5J9PC

Kcsa in vitro
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5j9pC00
1K4CC 5IY5C 3ZJZA 4H37A 4DXWA 3STLC 2EIMC 2X6AA 4XDLA 1XL4A 3JYCA 4XDJA 1ZWIC 2WLLB 4WFEA 4X88A 3WG7C 3ZRSA 1P7BA 3RW0A 2WLHA 5EK0A 3SPHA 4OXSA 1G4YB 3LDDA 4PA3A 5J9PC 3LDCA 3OGCC 1R3LC 3AG3C 3FB6C 4WFHA 3SPGA 3X2QC 4MW8A 3AG2C 2P7TC 4MSWC 4PDRA 3AG1C 1JVMA 2HVJC 3K0DA 4WFFA 4PA9A 5EBWC 1QLEC 3UKMA 3LDEA 5CBGA 4MVUA 3R65A 2X6BA 5KUKA 3GB7C 2EIKC 3E8FA 4PDVA 2Q67A 5CBHA 5B1BC 1M56C 3VOUA 2ZD9A 3AG4C 4HZ3A 4P9PA 1R3KC 2EILC 2Y69C 3ABKC 2EIJC 2EINC 2IH3C 4RAIA 2OCCC 1OCOC 3E8HA 4R7CA 3SYQA 3SJQC 4J9ZB 3K06A 2Q6AA 4JTDB 1J95A 3E83A 3FB8C 1S5HC 4LBEC 3F7YC 3LUTB 3TETA 3OR7C 3F5WC 4LCUC 2BOBC 4UUJC 4R8CA 1ORQC 2HG5C 2H8PC 3E86A 4PA6A 3KG2A 4J9YB 4QE7A 4CBCA 2DWEC 4X89A 4P30A 3SYOA 4GX5A 3K08A 2AHYA 2K1EA 3ASNC 1XL6A 4ZBMA 4G28B 2WLKA 2WLIA 3PJSK 3LNMB 2Q69A 4MTGA 3OUFA 4PA7A 3SYCA 2WLNA 3OUSA 4MVOA 4X8AA 2DWDC 4MVMA 3SYPA 4EKWA 2YEVA 1LNQA 2QTOA 4PDLA 5E1AC 4QNHB 3K04A 4H33A 4BW5A 5EC1C 4R6ZA 2HVKC 1V55C 5EC2C 2BOCC 4MVZA 4PDMA 2DYRC 4MVSA 3RVZA 4P2ZA 3UM7A 2NLJC 4MVRA 1V54C 1R3IC 3E8GA 1OCZC 2HJFC 2QKSA 4JTAB 3IFXA 1OCRC 4P9OA 3SYAA 2ZXWC 5B3SC 2WLLA 2W0FC 3F7VC 3FB7C 4KFMA 4RO2A 5BZBA 2KB1A 4MS2A 3T4ZA 3EFFK 2WLJA 3SPCA 4R50A 2A0LA 2IH1C 4PA4A 3ASOC 3IGAC 5CBFA 2X6CA 3E8BA 4GX0A 3RVYA 4LP8A 2R9RB 5KUMA 2HFEC 2WLMA 1BL8A 3TCUA 4GX2A 3T1CA 4XDKA 2AHZA 4TWKA 2A9HA 4QE9A 4RUFA 2ATKC 3ABLC 3ABMC 3E89A 3K03A 4WFGA 4I9WA 3K0GA 1KKDA 3T2MA 1OCCC 4G27B 3HPLC 4MW3A 2ITDC 2ITCC 4JTCB 3BEHA 3RBZA 3T4DA 1K4DC 5B1AC 2WLIB 3FB5C 4MTOA 4F4LA 5EBLC 2DYSC 2Q68A 1M57C 3OR6C 3STZC 4GX1A 1R3JC 4HYOA 3SPJA 3SPIA 5EBMC 2A79B 4RUEA 4MVQA 2JK5C 4MTFA
chains in the Genus database with same CATH superfamily
4NR1A 1COWG 2DQ0A 2P4VA 3CPWU 4LFAB 3WB1A 4JI5O 2ZM6O 1JQ0A 1N4CA 1BHBA 1R3LC 4IGGA 3MAQA 4CH3A 1BCCH 1W0JG 4K0KO 2LQTA 3AG2C 2MW2B 3K0DA 3OMIB 3ML0A 3CC2V 3ZRWA 2RQ6A 5DECA 4PDVA 5LHHA 3L72H 3JARB 4NB5A 4RAIA 2PI4A 2GUZA 2ZDIA 4NXMB 1JFFA 3J81N 5L3DA 2QSAA 1GM8A 1FFXA 2KSDA 4PA6A 4UB6Z 1RM1B 4X89A 1SC5B 4UFZA 4DR6O 2ADPA 3ZMUA 1XL6A 2UUCB 1OCCB 4GCZA 4PA7A 4LR3A 4DV7B 4DR2O 3P30A 1URFA 1MNGA 3UM7A 4P2ZA 5BMVB 1R3IC 4KL1A 3CRAA 3CRMA 3WG7B 3T1HO 2M7WA 2BE3A 4EFBA 1GKFA 2R9AA 3CCVV 4UCRA 4O2AB 3K57A 3AG1B 5DM6V 3W7SA 2HR3A 3CCMV 5EBLC 3MHSC 1PM9A 4JASA 4C7UA 2EIJB 3HKBA 2XHBA 4FLXA 5CA0B 4ZI7A 1TGOA 5HFLA 3BABA 1AB3A 1US6A 5KMGB 4A5UB 2DOSA 2WLHA 1SS3A 5J9PC 3LDCA 1VP7A 1FXHA 3RYIA 1IBMB 2W6IG 1HWYA 3OGIB 1OV9A 1DK1A 2QM7A 2FL4A 5IT9N 3UKMA 3K5MA 5LGNA 5CBGA 1AI4A 1K5SA 2P22C 3JASB 5EYPB 1R3KC 4LFCB 2Y4UA 4X1IB 5JH7A 2LJ2A 2AGAA 1FJGB 3OTFA 5LP6C 4LF9B 3E86A 1DLBA 2YIBA 4QPJA 4NTYA 5EZYB 3ASNC 4JYAO 3ZCCA 1EZJA 1H2LA 1N36O 2H94A 1FYJA 2QKAA 3DXRA 3TGUH 2Y4TA 3IJ4A 1M1KW 5JJNB 1OHHG 4FPPA 2HVKC 5JJJB 4JI8O 3B8MA 1HR0O 2ZQMA 4X62O 1YJWV 2R70A 2HJFC 1XQ8A 3E35A 2GTAA 3JD0A 3KZIZ 2XAHA 1N33O 1THZA 4K3AA 5CBFA 1TUBA 2HFEC 3H1JH 4I4TA 5KX5B 4B3RO 1JJ2U 5LXTA 4YHHO 4LF4O 2LFSA 3ZHRA 5A9GA 4G27B 2ZE6A 5FPRA 3W7UA 3MDSA 4F4LA 2P06A 3SJCC 4CH4A 3EHBB 3N2KA 3STZC 4DR7O 1VARA 2Y69B 4MVQA 2Z5UA 1P84F 4MTFA 2GSMB 3KCYA 5IY5C 2Z3YA 4HNAA 2DN9A 3S3WA 2DE0X 5EK0A 3ZEDA 1AP6A 2WSSG 2ZE8A 2BTQA 3CD6V 1HNZO 4D6TH 4WFHA 2D2CB 3SPGA 4D7SA 3X2QC 4BIZA 5IDJA 2JGDB 1SQBH 2YI8A 2FMLA 2QJ1A 1Y66A 4JI6B 3AK3A 1I0HA 1QLEC 2Q7HA 3I5DA 4O4JB 5CN0A 4PI2A 2Z0AA 1Q86W 4JF3A 4ZHQB 2EINC 2IH3C 1XUQA 5H6QA 1GN4A 2VQEO 1J95A 2Q7GA 1VMGA 4JI5B 1EN4A 1DF5A 2K9PA 4K0KB 4CBCA 1EBOA 3M8AA 1AJNA 4ZBMA 4DW1A 2JS3A 2GV9A 3LNMB 2WA4A 4DRXA 4EKWA 1F4NA 4YIOA 1LNQA 2HJDA 3W7XA 1M57B 4IT5A 4D7TA 3W7WA 4MVZA 1GRJA 1LUWA 1V54C 3IFXA 2QDOA 1WB8A 2EULA 1Y76B 2YSUB 4LF8O 2ODMA 3K9SA 5D5PA 1RFYA 2FB5A 2OYQA 5KUMA 1AROP 4DR6B 4J10A 2OTJV 2RDCA 3WU2Z 3JSLA 1IZ3A 1XMQO 4DR2B 4F6RA 3FB5C 2LFRA 1HW7A 3ABUA 1ZUQA 5J2UB 4OGQB 2JEUA 2A79B 1PV0A 2ZNJA 1Z2GA 5C93A 4DV2O 5B1OA 2EIMC 4X20B 2CDYA 3CCSV 5J2TA 4LF5B 1NVPB 2PYLA 1IURA 3RGBA 4MW8A 5JQGB 1AI6A 3CMEV 2IW5A 3ZMTA 4IHJB 1WPBA 1EFRG 3OM3B 3CE2A 2ZD9A 4J41A 2EILC 4AHCA 2R9IA 1S72V 4FM0A 3QVNA 4DV3O 5EZYA 1YTFB 4N21A 2Q0AA 4FLZA 2BOBC 4Q20A 1O9GA 1BQZA 3SYOA 3ETDA 4JI1B 2L35A 4NTWA 1MA1A 2DYRB 4RQFA 2ZKOA 4H44B 2PTMA 1MABG 1P49A 4N23A 4MVSA 4TQFA 2A06H 3HKDA 5B3SC 2QWQB 1HNWO 3JSNA 2A0LA 3D3IA 2WPDG 1JFFB 3CRQA 4JYAB 4I9QA 3CC7V 1VQ5V 4FK5C 5KHJA 5FLXN 4B7EA 5IWAO 2JJ2G 5KHKA 4TQDA 1YCIA 3IAYA 4JI8B 1HR0B 2Q68A 1VQ4V 2EIKB 4I5SA 3M7MX 3ABTA 4J7KA 3FKSG 1N33B 1P4RA 5L3CA 1SERA 4FLYA 5F2VO 1WB7A 5KHGA 4DV5O 4B3RB 1NH2B 3LDDA 1MSWD 2W0XA 4YHHB 4LF4B 4E2LA 4O4JA 4QPKA 2AZ2A 2H3OA 2NR5A 5D5QA 4RWUA 3ZS8C 4DR7B 3CCQV 3LSQA 1E1RG 3K5OA 3E8FA 1XDCA 1H8EG 2RCVA 4I50B 2OCCC 2RNBA 4CC6A 5IJ9A 2EZOA 1VQNV 2PYJA 3I56V 4JAAA 1XNQO 1J5EO 4LF9O 1HNZB 3JD4A 2F23A 1M90W 4P30A 4WCEV 2HKOA 3FAVB 4DO2A 3CHXA 2WA3A 2ZT9B 4JI4B 2XAGA 3RYIB 4DK1A 1KU9A 2RN9A 3ETQA 1Q6HA 5L3EA 1ROPA 1SA0B 4O4LA 1PNLA 2DYRC 2VQEB 2NLJC 3E8GA 5IYCO 2IJIA 4BAYA 2QWPB 3B40A 2YXHA 4PA4A 3ASOC 1XREA 3D3QA 5JH7B 3RVYA 4BIOA 3QG5A 2QA4V 1K92A 2ZDIC 1WJZA 4MTXA 3DSQA 3CYOA 4FMTA 4DR3O 1L1FA 5B1AC 2IJHA 1YSCA 4X20A 1YHQV 3ZX6A 1O9HA 5FPOA 2ZIMA 4H37A 5LMUO 2X6AA 5JQGA 4X1YB 1KUQA 5JJEB 4OXSA 1WA8A 3JAKB 3ZHVA 4FJCC 1TUBB 1R6KA 4IHJA 1VQ9V 1MMMA 4I4TB 4HAMA 1M9NA 5B1BB 3CCJV 3TXQA 3L71H 4UCUA 4MVUA 3C90A 1Y67A 3BRCA 1V55B 3GB7C 3M99B 3VQYA 2P6JA 1XHZA 4DV2B 3N2KB 1DTOA 1SQXH 2PUSA 2JVDA 4J9ZB 3P3PA 4JPRA 4JI3O 3OR7C 5L3GA 4HNAB 4K8ZA 4AILC 1K33A 2IU3A 3VQWA 5LMNO 4OX9B 2BTQB 1MOFA 4UCVA 4AQYO 4DW0A 4MTGA 1FXKB 1I5YA 2WLNA 3SJBC 4X66O 1HP8A 4WBNA 2JGUA 4Z1MG 1W0KG 1TVKA 4YY3O 1FAFA 