZLWK 4OGYL 4O02H 1TDQA 2AK4B 3T3PE 4LVOC 3FQRB 5D93C 1GC1L 5E56A 2XPGA 4P2RA 5FCUH 5DSCB 1PY9A 2D4FA 4YBLC 2R4SL 4WY7H 2HTKD 4XP1L 4NWTL 1JGUL 4L8CB 2J8OA 3MV8E 5I76A 3HNSL 2X4PA 4G9DB 2D9CA 3P4MB 4G9FE 2E9BA 4FFYH 4HIEB 1S7VB 1UYWH 2H2SC 3K46A 4YC2B 1JZ7A 2XKUA 3L3JA 5EBLA 4NRYA 4KK8D 5C0EA 3BKCL 1F3JB 2OX5A 2UVEA 3B9DA 5EC1A 5C6TH 3OKEB 2MWCA 4UDTA 1I1AA 4HFUL 4YHKH 4WV1C 5GGUA 5FKPB 1BIIB 1J1OL 1JZ8A 3UTTD 3O2DL 2LU3A 4JANB 3MMEB 2MHAB 5F7EH 4KJWD 3BN9C 2ESVB 1L7IL 2ZCKL 5E0QA 1KXQE 3CSBA 4ZO7A 4GLRH 1U3HC 4N9GB 4PB9H 4YEEA 2WQ8A 1CD8A 1HHGA 1XH3B 4FQQB 4P3CH 1S7TB 3FOLA 3QA3B 3SOBH 5DEGB 1ZAGA 4JHAL 3OKDB 3E6FB 3BWAA 4QTIH 3QUZC 4ZOAA 3QRGH 3BRFA 4X80H 5TH2A 3WS3A 2I26N 5H94B 2X4UB 5TE6H 1CG9A 1A1OB 3SKOB 1DVFB 4PB0L 4LPWA 2LFGA 4LHJB 5E6IA 1KB5H 1A5FL 2C4XA 1ZHLA 3MREB 4WUKH 3DVFA 2VLME 1ZLUH 1SM3L 5DMIL 1LDPH 2P1YA 2Q76B 5DD1L 4CBPA 2VL5A 5L0QB 4AEIL 1DFBH 4ODTH 4I4WB 4MAUH 4WIQA 3PUCA 2LV4A 4M7KL 3MBXH 4D3CL 2NY5L 4FQHB 4JAMB 1LO2L 3ULUE 3RTQD 5ICXA 1HHKA 3KPTA 1KC5L 1EJOL 4PV9B 3VFTA 1LO4L 5EIQA 5MEOB 3SGKA 3QDGB 1B0GA 4XPGL 2W91A 4V1DD 1T4KB 4EDWH 4S0TD 5BXFA 4UT9L 2B2XH 4DFIA 2IH1B 4PGJA 1KCRH 4Z7NF 1I1FA 3VH8A 4LVHC 5T33L 1JP5A 4NRXA 4ZNEE 2Q8BH 1WSST 1E4KC 4F57L 2R2BA 5HXMA 1FCGA 2AXGB 3CSPA 1U3HB 2ICEA 4ZUWB 4WHTA 1ES0B 1UXWB 4JFHE 2PCPB 5E00B 3MRGA 4X4ME 4ZTPH 4PG9B 2Y07L 3QUZB 2DQGH 3ULVH 3G5XA 1G7PA 1UC6A 4ETYA 2BNRA 4W81A 3UPRA 1QRNA 1YDPA 1TETH 2DYPD 1NLDH 4L8DB 1D6VH 2FDBP 3GMOB 1I3GH 3CJJA 4GFTB 2HRLA 4MJIB 4CJ1A 4LEOA 2NXYD 4PJ8C 4E9LA 4K7PX 3VDBA 2E6JA 4PGZA 3NGBC 4YZFF 1CXIA 2H3NB 2N4IA 4KMQA 3FQNB 2H9GB 4J3SA 5D7LE 3SKNA 1ZEAL 3OPZL 5ANMA 1QSEA 5GZOD 5DJAA 5I19H 3QH3A 2CGRH 2MFNA 5AUMA 1CFBA 1I9EA 4P2RE 3QNYA 5HDLA 5FYKL 4ALAL 3CXDL 2W0PA 4S2SA 2CDFB 4CN6A 1II4E 3CAFA 3ZE1E 1I1YB 5HHME 3VI4F 4K3HA 1CZ8L 4ODUA 2ICWJ 1DEEA 3WKNA 1KIQB 2NY0D 1DEDA 4X83A 4LGRB 4G6AC 2ZG2A 4PUBL 3ME0A 3DV6B 1X5ZA 3BW9B 4X6EA 3UTSD 1FFOB 5J56B 4OIBA 2FB4L 2YOCA 2RFXA 2HVJB 3MROA 4QXUL 4BA8A 1UKQA 3BGMA 4KAQL 3ZSSA 1JK8A 3CNKA 1M71A 2MTPA 4P2CG 4P2QA 4DZBB 2O26U 1I7TA 3SDCD 1FZKB 3CZFB 3T77A 3DGGA 3CXHK 1F4XL 4PJ8B 3WN5A 2EXWC 5I1LA 3GJEA 3NGBB 4J23A 4MQ7A 4N8VG 3W11C 1CD0A 4F33A 1NMCB 1I3UA 4R2GB 4NQDA 5EWIL 3FT3A 2VDOH 1ZGLA 3QAZB 2CR6A 4AIZA 4JQXA 2PTUA 4Y4KB 4NHUA 5C8JB 4EUPH 1OB1B 3QCVH 3NPSB 2YZ1A 4XPFH 3TA3B 2DQHH 2CLZA 5I9QC 4OQ1A 4M03A 1UACL 4TULH 4U2YA 3ZKXC 3BPOC 2PYFB 4S1QH 1RUKL 4MVBD 3RGHA 1MCOH 1U8LA 3OHXA 1UQSA 5J06A 1OAZH 4Y5YB 1MFDL 1X7QA 3QQ3B 4XX1G 1T0MB 5FM5M 3WUWA 4KROB 3EO9L 3B8SA 3GKWH 2PTTB 4LSVH 4WNQA 1I3RA 4RRPG 2BVOB 5KOVC 3S3SA 5JDSA 2Q7YA 4JM2F 1KJVB 1XGYH 4YHMH 4O9HH 1S9VA 5IMKA 4JPIB 3IF1A 4XNQB 4XP9L 2R69L 3KYNA 5D7JC 1NC2D 3QULB 4U6YA 1IGFL 5IKCB 4Q0XH 4UOW1 3PHQB 3CMGA 1MLBB 3GBNL 3JWOL 4RWHA 2GAZA 3KYMA 3X13B 1E28A 5C9JA 2Z31D 4MX7A 1OWRM 2BNRE 1CE1L 1NANH 2Z8RA 2R4SH 1QRNE 3PV6A 4XP1H 4WW2F 4Y2DA 3ARDA 5CHNB 5I9QB 4NWTH 1JGUH 3OKYA 3EJYC 3TO2A 3NCBB 3D0LA 3C87A 1G7MA 3HNSH 2R56L 3CDGB 4U1SA 4Q6IB 1IM9A 1NGWA 4KJPD 4Z77A 5TDOB 3MRIB 2ENYA 1XEDA 1TQCB 3AS3A 3VMNA 3PL6B 1BX2A 1HNGA 1WAAA 4XCCL 3BKCH 1BQHB 1BVKB 5MEQA 5ANME 3VW3L 1AGFA 1QSEE 3P9LA 1YNKL 1G6RL 1T3FA 1XCTB 5I8CA 3STLA 5J6GA 1A6UL 1WK0A 4XZUB 1J1OH 2DQUL 3O2DH 2NYYC 2FO4A 4LLVA 1L7IH 2ZCKH 3CPLA 1Y18B 2A0LC 3ARPA 5B38G 2DLTA 3NFSL 4GKZB 1CFTB 4LSQL 4OUUB 1ZT7A 3CFBB 3DURB 4GBXB 3NTCL 3P3YA 4JQVA 4Y1AB 4XCYA 2DOCA 2BCKA 2VDML 4MAYD 1U93B 4JHAH 2W0FB 4GG6F 4OFPA 1G7IB 4BFIA 4HIHA 2YA1A 3I2CL 4LP4A 1UKTA 2FHBA 2Q3AA 3W81A 3FT4A 12E8L 2EYRB 3WCYA 1I9IL 1A7OL 5EUOA 2R1YA 4P2QE 2A6DB 2AXJA 3UAJD 3EFDL 2WP3T 1A5FH 1Q9KB 3LKNB 3MBED 5D6CB 5DMIH 4FQCH 1XGRA 2H26A 4D3CH 1KENL 3I6LE 2NY5H 1KJ3L 4TOYL 3DMMA 4PP2A 1BQLL 3OAYH 4NQDE 1I9RL 5C0AA 5I17A 1KC5H 1EJOH 4HD9A 2X4SB 1LO4H 2P8MB 1EUTA 2APWA 5D72L 4XPGH 5I8EB 4P5TB 5BZWB 1EO5A 3ULUC 4ZXBB 3WNNA 4U3CA 3FRUB 3P73B 4UT9H 4AZ8A 3HTLX 1MHCB 4ZSOB 2BY2A 4MQSB 5D9SB 1IJ9A 3MUGB 5BVJA 5T33H 2QJDA 3MNVB 1FLRH 4YZFE 4M43L 2VKWA 1G1YA 2XWTB 3HRZA 4JFEA 4X9BA 2KDGA 5A3IC 4YE4H 1C12A 1EZVX 1DANT 1LQSR 3K8LA 5TPWL 5AD0A 3BZEA 1LK3L 2FJHA 1S9YA 4NPYA 2Y07H 4BZ1L 5AAMA 3Q5YA 3S34L 3MR9A 4Y5VA 5LCVL 1DQDL 1UB5A 4R8WL 4NWUL 3MCKB 1VPOH 1FNLA 2ATPB 4N0YH 1ZTXL 1KNOA 1LMKA 1OAUL 