5J9PC

Kcsa in vitro
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5j9pC00
3STLC 3RBZA 3R65A 1OCCC 2WLNA 5EC2C 4JTAB 2AHZA 4J9ZB 1V55C 4RUFA 2K1EA 4WFGA 4PA6A 2OCCC 4WFFA 2DWEC 4PDMA 2EINC 2Q67A 4R8CA 3PJSK 4PDRA 2Y69C 5B1AC 2W0FC 2ITCC 3ABKC 3T4DA 4GX5A 2QTOA 3RVZA 4CBCA 2BOCC 1OCRC 4RAIA 3FB5C 4MVQA 2EIJC 4HYOA 5EBLC 2R9RB 2H8PC 4MTOA 3SYOA 4GX0A 2WLIA 4RO2A 4GX1A 2DWDC 4H37A 4P9OA 2EIKC 3OUSA 4XDJA 4OXSA 3OR6C 4BW5A 2AHYA 3KG2A 4MVOA 2KB1A 3GB7C 4PA3A 1XL6A 4MVSA 3LUTB 3RVYA 3F5WC 1G4YB 3ZRSA 2EIMC 1KKDA 5CBFA 4R6ZA 3F7VC 4R50A 3BEHA 4MVRA 3SYQA 3E89A 4PA9A 3X2QC 4H33A 2QKSA 4R7CA 3K06A 1M56C 2WLHA 3K03A 2A0LA 3FB7C 3SYPA 3IFXA 3LDEA 4GX2A 4UUJC 1K4DC 4X88A 2WLLA 1OCOC 3T2MA 1QLEC 2ITDC 3K04A 3TETA 2HFEC 2WLIB 5EK0A 4LP8A 2HVKC 1ZWIC 3ZJZA 1LNQA 2IH3C 3AG1C 3FB8C 4XDKA 4P30A 3E83A 2HVJC 4I9WA 3OGCC 2DYRC 3F7YC 3K08A 1R3JC 3ASNC 3ASOC 5B3SC 2P7TC 3IGAC 2A9HA 2HJFC 4X8AA 1P7BA 3E8FA 5IY5C 4QNHB 1OCZC 5B1BC 5KUKA 4RUEA 3SPGA 4P2ZA 5J9PC 1M57C 2IH1C 2X6AA 5CBHA 2WLJA 4ZBMA 1S5HC 3AG3C 3SPIA 1R3KC 3UKMA 1JVMA 4G28B 3AG4C 2ZD9A 4MVZA 5E1AC 4JTDB 3T4ZA 4WFEA 4MW3A 5EC1C 3SPJA 2WLLB 3SYCA 3LDDA 1XL4A 2NLJC 3OR7C 4HZ3A 4WFHA 1R3IC 3FB6C 3SYAA 3VOUA 3ABMC 5EBWC 3UM7A 1BL8A 3T1CA 2DYSC 3STZC 2ZXWC 2YEVA 3AG2C 4PDVA 4EKWA 4PA4A 1K4CC 5EBMC 4MTGA 1V54C 4DXWA 5CBGA 4QE9A 3E8GA 3SPCA 4MVMA 3JYCA 4KFMA 4PA7A 2X6CA 4PDLA 4X89A 4MS2A 4MW8A 3SJQC 3E8BA 4MSWC 2ATKC 2X6BA 4LBEC 3SPHA 5KUMA 4MVUA 4XDLA 2JK5C 3TCUA 4TWKA 4J9YB 3ABLC 4P9PA 5BZBA 2Q6AA 2EILC 3RW0A 3HPLC 3K0DA 4G27B 4JTCB 3E86A 4LCUC 2Q69A 4F4LA 2Q68A 3EFFK 1J95A 3LDCA 3OUFA 3WG7C 4QE7A 1ORQC 2BOBC 4MTFA 3LNMB 2A79B 3K0GA 1R3LC 2WLKA 2WLMA 2HG5C 3E8HA
chains in the Genus database with same CATH superfamily
3U11A 3OTOO 3R65A 5LP6B 1NI8A 2OYQA 5LMUB 3N27A 4WFFA 3JD3A 4JYYA 3JAWA 4R8CA 2CE4A 4PHZA 2JS5A 3GWOA 1IZ3A 1QBZA 5EBLC 2HHHB 4MTOA 1N32B 5JQGB 2ZT9B 2ZXWB 1QVGU 1SQBH 3B09A 1CEZA 4IYHA 4FFBB 4JAAA 1VQ7V 4GKJB 4JI2B 2P4KA 4B3MO 1CPYA 2LGQA 2GTSA 3P30A 4WBNB 3P32A 1WP7A 2XAJA 4DV2B 1K4DC 4TSFG 1W59A 2D3OW 1YVWA 5AG2A 1LR1A 4JI7O 5IE9A 2QWNB 3L74H 3THOA 2CGNA 1OCCB 3OT7A 4Z1MG 2C2AA 2NN4A 3F5TA 3CD6V 4P2ZA 1IXMA 2JDIG 1PP9H 3T4ZA 5JJJB 4UFZA 4UVCA 1EBOA 5KHGA 2CAZC 4WFHA 4DR4B 2F95B 3FB6C 5TISZ 2UUBB 3T1CA 4DV4O 2IJKA 1ENVA 2ZXWC 2UXCB 1CXZB 1NT2B 4DK0A 5LMNO 2Y0PA 2CK3G 2ATKC 4LBEC 1WA8A 2RMKB 1YIJV 1RFYA 2G38A 1KB9F 3VQXA 5L3GA 5BZBA 1P7GA 4G27B 4AQYO 3EFFK 1FFXB 4U3FH 1WB7A 1K9MW 1IDSA 4WFAV 1OCCC 4J11A 1M93A 1ZX3A 4FLVA 5IJ9A 1Q6UA 3GWKC 1L0LH 2W6JG 4IIJB 1SZTA 4JI3B 4J41A 5FPOA 2R9RB 2YIBA 1QQCA 4B3SO 2YS8A 3OR6C 1XNRO 3OD4A 1J5EB 1NBMG 2YIBD 4DV3B 1JJ2U 4J7JA 2HLDG 4B3TO 1JCHA 3ZHTA 5JWPA 1SF9A 4R50A 2IJHA 3JATA 1L8DA 2K9PA 3JALB 2KG7B 4DR3O 1M56C 2JGUA 4WBNA 2P22C 1N33O 2WLLA 5H2FZ 2DOSA 3ZMSA 1AI4A 2R72A 1Q7YW 1HR0B 1Q86W 4LFCO 2E74B 5L3FA 1KD1W 2IBZH 5B1OA 1DK1A 4QNHB 2R70A 4RUEA 1PD3A 2MK3A 3AG7A 1NH2D 4X1KB 2F66C 4O4IB 4I4TB 5CBHA 2EJRA 2ZR3A 2P5OA 2NLJC 4DV1B 3CCEV 3ZHSA 3ABTA 2B9ZA 2W6IG 3K59A 3E2EA 1KU9A 5LYJA 5LHIA 1F4NA 2YI9A 4X89A 1GM8A 1K3EA 5BR8B 3OW2U 1PNKA 2OIEA 2KQXA 1KQSU 3EHBB 3G67A 4CC6A 1FJGO 5IYCO 2ZDIA 2A3QA 3CCLV 2BOBC 4MTFA 2RCVA 1DF5A 3STLC 2FL4A 5B1BB 2F4VO 4DR6O 4WFGA 1PL0A 4PDMA 2UXNA 4GZRB 1S0VA 2QTOA 1H2LA 1YXBA 3HB3B 5F2VO 4HNAA 4OXSA 1SESA 4PA3A 3CMAV 3OEEG 1VQNV 4IHJB 3K5OA 3E89A 3T1HB 1S5LZ 3JALA 1ZTEA 2E5LB 3VBBA 3H9VA 1XEQA 1HNWO 1JJOA 4JASA 3TETA 4Z2WA 5LXTA 1XUQA 3H1JH 1HNZO 3OGCC 2ZM6B 2DYRC 1G8MA 3F7YC 1N34B 1AROP 2BTOA 5LMUO 2HJFC 3ZMTA 5B1BC 4JI4O 1I94B 2F43G 1Y4MA 2VQFB 3ABUA 2HHHO 1FAFA 1N32O 4EB6B 3GVMA 5EC1C 4J42A 3E22B 3OR7C 3ETGA 2ZINA 4OX9O 2P67A 4O4JB 1K8AW 4PA4A 4DK1A 4JI2O 1XNQB 2XNDG 5JVDA 3UT5A 3CRRA 1Q82W 3E8BA 1X59A 5FPRA 3JASA 2LFSA 3ML0A 2XOKG 5K1PA 2UXDO 3HKDA 4GYCB 1J95A 2YEVB 3HKBB 1SQGA 2OT5A 4X65B 2Z5UA 4FZ1A 4K3AA 2AZ2A 4JTAB 3BRCA 3JARB 2PI5A 4RUFA 4UCVA 1S5JA 1TUBA 3PJSK 4I9QA 1QLNA 1Y76A 4DR4O 2D2CB 4TV8B 1JFFA 1MMMA 4X66O 2DWDC 1SQXH 4DV6O 3P3PA 2AHYA 3KG2A 5KAIZ 4LNUA 4UV8A 4O4HA 4U7NA 4DW0A 4KXRA 4B3RO 1I5YA 1RSOA 5CA1B 2ODMA 3MHSC 3K06A 3WB0A 2WSSG 4EFBA 2EILB 4UV9A 2WAMA 1XILA 4YJ3B 4NTWA 3S3WA 4ZIBA 3N2GA 4BAYA 2HVJC 2L6LA 3JD1A 4DRXB 5IJ0B 5LOVB 4LF8B 2PI4A 1R3JC 1LUWA 4LH7A 4O2AB 3PN1A 3HKCB 1NZ6A 1NTMH 4YY3O 3SGIA 1I7FA 4NTYA 4EB6A 1KP3A 4E2LA 4HZ3A 3SYAA 5JH7A 5EBWC 1BL8A 1RM1B 1J5EO 3LSQA 4DV3O 1K4CC 4I50B 3K5LA 2CH7A 1YHQV 3TGUH 1SERA 1UPGA 3CC7V 1ZUQA 2Q4PA 4N23A 4MS2A 3TXSA 1P4RA 2JGDA 5EIBC 2V4DA 1K97A 4X62O 4LF4B 2EILC 5BMVA 5H9CA 3JSLA 4KUMA 4DR7O 2ZIOA 1HR0O 4LF9B 2DMXA 1YITV 3G80A 4QE7A 4O4LA 1WJZA 1BT8A 3BCCH 1AP5A 2YI8A 5EC2C 2EIMB 4YHHB 3T1YO 3ICXA 5B1NA 2RQ6A 4PA6A 4NVPA 1WNSA 2HEPA 4FZ0A 4YXWG 2ZE6A 3S3XA 4YJ2B 3RVZA 3W7TA 3ZX6A 4DR2B 5GTHZ 4CH5A 4ZOLA 4TOIA 2BTQA 1OZ0A 2GV9A 3TJTA 2EBOA 4R6ZA 2UU9O 5KA5A 3JAWB 3X2QC 2F1MA 4D6TH 5EYPA 4YIPA 4GCZA 1KUQA 2ITDC 3BHPA 4X1IA 1NR7A 2PF4E 3KCXA 1B06A 4XDKA 1NR1A 5DN6G 4D7SA 1JMKC 3APQA 4FK5C 5IJ0A 1WAZA 1AI7A 3ZBHA 3OMIB 5IDJA 1I08A 3D36C 3FD9A 5GW7A 2ZD9A 3MHHC 3FFQA 1R3IC 4KP4A 4OPAA 4KHPO 2FKXA 2EZOA 3G6EV 1WPXA 2YXHA 1YEWA 3E8GA 1G6UA 3ZN0A 3SJQC 2E5LO 1G1XB 3CRAA 4D7TA 2E75B 5GTIZ 1Q90D 4OPHA 3FYEB 4JI0B 1OV9A 1GN4A 2LJ2A 5DEDA 3VQYA 3M99B 3B2EE 4LF7B 4CS3A 5KX5A 3ASNB 3Q4HA 3BA9A 2GHYA 2HG5C 4X1YA 1M57B 4L87A 3H1LH 1YF2A 2LP7A 1WA8B 4ABMA 1AB3A 2PYJA 2L35A 3ABMB 1YCIA 1QNMA 4HYOA 4YJ2A 2H8PC 4JI8O 3H01A 4RO2A 4MVOA 3ZN1A 2BE3A 4U3JB 1X4TA 3HR0A 5JJEB 4JV5O 5IJ9B 4K0KB 1IBKO 3I56V 4QJFB 1DF4A 4GX2A 4JAVA 3QNEA 5E79Z 3W7SA 1XMOB 3E83A 3IAYA 1Q3EA 3NR7A 3ASNC 4X64B 3CC2V 4JF3A 