5J9PC

Kcsa in vitro
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
molecule keywords Fab
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5j9pC00
1R3LC 2R9RB 2IH1C 4OXSA 3KG2A 2EILC 3LUTB 3AG1C 3EFFK 5B1AC 5KUMA 5J9PC 2EIKC 4MVMA 4X89A 4JTAB 2W0FC 5E1AC 4GX2A 4P30A 4MSWC 3E89A 2H8PC 3ASNC 1G4YB 2A9HA 2DWDC 3K03A 5EBMC 5EK0A 4ZBMA 3SPJA 3SYOA 4WFHA 5EBLC 3LNMB 2WLJA 4PA7A 4P9OA 4PDVA 4H33A 2BOCC 2QKSA 4MS2A 2X6CA 3K08A 2HG5C 1J95A 3SYPA 3T4DA 4LP8A 1P7BA 3SPGA 5EBWC 3X2QC 2WLNA 3OGCC 3R65A 5EC1C 2X6AA 1JVMA 4GX1A 5CBHA 4TWKA 4RAIA 3IGAC 4MVZA 3T2MA 3E86A 1M57C 2AHYA 3HPLC 4XDKA 3OR7C 4PA9A 1BL8A 4XDLA 3SPIA 4R8CA 4PDMA 3WG7C 2HFEC 4GX5A 4MVOA 4RUEA 4QNHB 2BOBC 4PA4A 4X8AA 5B3SC 2AHZA 3RBZA 3SYCA 4MW3A 3OR6C 4JTCB 2KB1A 4F4LA 4P2ZA 2ATKC 2WLHA 1K4CC 2A79B 4MVUA 1V55C 4XDJA 1R3IC 3ABKC 4P9PA 4PDRA 3OUFA 2HVKC 3RW0A 1R3KC 1OCOC 4MVRA 3F7VC 2WLMA 1OCCC 1XL6A 2ITDC 3AG3C 3FB5C 5CBGA 2NLJC 2X6BA 3F5WC 4R50A 4J9YB 3OUSA 2A0LA 3SYAA 1XL4A 1ORQC 2DWEC 2ZXWC 2EINC 2WLLA 3E8BA 3K0GA 3E8GA 4LCUC 4QE9A 4H37A 1QLEC 4HYOA 2P7TC 4MTFA 4RO2A 2HJFC 4LBEC 2IH3C 1OCRC 2Y69C 2Q6AA 4RUFA 4JTDB 2EIMC 4R7CA 2K1EA 4UUJC 3RVZA 4PA3A 4KFMA 2WLLB 3AG4C 3UM7A 2DYRC 2OCCC 4MVSA 3PJSK 4PDLA 4GX0A 2JK5C 2DYSC 4J9ZB 5B1BC 3LDCA 1R3JC 5BZBA 5CBFA 4MTOA 3STZC 4X88A 2ITCC 2WLIA 3AG2C 3STLC 3ABMC 4MTGA 2HVJC 4MVQA 4R6ZA 3LDDA 3RVYA 3K06A 3UKMA 2QTOA 4WFFA 1K4DC 3K04A 1KKDA 3TCUA 4DXWA 3TETA 4WFGA 3SJQC 2ZD9A 1LNQA 3E8FA 3IFXA 2WLKA 3FB7C 1ZWIC 3BEHA 3LDEA 2YEVA 2WLIB 3SYQA 3FB6C 5KUKA 3JYCA 3VOUA 3ABLC 4G27B 4HZ3A 1V54C 5IY5C 3ZJZA 4CBCA 3F7YC 5EC2C 4I9WA 3ZRSA 4PA6A 3SPHA 3T4ZA 3FB8C 3E83A 4WFEA 3K0DA 1M56C 3T1CA 3E8HA 4EKWA 1OCZC 4MW8A 1S5HC 4QE7A 2EIJC 2Q68A 3SPCA 4BW5A 3ASOC 4G28B 2Q69A 2Q67A 3GB7C
chains in the Genus database with same CATH superfamily
1I08A 3N2KB 5LOVB 4X66O 3LUTB 3EFFK 4DR5B 4MVMA 2ZCEA 4GX2A 3RT3C 2Y4TA 3E89A 3SPJA 4X9QA 4X20B 3B09A 1GN4A 4JI7B 2LW1A 4MTXA 1VQMV 3RYIB 1BZKA 1I5XA 2VWKA 5A9GA 1AJNA 3RGBA 3OMNB 2PF4E 3HKDA 5JJEB 2XAQA 3CB2A 5IWAB 4H13B 1PL0A 1TGOA 3JAKB 4JI7O 4BW5A 4NVPA 2UXNA 1K34A 1N36B 2P7TC 3JCZA 4JI6O 2Q6AA 2EIKB 4FLTA 1SERA 1NTZH 4JYAO 4OGQB 1PV0A 1H2NA 2OWOA 4DR7O 5IJ0B 4UCTA 1EZVH 4X66B 1Q5OA 3LDCA 2WWWA 1X59A 3P32A 3JALB 4O4IB 3ABMC 3A0BZ 1NVPD 4WFFA 5CB4B 2L35A 4WFGA 2CH7A 3FB7C 3FD9A 4FM0A 5H9CA 4TQFA 3CCRV 3LDEA 3SYQA 1GAXA 2IJHA 1TVKA 3VOUA 4HZ3A 4ICGA 4G27B 2MW2B 1V54C 1ZUQA 3ZJZA 4LF4B 2F4VB 3P3NA 4B7KA 3SPHA 