5BV7C 3BHBA 2ZG3A 5EH1A 1CDCA 1IGYA 4UU9B 5EU3A 5L88L 4KKCC 4QRPD 5IJVB 3BWUC 1EFXD 3PWLA 3Q6GL 4WRLA 3BDXA 5FKAA 4LDOB 5CEXB 5SWZA 4HC1L 3DROB 3OPZH 5F7LB 3AAZB 3CVHL 3MRKB 3QIBB 3TPKA 3U46B 4WWKA 3R8BB 3O2WL 2XTJE 5JDJA 1A02N 3G04A 4ALAH 2Y6SC 3CXDH 3BD4A 2CLVB 1URLA 5HHNA 4XMPL 4IOSD 1WT5A 2N56A 3O6FA 4JG1L 2NY3D 4CVWA 1CZ8H 1F6AA 3QFJB 4U2ZA 5GSVB 1EMTL 1ZT1B 1IGCL 5B21A 1CGXA 5IOPA 4LARL 2IPKA 3KYKH 5FAAA 1MFCL 4PUBH 1I8KB 1WAAE 2HT4C 5A16B 2BDNL 2AJ3A 3MO1B 5FIEA 5BJTB 3H2WA 4LIQL 3DNKA 4J3XA 5CEYA 3TV3L 3IDNB 4LKCB 3DGCR 1XGQB 1D9KC 5T5FL 2MPAL 4PJDB 5B3JF 1T20A 4PLKC 1BZ7B 5TGBB 1QA9A 2VABB 3QO0B 1I1AC 3RX7A 5BRZA 1F4XH 3BPLC 4GXVL 2ED9A 1CGTA 4HKBB 3LKQB 3SQOL 5C92A 4W6WB 1JNHA 3M1BB 5CZKA 4P57A 4NQSA 4PLNC 2XG5A 2P5WA 1AQDA 1FZMB 5C0JA 3BISA 4LAQL 5EUOE 1UACH 4YUEL 3OXSA 4NQCE 2XPGB 5INDA 3FRPG 3IVKB 5D1ZD 2YN5A 5HHMB 5F97E 1G7HB 5E6IC 4HFWB 5EOQH 2AEIT 5C0AE 2V2WA 5I71B 1PZUB 1MFDH 3PWNA 3RY5A 2IPUK 3CFIC 3EO9H 4U1LA 4C57C 1G84A 1ERNA 1RIHL 5IM7B 2QQNL 1SJXA 4R9HA 3GNML 3L3JB 5EBLB 5C0EB 1HQRB 5CZXD 1D5BA 5EC1B 5DMYA 1A7RL 1Q9LA 3MUJA 1K5NB 3DPBA 5JOFB 5DRXA 4XP9H 1LK2B 2R69H 2IAMD 2WQRA 1IGFH 4OLEA 1J8KA 2VSCA 3GBNH 3JWOH 3N1PC 3RVUD 2XN9D 4GAFB 4YFEA 2EDLA 2FEEL 5DUPL 4RAUA 4K7PL 1QFWI 3LRHA 3NN8A 3H3KA 2GUOB 3FOLB 4BJLA 1FE8H 4HW6A 1TJHL 1T66C 2BY3A 3QIUA 4ZQKB 1CXEA 2R56H 1I3VA 2F53E 1CG9B 1HIMH 3RGVA 5K9OA 3DOSA 2OP4L 2OJEA 2J8UB 3WIIL 5SWZE 2PUQT 2Y72A 2F54E 4XCCH 3BT2L 3VW3H 4HK0A 1TJIL 2VL5B 1KUMA 4RA3A 1YNKH 1G6RH 3O3UN 1A6UH 4XCEA 1V7NH 4AIXA 2ESVD 3C6SA 4O2EB 5ICXB 1HHKB 4XBEH 4Z7VF 4AM0B 4NM4H 3BDYH 4U1NA 2B5IB 3LKRA 5CSZA 4ZFOL 3VFOB 3QUXD 1N5AA 1GYAA 3VXNB 1WZLA 5F88A 3NFSH 5T3XD 5BXFB 1R24B 4JFPA 4LSQH 4P59L 2CRIA 35C8L 3VH8B 2QEJA 3SDYL 3PHOA 1X5XA 2A77L 1DVFD 3I2CH 4Z7OF 1CWVA 2ICEB 3DX8A 1GRWA 4H5SA 4R7NA 4WHTB 3IDJA 4Z8FL 3Q0HA 12E8H 2XZZA 4G5ZL 1I9IH 3Q3GB 4P46A 5GXBB 2AQ2A 2YD4A 3EFDH 1T7XA 2A6KA 3G5XB 5TE4L 4MSWA 4EDXA 3O45A 4WHYG 1DLHB 2BNRB 5BRZE 4BH7A 1YDPB 1KENH 3MQIA 4PJBF 1KJ3H 5HDOA 3Q48A 1BQLH 3CFJA 1I9RH 2GSGA 5AYQA 1KYOK 3MRDA 4GAYA 4YIQA 5F7NC 1YZZA 4LEOB 4OZGB 3WN5C 5E99L 4M00A 1DQQA 4OF5A 1SQ2N 3GSXA 4KK5D 5D72H 2AJYL 1EXUB 4HWEL 1T7VA 4OZ4A 3WHE1 5KAQF 2L0DA 3SKNB 3F5WA 1DQML 3WFEL 5DJAB 4LNVA 4JQXC 5HHOD 3QH3B 4PBXA 5AUMB 4MXWH 3NH7L 4L8SA 3OBAA 4M43H 3QNYB 1FDLL 2ADGA 2BNUA 3QZWB 4S2SB 1CTOA 2BOBA 2AAVA 1OAXL 4QKXB 5TPWH 1KEML 1LK3H 1CGSH 4RBPK 1WIPA 1AO7D 4BSVA 3ISWA 3GSQA 2BVTA 4JFDD 1YA5A 4ODUB 4NFCA 5B4MD 4BZ1H 3C5ZC 3TIDA 4WU7A 5LCVH 4M9PA 5CFHA 4NWUH 2Y23A 1ZTXH 3RWCA 9CGTA 1OAUH 4MJID 3GMQA 5F9JA 1G9NL 2RFXB 1G9ML 2A9NL 5IWLA 5HI4C 4BSJA 5KSUA 5FO8A 5I1KL 4MD0A 1M71B 3F8UB 5ACZA 4YNYA 3KJ6L 2BERA 4NGHL 1I7TB 5GRZA 3IJSA 2NW3A 5JA9A 4HC1H 5C0CB 3NABL 1T1WA 5DHXB 1HQ4A 5KANI 4JFFA 25C8L 3C6LA 4N0UA 3WN5B 4BH8A 2DBJA 3GBLA 4OV6F 3GJEB 5I1LB 2E7LC 4W68A 4MQ7B 3IYLW 1EGJL 4NQDB 1DTUA 3FT3B 2KL6A 3CLFL 1NKRA 1F5WA 3QQ9D 1ZGLB 3ALXA 3RBGA 2NX5B 4XMPH 4LPUA 4AIZB 3QRFM 4JG1H 1F00I 2XTJC 2FGWL 1AP2A 1EBPA 4NHUB 5JR1H 3V6FA 3T4AB 3BZDA 1I7UA 1EMTH 1T7ZA 1IGCH 4LARH 4PLOB 2CLZB 4Y2DC 3W9DB 4LAJH 2QKIB 4F7PB 5ITBH 5CJ5A 2VAJA 2VXTH 1W0YT 1A0QL 2BDNH 4HMCA 4LIQH 4JHWH 4CDHA 4LCUA 4X6BB 5T5FH 1P7QA 1DN2A 2N7AA 5EUKA 2MPAH 5JXEA 4KV5F 3PJSA 1TQBB 3D48R 1X7QB 4YJZL 3BIBX 3WUWB 2JCCA 1G6VK 1D6EA 5DJ8A 1UVQA 3QQNA 2CRMA 4WNQB 1I3RB 4J3UA 1MH5A 4GXVH 2WUCL 3UYRH 2EDOA 1S78C 5FECB 3SQOH 3KLHD 5JDSB 1VDGA 5B39A 3ARTA 4Y4KD 2C1PA 4RNRA 5IMKB 1GCFA 1ZKAA 4N9OB 4IDJL 5I73C 2NY2D 1MRCL 5K33A 4QTHA 1D5XB 3DSNA 5KSBF 15C8L 1KT2A 1CVRA 3SE4C 1AGDB 2V2TA 1YNTB 2E8ZA 5IMMA 4LDEB 4YUEH 1TVBB 3SO3C 4UIMA 1FC1A 3NIFF 4W70A 1QHPA 4WI2A 3PV6B 5F44A 4X9FA 1Q94B 3ARDB 3UBXA 3TO2B 2D31A 4LLWA 4M9OA 3UTZB 4KROD 2BY0A 2R2HA 3TCLB 1H3VA 4P23A 2BY1A 4U1SB 3NCEB 3S7GA 1IM9B 1QFWM 1RIHH 2QQNH 4QCIA 4Z77B 3DMMC 3GNMH 1BX2B 4LVNC 1HHJA 1EVTC 3MNWA 3GMRB 4ERSL 2DTML 1A7RH 4LCIH 1T3FB 4NBZB 5I8CB 3STLB 1MY5A 4RMTA 5EIVA 2F9BT 2FATL 2YRZA 1DBMH 3MJ7B 3CU7A 2P8LA 1IKFL 2M8XA 3MYZA 4EUPA 3KPRE 5IW6B 3QHFL 5JQHC 5F7DA 2BVQA 1RU9L 3LEXA 2Z35B 5DUPH 4K7PH 3RZCD 1ZT7B 2R9HC 3G5ZA 1BJ1J 4YHYC 2IALB 3VD4A 3KXFD 1A8JH 1TJHH 1DBKL 2EDKA 2IANB 4QGYA 4BFIB 4HIHB 4AY0A 4G6KL 4K8RC 2EE9A 2A73A 4AJ0A 4Y5VC 