3QVNA 3HKEA 4X8AA 4K8XA 5IY5C 2OCCB 3RFRA 1Z2GA 3JATB 5B1AB 1M57C 2ZCEA 3TK1A 4FM2A 2ZE8A 3R66A 3ETQA 4MW3A 4AI8A 4ZHQA 2WLLB 2UUCB 3ABMC 4CH3A 1K7DA 4CZZA 2PYLA 2XAQA 4MTGA 1NH2B 5FL7G 1MOFA 4MSWC 4K8ZA 1BGYH 5KUMA 2Q7HA 4BIOA 1MA1A 4NTXA 2Q73A 4F6EA 2JVDA 2Q68A 3CP1A 3CE2A 1SS3A 1PNMA 2M7WA 1B3QA 3RWRD 2A79B 3WFVA 4DR5O 3A0HZ 2ZIMA 4JI6B 1OCZB 5LYJB 5IYZA 2HR3A 5CA3A 5B5EZ 2HKOA 2X7RB 1HNXB 2OCCC 2DWEC 5A9GA 1M56B 1RPRA 5B1AC 4FM0A 1NKDA 2R9AA 3OGIB 3CX5F 4RAIA 3SYOA 2JIZG 2XASA 4JYCA 2YICA 1XQ8A 3CXCU 2NR5A 3ZS8C 1DTOA 3D3QA 4JYAO 4U3JA 3QO7A 3O65A 1QCEA 4B7KA 3CRQA 1AR4A 1SC5B 1O9HA 3FB7C 3SYPA 4X88A 4GKKO 4HNAB 4GT1A 3RYFA 3BVOA 2AGAA 1HP8A 3UO2A 1VQLV 3FX7A 1OCZC 2DE0X 4JI1B 4NXMB 1IBMB 2FTKA 1ZL8A 2QM8A 5LGNA 4L8JA 1OCRB 2EIJB 5KAFZ 3VOUA 2QEXV 1N36O 1H2KA 3SJAC 1QHTA 3L75H 2LW1A 1FD9A 5LXTB 1SRYA 2YXLA 2ZDIC 1NS1A 2DQ3A 3BPZA 4Z1VA 5DECA 5C8YA 3C3SA 4XDLA 1O9GA 4TWKA 1ZAUA 2LO1A 4RWUA 2AW9A 2Z3YA 3H1HH 4DW1A 3K0DA 1Y74A 5D5PA 5J2UA 4F6RA 3LDCA 4TQDA 2O57A 4MT8A 2UUAO 4JI5O 1U97A 4LFAB 3RBZA 4DR1B 5JVDB 3QTCA 4J7KA 1GAXA 2ZNJA 3FKSG 4QGPA 3UT5B 5LA6A 3JASB 3RYHA 1PM9A 2EINC 2Q67A 5DM6V 1H8HG 3CCRV 5KHKA 1OHHG 2BOCC 1HWYA 1OCRC 3HKDB 2EIJC 3B77A 3AG2B 3OUSA 4LFBO 2JJ1G 5KMGA 2DYRB 4UCUA 4TV9A 1R6NA 3GB7C 4TT3G 1JOYA 5CBFA 3WB2A 4B08A 1H2GA 2QTSA 4PA9A 2Q7GA 1TUBB 4FLTA 4DUYB 1Y76B 4DV7B 2H3OA 3AEIA 1JFFB 4LF7O 5ITZB 2Q7EA 1LNQA 2P90A 1BHAA 5D5QA 3G4SV 2XT9A 4LNUB 1D5NA 1F4MA 5KLVH 4O4HB 3E8FA 3W7UA 1RSOB 2E76B 3CCMV 1XMQB 3J7AU 2CUGA 1GRJA 3CB2A 1NTKH 1PL4A 1XL4A 1VQ4V 3CYOA 3CJHA 3UM7A 5IYBO 2DYSC 3N2GB 4KL1A 3RGBA 3AG2C 4PDVA 4W4LA 3JCZA 1AR5A 4I7ZB 1A32A 2ZNIA 4K0KO 1TVKB 1BMFG 1WLEA 4PI0A 1VQOV 1GK9A 4X9QA 5GONA 1NJIW 2JRIA 4JTCB 3AG1B 3SR2C 5JH7B 3TXQA 1Y6XA 4I5SA 1Q6HA 5EZYA 1CP9A 3CEIA 3SJCC 2FMLA 3RN4A 2CH7B 3L72H 1R3LC 4GKJO 2JGDB 1NVPD 3L73H 3DTUB 4PDRA 4DV2O 1KC8W 3CCVV 4I0XA 4AHCA 5BMVB 4GUNA 3FB5C 2LQTA 3ZRVA 4O4LB 1R73A 1QU7A 3UQ8A 2DQ0A 4DO2A 2YDEA 2ETNA 1KKDA 1Q5OA 2QM4A 3OTOB 2LGWA 4OGQB 5H5NA 4ZKIA 3JD2A 4TUYA 3B40A 2UXBB 5KHIA 2UUBO 4DUZB 3K04A 3W7XA 4DV0B 1Q6IA 5ITZA 2UXCO 3AG1C 1H2SB 4QIWF 2CTPA 4IYIA 4ZOLB 2BTQB 3FAVA 4BIZA 4U7OA 5IWAB 1SQQH 3APOA 4ZI7A 1HNXO 3IJ4A 1V55B 2Y0IA 3EVKA 3ZHVA 5KUKA 2IH1C 3KKYA 5EYPB 3K58A 1S77D 1MABG 3CRCA 4X1IB 4BW9A 2QKAA 4O2BA 5CBGA 3OM3B 2YC0A 1TVKA 4LR3A 2QM7A 1DLBA 4LWSA 1EN4A 4JYBA 4JI3O 1FXKA 4CC5A 1AJQA 3ZRWA 1K33A 3D3IA 3UO3A 3RW0A 2QWQB 4J10A 3AK2A 2NNUA 2ADQB 4FPPA 4N21A 4UVBA 1Q8IA 5LMNB 4RQFA 1BZKA 1V55C 3X2QB 1H2NA 1EFRG 4GX5A 1EZVH 3BY6A 1JA8A 2Y4UA 4GX0A 2JJ2G 1V9PA 2ARHA 2WLIA 4LC1A 5LGTA 4BIUA 3OMNB 4AQYB 3ZMUA 2OIGA 4HAMA 5KX5B 3Q4HB 1N0NA 3DC5A 1ZLZA 3C3TA 3LUTB 4X1YB 3ZRSA 2VRZA 1K73W 3BEHA 4IT5A 4FVMA 2ILMA 1JR9A 2A0LA 3OAAG 3IFXA 3K57A 4C7UA 1M9NA 4DV1O 3ZEDA 1F23A 4WFBV 2IH3C 2QDOA 3ZCCA 4B3SB 3JCUZ 1XNRB 3IGAC 2A9HA 1H2MA 3EXAA 5BR8O 1VF6A 1THZA 4PV1B 1S5HC 1GTOA 1Z5VA 1R3KC 5IT9N 4MVZA 3ZMVA 1MNGA 3G71V 3LDDA 4JGSA 4CH6A 3WB1A 3STZC 4LF6B 5EBMC 1E1RG 5K1XA 5L3BA 4LFCB 2P6JA 3HKEB 1BQZA 3DXRA 2GSMB 1SA0B 4DV7O 2LFRA 1MSWD 3JD4A 5LGUA 1E79G 1OCOB 4QPJA 4ZHQB 3HPLC 3P3NA 4LCUC 4CS2A 4LF5B 4IGGA 3CS5A 1ORQC 3B8NA 3K0GA 4CS4A 3LNNA 3T1HO 5CN0A 1XMQO 5CB4B 2JEUA 1XOUA 1R6TA 3AG4B 2RN9A 2BSKA 1K92A 1S72V 3L9DA 3AK1A 2EULA 3QG5A 4PJ0Z 3ETDA 3KCYA 1GH6A 2ZM6O 4H37A 1V54B 4FLWA 1N34O 4UCRA 2EZPA 2KB1A 1FJGB 4BR6A 2W0XA 1S76D 3RVYA 5IYZB 1QR8A 1I94O 5IY5B 1NTZH 4H0LB 2VQFO 2F4VB 1K34A 2E3CA 1MZFA 2CDYA 4DV5B 4UUJC 2CTQA 1AR1B 2OWOA 1OCOC 2P06A 5L3CA 1UJWB 4LP8A 3ZJZA 3WG7B 1KECA 1E1QG 1I5XA 4UB8Z 4EFEA 4AILC 2Z0AA 5HFMA 1XNQO 1MSDA 1P7BA 1ZSPA 1BHBA 2QE7G 5IYDO 2JEXA 2PY5A 3AG4C 1XHZA 3CWBH 5J2TA 4IL6Z 3ZIAG 4QPKA 1M1KW 3RYFB 5BY1A 4WF9V 3DC6A 4X65O 1V54C 1HNZB 1N0JA 1W2BU 3JYCA 2F93B 3BA8A 4PA7A 1VEWA 1VQKV 2Y48A 2UXBO 1URFA 2X6BA 2B5UA 1SA0A 1ZL8B 4JI4B 2QWRB 3JAKA 2Q5ZA 3TCUA 4DUZO 1Q81W 2XAFA 2QWPB 4DV0O 4UCTA 2HJDA 2WWWA 5IWAO 4F4LA 1T5EA 3WG7C 5L3EA 4NKGB 1VQPV 3N2KA 4OX9B 2GUZA 1K5SA 2FYUH 3E8HA 2PGGA 4XBFA 2IJJA 4X20A 1BS3A 5C8YB 5CA0B 2K1EA 2GTAA 3FYIB 3CPWU 3AG3B 5CB4A 3OEHG 4K35A 2W0FC 1FS0G 3QO5A 1Z5WA 1GN3A 4MVQA 3L70H 2UXDB 1Y74B 5J2UB 4F6RB 1KBHA 2QWOB 2ZKOA 1JPXA 2YSUB 4LF8O 2HP8A 1WN7A 1XL6A 2ZE5A 4MVSA 1WP8A 3F5WC 1G4YB 2DN9A 3OMAB 1YTFD 5LP6C 1HDJA 5LA6B 4E4EA 3RYHB 4I55A 4R7CA 3K9SA 1KKCA 3G6BA 3LDEA 5HFLA 2DJVA 4FLZA 4CH4A 1VQMV 2GBOA 1AI5A 2KSDA 5EK0A 1ZWIC 1F7YA 2EJ7A 3CRMA 1XI1A 5KMGB 4X66B 1PKXA 1XHXA 2IW5A 2Q0OC 4TV9B 4DV6B 2N05A 1R6KA 1PPJH 1L0NH 3RYCA 1MZEA 2M6YA 1YJNV 2YIDA 3H1IH 1BCCH 2QKCA 4B3RB 1YSCA 3LSUA 4ZBMA 3AG3C 4LF4O 3SPIA 3UKMA 4G28B 5E1AC 4WFEA 1B6QA 4LF9O 2BCCH 4DXWA 4YHHO 2B1IA 3SPCA 3OE7G 4PD4F 5LHHA 1ROPA 2AXTZ 5LP6A 1F51A 5FNVB 1IX9A 4UB6Z 2EINB 3JAMN 1WB8A 4MVUA 3JD0A 1YI2V 1XDCA 2DW4A 1TA8A 2CGOA 4YY3B 4DR2O 1SQVH 4G2KA 3CJHB 5JQGA 1BQ0A 3QO8A 3OUFA 1JQ0A 4FFBA 2EX3A 3UCSC 1QR9A 5CA0A 5GONB 3IC7A 1Q43A 1AVMA 1GKFA 2ITCC 4CBCA 4X62B 4LF6O 5LHGA 3RYIB 5EZYB 4DR7B 4NR1A 1NVPB 4BW5A 1U96A 3IC9A 1YDXA 2ADPA 1VMGA 4JZ2A 3OTFA 1BSMA 3KZIZ 4FLYA 3T1YB 3SYQA 3AK3A 4BWAA 2XAHA 3ZHQA 4NXNB 4I0XB 2VQEB 4LF5O 4NB5A 2ZE7A 1TGOA 3O9OA 2DYSB 2MW2B 4LH6A 3CMEV 1SQPH 1N4CA 2CTWA 1B04A 3CCUV 4H13B 4FLUA 4TUYB 2WLJA 1GM9A 4FIPC 2UU9B 4JI0O 3ZHUA 2IM9A 4TQFA 2EIKB 2PTMA 1VIBA 1OJHA 3FAVB 4EKWA 1FFTB 1FFXA 4ICGA 2WA4A 3CC4V 4ZI7B 1KP2A 4FLXA 4PDLA 5FNVA 3SJBC 1M90W 1JX9A 1Y67A 2YUAA 4DV5O 4IIJA 5H6RA 3LSSA 1QLEB 4MTXA 1I0HA 4JPRA 1IBLB 1VQ6V 4O2BB 1W0KG 4GLXA 4KHPB 3QF7A 2N04A 4LWSB 3JSNA 1FXKB 2KG7A 4UCOA 3ZRWB 1FKAO 3T4DA 3J81N 1FXVA 4H44B 1XMOO 2PUSA 4XDJA 4P9OA 