4UB8Z 4LH7A 2NNUA 2LW1A 2P67A 4DV3B 3SYAA 1DGSA 2ZXWC 3FB7C 4JI0B 2YI9A 5DN6G 2IH1C 3ZHTA 1P7GA 4TV8A 3G6EV 1W59A 2E5LO 1KKCA 3VQXA 1D5AA 4TWKA 2M6YA 2XASA 1VQMV 3ABMC 4JYCA 3CJHA 4DV6B 2UXBO 4GKJO 4DRXB 2R72A 4GX1A 3SPJA 2QEXV 4EB6A 3ABKB 4B7KA 1HNWB 1KC8W 3UO3A 1VF6A 2Y0IA 4DXWA 1K9MW 1JOYA 1UFIA 4LF5O 3JAWA 1K73W 1GN2A 2CGOA 5IWAB 3CSXA 2P4KA 1F4MA 2ADQB 3OE7G 2F1MA 4I50A 3UQ8A 4DV4O 4B08A 4J80A 1MZFA 4F6RB 3AK2A 3D36C 5B1BC 3AG4C 1YI2V 1SQVH 5IYDO 1Y6XA 3E8HA 5K1XA 1PL0A 4R7CA 1AP5A 5L3BA 3CCUV 4DV5B 3OW2U 3HB3B 4LFBO 3FAVA 1IVSA 2PY5A 1ZX3A 4QE7A 4JI1O 2ZE7A 2YUAA 1SA0A 4PV1B 5J2TB 2Q9LA 1KMIZ 1GN6A 1OZ0A 2DYSB 2DQ3A 3FD9A 4TV9A 2ZR3A 4YJ3B 1FKAO 3AG7A 3JCUZ 1XNQB 1J5EB 4OPHA 4MS2A 4TT3G 2N04A 1K3EA 4LF7O 1Y74A 1RM1C 4H13B 2V1DA 5C8YB 4DV1O 1AR5A 4QE9A 3K5LA 2X0LA 4CZZA 1OCCC 3JD3A 4U7OA 2CUGA 3RBZA 2F95B 3JD2A 4JZGA 4FZ1A 5AG2A 5KLVH 2Q73A 1YJ9V 1I08A 3OR6C 1S76D 5H9CA 4DK0A 1M56B 4X1YA 4X64O 1H2NA 3JCZA 4RUEA 4FZ0A 1OCOB 3JAKA 3L73H 4KP4A 4BR6A 3NR7A 3AEIA 2MK3A 4XDLA 3HKDB 4U7NA 3WG7C 2QR4A 1VIBA 1BT8A 4PA3A 4IIJB 3S3XA 5ITZA 4DR3B 3O9OA 1FD9A 3AG1C 1KP2A 1N8RW 2E76B 1RP3B 5LMUB 2EIJC 1XNRO 1OCRB 3CS5A 2ARHA 2OCHA 3RYCB 4LF6B 5DEDA 3TETA 2WWWA 1FXKA 3O65A 5A2QN 4PHZA 5LHIA 1IX9A 3SJAC 4JI4O 3N27A 3RT3C 1YDXA 2AXTZ 1EM1A 5KAFZ 3G71V 2IJKA 2B1IA 2V7QG 4O4IA 3K79A 3K3WA 3K04A 4CH5A 4BW5A 1N0JA 4LC1A 4ASUG 5EIBD 1YVWA 1L0LH 1Z5VA 3UT5B 4BW9A 4JI3B 5LP6A 4UXNA 3RYHA 3AK1A 4I7ZB 5IJ9B 1VQ7V 3L75H 4GX0A 1W2BU 5LMNB 1BL8A 4GX2A 4AQYB 5FNVA 4X66B 3W7TA 1Z5WA 4CS2A 5IYZB 4YY3B 1XI1A 3BEHA 1NVPD 2DW4A 3NXSA 3OEHG 2CTPA 1R3JC 4Q6GA 5CB4A 1B3QA 5K1PA 4FFKA 1UJWB 4O4LB 3QF7A 1NR1A 2E3CA 4WFEA 4PI0A 2E5LB 3QO7A 3OAAG 2KG7A 3OMNB 4PJ0Z 1DF4A 3VQVA 3H9VA 3RYFA 4PDRA 2UXBB 4GKJB 4PA9A 2CTQA 1E79G 2VWKA 1GTOA 2X6BA 5IE9A 4UCOA 3RWRD 2Y69C 2EZPA 4AI8A 1KBHA 2QTSA 1Q5OA 3RN4A 1H2KA 4FLVA 3GWKC 1RSOA 2DJVA 2OIGA 2LW7A 4UUJC 3EXAA 4X1KB 3U10A 4OX9O 5CA1A 1WA8B 3ABLB 4DV4B 2Q69A 4YJ3A 1H2SB 4FLTA 3SYCA 4ABMA 3OUSA 4QGPA 1ZSPA 3CCEV 3Q4HB 2B5UA 5IYBO 1PPJH 3BVOA 2VRZA 3RVZA 3BPZA 4LFBB 4JI0O 1YF2A 2HLDG 2WLLA 2W0FC 4WF9V 1X59A 3E2EA 3BA9A 5C8YA 1GM7A 1M93A 1SQQH 1IXMA 4R50A 2X6CA 1YEWA 2ZINA 4GYCB 2YIAA 1XMOO 2JDIG 3AG3B 3H1KH 3CRCA 4ZOLA 1U96A 3GVMA 3ZRXA 4DV6O 4NYKA 2LO1A 1NH2D 4MW3A 3CCRV 3ZBHA 2EJ7A 2QWNB 3KCXA 1M57C 4CC5A 3FX7A 1F7YA 4WBNB 1VEWA 1TVKB 5EBMC 4IIJA 1K4CC 2G38A 5E79Z 2XAQA 4LF7B 2HP8A 4LNUB 1K8AW 1ZWIC 3H1IH 1HDJA 3P32A 3SPHA 4JGSA 4EFEA 4DV1B 1A32A 4TV8B 1H8HG 1H2MA 1NZ6A 2CK3G 5EIBC 4JAUA 3HKCA 2HVJC 3TJTA 1VQ8V 1BMFG 2P90A 3CJHB 4X64B 3RYCA 1CPYA 3R65A 5L3FA 1CEZA 5CBHA 2Q7EA 2D3OW 4EB6B 2E74B 2ETNA 4JTDB 3DC6A 3A2FA 4L87A 3U11A 2DWEC 4GX5A 3JAWB 1K34A 4IYIA 1WPXA 4UV8A 3K58A 3PJSK 3UT5A 2DWDC 5JCOC 5KAIZ 2LGWA 4PDLA 2JIZG 1VQKV 1SQFA 2YICA 1XNRB 2YIBD 1CXZB 4GT1A 3EVKA 1QU7A 3WFVA 2QKSA 1PD3A 4JI2O 2PI5A 1SQGA 2YIDA 4CH6A 2ZE5A 4L8JA 5IYZA 3QO5A 1R73A 3ZIAG 1SF9A 4G2KA 1N34B 1JMKC 4UV9A 1BZKA 3AG2B 4WFGA 3G67A 3K0GA 1V9PA 4JTCB 3QO8A 4MTOA 1FXVA 1U97A 1WN7A 2YS8A 1E1QG 3C3SA 1VF7A 4TV9B 1Q6UA 4YJ2A 3JALB 5LA6A 1K5QA 1K97A 3ZHUA 1RPOA 2YXYA 1Y74B 2NN4A 2HHHO 3WB2A 2A7WA 4QJFB 1PP9H 1JCHA 1ZL8A 3ZN1A 3JD1A 3DTUB 3R66A 2EIKC 2Q67A 3HR0A 1AJPA 2GTSA 2E75B 3OMAB 4EEQA 4HBNA 4IL6Z 4B3SB 1WNSA 4X1KA 3K06A 2Q6AA 4NTXA 4LF6O 3E83A 3FB8C 3N2GB 3A8TA 1VF5B 4MT8A 2FTKA 4I55B 3A0BZ 3ZHQA 3Q4HA 1QQCA 1VF6C 5ITZB 2WLIA 3OUFA 1Q43A 1VQPV 4MVMA 5BXZA 1SQPH 5H2FZ 2QTOA 3H1HH 4UCSA 2IJJA 1WAZA 5EC2C 3OTOO 5BR8O 1VQ6V 3H01A 1SESA 4CS4A 4CS3A 1B6QA 1JR9A 1NBMG 1MG1A 4H0LB 5BZBA 1N0NA 3CXHF 2HEPA 2QWOB 5B5EZ 1XOUA 4XDKA 4O2BA 2ZCEA 1KKDA 4O4HB 3HPLC 3UCSC 2ITCC 3T4DA 2CTRA 2UU9O 3LSSA 2N74A 2YDEA 3B8NA 1Y4MA 4LNUA 1KQSU 4O4IB 4J42A 1XHXA 4HYOA 4IYHA 1AI7A 1NR7A 1QVFU 2QKCA 4E4EA 4NVPA 2CAZC 2UUBO 4F6EA 5JVDA 4JZ2A 3FYEB 3JYCA 1TUEB 1YITV 5KA6A 1QR8A 1XMOB 5LP6B 1BSMA 1T5EA 3RYHB 1SZTA 1FS0G 1OJHA 2OT5A 1FFTB 3ZRVA 1Q6IA 3B4SA 1TAEA 3GWOA 3ASNB 4Z1VA 3G4SV 1GN3A 5FNVB 1N32O 4FM2A 4OPAA 1ZTEA 2UXCO 3ZMVA 2V4DA 5BY1A 1AR4A 5GONA 4J7ZA 5CB4B 2IM9A 3SJQC 3E22B 1S5HC 2Q0OC 5LYJB 4PD4F 3ZN0A 3OFNG 2PGGA 5B66Z 3D8CA 3K08A 2KG7B 3CMAV 4ICGA 3CP1A 4GLXA 2CH7A 3RYFB 1AVMA 2YEVA 4KHPB 1S3JA 1IXBA 5LOVB 4ZKIA 2JRIA 1D2DA 1V55C 4PDMA 1VQLV 4P9OA 5IY5B 4I0XA 1QBZA 2Y48A 2WLJA 3SPCA 1D5NA 3OD4A 1X4TA 3PN1A 1RSOB 1GK9A 3TCUA 2JJ1G 3L9DA 2IU0A 3X2QB 1JJOA 3DGEA 2XT9A 5CA1B 1FXKC 1QLEB 2UXDO 4DUZO 1BS3A 3JALA 3ZHSA 1YZBA 5B1NA 4LWSB 3LSUA 2P5OA 3FYIB 2KQXA 2EINB 4JI2B 2XUMA 3H1LH 3T1YO 2EJRA 3STLC 2VS0A 2WLLB 1JX9A 1Q90D 1S5JA 3CRRA 3ZMSA 3OEEG 3WB0A 1IBKO 3FB6C 5KHIA 2UXNA 2XTAA 1BGYH 4DR4B 4ZOLB 1WP8A 1AILA 1QR9A 3LDEA 2B1GA 1R6NA 5JWPA 2ZIOA 3N2GA 1GMGA 5KUKA 4DV0O 4Z2WA 2FYUH 1BQ0A 3VOUA 1V54B 4I55A 3A0HZ 3ABKC 2JS5A 3CC4V 4GKKO 3SYQA 4W4LA 1WLEA 1QCEA 4YXWG 2Y0PA 3F7YC 3TK1A 3IC7A 1QHTA 4JAVA 3F5WC 4LCUC 4UVCA 4DUYO 3HKEA 2HHHB 1YXBA 1LR1A 4WFAV 3OT7A 4G28B 5LL6Y 2CE4A 4TUYB 3JATB 4MVOA 1H38A 1SKVA 2BSKA 2Q8VA 3D36A 5E1AC 1OCZB 3B77A 3HKCB 1R1BA 2RMKB 4DYLA 2YXLA 3SGIA 4WFBV 2VQFO 4B3TB 2EIMB 4RO2A 1M5IA 3T4ZA 1EN6A 1KYOF 3IGAC 4O4HA 1IBLO 1PL4A 2R9RB 1N34O 3VBBA 1F23A 3T1CA 5KA5A 3BCCH 1GM9A 1Q8IA 4B3MB 2A9HA 4KXRA 1S5LZ 4U3JB 3MD0A 4JYBA 3I55V 2LGQA 4U3FH 1S0VA 4TSFG 3OTOB 5BR8B 1M4UA 2PZSA 2DYSC 4X65B 3JARA 5HFMA 2F93B 1SZXA 3ZMZA 2EILB 2CGNA 4NXNO 2QGNA 1IDSA 1KECA 2XAFA 2C2AA 2VWJA 1XL4A 1WP7A 4JI7O 4X88A 3ZRSA 1YIJV 1P7BA 4LH6A 3OGCC 2ZM6B 3BFRA 1XEQA 3B09A 3UO2A 1GAXA 4MSWC 2UU9B 3B2EE 1I5XA 4DR1O 4WFFA 3BHPA 4QIWF 4BWAA 4FM1A 4FIPC 1PKXA 3E22A 4DR5O 5BMVA 5LYJA 2UUBB 4UCTA 1EN5A 4FLWA 