5I1GL 2W0LA 5LJYH 3FT4B 2OP4H 4KKLC 4Y19B 4NC0B 5KSAB 1CU4H 1A1MA 1OAKL 2R1YB 3WIIH 1A64A 5CD3A 5DHVA 3BT2H 3RY6A 2Y5TB 1CIDA 1TJIH 1XGRB 4N0UE 3WLBA 1RJZA 1HILA 2BMKA 4PP2B 3ZTJH 3MACL 1U91A 5C0AB 3IDYC 3MRCA 5I17B 4LVNB 3GHBL 5E2JA 4RFEA 2QTEA 3I6GA 4MGXA 4WWKC 5L9DL 2UV3A 4U33A 4PJBE 4GBXD 3PP3K 1E6JL 1CR9L 5EFIB 1FCCA 1MUJA 35C8H 3NZ8A 3QI9C 4GXUN 4XBGB 5BVJB 5D2NB 2DJ4A 5FO7A 3PWPB 3O6FC 2D7TH 2A77H 3VXOB 4ODXA 2XQBL 4JFEB 1C12B 4DZ8A 4GRWF 4H25A 4Z6AT 2NR6D 1GGYA 4G5ZH 1HHHB 3BZEB 1B88A 3HMWL 1DSFL 2FJHB 4L4VD 4NPYB 2OL3L 5CZVH 1RK1A 4Z7UF 5TE4H 3MR9B 3ZYZA 2JCCE 1NFDF 5D96B 2AJUL 1UB5B 3PWVA 3CCHA 4DGVL 1KNOB 3TN0B 5C08A 5D2LA 1GOHA 1P69B 1YYML 2MKLC 1IGYB 3HE6A 4H0IA 2ZJSL 4FXGA 3O2DA 1P4LA 1S7QA 3DXAE 1L6XA 3PWLB 5E99H 2DM7A 4HS6A 5FKAB 4JQIL 2AJYH 2R8SL 5GGRA 3A0OA 4HWEH 5FDWB 4N5UA 3FONA 3WIHH 1NCWL 4XVUD 4CVXA 1TITA 1DQMH 3WFEH 3AC0A 2AS5M 3MRBB 1UZ6F 2VQ1A 1U8NB 3WNKA 1YY9D 3NH7H 3VU2A 3G04B 1FDLH 1DE4A 1WV7T 4UT6H 4UTBL 2Z92A 4HIXH 2VE6A 1OAXH 2NY1C 5HHNB 1KEMH 2WMPA 4JDTH 5DMGD 4OD2A 5BZDA 4U1MA 4DVBA 4XNUL 1M7DA 2IPKB 4MA8L 4P9ML 1Z9OA 4B0MM 2WINB 3VFRA 2VN4A 4KKAD 3EYQD 2VQTA 3T3MF 1ROWA 3TF7C 5DGQA 2J88L 4HJJL 1G9NH 1WICA 2AJ3B 3ECBA 1FVDB 1G9MH 1CLZL 2A9NH 5CEYB 2L7UA 3IKCB 2YD2A 3O6KL 4WWID 5DYOA 4RGND 1U6AH 1T20B 1MCRA 3QIBD 5AAWA 3KJ6H 4NGHH 5I1JL 4CVZB 1QA9B 3NABH 1QBLH 5E7BA 3T0EA 4I2XA 1NC4A 3D69A 5DJZA 5J12B 3LEYL 4L3EA 2NZ9D 1AE6L 2A83B 5DZOA 2ZOLA 4KV5E 1F2QA 1EGJH 1IAKA 4PREB 5LKNA 3VGHA 3CLFH 4XC3H 3MOAL 1RZKC 3VH8G 4OGAC 4JO1L 1HE7A 1X5YA 1H8SA 1F42A 2FGWH 4NFDA 3CU1A 4NQSB 2D0FA 1BBDL 4XAKD 5TQ0L 2P5WB 1AQDB 4DAGL 1R5WB 1OCWL 2NY1B 3JZ7A 1M05A 4P2OD 4YDLC 3OXSB 5INDB 3AB0B 5EU4A 3RGVC 5E7FA 1JZ6A 4PD4K 1N2RA 5TF1L 2V2WB 1VADA 3NIFE 1XF1A 2DI7A 4EN3A 3GSOA 1AKJB 2BRQA 2WUCH 3QIWA 2UZXB 4WGWB 1D5BB 1UGNA 3O9WB 4JGJA 1MRCH 5DRXB 2BOCA 1NFIA 5CKAA 2HFGL 15C8H 3F6LA 4RGOL 4I77H 4XVJL 4NC2B 1QYGL 3QCTL 2I60L 3QEUA 5JPNB 3V5HB 4IIQB 4NO2B 4RAUB 2K3TA 2IFFL 2DJSA 2VXUL 4OI7A 5SWSA 3NN8B 5FGCB 4P46C 1DL7L 4OJFL 1FL3B 4XXCC 4RAHA 3FTGA 4YHPA 4M62L 3QIUB 5C08E 5FYJD 5I6XC 4P4KB 4I8DA 5J6HA 1MCBA 2XY2A 4XNZC 2ERJB 5B22A 1KYOJ 4RAVA 2KH2B 1E4XI 3GFUA 4FQXA 3RGVB 3X11A 2FYYB 4QHLB 3QEGL 2FH6A 3C9NA 4M1CC 2GK0B 4R6UA 2DF3A 2R0WL 4HKJA 2NLJB 4QRUA 5F70A 4QOKE 1T1YB 3KPSE 4HSQA 2I27N 4ERSH 2P46B 1MF2L 3WKML 4N1EA 3VXMD 4NKDB 3HNTL 1V5JA 4XCEB 5HJ3A 2FATH 4NN5B 3C6SB 4ZPTA 5EBGA 1CYGA 1SYSA 4U1NB 4AENA 3IXTA 3RWEA 5IB2A 3LKRB 3MV7A 3FCTB 4YXKH 4PJ9D 3AM8C 5F88B 1RU9H 1U95B 2D0GA 3I50H 2F15A 4L8BA 5SX5K 4JFPB 3DJ9A 2VLRA 1NQBA 2YS4A 1OGTA 4UTAL 4FTVD 1KIRA 4YFLI 5EA0L 3EOAB 3K1DA 3WDJA 4G6KH 3DX8B 4H5SB 4R7NB 1AGEA 3PIQA 5I1GH 4UILL 4M7JL 4KZEL 5A2FA 1RUPL 4UBDD 2CMRL 2PO6A 4FOMA 4MQTB 4QXTA 3WEXA 1OAKH 5GJTL 4GRLA 2W1NA 1KCVL 2IH3A 3LS4L 2BC4A 1YEDA 3T0EE 1Z9SA 4OTXH 3WUWG 4XNZB 5IWLC 4GUPA 1IGTA 4BH7B 3B9KA 2YPLA 2PXYB 5KJRL 3HUJF 1BBJA 3CFJB 3VRLE 2MKWA 4Z7UE 5K59E 1TTUA 1Y0LA 4PJEF 1NFDE 4GAYB 3GDBA 3MA7A 3C6LC 1MCIA 1HCFX 4XHQA 1KG0A 4DK6A 5L9DH 2G5BA 1A6VH 3GSXB 1E6JH 4Y4HA 4J2XA 1WBZB 1CR9H 4KHXH 3SE8L 3HZMA 3TWCL 1RZJL 3P30L 1ZHKA 3WSQH 1T5WA 1ACYL 1Z6JT 4OLWL 4L8SB 2NQCA 4XC1L 2XQBH 1X9QA 2ADGB 2BNUB 3VD3A 4EZMA 4X9GA 2AGJL 1R5IA 1JI2A 3HMWH 1DSFH 2GSIB 1UZ6E 2G5RA 5HSFA 3GSQB 5F6IB 1NGZA 4PGCA 2XXMB 1KB5B 4WU7B 3RWCB 3SDDB 4DGVH 3OZ9L 4I48A 4OM1H 5T3XL 1G6RA 1YYMH 3ES6A 1TZIB 5FYKE 3TVMD 3TNMA 2HT2D 4G42B 5K9JH 1T5XA 1BZ9A 5SX4H 5FO8B 4OZIF 3MJ9L 4MD0B 3T3ME 2R8SH 4Y4FB 1PKQB 4YNYB 2NW3B 1NCWH 2FCBA 5F1OB 1T1WB 1A7BA 3KPNA 4M7ZC 1HQ4B 4JFFB 1NSNH 4K7FB 4OCLC 4BH8B 1W72A 5FOBA 4UTBH 4WUUB 1JZ3A 5SWSE 5DI8A 1X5GA 4RISL 3PF2A 4C56A 4OCMC 1R3LA 3RA7L 4TUKL 1AP2B 3DUSA 4DCQA 3V6FB 4ODHL 1I7UB 2VH5L 3SJVE 1JZ4A 3B2VL 4XNUH 1R5VA 4HZAA 4AYFA 3EYOB 3VXSA 3S37H 3HC0A 2X1OA 5D7SL 5GJSL 5E70A 2J88H 4FFVC 4HJJH 1OP3H 2WUBL 4KU1A 1CLZH 3SE9L 3VE0A 3BRGC 5HTSA 4LCUB 3MYJA 5J1AA 4KC3B 3O6KH 5C0CD 1P7QB 2EDFA 2HRPL 2CJUH 5EUKB 3RNQA 3PJSB 4WU5A 1KLGA 4X4YB 2ZUVA 2V5MA 5I1JH 4QHKI 1ADQA 5HD8D 3MV7E 2NTFA 3LEYH 4NQTA 1MH5B 3FQTA 5DJXB 1AE6H 5IQ9A 4OSUL 4P3DB 2NX5D 3AREA 3L3OA 5HYIA 3LKOA 5B39B 4M7ZB 5C0BD 3P0YL 1OARL 4QRTA 4FQ2L 4LCCB 4HPOL 3WS6A 4JRYD 4QTHB 4OGZA 3DUUA 3EJJX 5TQ0H 4FRWA 4O51B 