2FB5A 1TUEB 2EIKC 3RYIA 1TAEA 4FJCC 4X64O 1N8RW 2KKWA 2Q8VA 4UVAA 3K5MA 2CTRA 1WPBA 1L1FA 3DGEA 1K5QA 2IU3A 3C90A 2QKSA 4X1KA 2LW7A 2JS3A 3K03A 3MAQA 3U0ZA 4O4IA 4W4KA 4I4TA 2UUCO 1UFIA 1QLEC 5JJNB 3VQVA 1AILA 2HFEC 2WLIB 2AZ0A 1AI6A 4JI8B 1YZBA 4PI2A 2V7QG 4J7ZA 1H38A 3ZMZA 4FFKA 1AJPA 1IVSA 4JV5B 3CCSV 1FXKC 1BE3H 1IBKB 1MG1A 1JVMA 4JTDB 1P49A 2QJ1A 3SPJA 2VWJA 1FXHA 4EEQA 2YXYA 5CMUA 1IXBA 3K79A 3CCJV 1SKVA 5KHJA 1Y66A 4JI6O 1VARA 4QE9A 4KFMA 2ZR2A 3K3WA 3E35A 2XAGA 1EN5A 1GMGA 2XUMA 2RJZA 5JCOC 1PV0A 4B3MB 3CXHF 1RP3B 4J9YB 4P9PA 2Q6AA 2QGNA 1LUVA 3E86A 4B7EA 4UXNA 4JZGA 1FPOA 1RPOA 1VF7A 2A06H 5B3SB 2F23A 2VS0A 4JI7B 1S3JA 2X0LA 2WLNA 3DXRB 4Q6GA 4IHJA 2AHZA 1GN6A 2UXXA 2Q9LA 1GM7A 1KYOF 2XTAA 1GO3F 4FMTA 3CSXA 2ZQMA 2QR4A 2YIAA 4UCSA 2WA3A 5LBQA 2Y4TA 4DV4B 2H94A 4JI1O 4NXMO 3MD0A 1IBMO 4DR5B 1XREA 1VP7A 3F7VC 4MVRA 5JCOA 4ASUG 1P84F 4H33A 1H8EG 1VF6C 2BSKB 2Q0AA 3ABLB 3WU2Z 3A2FA 3T2MA 4YIOA 2RDCA 1COWG 3BAAA 3E22A 2HVKC 3FB8C 4P30A 4O4JA 3D8CA 3SDLA 3I55V 5B3SC 2P7TC 3CHXA 4JYAB 3K5NA 2Y69B 2X6AA 3ABKB 1M5IA 1EN6A 3NXSA 3VQWA 1AJNA 1YJ9V 4GKKB 2YEVA 3HKBA 4LFAO 3I5DA 1SETA 3U10A 4DR1O 3BABA 1W0JG 4MVMA 3A0RA 4WCEV 3J80N 2X6CA 2IJIA 3JARA 4MW8A 4NXNO 2R9IA 2VQEO 3SPHA 2WPDG 3BFRA 5A2QN 2JK5C 4B3TB 1PNLA 2XHBA 3ABLC 4TV8A 4DR3B 5J2TB 1NU1H 2N74A 2Q69A 1N33B 1RM1C 1N36B 3LNMB 3ASOB 5KHHA 2WLMA 3B8MA 1NQTA 5H6QA 3K9AA 2OTLV 4J9ZB 1R1BA 1EM1A 1VQ5V 4DUYO 5CA1A 4A5UB 1HW7A 3JAKB 2Y69C 1VQ8V 3ABKC 3M8AA 1XBLA 5L3DA 5EIBD 3L71H 2GDSA 3A0BZ 4YJ3A 4J80A 4GX1A 3N2KB 4Q20A 4DRXA 3DSQA 2QSAA 3ZRXA 5LOVA 2GUZB 2OCHA 1IURA 2UUAB 4JI5B 4X20B 4O2AA 2EIMC 2PZSA 4RQEA 1EZJA 3HKCA 4HBNA 1GN2A 3B4SA 5C93A 2WLHA 5BXZA 2VWKA 3MDSA 1M4UA 1SZXA 1IBLO 4DYLA 5FLXN 3A8TA 2QA4V 4JAUA 1YTFB 5LL6Y 4I9WA 4I50A 3W7WA 4LFBB 3K08A 2A7WA 1D2DA 3ASOC 2OTJV 5B66Z 4FM1A 3SPGA 3CCQV 5J9PC 3OFNG 1QVFU 2V1DA 4I55B 4DR6B 2P4VA 3SYCA 1VQ9V 3ETEA 3ZHRA 4NYKA 1SQFA 3M7MX 2RNBA 3RYCB 1DGSA 3D36A 2B1GA 1AP6A 3RT3C 2IU0A 1KMIZ 1VF5B 4PELA 1YJWV 1FYJA 1HNWB 3H1KH 5KA6A 1D5AA 2WLKA 1US6A
chains in the Genus database with same CATH topology
3R65A 2EIMB 5EC2C 5B1NA 1NVPD 1QR9A 4PA6A 4WFFA 3JD3A 3IC7A 4R8CA 3DTUB 4PDRA 4YXWG 1GKFA 2ITCC 1KC8W 3CCVV 3GWOA 3RVZA 4CBCA 1QBZA 3FB5C 5EBLC 3W7TA 4MTOA 5LHGA 3ZRVA 2ZXWB 1QVGU 1NVPB 4BW5A 1R73A 1CEZA 1OZ0A 2DQ0A 4DO2A 1VQ7V 1KKDA 2EBOA 1CPYA 4R6ZA 3P30A 3SYQA 4ZKIA 3JD2A 2XAHA 3X2QC 5KA5A 3P32A 4GCZA 2XAJA 1K4DC 4TSFG 2ITDC 3K04A 3W7XA 2D3OW 1NR7A 2DYSB 3AG1C 4QIWF 4XDKA 1NR1A 4BIZA 5DN6G 3CMEV 4FK5C 4U7OA 1OCCB 1V55B 1AI7A 4Z1MG 5KUKA 3OMIB 2C2AA 3CD6V 3CCUV 4P2ZA 5IDJA 2IH1C 1IXMA 2WLJA 1GM9A 2JDIG 1S77D 4FIPC 5GW7A 3T4ZA 1MABG 2ZD9A 3MHHC 4UVCA 1EBOA 4WFHA 1R3IC 3FB6C 2EIKB 4KP4A 3T1CA 2IJKA 1ENVA 2ZXWC 4EKWA 1FFTB 2EZOA 3G6EV 1WPXA 5CBGA 3OM3B 3CC4V 3E8GA 1KP2A 3ZN0A 4PDLA 3SJQC 2QM7A 1DLBA 2CK3G 2ATKC 1M90W 4JYBA 1JX9A 4LBEC 1FXKA 1YIJV 1AJQA 5H6RA 1K33A 3ZRWA 3D3IA 3LSSA 1QLEB 5L3GA 5BZBA 4MTXA 3RW0A 4JPRA 3FYEB 4G27B 3M99B 3EFFK 2NNUA 1VQ6V 4FPPA 4N21A 1W0KG 3ASNB 4UVBA 1K9MW 2HG5C 2GHYA 4WFAV 1OCCC 4RQFA 1V55C 1M57B 4L87A 2LP7A 3X2QB 1FXKB 2W6JG 3ZRWB 1SZTA 3T4DA 1EFRG 4GX5A 3BY6A 3ABMB 4HYOA 1FXVA 2R9RB 2H8PC 4GX0A 2JJ2G 4LC1A 2WLIA 3H01A 4RO2A 5LGTA 4XDJA 4P9OA 4BIUA 1TUEB 2EIKC 3OMNB 3ZMUA 4FJCC 3OR6C 4HAMA 4MVOA 3ZN1A 1N8RW 1NBMG 3LUTB 1JJ2U 4UVAA 3ZRSA 1L1FA 2HLDG 1JCHA 3DGEA 1K73W 4R50A 3BEHA 2IJHA 1K5QA 2IU3A 3I56V 2QKSA 1M56C 3K03A 2A0LA 3OAAG 4QJFB 3IFXA 1DF4A 4GX2A 4JAVA 2WLLA 1M9NA 1QLEC 1F23A 2HFEC 2WLIB 3QNEA 3ZMSA 4WFBV 3W7SA 2IH3C 1AI6A 1AI4A 3E83A 3ZCCA 1Q7YW 1Q86W 5L3FA 1KD1W 3ASNC 2V7QG 5B1OA 3IGAC 2A9HA 4JF3A 3CC2V 4X8AA 1H38A 3ZMZA 5IY5C 4QNHB 1AJPA 2OCCB 4RUEA 1PD3A 2MK3A 5B1AB 1M57C 1NH2D 1THZA 3CCSV 1S5HC 1FXKC 1GTOA 3TK1A 1R3KC 1MG1A 1JVMA 4MVZA 5CBHA 4JTDB 4MW3A 3ZMVA 3SPJA 3G71V 2EJRA 2WLLB 2ZR3A 1FXHA 3LDDA 2NLJC 4JGSA 3ABMC 5CMUA 1K7DA 4CZZA 3K79A 2XAQA 3CCJV 3STZC 3CCEV 1Y66A 5EBMC 4MTGA 3ABTA 2W6IG 1NH2B 4QE9A 1E1RG 4KFMA 5FL7G 5L3BA 3E2EA 2P6JA 1MOFA 2ZR2A 5LHIA 1F4NA 3K3WA 2GSMB 1GM8A 2XAGA 1GMGA 3E35A 4X89A 4MSWC 1K3EA 2LFRA 5KUMA 1MSWD 3JD4A 5LGUA 3OW2U 1E79G 1OCOB 4J9YB 4QPJA 4P9PA 2Q6AA 3HPLC 1PNKA 3E86A 4LCUC 1KQSU 4UXNA 3EHBB 1RPOA 2Q68A 3CP1A 5IYCO 2ZDIA 1PNMA 1ORQC 2BOBC 2M7WA 3B8NA 4MTFA 3CCLV 2A79B 3K0GA 3WFVA 5B3SB 1DF5A 3STLC 1S3JA 1OCZB 5B1BB 2X0LA 2WLNA 2HR3A 5CA3A 2AHZA 2HKOA 2X7RB 5CN0A 2UXXA 2JEUA 4WFGA 1PL0A 2OCCC 2DWEC 4PDMA 1M56B 2UXNA 3AG4B 1RPRA 5B1AC 1K92A 1S72V 1GM7A 1S0VA 1NKDA 2QTOA 4RAIA 3SYOA 3HB3B 2JIZG 1GO3F 3ETDA 4FMTA 2ZQMA 4H37A 2XASA 4JYCA 5LBQA 1V54B 4OXSA 1SESA 3CXCU 2EZPA 2KB1A 4PA3A 2H94A 3CMAV 1DTOA 3OEEG 1S76D 1VQNV 3RVYA 3MD0A 1QR8A 5IY5B 3QO7A 1QCEA 3F7VC 4MVRA 3E89A 4ASUG 1K34A 4H33A 1H8EG 3ABLB 3FB7C 3SYPA 3VBBA 4UUJC 4X88A 1AR1B 3T2MA 1OCOC 4JASA 3TETA 1COWG 1UJWB 5L3CA 4LP8A 2HVKC 3ZJZA 4GT1A 3WG7B 3FB8C 1KECA 1E1QG 4P30A 1I5XA 3OGCC 5HFMA 2DYRC 1G8MA 3F7YC 1AROP 5B3SC 3I55V 2P7TC 1VQLV 2HJFC 3ZMTA 1P7BA 1OCZC 5B1BC 2Y69B 2FTKA 2QM8A 1BHBA 2F43G 2X6AA 3ABKB 5LGNA 1Y4MA 2QE7G 2JEXA 5IYDO 3ABUA 1OCRB 3AG4C 3NXSA 2EIJB 5EC1C 1AJNA 3VOUA 3OR7C 3ETGA 3ZIAG 4QPKA 2QEXV 1YJ9V 1M1KW 2P67A 2YEVA 1SRYA 4WF9V 1K8AW 4PA4A 1V54C 2ZDIC 1SETA 1W2BU 1W0JG 4MVMA 3JYCA 3A0RA 2XNDG 4PA7A 2DQ3A 4WCEV 2X6CA 2IJIA 1VQKV 4MW8A 1Q82W 3E8BA 2Y48A 2R9IA 2X6BA 2B5UA 3SPHA 2WPDG 4XDLA 2JK5C 3TCUA 1PNLA 2LFSA 1Q81W 2XAFA 4TWKA 3ML0A 3ABLC 2XOKG 2Z3YA 2WWWA 3K0DA 2Q69A 4F4LA 1J95A 1RM1C 2YEVB 3LDCA 3WG7C 5L3EA 1VQPV 4MT8A 3LNMB 3ASOB 2WLMA 2OT5A 3B8MA 1K5SA 2Z5UA 3E8HA 3RBZA 4XBFA 2IJJA 1NQTA 4JTAB 5H6QA 3K9AA 2OTLV 