1M56C 2YC0A 1BHAA 4P9PA 4B3SO 1OCOC 5B3SB 4JV5O 2QM4A 1SETA 4LBEC 3LUTB 1YTFD 3CX5F 3QNEA 2HG5C 3G80A 4YJ2B 5LA6B 2UUAO 3MHHC 2A3QA 3KG2A 4J9YB 2F4VO 1LUVA 4KUMA 4O2AA 5GTIZ 1HNXO 5LOVA 2B9ZA 2K1EA 3FFQA 1N32B 1AJQA 3APOA 3ETEA 4X9QA 3SYPA 3SR2C 2GBOA 4J11A 3CXCU 1KP3A 1QLNA 2UXCB 1I7FA 1ZL8B 2XAJA 3A0RA 4QNHB 4FFBB 5EC1C 4R6ZA 3P3NA 3CEIA 5CA0A 2BOCC 2QM8A 4GZRB 1G8MA 2XNDG 5KMGA 1OCZC 3DC5A 4JTAB 1OCRC 5H5NA 1NTMH 1I94O 3F7VC 4KFMA 4W4KA 4XBFA 3BY6A 3E8BA 4LFAO 1Q3EA 1NQTA 3T1HB 2WLMA 4JYYA 3QTCA 2BTOA 1NU1H 4LWSA 2ZNIA 1FPOA 2ITDC 2Q5ZA 1ENVA 2WLIB 3JASA 5EYPA 1ZAUA 1AI5A 1Q7YW 4X1IA 1ZLZA 4J7JA 2OCCB 1L0NH 4YIPA 4GUNA 4XDJA 5IJ0B 3APQA 4NXMO 1NKDA 1G4YB 1RPRA 1PNKA 2EX3A 2OTLV 2EBOA 2L6LA 2UXDB 2W6JG 3L74H 1B06A 2JEXA 1TA8A 4DUZB 3J7AU 4O2BB 2F43G 2UUCO 5LGTA 5FL7G 3BAAA 1GH6A 1GO3F 2UXXA 4DV7O 1EZVH 2F66C 3T1YB 4HZ3A 1R6TA 1Q81W 3ZRWB 5JVDB 3ASOB 1MZEA 4R8CA 1ORQC 3JATA 4TUYA 5CMUA 5KX5A 2H8PC 1IBKB 1NJIW 1NS1A 2GUZB 5GTHZ 2AHYA 2DMXA 1KB9F 1NT2B 3IC9A 2IBZH 1JA8A 1N36B 4KHPO 5B1AB 3ETGA 1FFXB 3K9AA 4DV0B 5KHHA 3BA8A 1AR1B 4GKKB 4MVRA 4X62B 4ZIBA 4PELA 5GONB 4DUYB 3EFFK 2GDSA 2KKWA 1H2GA 1K7DA 3ICXA 4U3JA 4LP8A 4BIUA 2QWRB 2WAMA 2JGDA 1F51A 1NTKH 1G1XB 3K5NA 3ABLC 3E89A 3K03A 1IBMO 3T2MA 4RQEA 1K4DC 2CH7B 4ZHQA 2VQFB 2YEVB 3K59A 2JK5C 2OIEA 1L8DA 3ZJZA 2X7RB 4LFCO 4NKGB 1IBLB 4I0XB 3U0ZA 2CTWA 2GHYA 3RW0A 1KD1W 5TISZ 2RJZA 4FVMA 5LBQA 3HKBB 1FJGO 2LP7A 4ZI7B 3AG3C 1NI8A 2ZR2A 5LHGA 1B04A 2P7TC 4DR4O 3J80N 1JVMA 5EBWC 2OWOA 2ILMA 2BCCH 1XILA 1Q82W 3CCLV 4K35A 4NXNB 1XBLA 2ZXWB 1QVGU 1Y76A 4JI7B 3JAMN 5GW7A 3SDLA 1NTZH 2AZ0A 1G6UA 3THOA 2XOKG 4FFBA 5LGUA 1QNMA 2N05A 4DR1B 4UVAA 3ABMB 1BE3H 2WLKA 1JPXA 2QE7G 5CA3A 4X8AA 4DR5B 5J2UA 4H33A 4K8XA 1SRYA 4FLUA 3TXSA 3RFRA 2AW9A 4JV5B 4B3TO 2O57A 2Q4PA 3CB2A 3DXRB 1S77D 3L70H 2KB1A 4TOIA 2UUAB 2F4VB 3C3TA 4LF8B 4UVBA 1HNXB 3KKYA 1CP9A 4B3MO 2AHZA 2FKXA 3HKEB 4RUFA 5JCOA 2ATKC 3G6BA 1YJNV 2PF4E 4I9WA 3LNNA 1PNMA 3CWBH 4X65O 1XMQB 1VQOV 4JI6O 2BSKB 5IJ0A 5LXTB 1UPGA 5H6RA 3SPIA 1I94B 1MSDA 3AG4B 3F5TA
chains in the Genus database with same CATH topology
1UJWB 3FKSG 2EJRA 1COWG 1P4RA 3STLC 5L3CA 1SERA 2DQ0A 1NR1A 3CPWU 2WLLB 1JX9A 4WFEA 3QO7A 3OAAG 1NH2B 3LDDA 3OMNB 3ZMSA 1MSWD 1JQ0A 3OEEG 1DF4A 4E2LA 1BHBA 1R3LC 3FB6C 4QPKA 1W0JG 2UXNA 3AG2C 4PDRA 3K0DA 3OMIB 4PA9A 3ML0A 1E79G 3LDEA 1QR9A 2B1GA 1R6NA 3CCQV 1GTOA 2X6BA 3LSQA 1E1RG 3CC2V 1GMGA 3ZRWA 5KUKA 3E8FA 4PDVA 3VOUA 5LHHA 1V54B 1H8EG 3ABKC 2Y69C 2EZPA 3CC4V 4RAIA 2PI4A 2OCCC 2ZDIA 3SYQA 2EZOA 1WLEA 1VQNV 1QCEA 4YXWG 3I56V 3F7YC 3TK1A 5L3DA 3IC7A 4JAVA 3F5WC 4LCUC 4UVCA 4UUJC 3JD4A 1GM8A 1RM1B 4PA6A 1M90W 4X89A 4P30A 4WFAV 4WCEV 2HKOA 3ABLB 1XL6A 3ZMUA 4DO2A 4G28B 2Q69A 1OCCB 2XAGA 4GCZA 4PA7A 3SYCA 3OUSA 4MVOA 3CCEV 1H38A 3D36A 5E1AC 1OCZB 2B5UA 3B77A 5IYBO 5L3EA 1ROPA 3P30A 1PNLA 2DYRC 3RVZA 3UM7A 4P2ZA 4WFBV 2NLJC 1R3IC 3E8GA 5IYCO 2IJIA 2HLDG 4BAYA 2WLLA 2W0FC 4WF9V 3E2EA 2EIMB 4RO2A 3T4ZA 1GM7A 1IXMA 3WG7B 4R50A 4PA4A 3ASOC 3IGAC 2X6CA 3RVYA 2M7WA 2R9RB 2JDIG 3VBBA 1F23A 1GKFA 3CCVV 2QA4V 3AG3B 3T1CA 1K92A 2ZDIC 5KA5A 1GM9A 2A9HA 3ZRXA 4MTXA 3CYOA 4FMTA 3AG1B 3MD0A 5DM6V 3W7SA 2HR3A 4MW3A 4JYBA 3CCMV 3CCRV 1NH2D 1L1FA 5B1AC 3I55V 2IJHA 1YSCA 4TSFG 1S0VA 1YHQV 5EBLC 2DYSC 3MHSC 1M57C 4JASA 5HFMA 5EBMC 3ZMZA 2EILB 2EIJB 1K4CC 5HFLA 4H37A 1KECA 2XAFA 2C2AA 2XAQA 2X6AA 1XL4A 1K8AW 1ZWIC 4X88A 3ZRSA 1YIJV 3P32A 1P7BA 2WLHA 3SPHA 4JGSA 4OXSA 5J9PC 3LDCA 3OGCC 1FXHA 1H8HG 4FJCC 1R6KA 2W6IG 1VQ9V 1HWYA 4MSWC 2CK3G 4HAMA 1I5XA 4JAUA 2QM7A 1M9NA 5B1BB 2HVJC 4WFFA 3UKMA 4QIWF 3CCJV 5LGNA 1BMFG 1VQ8V 4FIPC 2P90A 1PKXA 4MVUA 5CBGA 1CPYA 3R65A 1AI4A 5L3FA 1K5SA 1CEZA 1V55B 3GB7C 3M99B 5CBHA 2P6JA 1M56C 1BHAA 4P9PA 1R3KC 1DTOA 2D3OW 1OCOC 5B3SB 4J9ZB 4JTDB 1SETA 4JPRA 4LBEC 3LUTB 1YTFD 4L87A 3OR7C 5L3GA 3QNEA 2HG5C 3E86A 3MHHC 3KG2A 4J9YB 4KUMA 1K33A 1DLBA 2DWEC 2IU3A 4GX5A 4QPJA 2K1EA 3ASNC 1K34A 1WPXA 4UV8A 1MOFA 1AJQA 3PJSK 3ZCCA 1EZJA 3ETEA 4MTGA 2H94A 1FXKB 1I5YA 2WLNA 3SYPA 2DWDC 4Z1MG 3CXCU 1QLNA 1KP3A 1W0KG 4PDLA 2JIZG 1VQKV 1M1KW 2XAJA 3A0RA 4QNHB 1OHHG 4FPPA 4R6ZA 5EC1C 2HVKC 2NNUA 2QM8A 2BOCC 2ZQMA 2P67A 1G8MA 3B8MA 4GT1A 2XNDG 1YJWV 3WFVA 1OCZC 2HJFC 2QKSA 4JTAB 3SYAA 1OCRC 3E35A 1PD3A 2ZXWC 3F7VC 3FB7C 4KFMA 4XBFA 3JD0A 2XAHA 2PI5A 5DN6G 1THZA 2IH1C 3BY6A 5CBFA 3QO5A 3E8BA 1R73A 3ZIAG 3G6EV 1NQTA 2HFEC 4G2KA 2WLMA 4UV9A 1JJ2U 4TWKA 3AG2B 2LFSA 2XASA 1VQMV 3ABMC 4JYCA 4WFGA 3K0GA 4G27B 3W7UA 2ITDC 4JTCB 1ENVA 3QO8A 2WLIB 4MTOA 4F4LA 1FXVA 3EHBB 1AI5A 3STZC 4GX1A 3SPJA 1Q7YW 1E1QG 2QEXV 3ABKB 2Y69B 4MVQA 2Z5UA 4MTFA 2OCCB 2GSMB 1KC8W 5IY5C 4DXWA 1K9MW 2Z3YA 4XDJA 1K5QA 1JOYA 1NKDA 5EK0A 1K97A 1G4YB 2WSSG 1RPOA 1K73W 1RPRA 3CD6V 1PNKA 4WFHA 3SPGA 2OTLV 1F4MA 3X2QC 2EBOA 4BIZA 4QJFB 5IDJA 1JCHA 2W6JG 2JEXA 3OE7G 3ZN1A 1Y66A 3JD1A 2F43G 1QLEC 5LGTA 5FL7G 5CN0A 3DTUB 1GO3F 2EIKC 2Q67A 2UXXA 5B1BC 1Q86W 4JF3A 3AG4C 1AJPA 4HZ3A 2EINC 2IH3C 3OMAB 5IYDO 1YI2V 3E8HA 1PL0A 4R7CA 5H6QA 5L3BA 3CCUV 3K06A 2Q6AA 3OW2U 3HB3B 1J95A 3E83A 3FB8C 1Q81W 3ZRWB 4MT8A 3ASOB 2FTKA 4R8CA 1DF5A 1ORQC 5CMUA 2H8PC 4CBCA 1NJIW 4QE7A 1EBOA 2AHYA 1AJNA 4ZBMA 2WLIA 3LNMB 3OUFA 1VQPV 4EKWA 4MVMA 3ETGA 5B1AB 1F4NA 3K9AA 3W7XA 1LNQA 2QTOA 1OZ0A 2DYSB 1M57B 2IJJA 3W7WA 2DQ3A 1AR1B 5EC2C 4MVZA 2ZR3A 4MVRA 1V54C 1VQ6V 3H01A 1SESA 3IFXA 1B6QA 1NBMG 1MG1A 5BZBA 4MS2A 4PELA 3EFFK 4TT3G 2YSUB 1H2GA 1K7DA 1K3EA 4LP8A 5KUMA 4BIUA 1AROP 2WAMA 1RM1C 1F51A 2V1DA 4XDKA 2OTJV 4QE9A 3ABLC 3E89A 2X0LA 3K03A 4CZZA 1KKDA 3T2MA 1OCCC 3JD3A 4U7OA 3HPLC 2ITCC 3RBZA 3T4DA 4RQEA 1K4DC 3LSSA 3FB5C 2LFRA 3JD2A 3B8NA 3ABUA 1Y4MA 