2V2TB 4Z0XA 5KOMC 4X99A 4HQQH 1F4YL 3MLTA 3NCJL 5ELIA 3NACL 4MB4A 4AQ1B 3MLYL 2EEDA 2WWKO 4QF1A 3C2AL 4N5EC 2VITA 4UIMB 4PV8B 5DHYA 4LGSB 4YBHA 2VDLL 3UBXB 3ZKNC 3GMLB 2D31B 4LLWB 4ONFL 5TF1H 2R2HB 5DC4B 5FUOH 3RY6C 3DO3A 4P23B 5GRVK 4N1HB 4QWWC 3VXUE 3ROOA 1FSKC 1SMOA 4X6CB 4HC1A 4PRPE 1NCTA 4QCIB 1U8MB 1RUQL 3CVHA 4X7SL 2YD9A 3C8HA 3ROLA 2YD3A 2EO9A 1UENA 4NUGL 4KQ3L 5I1CL 2HFGH 3V0WL 3TBVB 4RGOH 4XVJH 1GC1C 1DN0A 4D0BB 4EUPB 1QYGH 3QCTH 1GL4B 2I60H 4DGIL 4PTUA 5F7DB 2BVEA 2BVQB 3LEXB 1FNGA 4JB9H 5D7KD 1A22B 2IFFH 5IBLC 2VXUH 5I0DA 1U8OB 1ZK9A 1MCCA 3LHPL 3G5ZB 4HS3A 4EI5A 2RBLA 3SDAB 3V4PL 1DL7H 4OJFH 1IBGH 4HPYH 3RPKA 3WNLA 4M62H 2WLZA 4L4JA 3BKJL 4XHJC 3QEQD 2A73B 1AFVL 4PR5A 1Q9OB 2AEWA 3B9EA 4JDZA 3WBDA 2XWBB 4LSDA 4EEEA 3QEGH 4O5LL 4OBSA 1YEHH 1NGPL 2R0WH 3LZFL 4NN6B 5I1HL 4IOFD 4YHNA 4KUCF 1MF2H 3MZGB 3WKMH 3WLBB 1RJZB 5DEFA 3HNTH 1IAOB 1IQDA 5E9DD 2BMKB 4M6NL 5CP3H 4NZJA 1U91B 4NQUA 3VWJA 2H45A 2HJKA 2YUXA 4HV8A 5GISL 1TTFA 4KTYA 5T1LD 3HPJA 3K0WA 3I6GB 1T04A 1N3NA 3JWDL 3K81A 4X7FC 5MENE 2FRGP 3WNOA 4X8JA 3D85A 4HEME 3HUJE 2KUTA 2I9TA 4JFZH 5ISZA 2IAND 3FFDB 1H8NA 1KACB 3LB6C 5IHZB 3L3HB 3VXRA 3VXSE 4WFFE 5FO7B 5EA0H 4R4FL 1JNJA 3MRMA 4Y19D 4DZ8B 5KSAD 1XMWA 4UILH 3C2SA 4H25B 4F58L 4M7JH 4KZEH 1RUPH 1UJ3A 4KJQD 2KPNA 4MCYB 3RVWC 3UEZA 3UTQB 1SMAA 2CMRH 4QT5A 1T1ZA 5GJTH 1KCVH 3LS4H 1U8KA 4HMDA 3RJQB 2NY5C 2ZNXA 5JW5B 1WCQA 3UX9B 4F9PC 5I1EL 1S7SA 3EYUL 4OFYD 2VUYA 5JQ6L 1XCQA 1VACB 1JMXA 1KB9K 3SGEI 3F12A 5C08B 2YD5A 1PG7X 3DHJA 5D2LB 3T0EC 4ONOA 2CQVA 3HE6B 5JPMA 2B0SL 3G9AB 2ZP0T 4HS6B 1K4CA 5GGRB 3FONB 2YEZA 3PWPD 3SE8H 1P9MA 1KPUB 2EDRA 1QP1A 3DVNA 3REVB 4N8PA 3MLUL 3P30H 4Y16C 4WFEE 1ACYH 3PQYA 4MJ6B 4OLWH 4PJ7B 4XC1H 1GZQB 2YHGA 3BIAX 4OBRA 1B4JL 5DD5L 2J7LA 3JV4A 2AGJH 5CIPB 2VE6B 2VZSA 4PD4J 2D2OA 4OD2B 4M7LL 1RUAL 4U1MB 5E95B 1T89A 4DVBB 3TN0D 1M7DB 2RIKA 1INEL 3ZSTA 3MGTB 1Z5LB 1EAJA 4PBWD 1U92B 3IFNL 3OMZA 3IJYA 5T3XH 1R3KA 2E7BA 4QRRD 2UWEF 5ITFB 5F1NA 3BGFB 4RZCA 1FNSL 4CADA 5DYOB 4ZFOA 1SJVA 3QIWC 2V9TA 2IBZY 1YEFH 4I2XB 4JRXB 4ODSL 3D69B 4L3EB 4RFNB 4ZUVA 1HSBA 1IT9L 2VJXA 1NBYA 1IAKB 2AABL 4KMLB 2DQJL 1I8LA 2NPLX 1CGYA 4JY4B 4JZOA 4LIQE 3RA7H 3S6CA 4TUKH 3VRIB 4GAJL 4TSAH 4EI6A 2VH5H 3B2VH 1U3JA 3UTTA 4HUMB 3WMSA 1DUYA 2UY7A 3D2UD 3TGXA 2EDEA 1N4XH 4G8EA 2WUBH 4JY5L 3VFVA 4FQXC 3SE9H 1ZMYA 3BN3B 4XNXL 4EXPX 1XIWC 3B2UC 3QXUA 1N2RB 1CDBA 5C0NC 3D25B 2HRPH 3C8DA 4PJ5D 5C0GA 4YPJA 1VADB 5KVFL 3S4SG 5CILL 3ZDYF 3S36L 1NEZG 4EN3B 4NCC1 3L6FB 4GKNA 2YRLA 2QLVB 4OSUH 1M7XA 5ISZE 1MPAL 1S7UA 1E0OB 3NCYS 2WK2A 3P9MA 3VXRE 5FB8B 5ID0A 3P0YH 1OARH 4PJXB 3MX0A 4FQ2H 4HPOH 5IFHH 4PJFF 3WD5H 2P5WD 5EZJB 3KHOA 1NFIB 3OAZK 3MFFA 4P48A 2Z91A 3FZUC 5IHUL 2BVYA 3VGGA 4TVSa 1F4YH 3NCJH 3QEUB 3MLYH 5IROC 3KYOA 2FIRT 1A6PA 3C2AH 4JLRA 1WWBX 1LNUB 1EO7A 2XI9A 5SWSB 4V1DA 2PO6C 2VDLH 1FGNL 2KKQA 1W0VA 1RZ8A 4GRLC 5DO2C 2XA8L 3FTGB 4ONFH 3WXWH 4UT7L 1AKJD 1H5BC 5J6HB 1J10A 5JMOC 5F3HA 2IG2L 1BVLA 3EOTL 4FQXB 4ZO6A 2VLKE 3C9NB 3EDKA 1HH9B 3OB0H 5LGJB 2DMCA 3OAUL 4QHNA 1RUQH 3HB3C 4X7SH 4HKJB 4HKZB 3O9WD 1KGCE 3IKKA 3PP4L 5INCB 1JGLL 2YBRA 3C60B 5DFVC 4OV5A 4Y4HC 4NUGH 4KQ3H 5HJ3B 5LBSH 3C09C 5I1CH 1U8IA 3RKDC 3V0WH 4ZPTB 2DYPA 2ID5A 3LIZL 4J1UA 4OGXL 4TSBL 3W0WB 5MHSD 1UADC 3RWEB 5HHVL 5IB2B 3MV7B 1IM3A 1N7ML 1QUNA 4DGIH 3SGDI 4M93B 5A1AA 5EZOH 1FGVL 1FL5A 5HPOA 4AG4H 1J5OL 4NCDA 3LHPH 3QIUD 2VLRB 1ZOXA 3RI5F 3TNNB 2EXYD 2OR9L 3BUTA 4P4KD 43C9A 1OGTB 3LKPB 1KIRB 1MRFL 5GPRA 3ESVF 2CKNA 5FF6A 2CXKA 2FEDC 1YECL 5HYJB 3QNXA 1AFVH 4PRIB 2VZUA 1CL7L 2DLHA 3S35H 1CFSA 1I75A 3U0PA 4QXTB 4JVPA 4O5LH 4BUGA 2VIRA 3WEXB 2IH3B 1NGPH 3LZFH 4UINL 5I1HH 4H1LA 1PX3A 1U2CA 2UUDK 4GUPB 4E42B 1IGTB 2AJSL 1QLFB 3B9KB 2YPLB 3GSRB 3G6JF 3FB7A 5E2TL 3BZ4B 4APQC 5CSBA 5F6HI 1BBJB 2ITCA 1N6UA 1Q1JL 5B39G 5GISH 3UTSA 1CICC 1CXLA 2X4TA 4JO4L 3MA7B 3JWDH 5IQ7L 1KG0B 2FWOB 2G5BB 3L3GA 1NCDH 3SDXA 3T2OA 2CIKB 1Q72H 5FYJL 4NO5A 1VEMA 2VB5A 2WW8A 3T4YB 1MHPL 4NFBA 3UTTE 3HZMB 1J0HA 2HVKB 2UYLA 1ZHKB 3BPNC 3SDCA 1T5WB 4R4FH 4YAQA 2YSSB 2Z4QB 5JTWA 1Q9WB 2AP2A 2ICWB 5D71L 4NC1E 1IZJA 4LSSL 3LRSA 1QR1A 4F58H 2CKBL 2O5ZL 1CFNA 3UBXG 3VA6A 4PS4L 4PJAF 3WYRA 4RMUA 4ZAKB 1UA6H 1BREA 1EEZB 1NGZB 4PRAA 2PXYD 3BQUC 5I1EH 1RY7B 2FJFA 1WJ3A 