3FKSG 4J9ZB 2PI5A 4RUFA 2K1EA 3FYIB 1VQ5V 3CPWU 3AG3B 2EINC 2Q67A 3OEHG 3PJSK 1QLNA 2Y69C 5DM6V 2W0FC 1H8HG 1VQ8V 3ABKC 1FS0G 3QO5A 3CCRV 5L3DA 1OHHG 2BOCC 1HWYA 1OCRC 4MVQA 2EIJC 3B77A 3AG2B 4GX1A 2DWDC 3OUSA 2JJ1G 1JPXA 2DYRB 2AHYA 2YSUB 3KG2A 4Q20A 1R6NA 3ZRXA 3GB7C 1XL6A 4MVSA 4TT3G 3F5WC 4UV8A 1G4YB 1JOYA 3OMAB 2EIMC 1YTFD 4U7NA 5CBFA 4RQEA 1EZJA 1H2GA 1I5YA 4PA9A 3MHSC 4R7CA 3K06A 5C93A 2WLHA 2WSSG 2EILB 4UV9A 3LDEA 5HFLA 2WAMA 3AEIA 1VQMV 1AI5A 5EK0A 2QA4V 4JAUA 1ZWIC 1LNQA 2P90A 1BHAA 1YTFB 4BAYA 2HVJC 4I9WA 1PKXA 2IW5A 3JD1A 3W7WA 3G4SV 3K08A 1R6KA 2PI4A 1R3JC 3ASOC 1F4MA 2OTJV 3E8FA 1YJNV 3W7UA 3SPGA 3CCQV 5J9PC 3OFNG 1QVFU 2V1DA 1YSCA 3CCMV 4ZBMA 3AG3C 3SPIA 3UKMA 4G28B 5E1AC 4WFEA 1B6QA 1KP3A 4E2LA 3SYCA 1XL4A 4HZ3A 3SYAA 3ETEA 1VQ4V 1VQ9V 3CYOA 5EBWC 3UM7A 5IYBO 1BL8A 1RM1B 2DYSC 3AG2C 4PDVA 3LSQA 1K4CC 3JCZA 4DXWA 1YHQV 1SERA 2B1IA 3SPCA 3OE7G 5LHHA 1ROPA 1BMFG 1F51A 3CC7V 4N23A 1WLEA 4MS2A 1P4RA 1VQOV 1GK9A 2EINB 3D36A 2B1GA 4MVUA 1K97A 3JD0A 1NJIW 1YI2V 2IU0A 2DW4A 2EILC 4G2KA 4PELA 4JTCB 3AG1B 5H9CA 1YJWV 4KUMA 3QO8A 1YITV 4I5SA 3OUFA 1CP9A 4QE7A 5KA6A 1JQ0A 1R3LC 2WLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STL C;  3RBZ A;  3R65 A;  1OCC C;  2WLN A;  5EC2 C;  4JTA B;  2AHZ A;  4J9Z B;  1V55 C;  4RUF A;  2K1E A;  4WFG A;  4PA6 A;  2OCC C;  4WFF A;  2DWE C;  4PDM A;  2EIN C;  2Q67 A;  4R8C A;  3PJS K;  4PDR A;  2Y69 C;  5B1A C;  2W0F C;  2ITC C;  3ABK C;  3T4D A;  4GX5 A;  2QTO A;  3RVZ A;  4CBC A;  2BOC C;  1OCR C;  4RAI A;  3FB5 C;  4MVQ A;  2EIJ C;  4HYO A;  5EBL C;  2R9R B;  2H8P C;  4MTO A;  3SYO A;  4GX0 A;  2WLI A;  4RO2 A;  4GX1 A;  2DWD C;  4H37 A;  4P9O A;  2EIK C;  3OUS A;  4XDJ A;  4OXS A;  3OR6 C;  4BW5 A;  2AHY A;  3KG2 A;  4MVO A;  2KB1 A;  3GB7 C;  4PA3 A;  1XL6 A;  4MVS A;  3LUT B;  3RVY A;  3F5W C;  1G4Y B;  3ZRS A;  2EIM C;  1KKD A;  5CBF A;  4R6Z A;  3F7V C;  4R50 A;  3BEH A;  4MVR A;  3SYQ A;  3E89 A;  4PA9 A;  3X2Q C;  4H33 A;  2QKS A;  4R7C A;  3K06 A;  1M56 C;  2WLH A;  3K03 A;  2A0L A;  3FB7 C;  3SYP A;  3IFX A;  3LDE A;  4GX2 A;  4UUJ C;  1K4D C;  4X88 A;  2WLL A;  1OCO C;  3T2M A;  1QLE C;  2ITD C;  3K04 A;  3TET A;  2HFE C;  2WLI B;  5EK0 A;  4LP8 A;  2HVK C;  1ZWI C;  3ZJZ A;  1LNQ A;  2IH3 C;  3AG1 C;  3FB8 C;  4XDK A;  4P30 A;  3E83 A;  2HVJ C;  4I9W A;  3OGC C;  2DYR C;  3F7Y C;  3K08 A;  1R3J C;  3ASN C;  3ASO C;  5B3S C;  2P7T C;  3IGA C;  2A9H A;  2HJF C;  4X8A A;  1P7B A;  3E8F A;  5IY5 C;  4QNH B;  1OCZ C;  5B1B C;  5KUK A;  4RUE A;  3SPG A;  4P2Z A;  5J9P C;  1M57 C;  2IH1 C;  2X6A A;  5CBH A;  2WLJ A;  4ZBM A;  1S5H C;  3AG3 C;  3SPI A;  1R3K C;  3UKM A;  1JVM A;  4G28 B;  3AG4 C;  2ZD9 A;  4MVZ A;  5E1A C;  4JTD B;  3T4Z A;  4WFE A;  4MW3 A;  5EC1 C;  3SPJ A;  2WLL B;  3SYC A;  3LDD A;  1XL4 A;  2NLJ C;  3OR7 C;  4HZ3 A;  4WFH A;  1R3I C;  3FB6 C;  3SYA A;  3VOU A;  3ABM C;  5EBW C;  3UM7 A;  1BL8 A;  3T1C A;  2DYS C;  3STZ C;  2ZXW C;  2YEV A;  3AG2 C;  4PDV A;  4EKW A;  4PA4 A;  1K4C C;  5EBM C;  4MTG A;  1V54 C;  4DXW A;  5CBG A;  4QE9 A;  3E8G A;  3SPC A;  4MVM A;  3JYC A;  4KFM A;  4PA7 A;  2X6C A;  4PDL A;  4X89 A;  4MS2 A;  4MW8 A;  3SJQ C;  3E8B A;  4MSW C;  2ATK C;  2X6B A;  4LBE C;  3SPH A;  5KUM A;  4MVU A;  4XDL A;  2JK5 C;  3TCU A;  4TWK A;  4J9Y B;  3ABL C;  4P9P A;  5BZB A;  2Q6A A;  2EIL C;  3RW0 A;  3HPL C;  3K0D A;  4G27 B;  4JTC B;  3E86 A;  4LCU C;  2Q69 A;  4F4L A;  2Q68 A;  3EFF K;  1J95 A;  3LDC A;  3OUF A;  3WG7 C;  4QE7 A;  1ORQ C;  2BOB C;  4MTF A;  3LNM B;  2A79 B;  3K0G A;  1R3L C;  2WLK A;  2WLM A;  2HG5 C;  3E8H A; 
#chains in the Genus database with same CATH topology
 3U11 A;  3OTO O;  3R65 A;  5LP6 B;  1NI8 A;  2OYQ A;  5LMU B;  3N27 A;  4WFF A;  3JD3 A;  4JYY A;  3JAW A;  4R8C A;  2CE4 A;  4PHZ A;  2JS5 A;  3GWO A;  1IZ3 A;  1QBZ A;  5EBL C;  2HHH B;  4MTO A;  1N32 B;  5JQG B;  2ZT9 B;  2ZXW B;  1QVG U;  1SQB H;  3B09 A;  1CEZ A;  4IYH A;  4FFB B;  4JAA A;  1VQ7 V;  4GKJ B;  4JI2 B;  2P4K A;  4B3M O;  1CPY A;  2LGQ A;  2GTS A;  3P30 A;  4WBN B;  3P32 A;  1WP7 A;  2XAJ A;  4DV2 B;  1K4D C;  4TSF G;  1W59 A;  2D3O W;  1YVW A;  5AG2 A;  1LR1 A;  4JI7 O;  5IE9 A;  2QWN B;  3L74 H;  3THO A;  2CGN A;  1OCC B;  3OT7 A;  4Z1M G;  2C2A A;  2NN4 A;  3F5T A;  3CD6 V;  4P2Z A;  1IXM A;  2JDI G;  1PP9 H;  3T4Z A;  5JJJ B;  4UFZ A;  4UVC A;  1EBO A;  5KHG A;  2CAZ C;  4WFH A;  4DR4 B;  2F95 B;  3FB6 C;  5TIS Z;  2UUB B;  3T1C A;  4DV4 O;  2IJK A;  1ENV A;  2ZXW C;  2UXC B;  1CXZ B;  1NT2 B;  4DK0 A;  5LMN O;  2Y0P A;  2CK3 G;  2ATK C;  4LBE C;  1WA8 A;  2RMK B;  1YIJ V;  1RFY A;  2G38 A;  1KB9 F;  3VQX A;  5L3G A;  5BZB A;  1P7G A;  4G27 B;  4AQY O;  3EFF K;  1FFX B;  4U3F H;  1WB7 A;  1K9M W;  1IDS A;  4WFA V;  1OCC C;  4J11 A;  1M93 A;  1ZX3 A;  4FLV A;  5IJ9 A;  1Q6U A;  3GWK C;  1L0L H;  2W6J G;  4IIJ B;  1SZT A;  4JI3 B;  4J41 A;  5FPO A;  2R9R B;  2YIB A;  1QQC A;  4B3S O;  2YS8 A;  3OR6 C;  1XNR O;  3OD4 A;  1J5E B;  1NBM G;  2YIB D;  4DV3 B;  1JJ2 U;  4J7J A;  2HLD G;  4B3T O;  1JCH A;  3ZHT A;  5JWP A;  1SF9 A;  4R50 A;  2IJH A;  3JAT A;  1L8D A;  2K9P A;  3JAL B;  2KG7 B;  4DR3 O;  1M56 C;  2JGU A;  4WBN A;  2P22 C;  1N33 O;  2WLL A;  5H2F Z;  2DOS A;  3ZMS A;  1AI4 A;  2R72 A;  1Q7Y W;  1HR0 B;  1Q86 W;  4LFC O;  2E74 B;  5L3F A;  1KD1 W;  2IBZ H;  5B1O A;  1DK1 A;  4QNH B;  2R70 A;  4RUE A;  1PD3 A;  2MK3 A;  3AG7 A;  1NH2 D;  4X1K B;  2F66 C;  4O4I B;  4I4T B;  5CBH A;  2EJR A;  2ZR3 A;  2P5O A;  2NLJ C;  4DV1 B;  3CCE V;  3ZHS A;  3ABT A;  2B9Z A;  2W6I G;  3K59 A;  