1KQSU 1YJ9V 3OR6C 1S76D 4HYOA 5H9CA 2YEVB 1AI7A 1M56B 1NR7A 2JEUA 1QVFU 2A79B 3JCZA 4RUEA 2JK5C 1OCOB 5C93A 3ZJZA 4KP4A 3FYEB 2X7RB 5B1OA 2EIMC 3AEIA 2MK3A 3JYCA 4XDLA 1TUEB 1YITV 2GHYA 1QR8A 5KA6A 4U7NA 3WG7C 3RW0A 1KD1W 3CCSV 1SZTA 1FS0G 2OT5A 5LBQA 4PA3A 1FFTB 2LP7A 3ZRVA 1NVPB 3AG3C 3GWOA 2ZR2A 5LHGA 3ASNB 4MW8A 1AI6A 2P7TC 3G4SV 3AG1C 1JVMA 3CMEV 5EBWC 1KP2A 2IW5A 1N8RW 1Q82W 3ZMTA 3CCLV 1EFRG 3ZMVA 3OM3B 2ZD9A 2EILC 2EIJC 1OCRB 2ZXWB 1QVGU 2R9IA 3SJQC 1S72V 5GW7A 1YTFB 4N21A 1S5HC 3TETA 3ZN0A 2BOBC 2WWWA 1FXKA 3OFNG 2XOKG 4Q20A 5LHIA 3SYOA 3ETDA 3K08A 5LGUA 3CMAV 4UVAA 3ABMB 2WLKA 1JPXA 3CP1A 3G71V 2QE7G 5CA3A 4X8AA 2IJKA 2B1IA 2V7QG 2DYRB 4RQFA 3K79A 2YEVA 3K3WA 1S3JA 3K04A 4H33A 4BW5A 4ZKIA 1SRYA 1MABG 1V55C 4LC1A 4N23A 4ASUG 4PDMA 4MVSA 1VQLV 4P9OA 5IY5B 5B3SC 1QBZA 1S77D 4UXNA 2KB1A 2Y48A 2WLJA 3SPCA 2A0LA 3D3IA 4UVBA 2WPDG 1VQ7V 4GX0A 1W2BU 1CP9A 1GK9A 1BL8A 3TCUA 2JJ1G 4GX2A 3CC7V 2IU0A 2AHZA 3X2QB 1VQ5V 4FK5C 4RUFA 2ATKC 1YJNV 3DGEA 3W7TA 4I9WA 2JJ2G 1FXKC 1PNMA 1QLEB 3BEHA 1NVPD 2DW4A 3NXSA 1VQOV 2Q68A 3OEHG 1VQ4V 2EIKB 1R3JC 5B1NA 5H6RA 4I5SA 3SPIA 3AG4B 3FYIB 2EINB 3ABTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4C C;  5IY5 C;  3ZJZ A;  4H37 A;  4DXW A;  3STL C;  2EIM C;  2X6A A;  4XDL A;  1XL4 A;  3JYC A;  4XDJ A;  1ZWI C;  2WLL B;  4WFE A;  4X88 A;  3WG7 C;  3ZRS A;  1P7B A;  3RW0 A;  2WLH A;  5EK0 A;  3SPH A;  4OXS A;  1G4Y B;  3LDD A;  4PA3 A;  5J9P C;  3LDC A;  3OGC C;  1R3L C;  3AG3 C;  3FB6 C;  4WFH A;  3SPG A;  3X2Q C;  4MW8 A;  3AG2 C;  2P7T C;  4MSW C;  4PDR A;  3AG1 C;  1JVM A;  2HVJ C;  3K0D A;  4WFF A;  4PA9 A;  5EBW C;  1QLE C;  3UKM A;  3LDE A;  5CBG A;  4MVU A;  3R65 A;  2X6B A;  5KUK A;  3GB7 C;  2EIK C;  3E8F A;  4PDV A;  2Q67 A;  5CBH A;  5B1B C;  1M56 C;  3VOU A;  2ZD9 A;  3AG4 C;  4HZ3 A;  4P9P A;  1R3K C;  2EIL C;  2Y69 C;  3ABK C;  2EIJ C;  2EIN C;  2IH3 C;  4RAI A;  2OCC C;  1OCO C;  3E8H A;  4R7C A;  3SYQ A;  3SJQ C;  4J9Z B;  3K06 A;  2Q6A A;  4JTD B;  1J95 A;  3E83 A;  3FB8 C;  1S5H C;  4LBE C;  3F7Y C;  3LUT B;  3TET A;  3OR7 C;  3F5W C;  4LCU C;  2BOB C;  4UUJ C;  4R8C A;  1ORQ C;  2HG5 C;  2H8P C;  3E86 A;  4PA6 A;  3KG2 A;  4J9Y B;  4QE7 A;  4CBC A;  2DWE C;  4X89 A;  4P30 A;  3SYO A;  4GX5 A;  3K08 A;  2AHY A;  2K1E A;  3ASN C;  1XL6 A;  4ZBM A;  4G28 B;  2WLK A;  2WLI A;  3PJS K;  3LNM B;  2Q69 A;  4MTG A;  3OUF A;  4PA7 A;  3SYC A;  2WLN A;  3OUS A;  4MVO A;  4X8A A;  2DWD C;  4MVM A;  3SYP A;  4EKW A;  2YEV A;  1LNQ A;  2QTO A;  4PDL A;  5E1A C;  4QNH B;  3K04 A;  4H33 A;  4BW5 A;  5EC1 C;  4R6Z A;  2HVK C;  1V55 C;  5EC2 C;  2BOC C;  4MVZ A;  4PDM A;  2DYR C;  4MVS A;  3RVZ A;  4P2Z A;  3UM7 A;  2NLJ C;  4MVR A;  1V54 C;  1R3I C;  3E8G A;  1OCZ C;  2HJF C;  2QKS A;  4JTA B;  3IFX A;  1OCR C;  4P9O A;  3SYA A;  2ZXW C;  5B3S C;  2WLL A;  2W0F C;  3F7V C;  3FB7 C;  4KFM A;  4RO2 A;  5BZB A;  2KB1 A;  4MS2 A;  3T4Z A;  3EFF K;  2WLJ A;  3SPC A;  4R50 A;  2A0L A;  2IH1 C;  4PA4 A;  3ASO C;  3IGA C;  5CBF A;  2X6C A;  3E8B A;  4GX0 A;  3RVY A;  4LP8 A;  2R9R B;  5KUM A;  2HFE C;  2WLM A;  1BL8 A;  3TCU A;  4GX2 A;  3T1C A;  4XDK A;  2AHZ A;  4TWK A;  2A9H A;  4QE9 A;  4RUF A;  2ATK C;  3ABL C;  3ABM C;  3E89 A;  3K03 A;  4WFG A;  4I9W A;  3K0G A;  1KKD A;  3T2M A;  1OCC C;  4G27 B;  3HPL C;  4MW3 A;  2ITD C;  2ITC C;  4JTC B;  3BEH A;  3RBZ A;  3T4D A;  1K4D C;  5B1A C;  2WLI B;  3FB5 C;  4MTO A;  4F4L A;  5EBL C;  2DYS C;  2Q68 A;  1M57 C;  3OR6 C;  3STZ C;  4GX1 A;  1R3J C;  4HYO A;  3SPJ A;  3SPI A;  5EBM C;  2A79 B;  4RUE A;  4MVQ A;  2JK5 C;  4MTF A; 
#chains in the Genus database with same CATH topology
 4NR1 A;  1COW G;  2DQ0 A;  2P4V A;  3CPW U;  4LFA B;  3WB1 A;  4JI5 O;  2ZM6 O;  1JQ0 A;  1N4C A;  1BHB A;  1R3L C;  4IGG A;  3MAQ A;  4CH3 A;  1BCC H;  1W0J G;  4K0K O;  2LQT A;  3AG2 C;  2MW2 B;  3K0D A;  3OMI B;  3ML0 A;  3CC2 V;  3ZRW A;  2RQ6 A;  5DEC A;  4PDV A;  5LHH A;  3L72 H;  3JAR B;  4NB5 A;  4RAI A;  2PI4 A;  2GUZ A;  2ZDI A;  4NXM B;  1JFF A;  3J81 N;  5L3D A;  2QSA A;  1GM8 A;  1FFX A;  2KSD A;  4PA6 A;  4UB6 Z;  1RM1 B;  4X89 A;  1SC5 B;  4UFZ A;  4DR6 O;  2ADP A;  3ZMU A;  1XL6 A;  2UUC B;  1OCC B;  4GCZ A;  4PA7 A;  4LR3 A;  4DV7 B;  4DR2 O;  3P30 A;  1URF A;  1MNG A;  3UM7 A;  4P2Z A;  5BMV B;  1R3I C;  4KL1 A;  3CRA A;  3CRM A;  3WG7 B;  3T1H O;  2M7W A;  2BE3 A;  4EFB A;  1GKF A;  2R9A A;  3CCV V;  4UCR A;  4O2A B;  3K57 A;  3AG1 B;  5DM6 V;  3W7S A;  2HR3 A;  3CCM V;  5EBL C;  3MHS C;  1PM9 A;  4JAS A;  4C7U A;  2EIJ B;  3HKB A;  2XHB A;  4FLX A;  5CA0 B;  4ZI7 A;  1TGO A;  5HFL A;  3BAB A;  1AB3 A;  1US6 A;  5KMG B;  4A5U B;  2DOS A;  2WLH A;  1SS3 A;  5J9P C;  3LDC A;  1VP7 A;  1FXH A;  3RYI A;  1IBM B;  2W6I G;  1HWY A;  3OGI B;  1OV9 A;  1DK1 A;  2QM7 A;  2FL4 A;  5IT9 N;  3UKM A;  3K5M A;  5LGN A;  5CBG A;  1AI4 A;  1K5S A;  2P22 C;  3JAS B;  5EYP B;  1R3K C;  4LFC B;  2Y4U A;  4X1I B;  5JH7 A;  2LJ2 A;  2AGA A;  1FJG B;  3OTF A;  5LP6 C;  4LF9 B;  3E86 A;  1DLB A;  2YIB A;  4QPJ A;  4NTY A;  5EZY B;  3ASN C;  4JYA O;  3ZCC A;  1EZJ A;  1H2L A;  1N36 O;  2H94 A;  1FYJ A;  2QKA A;  3DXR A;  3TGU H;  2Y4T A;  3IJ4 A;  1M1K W;  5JJN B;  1OHH G;  4FPP A;  2HVK C;  5JJJ B;  4JI8 O;  3B8M A;  1HR0 O;  2ZQM A;  4X62 O;  1YJW V;  2R70 A;  2HJF C;  1XQ8 A;  3E35 A;  2GTA A;  3JD0 A;  3KZI Z;  2XAH A;  1N33 O;  1THZ A;  4K3A A;  5CBF A;  1TUB A;  2HFE C;  3H1J H;  4I4T A;  5KX5 B;  4B3R O;  1JJ2 U;  5LXT A;  4YHH O;  4LF4 O;  2LFS A;  3ZHR A;  5A9G A;  4G27 B;  2ZE6 A;  5FPR A;  3W7U A;  