4FXKB 5ESVB 5JQ6H 1FVCA 3X12A 2NXZC 4HGMA 2DIJA 4POZD 4RMRA 1FZJA 1D5ZA 1G6RB 4ODWA 5E94B 3ES6B 2B7DT 4NKIH 5IV2A 4LFHD 5FYLH 3IGAA 2B0SH 3VG9B 1T5XB 4PJCA 1S8DA 2GTWA 1F3DH 2VXSL 1FFNB 1QZ1A 3TYGL 3KPNB 3H8NA 4EUPG 2P5EE 2ARWA 3MLUH 3WS6C 1FFPB 5GGVL 1NMBL 5DQ9A 5EU6E 5FOBB 2LAAA 5DD6A 3NIGE 4M8QB 1B4JH 4KXZH 4LMQE 4V1DE 3NIDE 5DI8B 2QSCL 4C56B 1R3LB 1P5UA 3DUSB 4DCQB 4M7LH 4Z5RA 1RUAH 3SDDD 2EYTA 1RHFA 3EZ8A 2GQHA 4ZOBA 1NC2A 5J1TC 5CBAA 3HC0B 3VWKC 3ZDXF 4PJGA 3IFNH 5DK2A 1HDMA 5F3BA 1DUZA 3KYAA 4UB0L 3VE0B 4Y4FD 2Z31A 3PDDA 5I74B 3L3DA 1FNSH 2RCSL 3MYJB 5DQJB 5J1AB 3RNQB 4NT6A 3S3PA 4IRJB 2DB8A 3RWHA 3MOQA 3LS5L 4ODSH 4ODBD 2NTFB 5IG7A 5DS8A 4WUUD 2VDRL 3FQTB 5IQ9B 5FA3A 5F8QC 3QUYC 3AREB 3L3OB 4KI5D 4ONHA 5HGHB 4IDLA 1MELA 2DQCL 3HZKA 3LKOB 3ZDYE 1JJUA 3EHBC 1OTTD 3DSFL 4LK4A 4PGEB 3ULVD 4GAJH 5IBTL 3WIFA 3MZTA 5JORA 2OL3A 3MRRA 3MGAA 5JO5A 3AGVA 1HH6A 1RULL 2A9MH 1JFQH 1QD0A 4U0QB 4X9IA 4QF1B 4F8TA 4JZNB 1QHOA 3O6ML 4MZ3A 4JY5H 4K2UL 5DHYB 4XNXH 1LE9A 3GUTA 1ETZB 1JTOA 3U36A 5CMAA 3MRJA 4MAYA 2FD6H 1EHNA 3UTSE 5KVFH 3MLVL 5CILH 3S36H 4JEGB 3ROOB 3U30B 5FYKU 5HYEA 5DR5L 3EOBA 1AXSA 2Y25A 1MREL 2NY6D 5E1AB 3VWJC 3LV3A 1MPAH 1A6TB 1GOGA 3L7EA 4MMXC 4OZHF 3C5JA 5IBUB 3ROLB 1JMZA 1A9BA 2DM4A 1UZ8A 3MBEA 4H88L 3OKOB 2PN5A 4HWUA 1RK0B 4U3HA 4H26A 2HTLC 5SWQA 4F15B 1DN0B 1PG7L 2I07A 5CCKH 3VFUA 2WBJA 1IEAB 1I8IA 3IU3A 4JM2B 5DK0A 1KTKE 1DBAL 3DTXB 4HS3B 1UJ3C 5EDXA 4EI5B 4U1KA 5GGSY 4HS8L 2XA8H 5L2KB 3BEWB 3N1FC 1KB9J 4UT7H 1PKOA 2GHWB 2DLIA 5EO9B 4LHUG 4U1HB 4EIGB 3EOTH 5C9KA 3O0RL 3OAUH 3QB7C 1S7RA 4GQPH 4PTTA 3SCMB 4JFXB 4G43A 4OIAA 4PJHA 5D7JD 4DKEH 4B41A 4YHNB 3UCRA 4OF3A 4JKWA 3WO4C 1JGLH 3B6SA 5DEFB 5E8OA 5GSRA 4PP1C 5FCSH 1Q0YL 4FG6D 3KG5A 2HJKB 4HV8B 1KV3A 2PR4H 3LIZH 4OGXH 5DJ2A 3HPJB 5HHVH 1OSPL 1T04B 1N3NB 1N7MH 4K9EH 3TBSA 1XF5A 3R1GL 5TDPB 4QRPA 1FGVH 1NUFA 4IHOA 3IAQA 3SDAD 1J5OH 1T7WA 4CDGC 5KS9F 3SGJA 1YUHA 2EZ0D 2OR9H 4NYLA 1MRFH 3VRJB 4PJGE 1UM4L 1XGTA 1YECH 3MRMB 5E8DL 4EXKA 2YMXL 3MV8D 1X5FA 1T89C 4KRPB 1CL7H 1KLUA 2LU4A 4LOUC 3TM6A 3GMMA 3S9DB 4S1RL 2YC1A 3W82A 4CU7A 4G9FD 4QT5B 2Q7NA 4Z95L 3HRPA 3KR3L 4BYHA 1INQB 5F9WB 1FP5A 1NBZA 4NNXA 4JO2H 1RZGA 5IW1A 4HUNB 4DN4L 1ZA6A 5A40E 1S7SB 5KW9H 2F58H 2AJSH 4GG6B 1T0NA 4YDKL 1XCQB 1KOAA 3OXRA 2C3VA 4PJAE 2HTKC 1C5DA 3F12B 1PJ9A 4F9LA 4E5XA 1Q1JH 3QQ4A 4PBVC 5JPMB 1MJ8L 2V2XA 2EDBA 2X4NA 4P9HL 1HINH 3X3FL 3FFCB 4D94A 2YEZB 3TYFA 2ADJA 1I8LC 3JXAA 1AHWC 4KK8C 3DIFA 1H15B 1HKFA 1U0QA 2VISA 4MCZA 3U83A 1LO5A 3PQYB 1EAPA 2X7LA 4HUWA 4I5BA 5D71H 1VFUA 3JV4B 5E4EC 4LSSH 4G6FD 3A6OA 4XMKL 2CKBH 2O5ZH 1S5HB 4JPVH 4KJWC 4PS4H 4ELKA 4HZLA 2E9JA 4NC1C 4POYA 3RDTB 1FFRA 1ZE3C 5JNYA 2HWZL 3P11H 4DJMA 2DLFH 5IB4B 3IJYB 3ULUD 4GS7C 1YEGL 5F1NB 4IBLT 4L29A 3RPIB 4KZDL 1SJEA 4CADB 2XNAA 4G8IB 5D1ZA 4ZFOB 2VXSH 2ZNWA 3TYGH 3K8KA 5A3ID 1I7ZA 2XRAL 4Z76B 4GOSA 5CGMA 4R7DA 1IEBA 2GJ6A 2SEBA 3LQAH 3BH9B 5E2UH 1NMBH 5GGVH 3LN5A 1HSBB 5FM5O 3AS2A 1P5VA 4LEXL 2M1KA 1MLCA 2ZPKL 1B2WL 1FPTL 3LOWA 3ZE2F 2V7HA 5T5NG 3RTQC 3VFWA 3RNKB 2YA0A 2JJSA 2QSCH 2Y36L 4CN4A 2QHLA 1YEJL 4PY7A 5E8NA 3L3IB 4RQQB 4GMSL 1HXYB 3A67L 1YY8A 4NDMA 3UTTB 1CBVL 1G9MC 2HLFC 3QNZB 5CEZL 4PJHE 2LTQC 2HG5A 2XN9A 1U36A 3VFVB 4UB0H 4YQXL 4QLRA 1ZT4A 5IFJB 4NNYA 2RCSH 3A6CL 5E8EA 4L8CA 1F4AA 5C0GB 4JRXD 1CLOL 3TJEL 2Y6SD 1H3PL 1WFUA 4GS7B 4LBEB 4HIEA 1S7VA 4QRPE 5I16B 4E41B 1F3JA 1RVFL 3U7YL 1FNEA 4OCSL 2DQCH 4ELMA 3P9MB 4I18A 3OKEA 4M02A 2X2YA 5HHPB 1JGDA 3DSFH 5FKPA 2DIAA 5IBTH 2FX8L 4JANA 2CDGB 3MMEA 2MHAA 2Z91B 3QSKB 1ZWIA 4OZHE 2VR5A 4OFKA 2YKLL 2ESVA 1RULH 3OR7A 3KYOB 5GZOC 1FHGA 1D9KD 4JLRB 4KTEL 4HH9B 3O6MH 3QUXA 3ARSA 2EECA 4QNPE 4K2UH 4HIIA 3BJLA 4WI3A 5EO0A 3OKDA 3E6FA 3QJHA 1ZGLM 1RZ8B 1OP5H 2QADB 3N9GL 1MIML 2G60H 3QO1A 2DWDB 1A1NA 5H94A 2X4UA 3MJ9A 5F3HB 3MLVH 2FX9L 3OF6D 3SKOA 1E4XL 1YN6B 1DVFA 1ZGLP 4LLYB 5DR5H 4NOBA 2NY0C 1MREH 4JKKA 3T08A 2AXHA 1WIUA 1HEZB 1CK0L 3V5DA 4FP8L 5JHLL 2WWMC 5LWYL 4ZNCD 2X41A 4H88H 2YBRB 5CJOL 3TBWA 4FQHA 4ZG1A 4OV5B 1QQDB 1U8IB 4GH7B 4MS8D 3O4LB 4WFHD 2LVCA 4PV9A 1PG7H 4U6XA 1F02I 3SDCC 3EDFA 3ZDZF 2ZKHL 2NXYB 1FL5B 2I9LB 3TBYB 1DBAH 1U3ZA 1MJUL 2HYMA 43C9B 3H7BA 4HS8H 1HI6A 5HHOA 4PFEA 4DOHB 1CFSB 1MFAL 3BSZL 1J0YA 2I24N 3UYPA 3O0RH 2W38A 4PG9A 