3E2E A;  1KU9 A;  5LYJ A;  5LHI A;  1F4N A;  2YI9 A;  4X89 A;  1GM8 A;  1K3E A;  5BR8 B;  3OW2 U;  1PNK A;  2OIE A;  2KQX A;  1KQS U;  3EHB B;  3G67 A;  4CC6 A;  1FJG O;  5IYC O;  2ZDI A;  2A3Q A;  3CCL V;  2BOB C;  4MTF A;  2RCV A;  1DF5 A;  3STL C;  2FL4 A;  5B1B B;  2F4V O;  4DR6 O;  4WFG A;  1PL0 A;  4PDM A;  2UXN A;  4GZR B;  1S0V A;  2QTO A;  1H2L A;  1YXB A;  3HB3 B;  5F2V O;  4HNA A;  4OXS A;  1SES A;  4PA3 A;  3CMA V;  3OEE G;  1VQN V;  4IHJ B;  3K5O A;  3E89 A;  3T1H B;  1S5L Z;  3JAL A;  1ZTE A;  2E5L B;  3VBB A;  3H9V A;  1XEQ A;  1HNW O;  1JJO A;  4JAS A;  3TET A;  4Z2W A;  5LXT A;  1XUQ A;  3H1J H;  1HNZ O;  3OGC C;  2ZM6 B;  2DYR C;  1G8M A;  3F7Y C;  1N34 B;  1ARO P;  2BTO A;  5LMU O;  2HJF C;  3ZMT A;  5B1B C;  4JI4 O;  1I94 B;  2F43 G;  1Y4M A;  2VQF B;  3ABU A;  2HHH O;  1FAF A;  1N32 O;  4EB6 B;  3GVM A;  5EC1 C;  4J42 A;  3E22 B;  3OR7 C;  3ETG A;  2ZIN A;  4OX9 O;  2P67 A;  4O4J B;  1K8A W;  4PA4 A;  4DK1 A;  4JI2 O;  1XNQ B;  2XND G;  5JVD A;  3UT5 A;  3CRR A;  1Q82 W;  3E8B A;  1X59 A;  5FPR A;  3JAS A;  2LFS A;  3ML0 A;  2XOK G;  5K1P A;  2UXD O;  3HKD A;  4GYC B;  1J95 A;  2YEV B;  3HKB B;  1SQG A;  2OT5 A;  4X65 B;  2Z5U A;  4FZ1 A;  4K3A A;  2AZ2 A;  4JTA B;  3BRC A;  3JAR B;  2PI5 A;  4RUF A;  4UCV A;  1S5J A;  1TUB A;  3PJS K;  4I9Q A;  1QLN A;  1Y76 A;  4DR4 O;  2D2C B;  4TV8 B;  1JFF A;  1MMM A;  4X66 O;  2DWD C;  1SQX H;  4DV6 O;  3P3P A;  2AHY A;  3KG2 A;  5KAI Z;  4LNU A;  4UV8 A;  4O4H A;  4U7N A;  4DW0 A;  4KXR A;  4B3R O;  1I5Y A;  1RSO A;  5CA1 B;  2ODM A;  3MHS C;  3K06 A;  3WB0 A;  2WSS G;  4EFB A;  2EIL B;  4UV9 A;  2WAM A;  1XIL A;  4YJ3 B;  4NTW A;  3S3W A;  4ZIB A;  3N2G A;  4BAY A;  2HVJ C;  2L6L A;  3JD1 A;  4DRX B;  5IJ0 B;  5LOV B;  4LF8 B;  2PI4 A;  1R3J C;  1LUW A;  4LH7 A;  4O2A B;  3PN1 A;  3HKC B;  1NZ6 A;  1NTM H;  4YY3 O;  3SGI A;  1I7F A;  4NTY A;  4EB6 A;  1KP3 A;  4E2L A;  4HZ3 A;  3SYA A;  5JH7 A;  5EBW C;  1BL8 A;  1RM1 B;  1J5E O;  3LSQ A;  4DV3 O;  1K4C C;  4I50 B;  3K5L A;  2CH7 A;  1YHQ V;  3TGU H;  1SER A;  1UPG A;  3CC7 V;  1ZUQ A;  2Q4P A;  4N23 A;  4MS2 A;  3TXS A;  1P4R A;  2JGD A;  5EIB C;  2V4D A;  1K97 A;  4X62 O;  4LF4 B;  2EIL C;  5BMV A;  5H9C A;  3JSL A;  4KUM A;  4DR7 O;  2ZIO A;  1HR0 O;  4LF9 B;  2DMX A;  1YIT V;  3G80 A;  4QE7 A;  4O4L A;  1WJZ A;  1BT8 A;  3BCC H;  1AP5 A;  2YI8 A;  5EC2 C;  2EIM B;  4YHH B;  3T1Y O;  3ICX A;  5B1N A;  2RQ6 A;  4PA6 A;  4NVP A;  1WNS A;  2HEP A;  4FZ0 A;  4YXW G;  2ZE6 A;  3S3X A;  4YJ2 B;  3RVZ A;  3W7T A;  3ZX6 A;  4DR2 B;  5GTH Z;  4CH5 A;  4ZOL A;  4TOI A;  2BTQ A;  1OZ0 A;  2GV9 A;  3TJT A;  2EBO A;  4R6Z A;  2UU9 O;  5KA5 A;  3JAW B;  3X2Q C;  2F1M A;  4D6T H;  5EYP A;  4YIP A;  4GCZ A;  1KUQ A;  2ITD C;  3BHP A;  4X1I A;  1NR7 A;  2PF4 E;  3KCX A;  1B06 A;  4XDK A;  1NR1 A;  5DN6 G;  4D7S A;  1JMK C;  3APQ A;  4FK5 C;  5IJ0 A;  1WAZ A;  1AI7 A;  3ZBH A;  3OMI B;  5IDJ A;  1I08 A;  3D36 C;  3FD9 A;  5GW7 A;  2ZD9 A;  3MHH C;  3FFQ A;  1R3I C;  4KP4 A;  4OPA A;  4KHP O;  2FKX A;  2EZO A;  3G6E V;  1WPX A;  2YXH A;  1YEW A;  3E8G A;  1G6U A;  3ZN0 A;  3SJQ C;  2E5L O;  1G1X B;  3CRA A;  4D7T A;  2E75 B;  5GTI Z;  1Q90 D;  4OPH A;  3FYE B;  4JI0 B;  1OV9 A;  1GN4 A;  2LJ2 A;  5DED A;  3VQY A;  3M99 B;  3B2E E;  4LF7 B;  4CS3 A;  5KX5 A;  3ASN B;  3Q4H A;  3BA9 A;  2GHY A;  2HG5 C;  4X1Y A;  1M57 B;  4L87 A;  3H1L H;  1YF2 A;  2LP7 A;  1WA8 B;  4ABM A;  1AB3 A;  2PYJ A;  2L35 A;  3ABM B;  1YCI A;  1QNM A;  4HYO A;  4YJ2 A;  2H8P C;  4JI8 O;  3H01 A;  4RO2 A;  4MVO A;  3ZN1 A;  2BE3 A;  4U3J B;  1X4T A;  3HR0 A;  5JJE B;  4JV5 O;  5IJ9 B;  4K0K B;  1IBK O;  3I56 V;  4QJF B;  1DF4 A;  4GX2 A;  4JAV A;  3QNE A;  5E79 Z;  3W7S A;  1XMO B;  3E83 A;  3IAY A;  1Q3E A;  3NR7 A;  3ASN C;  4X64 B;  3CC2 V;  4JF3 A;  3QVN A;  3HKE A;  4X8A A;  4K8X A;  5IY5 C;  2OCC B;  3RFR A;  1Z2G A;  3JAT B;  5B1A B;  1M57 C;  2ZCE A;  3TK1 A;  4FM2 A;  2ZE8 A;  3R66 A;  3ETQ A;  4MW3 A;  4AI8 A;  4ZHQ A;  2WLL B;  2UUC B;  3ABM C;  4CH3 A;  1K7D A;  4CZZ A;  2PYL A;  2XAQ A;  4MTG A;  1NH2 B;  5FL7 G;  1MOF A;  4MSW C;  4K8Z A;  1BGY H;  5KUM A;  2Q7H A;  4BIO A;  1MA1 A;  4NTX A;  2Q73 A;  4F6E A;  2JVD A;  2Q68 A;  3CP1 A;  3CE2 A;  1SS3 A;  1PNM A;  2M7W A;  1B3Q A;  3RWR D;  2A79 B;  3WFV A;  4DR5 O;  3A0H Z;  2ZIM A;  4JI6 B;  1OCZ B;  5LYJ B;  5IYZ A;  2HR3 A;  5CA3 A;  5B5E Z;  2HKO A;  2X7R B;  1HNX B;  2OCC C;  2DWE C;  5A9G A;  1M56 B;  1RPR A;  5B1A C;  4FM0 A;  1NKD A;  2R9A A;  3OGI B;  3CX5 F;  4RAI A;  3SYO A;  2JIZ G;  2XAS A;  4JYC A;  2YIC A;  1XQ8 A;  3CXC U;  2NR5 A;  3ZS8 C;  1DTO A;  3D3Q A;  4JYA O;  4U3J A;  3QO7 A;  3O65 A;  1QCE A;  4B7K A;  3CRQ A;  1AR4 A;  1SC5 B;  1O9H A;  3FB7 C;  3SYP A;  4X88 A;  4GKK O;  4HNA B;  4GT1 A;  3RYF A;  3BVO A;  2AGA A;  1HP8 A;  3UO2 A;  1VQL V;  3FX7 A;  1OCZ C;  2DE0 X;  4JI1 B;  4NXM B;  1IBM B;  2FTK A;  1ZL8 A;  2QM8 A;  5LGN A;  4L8J A;  1OCR B;  2EIJ B;  5KAF Z;  3VOU A;  2QEX V;  1N36 O;  1H2K A;  3SJA C;  1QHT A;  3L75 H;  2LW1 A;  1FD9 A;  5LXT B;  1SRY A;  2YXL A;  2ZDI C;  1NS1 A;  2DQ3 A;  3BPZ A;  4Z1V A;  5DEC A;  5C8Y A;  3C3S A;  4XDL A;  1O9G A;  4TWK A;  1ZAU A;  2LO1 A;  4RWU A;  2AW9 A;  2Z3Y A;  3H1H H;  4DW1 A;  3K0D A;  1Y74 A;  5D5P A;  5J2U A;  4F6R A;  3LDC A;  4TQD A;  2O57 A;  4MT8 A;  2UUA O;  4JI5 O;  1U97 A;  4LFA B;  3RBZ A;  4DR1 B;  5JVD B;  3QTC A;  4J7K A;  1GAX A;  2ZNJ A;  3FKS G;  4QGP A;  3UT5 B;  5LA6 A;  3JAS B;  3RYH A;  1PM9 A;  2EIN C;  2Q67 A;  5DM6 V;  1H8H G;  3CCR