3MDS A;  4F4L A;  2P06 A;  3SJC C;  4CH4 A;  3EHB B;  3N2K A;  3STZ C;  4DR7 O;  1VAR A;  2Y69 B;  4MVQ A;  2Z5U A;  1P84 F;  4MTF A;  2GSM B;  3KCY A;  5IY5 C;  2Z3Y A;  4HNA A;  2DN9 A;  3S3W A;  2DE0 X;  5EK0 A;  3ZED A;  1AP6 A;  2WSS G;  2ZE8 A;  2BTQ A;  3CD6 V;  1HNZ O;  4D6T H;  4WFH A;  2D2C B;  3SPG A;  4D7S A;  3X2Q C;  4BIZ A;  5IDJ A;  2JGD B;  1SQB H;  2YI8 A;  2FML A;  2QJ1 A;  1Y66 A;  4JI6 B;  3AK3 A;  1I0H A;  1QLE C;  2Q7H A;  3I5D A;  4O4J B;  5CN0 A;  4PI2 A;  2Z0A A;  1Q86 W;  4JF3 A;  4ZHQ B;  2EIN C;  2IH3 C;  1XUQ A;  5H6Q A;  1GN4 A;  2VQE O;  1J95 A;  2Q7G A;  1VMG A;  4JI5 B;  1EN4 A;  1DF5 A;  2K9P A;  4K0K B;  4CBC A;  1EBO A;  3M8A A;  1AJN A;  4ZBM A;  4DW1 A;  2JS3 A;  2GV9 A;  3LNM B;  2WA4 A;  4DRX A;  4EKW A;  1F4N A;  4YIO A;  1LNQ A;  2HJD A;  3W7X A;  1M57 B;  4IT5 A;  4D7T A;  3W7W A;  4MVZ A;  1GRJ A;  1LUW A;  1V54 C;  3IFX A;  2QDO A;  1WB8 A;  2EUL A;  1Y76 B;  2YSU B;  4LF8 O;  2ODM A;  3K9S A;  5D5P A;  1RFY A;  2FB5 A;  2OYQ A;  5KUM A;  1ARO P;  4DR6 B;  4J10 A;  2OTJ V;  2RDC A;  3WU2 Z;  3JSL A;  1IZ3 A;  1XMQ O;  4DR2 B;  4F6R A;  3FB5 C;  2LFR A;  1HW7 A;  3ABU A;  1ZUQ A;  5J2U B;  4OGQ B;  2JEU A;  2A79 B;  1PV0 A;  2ZNJ A;  1Z2G A;  5C93 A;  4DV2 O;  5B1O A;  2EIM C;  4X20 B;  2CDY A;  3CCS V;  5J2T A;  4LF5 B;  1NVP B;  2PYL A;  1IUR A;  3RGB A;  4MW8 A;  5JQG B;  1AI6 A;  3CME V;  2IW5 A;  3ZMT A;  4IHJ B;  1WPB A;  1EFR G;  3OM3 B;  3CE2 A;  2ZD9 A;  4J41 A;  2EIL C;  4AHC A;  2R9I A;  1S72 V;  4FM0 A;  3QVN A;  4DV3 O;  5EZY A;  1YTF B;  4N21 A;  2Q0A A;  4FLZ A;  2BOB C;  4Q20 A;  1O9G A;  1BQZ A;  3SYO A;  3ETD A;  4JI1 B;  2L35 A;  4NTW A;  1MA1 A;  2DYR B;  4RQF A;  2ZKO A;  4H44 B;  2PTM A;  1MAB G;  1P49 A;  4N23 A;  4MVS A;  4TQF A;  2A06 H;  3HKD A;  5B3S C;  2QWQ B;  1HNW O;  3JSN A;  2A0L A;  3D3I A;  2WPD G;  1JFF B;  3CRQ A;  4JYA B;  4I9Q A;  3CC7 V;  1VQ5 V;  4FK5 C;  5KHJ A;  5FLX N;  4B7E A;  5IWA O;  2JJ2 G;  5KHK A;  4TQD A;  1YCI A;  3IAY A;  4JI8 B;  1HR0 B;  2Q68 A;  1VQ4 V;  2EIK B;  4I5S A;  3M7M X;  3ABT A;  4J7K A;  3FKS G;  1N33 B;  1P4R A;  5L3C A;  1SER A;  4FLY A;  5F2V O;  1WB7 A;  5KHG A;  4DV5 O;  4B3R B;  1NH2 B;  3LDD A;  1MSW D;  2W0X A;  4YHH B;  4LF4 B;  4E2L A;  4O4J A;  4QPK A;  2AZ2 A;  2H3O A;  2NR5 A;  5D5Q A;  4RWU A;  3ZS8 C;  4DR7 B;  3CCQ V;  3LSQ A;  1E1R G;  3K5O A;  3E8F A;  1XDC A;  1H8E G;  2RCV A;  4I50 B;  2OCC C;  2RNB A;  4CC6 A;  5IJ9 A;  2EZO A;  1VQN V;  2PYJ A;  3I56 V;  4JAA A;  1XNQ O;  1J5E O;  4LF9 O;  1HNZ B;  3JD4 A;  2F23 A;  1M90 W;  4P30 A;  4WCE V;  2HKO A;  3FAV B;  4DO2 A;  3CHX A;  2WA3 A;  2ZT9 B;  4JI4 B;  2XAG A;  3RYI B;  4DK1 A;  1KU9 A;  2RN9 A;  3ETQ A;  1Q6H A;  5L3E A;  1ROP A;  1SA0 B;  4O4L A;  1PNL A;  2DYR C;  2VQE B;  2NLJ C;  3E8G A;  5IYC O;  2IJI A;  4BAY A;  2QWP B;  3B40 A;  2YXH A;  4PA4 A;  3ASO C;  1XRE A;  3D3Q A;  5JH7 B;  3RVY A;  4BIO A;  3QG5 A;  2QA4 V;  1K92 A;  2ZDI C;  1WJZ A;  4MTX A;  3DSQ A;  3CYO A;  4FMT A;  4DR3 O;  1L1F A;  5B1A C;  2IJH A;  1YSC A;  4X20 A;  1YHQ V;  3ZX6 A;  1O9H A;  5FPO A;  2ZIM A;  4H37 A;  5LMU O;  2X6A A;  5JQG A;  4X1Y B;  1KUQ A;  5JJE B;  4OXS A;  1WA8 A;  3JAK B;  3ZHV A;  4FJC C;  1TUB B;  1R6K A;  4IHJ A;  1VQ9 V;  1MMM A;  4I4T B;  4HAM A;  1M9N A;  5B1B B;  3CCJ V;  3TXQ A;  3L71 H;  4UCU A;  4MVU A;  3C90 A;  1Y67 A;  3BRC A;  1V55 B;  3GB7 C;  3M99 B;  3VQY A;  2P6J A;  1XHZ A;  4DV2 B;  3N2K B;  1DTO A;  1SQX H;  2PUS A;  2JVD A;  4J9Z B;  3P3P A;  4JPR A;  4JI3 O;  3OR7 C;  5L3G A;  4HNA B;  4K8Z A;  4AIL C;  1K33 A;  2IU3 A;  3VQW A;  5LMN O;  4OX9 B;  2BTQ B;  1MOF A;  4UCV A;  4AQY O;  4DW0 A;  4MTG A;  1FXK B;  1I5Y A;  2WLN A;  3SJB C;  4X66 O;  1HP8 A;  4WBN A;  2JGU A;  4Z1M G;  1W0K G;  1TVK A;  4YY3 O;  1FAF A;  4UB8 Z;  4LH7 A;  2NNU A;  2LW1 A;  2P67 A;  4DV3 B;  3SYA A;  1DGS A;  2ZXW C;  3FB7 C;  4JI0 B;  2YI9 A;  5DN6 G;  2IH1 C;  3ZHT A;  1P7G A;  4TV8 A;  3G6E V;  1W59 A;  2E5L O;  1KKC A;  3VQX A;  1D5A A;  4TWK A;  2M6Y A;  2XAS A;  1VQM V;  3ABM C;  4JYC A;  3CJH A;  4DV6 B;  2UXB O;  4GKJ O;  4DRX B;  2R72 A;  4GX1 A;  3SPJ A;  2QEX V;  4EB6 A;  3ABK B;  4B7K A;  1HNW B;  1KC8 W;  3UO3 A;  1VF6 A;  2Y0I A;  4DXW A;  1K9M W;  1JOY A;  1UFI A;  4LF5 O;  3JAW A;  1K73 W;  1GN2 A;  2CGO A;  5IWA B;  3CSX A;  2P4K A;  1F4M A;  2ADQ B;  3OE7 G;  2F1M A;  4I50 A;  3UQ8 A;  4DV4 O;  4B08 A;  4J80 A;  1MZF A;  4F6R B;  3AK2 A;  3D36 C;  5B1B C;  3AG4 C;  1YI2 V;  1SQV H;  5IYD O;  1Y6X A;  3E8H A;  5K1X A;  1PL0 A;  4R7C A;  1AP5 A;  5L3B A;  3CCU V;  4DV5 B;  3OW2 U;  3HB3 B;  4LFB O;  3FAV A;  1IVS A;  2PY5 A;  1ZX3 A;  4QE7 A;  4JI1 O;  2ZE7 A;  2YUA A;  1SA0 A;  4PV1 B;  5J2T B;  2Q9L A;  1KMI Z;  1GN6 A;  1OZ0 A;  2DYS B;  2DQ3 A;  3FD9 A;  4TV9 A;  2ZR3 A;  4YJ3 B;  1FKA O;  3AG7 A;  3JCU Z;  1XNQ B;  1J5E B;  4OPH A;  4MS2 A;  4TT3 G;  2N04 A;  1K3E A;  4LF7 O;  1Y74 A;  1RM1 C;  4H13 B;  2V1D A;  5C8Y B;  4DV1 O;  1AR5 A;  4QE9 A;  3K5L A;  2X0L A;  4CZZ A;  1OCC C;  3JD3 A;  4U7O A;  2CUG A;  3RBZ A;  2F95 B;  3JD2 A;  4JZG A;  4FZ1 A;  5AG2 A;  5KLV H;  2Q73 A;  1YJ9 V;  1I08 A;  3OR6 C;  1S76 D;  5H9C A;  4DK0 A;  1M56 B;  4X1Y A;  4X64 O;  1H2N A;  3JCZ A;  4RUE A;  4FZ0 A;  1OCO B;  3JAK A;  3L73 H;  4KP4 A;  4BR6 A;  3NR7 A;  3AEI A;  2MK3 A;  4XDL A;  3HKD B;  4U7N A;  3WG7 C;  2QR4 A;  1VIB A;  1BT8 A;  4PA3 A;  4IIJ B;  3S3X A;  5ITZ A;  4DR3 B;  3O9O A;  1FD9 A;  3AG1 C;  1KP2 A;  1N8R W;  2E76 B;  1RP3 B;  5LMU B;  2EIJ C;  1XNR O;  1OCR