2VIRB 3B3IB 2F74B 4NQXB 4U6HA 4XPHL 2Z0BA 5DFTA 4PRDB 1ULVA 2MSPA 2Z93A 1AO7A 3C60D 4JFDA 4L9LB 3WV0A 3OKKB 4YO0B 1PW3A 4QHKJ 5LAXA 4EVNA 4MVBC 4OLUL 2XQYG 5T1MB 3RAJL 4L8DA 5L8JB 1Q0YH 4ESKA 3W0WD 5I75C 3FT2B 1GZPA 5F1IB 1JYXA 3QR2A 3NZHL 4HUKB 3NA4A 3T0VA 4NRZB 5F7HA 3KVQA 4MJIA 1OSPH 3JUYA 3AFLA 1ZANL 2R23B 3DX6B 3L3GB 3R1GH 5HI3C 2R15A 3SDXB 5I2IA 3IDMB 4NO5B 2H9GA 4MA3A 3BI9X 4MA7L 2C7UB 3OKLA 1XZ0B 3HCVA 1KN4L 3FB6A 3HMXL 5HYJD 4XB7A 2UYLB 2AK4E 3SDCB 4PRID 3SKJL 3OV6A 4LLMB 1UM4H 3AY4C 4Z7VB 2DI9A 2XN9E 1T7YA 5CJXC 5E8DH 2YMXH 1I1YA 1QR1B 3V0AC 1CDYA 2W9LA 4S1RH 1AXIB 1XGPB 3KR3H 3GJFH 1BJ8A 2QQKH 3GRWL 4PRAB 3DRQB 4HKXB 3ILQD 3QUMH 1KIQA 4DN4H 2KZWA 2Z31C 5ABDE 5JIIA 1ITCA 3MLSL 4IRSB 4RIRA 1VHPA 1IAII 1BJMA 1FVCB 1QBAA 1FFOA 3X12B 1JPSL 1A7NL 1ODAA 1ZSDB 5FGBA 4DN3L 2HVJA 2AQ1A 4KDTA 3IGAB 1L7TL 3D0VA 4PJCB 1S8DB 2XWJB 3X3FH 4HJ0D 4KJPC 3B83A 5I75B 1CD1A 4TVPH 1F8TL 1U8QA 3CZFA 3V0VA 1KELL 4YDIH 2ESVE 1MJJA 1U58A 1V3JA 2HFTA 3ZHDA 5DD6B 4YK4B 2YR3A 3MNZB 4ZAKD 4XMKH 5HDQL 3JUZA 2VXQL 1YEIL 3NAAL 3CFKB 3MCLL 5EPMB 4Y4KA 2ZOKB 1OB1A 1FNAA 2V17L 2DKSA 3ZE2E 2JB5L 4XWOD 2EYTB 3KJ4C 2QHRL 4HGKC 1NC2B 3LQMA 3MUZ1 5JHDB 5IR1B 1MHEB 3J8F7 1MJ7L 3O6LL 4MAYC 1HWHB 3TIEB 5FCUL 2WM0A 5DK2B 1HDMB 2OR7A 3FN9A 1QLEL 5F3BB 4U31A 2Z8VC 4WY7L 3T0AA 3G5YA 1QKZL 1N0XL 5IVXA 1RAMA 4Y5YA 3QQ3A 4CN1A 1T0MA 3MJGX 4Z0BL 2PTTA 2XRAH 3ZKSD 3MBEC 1BZQK 4G3YL 3N1MC 3QDGE 1OWWA 5D5MF 3UZVB 3Q2CA 1OM3H 32C2A 1P6FA 1B0WA 2ZPKH 1B2WH 3V8CA 4JPIA 3C5ZD 1GPOH 1YPZA 1ZXQA 4GLRI 4HF5H 2JB6A 3PNWB 7CGTA 3HNVL 3T3PF 2Y36H 4B50A 1YEJH 4GMSH 3QULA 1VGEL 3ARUA 3A67H 5IW3A 5JORB 5IKCA 1OTUD 4HLJA 1CBVH 1DR9A 3K7UA 2OI9B 5HI4D 4YHZL 1AO7E 5CEZH 4PB9L 2ZUQC 4N8CL 1RURL 4OT1H 4P3CL 4YQXH 4ETQB 5CHNA 3RZCA 4IRJD 5CJ8A 3GUTB 3A6CH 3U36B 3FN0L 1U2HA 3HI6H 3MRJB 4C83B 1K3IA 3KXFA 3N50A 3CDGA 3TJEH 4I0PC 5TE6L 4MJIE 4Q6IA 1H3PH 4KK6D 2WP3O 1OP9A 3MRIA 1AD9A 1KB5L 3LV3B 1BQHA 1RVFH 3U7YH 3WXVL 4OCSH 4DKFL 1NUDA 5F9DC 4XRCA 4A6YL 5DVKA 4PRHB 4MAUL 1UZ8B 5SV4A 4GG8A 2NY4C 4U6TA 5E03A 1UWEH 3EJZC 4MB3A 2FX8H 1KEGL 3SGJC 2YKLH 3DBXB 2I07B 3LDBB 3VFUB 2WBJB 5DGRA 1BVZA 1I8IB 4MMZC 4GKZA 4F80A 4KTEH 5JA8B 5DK0B 1CFTA 4OUUA 4GBXA 4YXLH 1KCRL 1U93A 4U1KB 2ZUWA 4D0CB 1MCWW 1PEZA 1T22B 3N9GH 2VL4A 3ZDZE 4BQ9A 3KDMB 5T3ZL 4P2YA 2FX9H 1E4XH 1NGYB 3ZTJG 5CGYC 4ZTPL 3KLAA 1S7RB 4J6RL 4AIOA 5DUBA 3ULVL 3LKNA 4PJHB 4L4VA 4M3KB 4FP8H 1QBML 5JHLH 5LWYH 2DQIL 3B6SB 5E8OB 5CJOH 1NLDL 1KFAL 1WC7B 1FFQA 3OKMA 5IB5A 5HVGB 1KJ2L 2VZ1A 2P8MA 4JM2D 5DVMA 3TBSB 3ZLQC 1XF5B 4J8RB 5I8EA 2EC9U 4XP5H 2ZKHH 4IHOB 3P73A 5C07B 1MHCA 4ZSOA 3ESUF 4NQCD 5D9SA 5L2KD 1PSKL 3B5GA 2MCG1 1MFBL 1MJUH 1Y6MR 1YUHB 5TQ2L 4NYLB 4W4OC 3MNVA 4PJDF 5HGAB 5E1HB 2Q86B 2XWTA 3CD4A 3JTTA 1TIUA 1MFAH 3BSZH 3SCMD 2YC1B 5IVXE 3UBXI 4XPHH 1P53A 2ZZUT 4F8QA 4NNXB 1RZGB 1WLHA 2NY3B 5IW1B 5EOCL 1KCUL 4OLUH 3OXRB 4NO0B 4IOIB 1K4DA 1YC7A 3NZHH 5L8LB 4E5XB 4UU9A 3V7MA 3OSKA 4RWYL 3TO4B 2B1AL 3GB7A 5I30L 2V2XB 1B9ZA 3LSOA 1QSZA 2X4NB 1G7JA 1IAIM 1C5BH 2ADJB 4MA7H 2H32H 3PGDA 4QRQA 3T09A 3ZE1F 5JIHA 1KN4H 3HMXH 3DIFB 1FC2D 5CZXC 4MCZB 1BOYA 1R0AL 1EAPB 2E6QA 2ENSA 2X7LB 1UM5L 3FB8A 3S88L 2VDOL 4I5BB 2IAMC 1GAFL 1T6WA 2F53D 1JV5B 1I85A 1J88A 4HHAB 3E6HA 3RVTD 2B4CL 3CIQA 3FQUA 3QCVL 3GRWH 3RVUC 2YA2A 5IK3B 1LEKA 5GRYA 4HUVA 2ICES 5JNYB 2FNBA 4TULL 1I8KA 4TRPL 5A16A 1JPSH 1A7NH 4GMTH 4MLIA 5C1MB 4P2OA 4DN3H 3MO1A 5BJTA 4GRWB 5CS7A 3FFCD 4NCC2 4L29B 4LKCA 1T80A 1L7TH 1XGQA 1YQ2A 4YC2C 1SJEB 3LKSB 2XNAB 3P4OB 1BZ7A 1RZJC 2OXGA 5D1ZB 2D7OA 2YUVA 1F8TH 3PQYD 1XGUA 3KPMB 4I18C 5E2WH 1C16B 1KELH 1I7ZB 4LSVL 4LLDB 5JOEA 2ZCLH 4R7DB 1IEBB 2GJ6B 2SEBB 1NKOA 4Q7DA 3LN5B 4OZFG 1K9TA 2D0HA 1LDSA 1FJ1A 3LKQA 3K3QA 4OF0A 1S3KL 1MLCB 4YHML 2V7HB 1PYWA 4Y1AE 1FAIL 5HDQH 1YEIH 3M1BA 1IMHC 3HKFA 1ONQB 3MCLH 5A2LH 1MAML 1JF1B 3RDTD 5LGKA 4HCRL 2MJWA 4PY7B 1NANI 5E8NB 5T1KD 2V17H 2ZSVB 2JB5H 4Q0XL 5I18H 1FZMA 1X44A 2O5XL 3HI5L 4MNQB 1ITBB 4X9HA 3GEWB 4QHUB 1MJ7H 3GSUB 3O6LH 1PX4A 2X6MA 3IDGA 2DDQH 2G9HA 4ZFFA 1AGCB 3FQWB 4JREB 4HXBH 2HG5B 1QLEH 2XN9B 4H1LG 1DVFC 3IVKA 2Z9TA 4U1JA 3BP7A 4Y7MA 3RWIB 3TT1H 1ZT4B 3S97C 2G2RB 4ZTOL 5I8OL 1QKZH 1G7HA 4NNYB 1FQ9C 1N0XH 5E8EB 1IL1B 4HFWA 1TVHA 4XNYL 5B3NA 4ZUSA 3VCLB 5LQBH 3CFCL 3LAFA 