V;  5KHK A;  1OHH G;  2BOC C;  1HWY A;  1OCR C;  3HKD B;  2EIJ C;  3B77 A;  3AG2 B;  3OUS A;  4LFB O;  2JJ1 G;  5KMG A;  2DYR B;  4UCU A;  4TV9 A;  1R6N A;  3GB7 C;  4TT3 G;  1JOY A;  5CBF A;  3WB2 A;  4B08 A;  1H2G A;  2QTS A;  4PA9 A;  2Q7G A;  1TUB B;  4FLT A;  4DUY B;  1Y76 B;  4DV7 B;  2H3O A;  3AEI A;  1JFF B;  4LF7 O;  5ITZ B;  2Q7E A;  1LNQ A;  2P90 A;  1BHA A;  5D5Q A;  3G4S V;  2XT9 A;  4LNU B;  1D5N A;  1F4M A;  5KLV H;  4O4H B;  3E8F A;  3W7U A;  1RSO B;  2E76 B;  3CCM V;  1XMQ B;  3J7A U;  2CUG A;  1GRJ A;  3CB2 A;  1NTK H;  1PL4 A;  1XL4 A;  1VQ4 V;  3CYO A;  3CJH A;  3UM7 A;  5IYB O;  2DYS C;  3N2G B;  4KL1 A;  3RGB A;  3AG2 C;  4PDV A;  4W4L A;  3JCZ A;  1AR5 A;  4I7Z B;  1A32 A;  2ZNI A;  4K0K O;  1TVK B;  1BMF G;  1WLE A;  4PI0 A;  1VQO V;  1GK9 A;  4X9Q A;  5GON A;  1NJI W;  2JRI A;  4JTC B;  3AG1 B;  3SR2 C;  5JH7 B;  3TXQ A;  1Y6X A;  4I5S A;  1Q6H A;  5EZY A;  1CP9 A;  3CEI A;  3SJC C;  2FML A;  3RN4 A;  2CH7 B;  3L72 H;  1R3L C;  4GKJ O;  2JGD B;  1NVP D;  3L73 H;  3DTU B;  4PDR A;  4DV2 O;  1KC8 W;  3CCV V;  4I0X A;  4AHC A;  5BMV B;  4GUN A;  3FB5 C;  2LQT A;  3ZRV A;  4O4L B;  1R73 A;  1QU7 A;  3UQ8 A;  2DQ0 A;  4DO2 A;  2YDE A;  2ETN A;  1KKD A;  1Q5O A;  2QM4 A;  3OTO B;  2LGW A;  4OGQ B;  5H5N A;  4ZKI A;  3JD2 A;  4TUY A;  3B40 A;  2UXB B;  5KHI A;  2UUB O;  4DUZ B;  3K04 A;  3W7X A;  4DV0 B;  1Q6I A;  5ITZ A;  2UXC O;  3AG1 C;  1H2S B;  4QIW F;  2CTP A;  4IYI A;  4ZOL B;  2BTQ B;  3FAV A;  4BIZ A;  4U7O A;  5IWA B;  1SQQ H;  3APO A;  4ZI7 A;  1HNX O;  3IJ4 A;  1V55 B;  2Y0I A;  3EVK A;  3ZHV A;  5KUK A;  2IH1 C;  3KKY A;  5EYP B;  3K58 A;  1S77 D;  1MAB G;  3CRC A;  4X1I B;  4BW9 A;  2QKA A;  4O2B A;  5CBG A;  3OM3 B;  2YC0 A;  1TVK A;  4LR3 A;  2QM7 A;  1DLB A;  4LWS A;  1EN4 A;  4JYB A;  4JI3 O;  1FXK A;  4CC5 A;  1AJQ A;  3ZRW A;  1K33 A;  3D3I A;  3UO3 A;  3RW0 A;  2QWQ B;  4J10 A;  3AK2 A;  2NNU A;  2ADQ B;  4FPP A;  4N21 A;  4UVB A;  1Q8I A;  5LMN B;  4RQF A;  1BZK A;  1V55 C;  3X2Q B;  1H2N A;  1EFR G;  4GX5 A;  1EZV H;  3BY6 A;  1JA8 A;  2Y4U A;  4GX0 A;  2JJ2 G;  1V9P A;  2ARH A;  2WLI A;  4LC1 A;  5LGT A;  4BIU A;  3OMN B;  4AQY B;  3ZMU A;  2OIG A;  4HAM A;  5KX5 B;  3Q4H B;  1N0N A;  3DC5 A;  1ZLZ A;  3C3T A;  3LUT B;  4X1Y B;  3ZRS A;  2VRZ A;  1K73 W;  3BEH A;  4IT5 A;  4FVM A;  2ILM A;  1JR9 A;  2A0L A;  3OAA G;  3IFX A;  3K57 A;  4C7U A;  1M9N A;  4DV1 O;  3ZED A;  1F23 A;  4WFB V;  2IH3 C;  2QDO A;  3ZCC A;  4B3S B;  3JCU Z;  1XNR B;  3IGA C;  2A9H A;  1H2M A;  3EXA A;  5BR8 O;  1VF6 A;  1THZ A;  4PV1 B;  1S5H C;  1GTO A;  1Z5V A;  1R3K C;  5IT9 N;  4MVZ A;  3ZMV A;  1MNG A;  3G71 V;  3LDD A;  4JGS A;  4CH6 A;  3WB1 A;  3STZ C;  4LF6 B;  5EBM C;  1E1R G;  5K1X A;  5L3B A;  4LFC B;  2P6J A;  3HKE B;  1BQZ A;  3DXR A;  2GSM B;  1SA0 B;  4DV7 O;  2LFR A;  1MSW D;  3JD4 A;  5LGU A;  1E79 G;  1OCO B;  4QPJ A;  4ZHQ B;  3HPL C;  3P3N A;  4LCU C;  4CS2 A;  4LF5 B;  4IGG A;  3CS5 A;  1ORQ C;  3B8N A;  3K0G A;  4CS4 A;  3LNN A;  3T1H O;  5CN0 A;  1XMQ O;  5CB4 B;  2JEU A;  1XOU A;  1R6T A;  3AG4 B;  2RN9 A;  2BSK A;  1K92 A;  1S72 V;  3L9D A;  3AK1 A;  2EUL A;  3QG5 A;  4PJ0 Z;  3ETD A;  3KCY A;  1GH6 A;  2ZM6 O;  4H37 A;  1V54 B;  4FLW A;  1N34 O;  4UCR A;  2EZP A;  2KB1 A;  1FJG B;  4BR6 A;  2W0X A;  1S76 D;  3RVY A;  5IYZ B;  1QR8 A;  1I94 O;  5IY5 B;  1NTZ H;  4H0L B;  2VQF O;  2F4V B;  1K34 A;  2E3C A;  1MZF A;  2CDY A;  4DV5 B;  4UUJ C;  2CTQ A;  1AR1 B;  2OWO A;  1OCO C;  2P06 A;  5L3C A;  1UJW B;  4LP8 A;  3ZJZ A;  3WG7 B;  1KEC A;  1E1Q G;  1I5X A;  4UB8 Z;  4EFE A;  4AIL C;  2Z0A A;  5HFM A;  1XNQ O;  1MSD A;  1P7B A;  1ZSP A;  1BHB A;  2QE7 G;  5IYD O;  2JEX A;  2PY5 A;  3AG4 C;  1XHZ A;  3CWB H;  5J2T A;  4IL6 Z;  3ZIA G;  4QPK A;  1M1K W;  3RYF B;  5BY1 A;  4WF9 V;  3DC6 A;  4X65 O;  1V54 C;  1HNZ B;  1N0J A;  1W2B U;  3JYC A;  2F93 B;  3BA8 A;  4PA7 A;  1VEW A;  1VQK V;  2Y48 A;  2UXB O;  1URF A;  2X6B A;  2B5U A;  1SA0 A;  1ZL8 B;  4JI4 B;  2QWR B;  3JAK A;  2Q5Z A;  3TCU A;  4DUZ O;  1Q81 W;  2XAF A;  2QWP B;  4DV0 O;  4UCT A;  2HJD A;  2WWW A;  5IWA O;  4F4L A;  1T5E A;  3WG7 C;  5L3E A;  4NKG B;  1VQP V;  3N2K A;  4OX9 B;  2GUZ A;  1K5S A;  2FYU H;  3E8H A;  2PGG A;  4XBF A;  2IJJ A;  4X20 A;  1BS3 A;  5C8Y B;  5CA0 B;  2K1E A;  2GTA A;  3FYI B;  3CPW U;  3AG3 B;  5CB4 A;  3OEH G;  4K35 A;  2W0F C;  1FS0 G;  3QO5 A;  1Z5W A;  1GN3 A;  4MVQ A;  3L70 H;  2UXD B;  1Y74 B;  5J2U B;  4F6R B;  1KBH A;  2QWO B;  2ZKO A;  1JPX A;  2YSU B;  4LF8 O;  2HP8 A;  1WN7 A;  1XL6 A;  2ZE5 A;  4MVS A;  1WP8 A;  3F5W C;  1G4Y B;  2DN9 A;  3OMA B;  1YTF D;  5LP6 C;  1HDJ A;  5LA6 B;  4E4E A;  3RYH B;  4I55 A;  4R7C A;  3K9S A;  1KKC A;  3G6B A;  3LDE A;  5HFL A;  2DJV A;  4FLZ A;  4CH4 A;  1VQM V;  2GBO A;  1AI5 A;  2KSD A;  5EK0 A;  1ZWI C;  1F7Y A;  2EJ7 A;  3CRM A;  1XI1 A;  5KMG B;  4X66 B;  1PKX A;  1XHX A;  2IW5 A;  2Q0O C;  4TV9 B;  4DV6 B;  2N05 A;  1R6K A;  1PPJ H;  1L0N H;  3RYC A;  1MZE A;  2M6Y A;  1YJN V;  2YID A;  3H1I H;  1BCC H;  2QKC A;  4B3R B;  1YSC A;  3LSU A;  4ZBM A;  3AG3 C;  4LF4 O;  3SPI A;  3UKM A;  4G28 B;  5E1A C;  4WFE A;  1B6Q A;  4LF9 O;  2BCC H;  4DXW A;  4YHH O;  2B1I A;  3SPC A;  3OE7 G;  4PD4 F;  5LHH A;  1ROP A;  2AXT Z;  5LP6 A;  1F51 A;  5FNV B;  1IX9 A;  4UB6 Z;  2EIN B;  3JAM N;  1WB8 A;  4MVU A;  3JD0 A;  1YI2 V;  1XDC A;  2DW4 A;  1TA8 A;  2CGO A;  4YY3 B;  4DR2 O;  1SQV H;  4G2K A;  3CJH B;  5JQG A;  1BQ0 A;  3QO8 A;  3OUF A;  1JQ0 A;  4FFB A;  2EX3 A;  3UCS C;  1QR9 A;  5CA0 A;  5GON B;  