B;  3CS5 A;  2ARH A;  2OCH A;  3RYC B;  4LF6 B;  5DED A;  3TET A;  2WWW A;  1FXK A;  3O65 A;  5A2Q N;  4PHZ A;  5LHI A;  1IX9 A;  3SJA C;  4JI4 O;  3N27 A;  3RT3 C;  1YDX A;  2AXT Z;  1EM1 A;  5KAF Z;  3G71 V;  2IJK A;  2B1I A;  2V7Q G;  4O4I A;  3K79 A;  3K3W A;  3K04 A;  4CH5 A;  4BW5 A;  1N0J A;  4LC1 A;  4ASU G;  5EIB D;  1YVW A;  1L0L H;  1Z5V A;  3UT5 B;  4BW9 A;  4JI3 B;  5LP6 A;  4UXN A;  3RYH A;  3AK1 A;  4I7Z B;  5IJ9 B;  1VQ7 V;  3L75 H;  4GX0 A;  1W2B U;  5LMN B;  1BL8 A;  4GX2 A;  4AQY B;  5FNV A;  4X66 B;  3W7T A;  1Z5W A;  4CS2 A;  5IYZ B;  4YY3 B;  1XI1 A;  3BEH A;  1NVP D;  2DW4 A;  3NXS A;  3OEH G;  2CTP A;  1R3J C;  4Q6G A;  5CB4 A;  1B3Q A;  5K1P A;  4FFK A;  1UJW B;  4O4L B;  3QF7 A;  1NR1 A;  2E3C A;  4WFE A;  4PI0 A;  2E5L B;  3QO7 A;  3OAA G;  2KG7 A;  3OMN B;  4PJ0 Z;  1DF4 A;  3VQV A;  3H9V A;  3RYF A;  4PDR A;  2UXB B;  4GKJ B;  4PA9 A;  2CTQ A;  1E79 G;  2VWK A;  1GTO A;  2X6B A;  5IE9 A;  4UCO A;  3RWR D;  2Y69 C;  2EZP A;  4AI8 A;  1KBH A;  2QTS A;  1Q5O A;  3RN4 A;  1H2K A;  4FLV A;  3GWK C;  1RSO A;  2DJV A;  2OIG A;  2LW7 A;  4UUJ C;  3EXA A;  4X1K B;  3U10 A;  4OX9 O;  5CA1 A;  1WA8 B;  3ABL B;  4DV4 B;  2Q69 A;  4YJ3 A;  1H2S B;  4FLT A;  3SYC A;  4ABM A;  3OUS A;  4QGP A;  1ZSP A;  3CCE V;  3Q4H B;  2B5U A;  5IYB O;  1PPJ H;  3BVO A;  2VRZ A;  3RVZ A;  3BPZ A;  4LFB B;  4JI0 O;  1YF2 A;  2HLD G;  2WLL A;  2W0F C;  4WF9 V;  1X59 A;  3E2E A;  3BA9 A;  5C8Y A;  1GM7 A;  1M93 A;  1SQQ H;  1IXM A;  4R50 A;  2X6C A;  1YEW A;  2ZIN A;  4GYC B;  2YIA A;  1XMO O;  2JDI G;  3AG3 B;  3H1K H;  3CRC A;  4ZOL A;  1U96 A;  3GVM A;  3ZRX A;  4DV6 O;  4NYK A;  2LO1 A;  1NH2 D;  4MW3 A;  3CCR V;  3ZBH A;  2EJ7 A;  2QWN B;  3KCX A;  1M57 C;  4CC5 A;  3FX7 A;  1F7Y A;  4WBN B;  1VEW A;  1TVK B;  5EBM C;  4IIJ A;  1K4C C;  2G38 A;  5E79 Z;  2XAQ A;  4LF7 B;  2HP8 A;  4LNU B;  1K8A W;  1ZWI C;  3H1I H;  1HDJ A;  3P32 A;  3SPH A;  4JGS A;  4EFE A;  4DV1 B;  1A32 A;  4TV8 B;  1H8H G;  1H2M A;  1NZ6 A;  2CK3 G;  5EIB C;  4JAU A;  3HKC A;  2HVJ C;  3TJT A;  1VQ8 V;  1BMF G;  2P90 A;  3CJH B;  4X64 B;  3RYC A;  1CPY A;  3R65 A;  5L3F A;  1CEZ A;  5CBH A;  2Q7E A;  2D3O W;  4EB6 B;  2E74 B;  2ETN A;  4JTD B;  3DC6 A;  3A2F A;  4L87 A;  3U11 A;  2DWE C;  4GX5 A;  3JAW B;  1K34 A;  4IYI A;  1WPX A;  4UV8 A;  3K58 A;  3PJS K;  3UT5 A;  2DWD C;  5JCO C;  5KAI Z;  2LGW A;  4PDL A;  2JIZ G;  1VQK V;  1SQF A;  2YIC A;  1XNR B;  2YIB D;  1CXZ B;  4GT1 A;  3EVK A;  1QU7 A;  3WFV A;  2QKS A;  1PD3 A;  4JI2 O;  2PI5 A;  1SQG A;  2YID A;  4CH6 A;  2ZE5 A;  4L8J A;  5IYZ A;  3QO5 A;  1R73 A;  3ZIA G;  1SF9 A;  4G2K A;  1N34 B;  1JMK C;  4UV9 A;  1BZK A;  3AG2 B;  4WFG A;  3G67 A;  3K0G A;  1V9P A;  4JTC B;  3QO8 A;  4MTO A;  1FXV A;  1U97 A;  1WN7 A;  2YS8 A;  1E1Q G;  3C3S A;  1VF7 A;  4TV9 B;  1Q6U A;  4YJ2 A;  3JAL B;  5LA6 A;  1K5Q A;  1K97 A;  3ZHU A;  1RPO A;  2YXY A;  1Y74 B;  2NN4 A;  2HHH O;  3WB2 A;  2A7W A;  4QJF B;  1PP9 H;  1JCH A;  1ZL8 A;  3ZN1 A;  3JD1 A;  3DTU B;  3R66 A;  2EIK C;  2Q67 A;  3HR0 A;  1AJP A;  2GTS A;  2E75 B;  3OMA B;  4EEQ A;  4HBN A;  4IL6 Z;  4B3S B;  1WNS A;  4X1K A;  3K06 A;  2Q6A A;  4NTX A;  4LF6 O;  3E83 A;  3FB8 C;  3N2G B;  3A8T A;  1VF5 B;  4MT8 A;  2FTK A;  4I55 B;  3A0B Z;  3ZHQ A;  3Q4H A;  1QQC A;  1VF6 C;  5ITZ B;  2WLI A;  3OUF A;  1Q43 A;  1VQP V;  4MVM A;  5BXZ A;  1SQP H;  5H2F Z;  2QTO A;  3H1H H;  4UCS A;  2IJJ A;  1WAZ A;  5EC2 C;  3OTO O;  5BR8 O;  1VQ6 V;  3H01 A;  1SES A;  4CS4 A;  4CS3 A;  1B6Q A;  1JR9 A;  1NBM G;  1MG1 A;  4H0L B;  5BZB A;  1N0N A;  3CXH F;  2HEP A;  2QWO B;  5B5E Z;  1XOU A;  4XDK A;  4O2B A;  2ZCE A;  1KKD A;  4O4H B;  3HPL C;  3UCS C;  2ITC C;  3T4D A;  2CTR A;  2UU9 O;  3LSS A;  2N74 A;  2YDE A;  3B8N A;  1Y4M A;  4LNU A;  1KQS U;  4O4I B;  4J42 A;  1XHX A;  4HYO A;  4IYH A;  1AI7 A;  1NR7 A;  1QVF U;  2QKC A;  4E4E A;  4NVP A;  2CAZ C;  2UUB O;  4F6E A;  5JVD A;  4JZ2 A;  3FYE B;  3JYC A;  1TUE B;  1YIT V;  5KA6 A;  1QR8 A;  1XMO B;  5LP6 B;  1BSM A;  1T5E A;  3RYH B;  1SZT A;  1FS0 G;  1OJH A;  2OT5 A;  1FFT B;  3ZRV A;  1Q6I A;  3B4S A;  1TAE A;  3GWO A;  3ASN B;  4Z1V A;  3G4S V;  1GN3 A;  5FNV B;  1N32 O;  4FM2 A;  4OPA A;  1ZTE A;  2UXC O;  3ZMV A;  2V4D A;  5BY1 A;  1AR4 A;  5GON A;  4J7Z A;  5CB4 B;  2IM9 A;  3SJQ C;  3E22 B;  1S5H C;  2Q0O C;  5LYJ B;  4PD4 F;  3ZN0 A;  3OFN G;  2PGG A;  5B66 Z;  3D8C A;  3K08 A;  2KG7 B;  3CMA V;  4ICG A;  3CP1 A;  4GLX A;  2CH7 A;  3RYF B;  1AVM A;  2YEV A;  4KHP B;  1S3J A;  1IXB A;  5LOV B;  4ZKI A;  2JRI A;  1D2D A;  1V55 C;  4PDM A;  1VQL V;  4P9O A;  5IY5 B;  4I0X A;  1QBZ A;  2Y48 A;  2WLJ A;  3SPC A;  1D5N A;  3OD4 A;  1X4T A;  3PN1 A;  1RSO B;  1GK9 A;  3TCU A;  2JJ1 G;  3L9D A;  2IU0 A;  3X2Q B;  1JJO A;  3DGE A;  2XT9 A;  5CA1 B;  1FXK C;  1QLE B;  2UXD O;  4DUZ O;  1BS3 A;  3JAL A;  3ZHS A;  1YZB A;  5B1N A;  4LWS B;  3LSU A;  2P5O A;  3FYI B;  2KQX A;  2EIN B;  4JI2 B;  2XUM A;  3H1L H;  3T1Y O;  2EJR A;  3STL C;  2VS0 A;  2WLL B;  1JX9 A;  1Q90 D;  1S5J A;  3CRR A;  3ZMS A;  3OEE G;  3WB0 A;  1IBK O;  3FB6 C;  5KHI A;  2UXN A;  2XTA A;  1BGY H;  4DR4 B;  4ZOL B;  1WP8 A;  1AIL A;  1QR9 A;  3LDE A;  2B1G A;  1R6N A;  5JWP A;  2ZIO A;  3N2G A;  1GMG A;  5KUK A;  4DV0 O;  4Z2W A;  2FYU H;  1BQ0 A;  3VOU A;  1V54 B;  4I55 A;  3A0H Z;  3ABK C;  2JS5 A;  3CC4 V;  4GKK O;  3SYQ A;  4W4L A;  1WLE A;  1QCE A;  4YXW G;  2Y0P A;  3F7Y C;  3TK1 A;  3IC7 A;  1QHT A;  4JAV A;  3F5W C;  4LCU C;  4UVC A;  4DUY O;  3HKE A;  2HHH B;  1YXB A;  1LR1 A;  