5L0QC 5F6HJ 4Z0BH 4U1IA 5DRZB 3UTPD 2ATKA 5IM7A 4G3YH 5ERWA 1A6ZA 5AEAA 1VENA 2VZ3A 3HE7B 3UO1H 4ZSOE 2WNGA 3I3EA 1HQRA 4X5WB 1FNEB 3RUGA 1SY6L 3LCYA 3MV9B 4LSRL 4ELMB 2VLJD 5ETUA 3FMGL 4I18B 2YXMA 4W6YB 1K5NA 2QSVA 3W39A 4JFOB 5JOFA 3HNVH 1MFEL 2H2PD 1LK2A 4K3DL 3F62A 1JGDB 1C7TA 2X1PA 2ZUUA 4B7IA 1BEYL 3QYCA 2CKBA 3VXMA 5GHWL 4KK5C 1VGEH 2HFFA 5DJCA 3ULUL 1OD7A 1YYLL 1ZWIB 3P4NA 5IESL 3OR7B 3V6BR 3CDYA 4FQJL 4YHZH 1NBVL 5B8CB 4N8CH 1RURH 4PJ9A 5I15L 3QUXB 4S1SL 5JIPA 2GUOA 4ONGL 4DGYL 4HIIB 5EO0B 5K93A 5ACLA 3QJHB 2GI7A 4ZQKA 3FN0H 2G75B 3QO1B 4FTVA 1A1NB 1HOCB 1J05B 1MRDL 3OG6B 2XKSA 1MHHA 1E4JA 4E41D 5IEKA 2ARJQ 2DLEA 4OGAD 2DD8L 2J8UA 1X3DA 3MRFA 5C0RL 4Y0GA 5BV7L 3WXVH 4FQCL 4DKFH 3V5DB 3VD7A 4A6YH 4NKOA 3TBWB 1WGOA 3WFDL 5D1XD 4O2EA 4CAGA 4AM0A 2D7QA 1KEGH 1ZHBA 4U6XB 1BHGA 2O93L 3VFOA 5HYSA 3VXNA 3QFJE 2QL1A 2Q1EA 1LVEA 2WSKA 5CLTA 4BK4A 1R24A 1I4FA 1CD9B 2QADD 1JHTB 1IE5A 4XAKE 3QQ9C 3H7BB 1AGBB 1FLRL 1HI6B 2HP4A 2PW1B 4YE4L 5HHOB 5T3ZH 5EBWB 1O7VA 3A6BL 4RGMB 3O3BA 3Q3GA 1N64L 4PJDE 4XTRD 4U6HB 4J6RH 4OLYL 2Z93B 1AO7B 1GGBL 5HVFB 2F19L 4GW4B 4KDTC 4JFDB 1DLHA 1QBMH 2DQIH 1VESA 3EYVA 1VPOL 3BKYL 5SV3A 4WHYH 5LAXB 2YWZA 4N0YL 4EVNB 3O4LD 2J8HA 1KFAH 4UIKL 1GZPB 3KLSA 4KKBD 1KJ2H 3VFMB 5M7QA 1X5IA 2E9WA 2OR8A 4QY8A 4OZGA 1UEMA 2X9YA 4YWGL 4MJ4A 3F7YA 5IVZA 3TVMA 3IB4A 5FHBH 1NMCC 1EXUA 4R2GC 5I2IB 3R06A 4MA3B 2DQDL 2Y5EA 3OKLB 3HCVB 3QAZC 2EKSA 1MCEA 1PSKH 3FB6B 3KLHC 1MFBH 2FBJL 3UROR 5TQ2H 3NVQA 4Y4KC 1JHLH 2C3XA 3IU4H 2WBKA 3RBSA 4J7RA 3NPSC 3VFPA 4M1CD 3QZWA 1WVZA 2VERN 4JKLA 3TA3C 1FG2B 3HFMH 1AXTL 1FO0L 2MCPL 1NGXA 4MNGA 5E2VL 1BAFH 5FYJE 3KYKL 4DWHA 3PHSA 5EOCH 5JLZA 4RIRB 1KCUH 4Y5YC 1FVEA 4MA1B 2HKHL 4KROC 3PE9A 2V5SA 5GS0C 1OTSD 4RWYH 4YLQT 3RX8A 2B1AH 5I30H 2A6JB 3D0VB 3JBG7 3KPRD 3H42L 1CD1B 5C0CA 3HZYA 1U8QB 3V0VB 5FGSA 4XCFL 3RHWK 1MJJB 1U58B 1R0AH 5D1QD 1UM5H 3B5HA 3S88H 3CK0L 2CR3A 1GAFH 2NX5A 3UZEA 4QO1A 1KTDB 1WAAF 5C0BA 2B4CH 4JFYB 4FTVE 3T4AA 4IRSD 4JN2B 2NY2B 4M6OL 4JRYA 1E6OL 1K2DA 3RZCC 4BSWA 3W9DA 4ZPVA 2J8UE 2QKIA 4F7PA 3ABZA 4TRPH 3MSPA 3JVGC 3TT3H 5MP6L 1WEJH 3UPCA 4Q6IC 1T83C 5DFWH 4ORGA 2EDQA 5GIRA 3N85L 3G5YB 3OQ3B 4X6BA 1T03L 3DVGA 2IGFL 1TQCC 5IVXB 5EOQL 3PL6C 5HVHB 2VO5A 1ZLUK 5KVGL 5CSGA 1R3JB 3G6DL 5ECJE 32C2B 5FECA 5BS0B 4Y5XB 1S3KH 2OK0L 1FAIH 3I02B 1YPZB 5EUOF 1TPXB 2JB6B 1MAMH 1SEQL 1D5XA 3IDIA 5BW7A 4HCRH 4WGVB 5JHDD 1AGDA 4GBXC 3U4EA 1YNTA 3FO9A 1J8HD 4TYUA 2MQCA 2O5XH 1SYVA 1IRAY 3HI5H 4FFWC 1OOAA 2DJUA 1TZGL 3BVNB 4NSKB 5DJYB 1LEGA 1TVBA 4AEFA 3VGBA 1BP3B 2P48B 1KPVA 3MA9H 4S1DD 3GMPA 5TJWK 1FE8L 2EEBA 1Q94A 2EDJA 4ZTOH 3RZCB 5I8OH 3UTZA 3V6ZA 2NR6C 3DXAD 1GGIL 4XNYH 5D7IA 3TCLA 3U7WL 3KXFB 1F6FB 3CFCH 2NW2B 1HIML 4OZGE 3LY6A 2H8PB 3QEQA 5J7CC 3EFFA 5E08H 1AD9B 4QEGA 4PLJC 1AD0A 1SY6H 1WCBB 3GMRA 4LSRH 4XRCB 2RAMA 3FMGH 5EO1A 5J3HC 4OFIA 1MFEH 4P5TC 3K74B 4K3DH 4GG8B 4ZXBC 1V7NL 3MJ7A 1BEYH 3UZQA 3IDXH 3QDMB 4XBEL 4NM4L 5GHWH 3BDYL 3MV11 5E9DA 3ULUH 3QDHA 1YYLH 2VQUA 5DT1L 3O3DB 5IW6A 4XVUC 5IESH 2ARJB 3V5KB 4FQJH 5T1LA 1NMAL 2QSQA 2Z35A 4EQ3A 1NBVH 1YY9C 1X5KA 5I15H 4S1SH 2Z8WC 2IALA 4ONGH 4DGYH 4Z78A 2IANA 1P7HL 3BOVA 3NFNA 1D5IL 4N1CA 5CIPH 3I75A 5DMGC 1MRDH 5IFAH 2VLLA 5GGQL 2XKNB 1UH3A 4Y19A 4KVNL 4M5YL 5KSAA 2DD8H 3KLAB 4NN7B 3U9PH 4PRHD 5DUBB 5C0CE 5C0RH 4KKAC 3CSYA 3EYQC 5BV7H 3D3VB 4L4VB 2Y5TA 2C3WA 1YC8A 4OF7A 1Z9LA 1FG9C 3OKMB 3WFDH 1E27B 4OFYA 1RZFH 5FM4A 5IB5B 2WBJD 3WE6A 3LD8B 2NX5E 3QIBC 5EIIB 5LGHH 1SHMA 3U0WH 3LPFA 1OGAD 1HHIB 1QBBA 5EFIA 2NZ9C 2ZUXA 3Q5TA 4XBGA 5D2NA 3LPWA 4OFVA 1I85C 3PWPA 4N68A 4QWWD 3CFDA 4MXWL 2ZUSA 2DI8A 3VXOA 3MXVL 5CLWA 1EIBA 3JTTB 5BVPL 1WZMA 3A6BH 5DD3L 1HHHA 1CGSL 4X7TA 1N64H 4JPKL 1P1ZB 3OGOE 4V2CB 5EZLB 4P2OC 4OLYH 3N06B 1GGBH 2GCYA 2F19H 4NJAH 4L3CB 3WJLA 4Y2OA 2HMIC 5M94B 1K8IA 1KCKA 3BKYH 2X4OB 3TN0A 3BPCA 4UIKH 1K4DB 1FV1B 5EG6C 1S9KC 4S10A 4IS6B 4P4RA 1WBXB 4TTDD 3GB7B 4JFQA 3HPLA 5C07D 3LSOB 4HT1L 4QRRA 4LQ1A 3IAPA 4YWGH 1DZBA 1FL6B 1G7JB 2R39A 3EAKA 5DWUL 2R4RL 5FDWA 2DQDH 3PGDB 4RGNB 4QRQB 4XHJD 3FN3A 2FBJH 1L4IA 3MRBA 1U8NA 2B8OT 4OI9A 2IMNA 2BSSA 2Y4SA 2AKRB 3FB8B 5CJBA 4PGDA 3IFLL 1IGMH 5D7KE 4WO4B 5AZ2L 1I8MA 3ETBF 4HUUA 1W2KT 1AXTH 1FO0H 2MCPH 3E6HB 3GSNL 2K7QA 2QBWA 5JR1L 3FQUB 5E2VH 4XBPB 