3IC7 A;  1Q43 A;  1AVM A;  1GKF A;  2ITC C;  4CBC A;  4X62 B;  4LF6 O;  5LHG A;  3RYI B;  5EZY B;  4DR7 B;  4NR1 A;  1NVP B;  4BW5 A;  1U96 A;  3IC9 A;  1YDX A;  2ADP A;  1VMG A;  4JZ2 A;  3OTF A;  1BSM A;  3KZI Z;  4FLY A;  3T1Y B;  3SYQ A;  3AK3 A;  4BWA A;  2XAH A;  3ZHQ A;  4NXN B;  4I0X B;  2VQE B;  4LF5 O;  4NB5 A;  2ZE7 A;  1TGO A;  3O9O A;  2DYS B;  2MW2 B;  4LH6 A;  3CME V;  1SQP H;  1N4C A;  2CTW A;  1B04 A;  3CCU V;  4H13 B;  4FLU A;  4TUY B;  2WLJ A;  1GM9 A;  4FIP C;  2UU9 B;  4JI0 O;  3ZHU A;  2IM9 A;  4TQF A;  2EIK B;  2PTM A;  1VIB A;  1OJH A;  3FAV B;  4EKW A;  1FFT B;  1FFX A;  4ICG A;  2WA4 A;  3CC4 V;  4ZI7 B;  1KP2 A;  4FLX A;  4PDL A;  5FNV A;  3SJB C;  1M90 W;  1JX9 A;  1Y67 A;  2YUA A;  4DV5 O;  4IIJ A;  5H6R A;  3LSS A;  1QLE B;  4MTX A;  1I0H A;  4JPR A;  1IBL B;  1VQ6 V;  4O2B B;  1W0K G;  4GLX A;  4KHP B;  3QF7 A;  2N04 A;  4LWS B;  3JSN A;  1FXK B;  2KG7 A;  4UCO A;  3ZRW B;  1FKA O;  3T4D A;  3J81 N;  1FXV A;  4H44 B;  1XMO O;  2PUS A;  4XDJ A;  4P9O A;  2FB5 A;  1TUE B;  2EIK C;  3RYI A;  1TAE A;  4FJC C;  4X64 O;  1N8R W;  2KKW A;  2Q8V A;  4UVA A;  3K5M A;  2CTR A;  1WPB A;  1L1F A;  3DGE A;  1K5Q A;  2IU3 A;  3C90 A;  2QKS A;  4X1K A;  2LW7 A;  2JS3 A;  3K03 A;  3MAQ A;  3U0Z A;  4O4I A;  4W4K A;  4I4T A;  2UUC O;  1UFI A;  1QLE C;  5JJN B;  3VQV A;  1AIL A;  2HFE C;  2WLI B;  2AZ0 A;  1AI6 A;  4JI8 B;  1YZB A;  4PI2 A;  2V7Q G;  4J7Z A;  1H38 A;  3ZMZ A;  4FFK A;  1AJP A;  1IVS A;  4JV5 B;  3CCS V;  1FXK C;  1BE3 H;  1IBK B;  1MG1 A;  1JVM A;  4JTD B;  1P49 A;  2QJ1 A;  3SPJ A;  2VWJ A;  1FXH A;  4EEQ A;  2YXY A;  5CMU A;  1IXB A;  3K79 A;  3CCJ V;  1SKV A;  5KHJ A;  1Y66 A;  4JI6 O;  1VAR A;  4QE9 A;  4KFM A;  2ZR2 A;  3K3W A;  3E35 A;  2XAG A;  1EN5 A;  1GMG A;  2XUM A;  2RJZ A;  5JCO C;  1PV0 A;  4B3M B;  3CXH F;  1RP3 B;  4J9Y B;  4P9P A;  2Q6A A;  2QGN A;  1LUV A;  3E86 A;  4B7E A;  4UXN A;  4JZG A;  1FPO A;  1RPO A;  1VF7 A;  2A06 H;  5B3S B;  2F23 A;  2VS0 A;  4JI7 B;  1S3J A;  2X0L A;  2WLN A;  3DXR B;  4Q6G A;  4IHJ A;  2AHZ A;  1GN6 A;  2UXX A;  2Q9L A;  1GM7 A;  1KYO F;  2XTA A;  1GO3 F;  4FMT A;  3CSX A;  2ZQM A;  2QR4 A;  2YIA A;  4UCS A;  2WA3 A;  5LBQ A;  2Y4T A;  4DV4 B;  2H94 A;  4JI1 O;  4NXM O;  3MD0 A;  1IBM O;  4DR5 B;  1XRE A;  1VP7 A;  3F7V C;  4MVR A;  5JCO A;  4ASU G;  1P84 F;  4H33 A;  1H8E G;  1VF6 C;  2BSK B;  2Q0A A;  3ABL B;  3WU2 Z;  3A2F A;  3T2M A;  4YIO A;  2RDC A;  1COW G;  3BAA A;  3E22 A;  2HVK C;  3FB8 C;  4P30 A;  4O4J A;  3D8C A;  3SDL A;  3I55 V;  5B3S C;  2P7T C;  3CHX A;  4JYA B;  3K5N A;  2Y69 B;  2X6A A;  3ABK B;  1M5I A;  1EN6 A;  3NXS A;  3VQW A;  1AJN A;  1YJ9 V;  4GKK B;  2YEV A;  3HKB A;  4LFA O;  3I5D A;  1SET A;  3U10 A;  4DR1 O;  3BAB A;  1W0J G;  4MVM A;  3A0R A;  4WCE V;  3J80 N;  2X6C A;  2IJI A;  3JAR A;  4MW8 A;  4NXN O;  2R9I A;  2VQE O;  3SPH A;  2WPD G;  3BFR A;  5A2Q N;  2JK5 C;  4B3T B;  1PNL A;  2XHB A;  3ABL C;  4TV8 A;  4DR3 B;  5J2T B;  1NU1 H;  2N74 A;  2Q69 A;  1N33 B;  1RM1 C;  1N36 B;  3LNM B;  3ASO B;  5KHH A;  2WLM A;  3B8M A;  1NQT A;  5H6Q A;  3K9A A;  2OTL V;  4J9Z B;  1R1B A;  1EM1 A;  1VQ5 V;  4DUY O;  5CA1 A;  4A5U B;  1HW7 A;  3JAK B;  2Y69 C;  1VQ8 V;  3ABK C;  3M8A A;  1XBL A;  5L3D A;  5EIB D;  3L71 H;  2GDS A;  3A0B Z;  4YJ3 A;  4J80 A;  4GX1 A;  3N2K B;  4Q20 A;  4DRX A;  3DSQ A;  2QSA A;  3ZRX A;  5LOV A;  2GUZ B;  2OCH A;  1IUR A;  2UUA B;  4JI5 B;  4X20 B;  4O2A A;  2EIM C;  2PZS A;  4RQE A;  1EZJ A;  3HKC A;  4HBN A;  1GN2 A;  3B4S A;  5C93 A;  2WLH A;  5BXZ A;  2VWK A;  3MDS A;  1M4U A;  1SZX A;  1IBL O;  4DYL A;  5FLX N;  3A8T A;  2QA4 V;  4JAU A;  1YTF B;  5LL6 Y;  4I9W A;  4I50 A;  3W7W A;  4LFB B;  3K08 A;  2A7W A;  1D2D A;  3ASO C;  2OTJ V;  5B66 Z;  4FM1 A;  3SPG A;  3CCQ V;  5J9P C;  3OFN G;  1QVF U;  2V1D A;  4I55 B;  4DR6 B;  2P4V A;  3SYC A;  1VQ9 V;  3ETE A;  3ZHR A;  4NYK A;  1SQF A;  3M7M X;  2RNB A;  3RYC B;  1DGS A;  3D36 A;  2B1G A;  1AP6 A;  3RT3 C;  2IU0 A;  1KMI Z;  1VF5 B;  4PEL A;  1YJW V;  1FYJ A;  1HNW B;  3H1K H;  5KA6 A;  1D5A A;  2WLK A;  1US6 A; 
#chains in the Genus database with same CATH homology
 3R65 A;  2EIM B;  5EC2 C;  5B1N A;  1NVP D;  1QR9 A;  4PA6 A;  4WFF A;  3JD3 A;  3IC7 A;  4R8C A;  3DTU B;  4PDR A;  4YXW G;  1GKF A;  2ITC C;  1KC8 W;  3CCV V;  3GWO A;  3RVZ A;  4CBC A;  1QBZ A;  3FB5 C;  5EBL C;  3W7T A;  4MTO A;  5LHG A;  3ZRV A;  2ZXW B;  1QVG U;  1NVP B;  4BW5 A;  1R73 A;  1CEZ A;  1OZ0 A;  2DQ0 A;  4DO2 A;  1VQ7 V;  1KKD A;  2EBO A;  1CPY A;  4R6Z A;  3P30 A;  3SYQ A;  4ZKI A;  3JD2 A;  2XAH A;  3X2Q C;  5KA5 A;  3P32 A;  4GCZ A;  2XAJ A;  1K4D C;  4TSF G;  2ITD C;  3K04 A;  3W7X A;  2D3O W;  1NR7 A;  2DYS B;  3AG1 C;  4QIW F;  4XDK A;  1NR1 A;  4BIZ A;  5DN6 G;  3CME V;  4FK5 C;  4U7O A;  1OCC B;  1V55 B;  1AI7 A;  4Z1M G;  5KUK A;  3OMI B;  2C2A A;  3CD6 V;  3CCU V;  4P2Z A;  5IDJ A;  2IH1 C;  1IXM A;  2WLJ A;  1GM9 A;  2JDI G;  1S77 D;  4FIP C;  5GW7 A;  3T4Z A;  1MAB G;  2ZD9 A;  3MHH C;  4UVC A;  1EBO A;  4WFH A;  1R3I C;  3FB6 C;  2EIK B;  4KP4 A;  3T1C A;  2IJK A;  1ENV A;  2ZXW C;  4EKW A;  1FFT B;  2EZO A;  3G6E V;  1WPX A;  5CBG A;  3OM3 B;  3CC4 V;  3E8G A;  1KP2 A;  3ZN0 A;  4PDL A;  3SJQ C;  2QM7 A;  1DLB A;  2CK3 G;  2ATK C;  1M90 W;  4JYB A;  1JX9 A;  4LBE C;  1FXK A;  1YIJ V;  1AJQ A;  5H6R A;  1K33 A;  3ZRW A;  3D3I A;  3LSS A;  1QLE B;  5L3G A;  5BZB A;  4MTX A;  3RW0 A;  4JPR A;  3FYE B;  4G27 B;  3M99 B;  3EFF K;  2NNU A;  1VQ6 V;  4FPP A;  4N21 A;  1W0K G;  3ASN B;  4UVB A;  