4WFA V;  3OT7 A;  4G28 B;  5LL6 Y;  2CE4 A;  4TUY B;  3JAT B;  4MVO A;  1H38 A;  1SKV A;  2BSK A;  2Q8V A;  3D36 A;  5E1A C;  1OCZ B;  3B77 A;  3HKC B;  1R1B A;  2RMK B;  4DYL A;  2YXL A;  3SGI A;  4WFB V;  2VQF O;  4B3T B;  2EIM B;  4RO2 A;  1M5I A;  3T4Z A;  1EN6 A;  1KYO F;  3IGA C;  4O4H A;  1IBL O;  1PL4 A;  2R9R B;  1N34 O;  3VBB A;  1F23 A;  3T1C A;  5KA5 A;  3BCC H;  1GM9 A;  1Q8I A;  4B3M B;  2A9H A;  4KXR A;  1S5L Z;  4U3J B;  3MD0 A;  4JYB A;  3I55 V;  2LGQ A;  4U3F H;  1S0V A;  4TSF G;  3OTO B;  5BR8 B;  1M4U A;  2PZS A;  2DYS C;  4X65 B;  3JAR A;  5HFM A;  2F93 B;  1SZX A;  3ZMZ A;  2EIL B;  2CGN A;  4NXN O;  2QGN A;  1IDS A;  1KEC A;  2XAF A;  2C2A A;  2VWJ A;  1XL4 A;  1WP7 A;  4JI7 O;  4X88 A;  3ZRS A;  1YIJ V;  1P7B A;  4LH6 A;  3OGC C;  2ZM6 B;  3BFR A;  1XEQ A;  3B09 A;  3UO2 A;  1GAX A;  4MSW C;  2UU9 B;  3B2E E;  1I5X A;  4DR1 O;  4WFF A;  3BHP A;  4QIW F;  4BWA A;  4FM1 A;  4FIP C;  1PKX A;  3E22 A;  4DR5 O;  5BMV A;  5LYJ A;  2UUB B;  4UCT A;  1EN5 A;  4FLW A;  1M56 C;  2YC0 A;  1BHA A;  4P9P A;  4B3S O;  1OCO C;  5B3S B;  4JV5 O;  2QM4 A;  1SET A;  4LBE C;  3LUT B;  1YTF D;  3CX5 F;  3QNE A;  2HG5 C;  3G80 A;  4YJ2 B;  5LA6 B;  2UUA O;  3MHH C;  2A3Q A;  3KG2 A;  4J9Y B;  2F4V O;  1LUV A;  4KUM A;  4O2A A;  5GTI Z;  1HNX O;  5LOV A;  2B9Z A;  2K1E A;  3FFQ A;  1N32 B;  1AJQ A;  3APO A;  3ETE A;  4X9Q A;  3SYP A;  3SR2 C;  2GBO A;  4J11 A;  3CXC U;  1KP3 A;  1QLN A;  2UXC B;  1I7F A;  1ZL8 B;  2XAJ A;  3A0R A;  4QNH B;  4FFB B;  5EC1 C;  4R6Z A;  3P3N A;  3CEI A;  5CA0 A;  2BOC C;  2QM8 A;  4GZR B;  1G8M A;  2XND G;  5KMG A;  1OCZ C;  3DC5 A;  4JTA B;  1OCR C;  5H5N A;  1NTM H;  1I94 O;  3F7V C;  4KFM A;  4W4K A;  4XBF A;  3BY6 A;  3E8B A;  4LFA O;  1Q3E A;  1NQT A;  3T1H B;  2WLM A;  4JYY A;  3QTC A;  2BTO A;  1NU1 H;  4LWS A;  2ZNI A;  1FPO A;  2ITD C;  2Q5Z A;  1ENV A;  2WLI B;  3JAS A;  5EYP A;  1ZAU A;  1AI5 A;  1Q7Y W;  4X1I A;  1ZLZ A;  4J7J A;  2OCC B;  1L0N H;  4YIP A;  4GUN A;  4XDJ A;  5IJ0 B;  3APQ A;  4NXM O;  1NKD A;  1G4Y B;  1RPR A;  1PNK A;  2EX3 A;  2OTL V;  2EBO A;  2L6L A;  2UXD B;  2W6J G;  3L74 H;  1B06 A;  2JEX A;  1TA8 A;  4DUZ B;  3J7A U;  4O2B B;  2F43 G;  2UUC O;  5LGT A;  5FL7 G;  3BAA A;  1GH6 A;  1GO3 F;  2UXX A;  4DV7 O;  1EZV H;  2F66 C;  3T1Y B;  4HZ3 A;  1R6T A;  1Q81 W;  3ZRW B;  5JVD B;  3ASO B;  1MZE A;  4R8C A;  1ORQ C;  3JAT A;  4TUY A;  5CMU A;  5KX5 A;  2H8P C;  1IBK B;  1NJI W;  1NS1 A;  2GUZ B;  5GTH Z;  2AHY A;  2DMX A;  1KB9 F;  1NT2 B;  3IC9 A;  2IBZ H;  1JA8 A;  1N36 B;  4KHP O;  5B1A B;  3ETG A;  1FFX B;  3K9A A;  4DV0 B;  5KHH A;  3BA8 A;  1AR1 B;  4GKK B;  4MVR A;  4X62 B;  4ZIB A;  4PEL A;  5GON B;  4DUY B;  3EFF K;  2GDS A;  2KKW A;  1H2G A;  1K7D A;  3ICX A;  4U3J A;  4LP8 A;  4BIU A;  2QWR B;  2WAM A;  2JGD A;  1F51 A;  1NTK H;  1G1X B;  3K5N A;  3ABL C;  3E89 A;  3K03 A;  1IBM O;  3T2M A;  4RQE A;  1K4D C;  2CH7 B;  4ZHQ A;  2VQF B;  2YEV B;  3K59 A;  2JK5 C;  2OIE A;  1L8D A;  3ZJZ A;  2X7R B;  4LFC O;  4NKG B;  1IBL B;  4I0X B;  3U0Z A;  2CTW A;  2GHY A;  3RW0 A;  1KD1 W;  5TIS Z;  2RJZ A;  4FVM A;  5LBQ A;  3HKB B;  1FJG O;  2LP7 A;  4ZI7 B;  3AG3 C;  1NI8 A;  2ZR2 A;  5LHG A;  1B04 A;  2P7T C;  4DR4 O;  3J80 N;  1JVM A;  5EBW C;  2OWO A;  2ILM A;  2BCC H;  1XIL A;  1Q82 W;  3CCL V;  4K35 A;  4NXN B;  1XBL A;  2ZXW B;  1QVG U;  1Y76 A;  4JI7 B;  3JAM N;  5GW7 A;  3SDL A;  1NTZ H;  2AZ0 A;  1G6U A;  3THO A;  2XOK G;  4FFB A;  5LGU A;  1QNM A;  2N05 A;  4DR1 B;  4UVA A;  3ABM B;  1BE3 H;  2WLK A;  1JPX A;  2QE7 G;  5CA3 A;  4X8A A;  4DR5 B;  5J2U A;  4H33 A;  4K8X A;  1SRY A;  4FLU A;  3TXS A;  3RFR A;  2AW9 A;  4JV5 B;  4B3T O;  2O57 A;  2Q4P A;  3CB2 A;  3DXR B;  1S77 D;  3L70 H;  2KB1 A;  4TOI A;  2UUA B;  2F4V B;  3C3T A;  4LF8 B;  4UVB A;  1HNX B;  3KKY A;  1CP9 A;  4B3M O;  2AHZ A;  2FKX A;  3HKE B;  4RUF A;  5JCO A;  2ATK C;  3G6B A;  1YJN V;  2PF4 E;  4I9W A;  3LNN A;  1PNM A;  3CWB H;  4X65 O;  1XMQ B;  1VQO V;  4JI6 O;  2BSK B;  5IJ0 A;  5LXT B;  1UPG A;  5H6R A;  3SPI A;  1I94 B;  1MSD A;  3AG4 B;  3F5T A; 
#chains in the Genus database with same CATH homology
 1UJW B;  3FKS G;  2EJR A;  1COW G;  1P4R A;  3STL C;  5L3C A;  1SER A;  2DQ0 A;  1NR1 A;  3CPW U;  2WLL B;  1JX9 A;  4WFE A;  3QO7 A;  3OAA G;  1NH2 B;  3LDD A;  3OMN B;  3ZMS A;  1MSW D;  1JQ0 A;  3OEE G;  1DF4 A;  4E2L A;  1BHB A;  1R3L C;  3FB6 C;  4QPK A;  1W0J G;  2UXN A;  3AG2 C;  4PDR A;  3K0D A;  3OMI B;  4PA9 A;  3ML0 A;  1E79 G;  3LDE A;  1QR9 A;  2B1G A;  1R6N A;  3CCQ V;  1GTO A;  2X6B A;  3LSQ A;  1E1R G;  3CC2 V;  1GMG A;  3ZRW A;  5KUK A;  3E8F A;  4PDV A;  3VOU A;  5LHH A;  1V54 B;  1H8E G;  3ABK C;  2Y69 C;  2EZP A;  3CC4 V;  4RAI A;  2PI4 A;  2OCC C;  2ZDI A;  3SYQ A;  2EZO A;  1WLE A;  1VQN V;  1QCE A;  4YXW G;  3I56 V;  3F7Y C;  3TK1 A;  5L3D A;  3IC7 A;  4JAV A;  3F5W C;  4LCU C;  4UVC A;  4UUJ C;  3JD4 A;  1GM8 A;  1RM1 B;  4PA6 A;  1M90 W;  4X89 A;  4P30 A;  4WFA V;  4WCE V;  2HKO A;  3ABL B;  1XL6 A;  3ZMU A;  4DO2 A;  4G28 B;  2Q69 A;  1OCC B;  2XAG A;  4GCZ A;  4PA7 A;  3SYC A;  3OUS A;  4MVO A;  3CCE V;  1H38 A;  3D36 A;  5E1A C;  1OCZ B;  2B5U A;  3B77 A;  5IYB O;  5L3E A;  1ROP A;  3P30 A;  1PNL A;  2DYR C;  3RVZ A;  3UM7 A;  4P2Z A;  4WFB V;  2NLJ C;  1R3I C;  3E8G A;  5IYC O;  2IJI A;  2HLD G;  4BAY A;  2WLL A;  2W0F C;  4WF9 V;  3E2E A;  2EIM B;  4RO2 A;  3T4Z A;  1GM7 A;  1IXM A;  3WG7 B;  4R50 A;  4PA4 A;  3ASO C;  3IGA C;  2X6C A;  3RVY A;  2M7W A;  2R9R B;  2JDI G;  3VBB A;  1F23 A;  