1LEKB 5EULV 4QOKD 4HUVB 3KPSD 4NO0D 3K80A 2WINA 3MJ8B 5I71C 5ITBL 3TO4D 2VXTL 1X6LA 3K4DA 5FUCE 4P2OB 5F1SA 3D2UA 1FIGL 2HKHH 1FVDA 1C8PA 1G1CA 1HYRC 3EIFA 4JHWL 4OCRL 2HT3C 1O5DT 1T2XA 3IKCA 2E7CA 2QQLL 2AK1H 3H42H 3MJ6A 3P77A 1IQWL 4CVZA 4H20H 5E9DE 5C6WH 1XGUB 4PJ5A 3ARBD 4XCFH 2PW2A 4KFZC 4EQ2A 3HR5B 4BM7A 2A83A 1HWGB 3UYRL 2A6IB 3TJHD 4PREA 1FJ1B 1N8ZB 5JW4N 8FABA 3CK0H 3GKZA 1PYWB 4JJ5A 3GBML 4ZYKA 3QEHA 5BCAA 2IANE 1O7SA 4MXQC 1P2CB 1GH7A 3BZFA 1JI1A 3QP3A 4M6OH 5GGTA 2XV6B 1E6OH 1R5WA 4Y19E 3PWJB 2IWGA 1C7SA 1IC7L 2KQNA 5DDHB 4K3JH 4HDIA 3OTTA 5MP6H 5I1IL 4UQ2B 3IDGB 2G9HB 4ZFFB 4UNVA 4K8RL 3KAAA 3WLWD 4U1JB 3BP7B 1RZIA 3N85H 3GM0A 1T03H 2IGFH 1TVHB 4Y16D 4OCWL 1DBBL 1EDQA 1RI8A 4HIJB 4ZUSB 4UBDC 4CU6A 2XZQL 4K71B 5KVGH 2GJ6D 1EEQA 2FGZA 4G7VL 4U1IB 1AKJA 1KCSH 3G6DH 2ATKB 5ERWB 1A6ZB 2H32A 5DA4A 5KG9B 5KN5B 3HMXA 3F7QA 3OAYK 1LE5B 2UWEB 5L6YL 1RHHA 3RUGB 3T8XB 4L5FH 5D2NE 5ETUB 3BYTA 2B5IC 2OK0H 1NCAL 3PWPE 4LCIL 1JL8A 2FEEI 2XXCB 1KLFA 1DQTA 1WITA 3O9WA 4XGZA 3SGKC 3W39B 1PY4A 1SEQH 2F5AL 3KPQB 4GKSB 4PRBB 4JFEE 1DBML 2CKBB 1H3TA 3RX5A 4MNQD 3VXMB 5J0BA 4RSVA 3S37X 2HFFB 5DJCB 2AW2A 5C09A 4DEPB 5DRWA 1DP0A 3P4NB 3GRWA 5JPNA 1TZGH 3V5HA 3RHWF 1UFUA 4IIQA 4NO2A 3KWWA 2DMBA 4FQLL 3CLEL 4PJ9B 1ZV5A 3O41A 3RQ3A 4H0GA 4CW1A 4QXWA 5CINL 1FL3A 4G80A 3MODL 1ACZA 1UWGL 2AJVH 1GGIH 3U7WH 3IFOB 4P4KA 4PRNA 4FTVB 3WFHB 2H6PA 2EH7L 5IMOB 3HE7D 1MHHB 3HG1B 1KTRL 2FYYA 4QHLA 4QRRE 5IEKB 1CU4L 1QSFD 2GK0A 3MV9D 2EE6A 5F7YC 3P4LA 1U8HB 3MRFB 2NLJA 1T1YA 4XB8A 1N59A 2JELL 4LRNH 1JRHI 2C1OB 4NKDA 4NKOB 4WV1A 2OBGA 1F4HA 4W4NA 2HT2C 4WTXA 3FO0L 4IJ3B 1RSFA 2FH8A 4LASL 3G08B 5DT1H 1CDGA 1ZHBB 3FCTA 1UH4A 3SJVD 5J13B 1XIWD 1NMAH 5HYSB 2CH8A 2KQMA 3STZB 1U95A 1I4FB 3QUKB 1AQKL 4I3GA 1MIEL 1NBQA 2P42B 1IZKA 2D7TL 4PJFB 3EOAA 3FRPA 1D5IH 3U9UA 1CIUA 3IAGC 3V95A 4XXDA 5IVNA 2YWYA 5GGQH 4KVNH 3O3BB 4M5YH 4LCYA 4ZS6D 3D39B 5CZVL 3ARVA 5ICYA 1KPRB 3R0NA 5J89A 5BMFL 3ARQA 2CLRA 2MMXA 3EYVB 3RVXC 3CXHJ 4OD1L 2PXYA 4R97B 3CVIL 3V8OA 5TDNB 3Q5OA 1A9EA 1CDJA 4XVTL 4QY8B 1K3ZA 3U0TA 3AU1B 4WI8A 2AJZB 3F7YB 5IVZB 3TVMB 1WBZA 5DO2D 1UXSB 4CUCA 4PIRF 3R06B 3NMEA 3WIHL 5ESAA 2P5WE 1K85A 1DQJA 3ZHKA 2A1WL 2EKSB 3BXNA 3F65A 1R6VA 3ARGB 1E4KA 4NQED 1RZKL 5F9AC 4WI5A 3HS0B 3MXVH 3VFPB 2XACC 3MUHL 2JCCF 4UT6L 3HB3D 4HIXL 3RVVC 5BVPH 1BQUA 5DD3H 4FN0A 4D9RD 2CO7B 4LMQI 2GSIA 3VXUD 4JDTL 5JOPD 1NGXB 4JPKH 4MNGB 5EB9A 1IGIL 1PBYA 4PRPD 5DFVD 5A43C 1M4KA 1KB5A 4F7MB 1I1RA 5JLZB 3SDDA 1TQBC 4MYWB 4A6YA 3BRDA 1FVEB 3DRTA 1BQHG 2A2QT 1TZIA 5FO9A 3L5WA 1FRGL 4G42A 4HT1H 5K9KA 4X6DA 4EJ1C 1U6AL 2OLDA 4X0KB 5DWUH 1BD2B 4LU5L 4Y4FA 1PKQA 2R4RH 5JIKA 2UZIH 3VGDA 5DZNA 4LCWB 3HZYB 1QBLL 2FEDD 1UEYA 1J7VR 1TCRB 4ZUTA 2JIXA 4K7FA 5GS1B 3FKUS 5TFSL 5MHSE 1KXVC 4WUUA 4XC3L 2EDYA 3HAEH 4J3OC 5FGCE 4O2CB 3IFLH 3NCCB 4N0FA 1QOKA 1CT8B 5AZ2H 3V79C 3FOMA 4QRSB 5J11B 5C0BB 3T1WA 3GSNH 4L3AA 3WFZA 3UJJL 4URTB 1FAKT 4LGPB 3OJVC 1Y6NR 2ADFL 4JRYB 1K2DB 3EYOA 3ARDC 4BSWB 4ZPVB 1KXTB 5TE7L 3WJJA 3G5VA 5HYQA 1BQSA 3RIAK 3TPUB 1FZOA 4P9HC 2NTSP 2CIIB 1FIGH 4XI5D 4ORGB 4OCRH 1J11A 5GIRB 1KJ2A 2BSTA 3DVGB 1EK3A 2QQLH 3DV4A 4X4YA 5MEND 3UXFA 5FUCC 1IQWH 2BNQD 2EC9T 3JTSB 4PJIA 4TNWK 1JWUA 1SBBA 5EU7E 4V2BA 1G7QA 5DJXA 5DTFA 4K7PY 4P3DA 5E6ZA 2H1PL 2MQ0A 1NLBL 3INUL 4YBQD 4FQIL 5F72S 1C5CL 1ZLVH 3GBMH 2RJMA 4LCCA 5F93C 5JW4M 3BQUD 2YK1L 3IDIB 4H8WC 4I77L 3U4EB 4O51A 3FO9B 2JTDA 4JQVC 4Z7WA 3GJFB 1CDUA 1SYVB 3HR6A 1IC7H 3QUMB 1LEGB 5I1IH 1KPVB 1BM3L 4M6AA 2Y1VA 3GMPB 4PV8A 5BO1L 1JGEA 4D0DB 4K8RH 2OYPA 5IJKA 4Z18A 5KSAC 3ARFB 5FYJU 1CFQB 4LLUB 5DMJB 3GMLA 5ICZA 1EHLL 3V6ZB 3AROA 4KJQC 4OCWH 1DBBH 5HGBB 5D7IB 2RHEA 4LDLB 2XZQH 2CPCA 3BEVB 1GOFA 4G7VH 1HYSD 3QEQB 5BS0D 4X6CA 5GRJH 3EFFB 1MCKA 3HN3A 1VCAA 1MI5D 1U8MA 3MC0A 4MD4A 4WFED 4WEUD 5L6YH 1AD0B 4CMHC 1OY3B 3TBTA 1NCAH 5EO1B 4N8VB 5D7JA 4UQ3A 2F5AH 4JGUA 4OD3L 5MI0C 1UJTA 2PTVA 1NDMB 3TBVA 3VWKD 1R3HA 1ZLWH 1LP9A 5E9DB 3K2UL 5D2NC 2XQYK 4D0BA 1MQ8A 4YXKL 5AYUL 4P5KB 5T1LB 1OT1A 4UNTA 3QJFB 5D2LF 3I50L 4FQLH 3CLEH 2FJGB 1U8OA 3BUYA 5FYLD 3V4UL 4K23L 1R3IL 5CINH 3SDAA 3R4DA 4Z78B 3MODH 2IQ9L 2VDQL 3NFNB 3BIKB 1UWGH 1BECA 2XOTA 3D5OF 3I75B 3VXTA 4X7EC 5D96C 1Q9OA 3QUYD 3L5XH 2P24B 2XWBA 2EH7H 2VLLB 2W65A 3MV8A 3H3BC