1K9M W;  2HG5 C;  2GHY A;  4WFA V;  1OCC C;  4RQF A;  1V55 C;  1M57 B;  4L87 A;  2LP7 A;  3X2Q B;  1FXK B;  2W6J G;  3ZRW B;  1SZT A;  3T4D A;  1EFR G;  4GX5 A;  3BY6 A;  3ABM B;  4HYO A;  1FXV A;  2R9R B;  2H8P C;  4GX0 A;  2JJ2 G;  4LC1 A;  2WLI A;  3H01 A;  4RO2 A;  5LGT A;  4XDJ A;  4P9O A;  4BIU A;  1TUE B;  2EIK C;  3OMN B;  3ZMU A;  4FJC C;  3OR6 C;  4HAM A;  4MVO A;  3ZN1 A;  1N8R W;  1NBM G;  3LUT B;  1JJ2 U;  4UVA A;  3ZRS A;  1L1F A;  2HLD G;  1JCH A;  3DGE A;  1K73 W;  4R50 A;  3BEH A;  2IJH A;  1K5Q A;  2IU3 A;  3I56 V;  2QKS A;  1M56 C;  3K03 A;  2A0L A;  3OAA G;  4QJF B;  3IFX A;  1DF4 A;  4GX2 A;  4JAV A;  2WLL A;  1M9N A;  1QLE C;  1F23 A;  2HFE C;  2WLI B;  3QNE A;  3ZMS A;  4WFB V;  3W7S A;  2IH3 C;  1AI6 A;  1AI4 A;  3E83 A;  3ZCC A;  1Q7Y W;  1Q86 W;  5L3F A;  1KD1 W;  3ASN C;  2V7Q G;  5B1O A;  3IGA C;  2A9H A;  4JF3 A;  3CC2 V;  4X8A A;  1H38 A;  3ZMZ A;  5IY5 C;  4QNH B;  1AJP A;  2OCC B;  4RUE A;  1PD3 A;  2MK3 A;  5B1A B;  1M57 C;  1NH2 D;  1THZ A;  3CCS V;  1S5H C;  1FXK C;  1GTO A;  3TK1 A;  1R3K C;  1MG1 A;  1JVM A;  4MVZ A;  5CBH A;  4JTD B;  4MW3 A;  3ZMV A;  3SPJ A;  3G71 V;  2EJR A;  2WLL B;  2ZR3 A;  1FXH A;  3LDD A;  2NLJ C;  4JGS A;  3ABM C;  5CMU A;  1K7D A;  4CZZ A;  3K79 A;  2XAQ A;  3CCJ V;  3STZ C;  3CCE V;  1Y66 A;  5EBM C;  4MTG A;  3ABT A;  2W6I G;  1NH2 B;  4QE9 A;  1E1R G;  4KFM A;  5FL7 G;  5L3B A;  3E2E A;  2P6J A;  1MOF A;  2ZR2 A;  5LHI A;  1F4N A;  3K3W A;  2GSM B;  1GM8 A;  2XAG A;  1GMG A;  3E35 A;  4X89 A;  4MSW C;  1K3E A;  2LFR A;  5KUM A;  1MSW D;  3JD4 A;  5LGU A;  3OW2 U;  1E79 G;  1OCO B;  4J9Y B;  4QPJ A;  4P9P A;  2Q6A A;  3HPL C;  1PNK A;  3E86 A;  4LCU C;  1KQS U;  4UXN A;  3EHB B;  1RPO A;  2Q68 A;  3CP1 A;  5IYC O;  2ZDI A;  1PNM A;  1ORQ C;  2BOB C;  2M7W A;  3B8N A;  4MTF A;  3CCL V;  2A79 B;  3K0G A;  3WFV A;  5B3S B;  1DF5 A;  3STL C;  1S3J A;  1OCZ B;  5B1B B;  2X0L A;  2WLN A;  2HR3 A;  5CA3 A;  2AHZ A;  2HKO A;  2X7R B;  5CN0 A;  2UXX A;  2JEU A;  4WFG A;  1PL0 A;  2OCC C;  2DWE C;  4PDM A;  1M56 B;  2UXN A;  3AG4 B;  1RPR A;  5B1A C;  1K92 A;  1S72 V;  1GM7 A;  1S0V A;  1NKD A;  2QTO A;  4RAI A;  3SYO A;  3HB3 B;  2JIZ G;  1GO3 F;  3ETD A;  4FMT A;  2ZQM A;  4H37 A;  2XAS A;  4JYC A;  5LBQ A;  1V54 B;  4OXS A;  1SES A;  3CXC U;  2EZP A;  2KB1 A;  4PA3 A;  2H94 A;  3CMA V;  1DTO A;  3OEE G;  1S76 D;  1VQN V;  3RVY A;  3MD0 A;  1QR8 A;  5IY5 B;  3QO7 A;  1QCE A;  3F7V C;  4MVR A;  3E89 A;  4ASU G;  1K34 A;  4H33 A;  1H8E G;  3ABL B;  3FB7 C;  3SYP A;  3VBB A;  4UUJ C;  4X88 A;  1AR1 B;  3T2M A;  1OCO C;  4JAS A;  3TET A;  1COW G;  1UJW B;  5L3C A;  4LP8 A;  2HVK C;  3ZJZ A;  4GT1 A;  3WG7 B;  3FB8 C;  1KEC A;  1E1Q G;  4P30 A;  1I5X A;  3OGC C;  5HFM A;  2DYR C;  1G8M A;  3F7Y C;  1ARO P;  5B3S C;  3I55 V;  2P7T C;  1VQL V;  2HJF C;  3ZMT A;  1P7B A;  1OCZ C;  5B1B C;  2Y69 B;  2FTK A;  2QM8 A;  1BHB A;  2F43 G;  2X6A A;  3ABK B;  5LGN A;  1Y4M A;  2QE7 G;  2JEX A;  5IYD O;  3ABU A;  1OCR B;  3AG4 C;  3NXS A;  2EIJ B;  5EC1 C;  1AJN A;  3VOU A;  3OR7 C;  3ETG A;  3ZIA G;  4QPK A;  2QEX V;  1YJ9 V;  1M1K W;  2P67 A;  2YEV A;  1SRY A;  4WF9 V;  1K8A W;  4PA4 A;  1V54 C;  2ZDI C;  1SET A;  1W2B U;  1W0J G;  4MVM A;  3JYC A;  3A0R A;  2XND G;  4PA7 A;  2DQ3 A;  4WCE V;  2X6C A;  2IJI A;  1VQK V;  4MW8 A;  1Q82 W;  3E8B A;  2Y48 A;  2R9I A;  2X6B A;  2B5U A;  3SPH A;  2WPD G;  4XDL A;  2JK5 C;  3TCU A;  1PNL A;  2LFS A;  1Q81 W;  2XAF A;  4TWK A;  3ML0 A;  3ABL C;  2XOK G;  2Z3Y A;  2WWW A;  3K0D A;  2Q69 A;  4F4L A;  1J95 A;  1RM1 C;  2YEV B;  3LDC A;  3WG7 C;  5L3E A;  1VQP V;  4MT8 A;  3LNM B;  3ASO B;  2WLM A;  2OT5 A;  3B8M A;  1K5S A;  2Z5U A;  3E8H A;  3RBZ A;  4XBF A;  2IJJ A;  1NQT A;  4JTA B;  5H6Q A;  3K9A A;  2OTL V;  3FKS G;  4J9Z B;  2PI5 A;  4RUF A;  2K1E A;  3FYI B;  1VQ5 V;  3CPW U;  3AG3 B;  2EIN C;  2Q67 A;  3OEH G;  3PJS K;  1QLN A;  2Y69 C;  5DM6 V;  2W0F C;  1H8H G;  1VQ8 V;  3ABK C;  1FS0 G;  3QO5 A;  3CCR V;  5L3D A;  1OHH G;  2BOC C;  1HWY A;  1OCR C;  4MVQ A;  2EIJ C;  3B77 A;  3AG2 B;  4GX1 A;  2DWD C;  3OUS A;  2JJ1 G;  1JPX A;  2DYR B;  2AHY A;  2YSU B;  3KG2 A;  4Q20 A;  1R6N A;  3ZRX A;  3GB7 C;  1XL6 A;  4MVS A;  4TT3 G;  3F5W C;  4UV8 A;  1G4Y B;  1JOY A;  3OMA B;  2EIM C;  1YTF D;  4U7N A;  5CBF A;  4RQE A;  1EZJ A;  1H2G A;  1I5Y A;  4PA9 A;  3MHS C;  4R7C A;  3K06 A;  5C93 A;  2WLH A;  2WSS G;  2EIL B;  4UV9 A;  3LDE A;  5HFL A;  2WAM A;  3AEI A;  1VQM V;  1AI5 A;  5EK0 A;  2QA4 V;  4JAU A;  1ZWI C;  1LNQ A;  2P90 A;  1BHA A;  1YTF B;  4BAY A;  2HVJ C;  4I9W A;  1PKX A;  2IW5 A;  3JD1 A;  3W7W A;  3G4S V;  3K08 A;  1R6K A;  2PI4 A;  1R3J C;  3ASO C;  1F4M A;  2OTJ V;  3E8F A;  1YJN V;  3W7U A;  3SPG A;  3CCQ V;  5J9P C;  3OFN G;  1QVF U;  2V1D A;  1YSC A;  3CCM V;  4ZBM A;  3AG3 C;  3SPI A;  3UKM A;  4G28 B;  5E1A C;  4WFE A;  1B6Q A;  1KP3 A;  4E2L A;  3SYC A;  1XL4 A;  4HZ3 A;  3SYA A;  3ETE A;  1VQ4 V;  1VQ9 V;  3CYO A;  5EBW C;  3UM7 A;  5IYB O;  1BL8 A;  1RM1 B;  2DYS C;  3AG2 C;  4PDV A;  3LSQ A;  1K4C C;  3JCZ A;  4DXW A;  1YHQ V;  1SER A;  2B1I A;  3SPC A;  3OE7 G;  5LHH A;  1ROP A;  1BMF G;  1F51 A;  3CC7 V;  4N23 A;  1WLE A;  4MS2 A;  1P4R A;  1VQO V;  1GK9 A;  2EIN B;  3D36 A;  2B1G A;  4MVU A;  1K97 A;  3JD0 A;  1NJI W;  1YI2 V;  2IU0 A;  2DW4 A;  2EIL C;  4G2K A;  4PEL A;  4JTC B;  3AG1 B;  5H9C A;  1YJW V;  4KUM A;  3QO8 A;  1YIT V;  4I5S A;  3OUF A;  1CP9 A;  4QE7 A;  5KA6 A;  1JQ0 A;  1R3L C;  2WLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...