1GKF A;  3CCV V;  2QA4 V;  3AG3 B;  3T1C A;  1K92 A;  2ZDI C;  5KA5 A;  1GM9 A;  2A9H A;  3ZRX A;  4MTX A;  3CYO A;  4FMT A;  3AG1 B;  3MD0 A;  5DM6 V;  3W7S A;  2HR3 A;  4MW3 A;  4JYB A;  3CCM V;  3CCR V;  1NH2 D;  1L1F A;  5B1A C;  3I55 V;  2IJH A;  1YSC A;  4TSF G;  1S0V A;  1YHQ V;  5EBL C;  2DYS C;  3MHS C;  1M57 C;  4JAS A;  5HFM A;  5EBM C;  3ZMZ A;  2EIL B;  2EIJ B;  1K4C C;  5HFL A;  4H37 A;  1KEC A;  2XAF A;  2C2A A;  2XAQ A;  2X6A A;  1XL4 A;  1K8A W;  1ZWI C;  4X88 A;  3ZRS A;  1YIJ V;  3P32 A;  1P7B A;  2WLH A;  3SPH A;  4JGS A;  4OXS A;  5J9P C;  3LDC A;  3OGC C;  1FXH A;  1H8H G;  4FJC C;  1R6K A;  2W6I G;  1VQ9 V;  1HWY A;  4MSW C;  2CK3 G;  4HAM A;  1I5X A;  4JAU A;  2QM7 A;  1M9N A;  5B1B B;  2HVJ C;  4WFF A;  3UKM A;  4QIW F;  3CCJ V;  5LGN A;  1BMF G;  1VQ8 V;  4FIP C;  2P90 A;  1PKX A;  4MVU A;  5CBG A;  1CPY A;  3R65 A;  1AI4 A;  5L3F A;  1K5S A;  1CEZ A;  1V55 B;  3GB7 C;  3M99 B;  5CBH A;  2P6J A;  1M56 C;  1BHA A;  4P9P A;  1R3K C;  1DTO A;  2D3O W;  1OCO C;  5B3S B;  4J9Z B;  4JTD B;  1SET A;  4JPR A;  4LBE C;  3LUT B;  1YTF D;  4L87 A;  3OR7 C;  5L3G A;  3QNE A;  2HG5 C;  3E86 A;  3MHH C;  3KG2 A;  4J9Y B;  4KUM A;  1K33 A;  1DLB A;  2DWE C;  2IU3 A;  4GX5 A;  4QPJ A;  2K1E A;  3ASN C;  1K34 A;  1WPX A;  4UV8 A;  1MOF A;  1AJQ A;  3PJS K;  3ZCC A;  1EZJ A;  3ETE A;  4MTG A;  2H94 A;  1FXK B;  1I5Y A;  2WLN A;  3SYP A;  2DWD C;  4Z1M G;  3CXC U;  1QLN A;  1KP3 A;  1W0K G;  4PDL A;  2JIZ G;  1VQK V;  1M1K W;  2XAJ A;  3A0R A;  4QNH B;  1OHH G;  4FPP A;  4R6Z A;  5EC1 C;  2HVK C;  2NNU A;  2QM8 A;  2BOC C;  2ZQM A;  2P67 A;  1G8M A;  3B8M A;  4GT1 A;  2XND G;  1YJW V;  3WFV A;  1OCZ C;  2HJF C;  2QKS A;  4JTA B;  3SYA A;  1OCR C;  3E35 A;  1PD3 A;  2ZXW C;  3F7V C;  3FB7 C;  4KFM A;  4XBF A;  3JD0 A;  2XAH A;  2PI5 A;  5DN6 G;  1THZ A;  2IH1 C;  3BY6 A;  5CBF A;  3QO5 A;  3E8B A;  1R73 A;  3ZIA G;  3G6E V;  1NQT A;  2HFE C;  4G2K A;  2WLM A;  4UV9 A;  1JJ2 U;  4TWK A;  3AG2 B;  2LFS A;  2XAS A;  1VQM V;  3ABM C;  4JYC A;  4WFG A;  3K0G A;  4G27 B;  3W7U A;  2ITD C;  4JTC B;  1ENV A;  3QO8 A;  2WLI B;  4MTO A;  4F4L A;  1FXV A;  3EHB B;  1AI5 A;  3STZ C;  4GX1 A;  3SPJ A;  1Q7Y W;  1E1Q G;  2QEX V;  3ABK B;  2Y69 B;  4MVQ A;  2Z5U A;  4MTF A;  2OCC B;  2GSM B;  1KC8 W;  5IY5 C;  4DXW A;  1K9M W;  2Z3Y A;  4XDJ A;  1K5Q A;  1JOY A;  1NKD A;  5EK0 A;  1K97 A;  1G4Y B;  2WSS G;  1RPO A;  1K73 W;  1RPR A;  3CD6 V;  1PNK A;  4WFH A;  3SPG A;  2OTL V;  1F4M A;  3X2Q C;  2EBO A;  4BIZ A;  4QJF B;  5IDJ A;  1JCH A;  2W6J G;  2JEX A;  3OE7 G;  3ZN1 A;  1Y66 A;  3JD1 A;  2F43 G;  1QLE C;  5LGT A;  5FL7 G;  5CN0 A;  3DTU B;  1GO3 F;  2EIK C;  2Q67 A;  2UXX A;  5B1B C;  1Q86 W;  4JF3 A;  3AG4 C;  1AJP A;  4HZ3 A;  2EIN C;  2IH3 C;  3OMA B;  5IYD O;  1YI2 V;  3E8H A;  1PL0 A;  4R7C A;  5H6Q A;  5L3B A;  3CCU V;  3K06 A;  2Q6A A;  3OW2 U;  3HB3 B;  1J95 A;  3E83 A;  3FB8 C;  1Q81 W;  3ZRW B;  4MT8 A;  3ASO B;  2FTK A;  4R8C A;  1DF5 A;  1ORQ C;  5CMU A;  2H8P C;  4CBC A;  1NJI W;  4QE7 A;  1EBO A;  2AHY A;  1AJN A;  4ZBM A;  2WLI A;  3LNM B;  3OUF A;  1VQP V;  4EKW A;  4MVM A;  3ETG A;  5B1A B;  1F4N A;  3K9A A;  3W7X A;  1LNQ A;  2QTO A;  1OZ0 A;  2DYS B;  1M57 B;  2IJJ A;  3W7W A;  2DQ3 A;  1AR1 B;  5EC2 C;  4MVZ A;  2ZR3 A;  4MVR A;  1V54 C;  1VQ6 V;  3H01 A;  1SES A;  3IFX A;  1B6Q A;  1NBM G;  1MG1 A;  5BZB A;  4MS2 A;  4PEL A;  3EFF K;  4TT3 G;  2YSU B;  1H2G A;  1K7D A;  1K3E A;  4LP8 A;  5KUM A;  4BIU A;  1ARO P;  2WAM A;  1RM1 C;  1F51 A;  2V1D A;  4XDK A;  2OTJ V;  4QE9 A;  3ABL C;  3E89 A;  2X0L A;  3K03 A;  4CZZ A;  1KKD A;  3T2M A;  1OCC C;  3JD3 A;  4U7O A;  3HPL C;  2ITC C;  3RBZ A;  3T4D A;  4RQE A;  1K4D C;  3LSS A;  3FB5 C;  2LFR A;  3JD2 A;  3B8N A;  3ABU A;  1Y4M A;  1KQS U;  1YJ9 V;  3OR6 C;  1S76 D;  4HYO A;  5H9C A;  2YEV B;  1AI7 A;  1M56 B;  1NR7 A;  2JEU A;  1QVF U;  2A79 B;  3JCZ A;  4RUE A;  2JK5 C;  1OCO B;  5C93 A;  3ZJZ A;  4KP4 A;  3FYE B;  2X7R B;  5B1O A;  2EIM C;  3AEI A;  2MK3 A;  3JYC A;  4XDL A;  1TUE B;  1YIT V;  2GHY A;  1QR8 A;  5KA6 A;  4U7N A;  3WG7 C;  3RW0 A;  1KD1 W;  3CCS V;  1SZT A;  1FS0 G;  2OT5 A;  5LBQ A;  4PA3 A;  1FFT B;  2LP7 A;  3ZRV A;  1NVP B;  3AG3 C;  3GWO A;  2ZR2 A;  5LHG A;  3ASN B;  4MW8 A;  1AI6 A;  2P7T C;  3G4S V;  3AG1 C;  1JVM A;  3CME V;  5EBW C;  1KP2 A;  2IW5 A;  1N8R W;  1Q82 W;  3ZMT A;  3CCL V;  1EFR G;  3ZMV A;  3OM3 B;  2ZD9 A;  2EIL C;  2EIJ C;  1OCR B;  2ZXW B;  1QVG U;  2R9I A;  3SJQ C;  1S72 V;  5GW7 A;  1YTF B;  4N21 A;  1S5H C;  3TET A;  3ZN0 A;  2BOB C;  2WWW A;  1FXK A;  3OFN G;  2XOK G;  4Q20 A;  5LHI A;  3SYO A;  3ETD A;  3K08 A;  5LGU A;  3CMA V;  4UVA A;  3ABM B;  2WLK A;  1JPX A;  3CP1 A;  3G71 V;  2QE7 G;  5CA3 A;  4X8A A;  2IJK A;  2B1I A;  2V7Q G;  2DYR B;  4RQF A;  3K79 A;  2YEV A;  3K3W A;  1S3J A;  3K04 A;  4H33 A;  4BW5 A;  4ZKI A;  1SRY A;  1MAB G;  1V55 C;  4LC1 A;  4N23 A;  4ASU G;  4PDM A;  4MVS A;  1VQL V;  4P9O A;  5IY5 B;  5B3S C;  1QBZ A;  1S77 D;  4UXN A;  2KB1 A;  2Y48 A;  2WLJ A;  3SPC A;  2A0L A;  3D3I A;  4UVB A;  2WPD G;  1VQ7 V;  4GX0 A;  1W2B U;  1CP9 A;  1GK9 A;  1BL8 A;  3TCU A;  2JJ1 G;  4GX2 A;  3CC7 V;  2IU0 A;  2AHZ A;  3X2Q B;  1VQ5 V;  4FK5 C;  4RUF A;  2ATK C;  1YJN V;  3DGE A;  3W7T A;  4I9W A;  2JJ2 G;  1FXK C;  1PNM A;  1QLE B;  3BEH A;  1NVP D;  2DW4 A;  3NXS A;  1VQO V;  2Q68 A;  3OEH G;  1VQ4 V;  2EIK B;  1R3J C;  5B1N A;  5H6R A;  4I5S A;  3SPI A;  3AG4 B;  3FYI B;  2EIN B;  3ABT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...