1NH2B 4DR6B 2X7RB 1K8AW 4UB8Z 4E4EA 3OMIB 3RYFA 3ZS8C 3FAVB 5GONB 3JARA 1AI6A 1KYOF 3OE7G 2Q8VA 4QGPA 2ODMA 2K9PA 5HFMA 3B4SA 1YHQV 4H44B 2BE3A 5CB4A 4I5SA 4DUYO 4TV8B 5EBLC 2WLJA 1KP2A 3CSXA 4IGGA 1V55B 4DRXB 3CS5A 2CK3G 5EIBC 4CZZA 4H0LB 3OTFA 2LFSA 1GRJA 1MG1A 3DTUB 1G1XB 1BHAA 1FFTB 1NJIW 1ZTEA 3CMAV 4R8CA 4QNHB 4O2BA 4ZI7A 1VQPV 1FFXA 2JS5A 1E1QG 1THZA 1N33B 1HWYA 3CYOA 1R3IC 4DUYB 4X65B 1R3KC 2RN9A 5B5EZ 3MHHC 2H94A 2X6BA 3F5WC 1XL4A 2XAHA 4HYOA 3DXRA 2CTQA 3QF7A 4YXWG 1JMKC 1QQCA 1MA1A 2OYQA 5B1BC 1OCRB 1XHZA 1I94O 2ZIMA 2WLIA 2UUBO 3LDDA 4DV7B 3UKMA 3TCUA 1Y74A 3ZEDA 5IYDO 4LF5O 2JJ2G 4YY3B 5DEDA 3F7YC 4CH3A 2Q7HA 3T1YB 1MZFA 3E22B 1NBMG 1AP5A 4JYAB 3M99B 3N27A 3H1IH 2QEXV 4FM1A 4X89A 4DV6O 5EYPB 3FKSG 3K03A 4EEQA 5KHIA 4KHPO 1VQNV 1GN2A 3K5OA 3OTOB 3ZRWA 3ABMB 3ZMSA 2GUZA 1US6A 2DYSB 1HNWO 3JSLA 2KSDA 2R9IA 2IJKA 4ZOLA 4DV6B 3FX7A 4GX1A 1XHXA 4YIOA 3VQWA 4TWKA 1FD9A 2YUAA 1L0LH 1PD3A 4PDMA 3K9AA 4RUEA 4YJ3A 2B1IA 1VF6A 4DV7O 5LP6A 4DK1A 4CS3A 2JS3A 1CP9A 1GM8A 1IX9A 4YY3O 2B5UA 4GKKO 1OCCC 3AG3C 1MNGA 3BCCH 1SS3A 4R50A 3CCMV 5KMGA 4DV3B 5IJ0A 3EXAA 3IC9A 1L0NH 2ZDIC 4O4IA 2FKXA 3CC2V 5K1XA 3ZRXA 1WA8B 1GTOA 3ASOB 4MTOA 3MDSA 1ZSPA 3JASA 3K06A 1Q7YW 4JZ2A 3T1YO 1KKDA 4GYCB 2IJIA 2ZD9A 4K35A 1I5YA 1XREA 4B7EA 1K9MW 1TAEA 2EINB 5E79Z 4GKKB 3WB0A 2LQTA 3AK2A 3RFRA 1YITV 3ICXA 4X65O 3WG7B 5IY5C 3W7SA 1I7FA 5EC2C 1TUBB 2Z0AA 1B3QA 3J80N 2F95B 2JRIA 4CH5A 2IM9A 4GZRB 2IH1C 3KG2A 2ZM6B 1I94B 2Q73A 2XAFA 3OAAG 1RM1B 1YVWA 5FL7G 3WB1A 1QR9A 4P9OA 4JAUA 1Y66A 4I50A 1OCCB 5JQGB 2WLNA 2UXBB 3D8CA 2KG7A 1SRYA 1N0JA 4BW9A 1YIJV 3OR7C 1M9NA 1ZL8B 4FZ1A 1QBZA 3AG1B 1EFRG 3JD0A 1CPYA 2H3OA 3CXHF 3QNEA 1ZL8A 3D36C 1B06A 2LGWA 2RDCA 1Q6IA 1WA8A 4GUNA 1S72V 3ZIAG 1FJGB 3AG3B 3L71H 5IYZA 4DUZO 1VMGA 5BMVA 2ZE7A 2UU9O 5J2TB 3O9OA 1BGYH 4PDLA 1NZ6A 4CS2A 3VBBA 4DV1B 1ZLZA 3STZC 3SJAC 3H1HH 4IHJB 3RN4A 4R6ZA 1WP8A 4FVMA 5IJ9A 3IFXA 2E74B 3M8AA 1PP9H 1NU1H 3OMAB 2VRZA 2YXLA 1P7GA 1FAFA 5ITZB 5DECA 1MSWD 2LP7A 3M7MX 4CC6A 4HAMA 3E35A 4JGSA 1S5JA 1HNZO 3K79A 2EIJC 2AZ2A 4YHHO 2Q69A 4UFZA 1HP8A 5C8YA 2CDYA 3OGIB 2Z3YA 4IHJA 3JATB 5EIBD 4BAYA 1YEWA 4ZBMA 2GBOA 4DV0O 5J2UA 4K3AA 2HG5C 1P7BA 2Q5ZA 1YSCA 1WB7A 2JGDB 3A8TA 3ABUA 4F6EA 1JVMA 2AZ0A 5J2UB 1E1RG 1URFA 2R72A 5IE9A 1GKFA 1JJ2U 1P4RA 3DGEA 4LF8B 2YIDA 4UVCA 5D5PA 2BSKB 1T5EA 1K7DA 4P2ZA 4LF9O 1K4CC 1XMOO 1SA0B 1H2GA 1VQ9V 5L3FA 2E5LO 1LUVA 1AVMA 1KD1W 4Z1VA 1FPOA 2FL4A 4QE9A 4JI3B 1IURA 2CGOA 3UO2A 2YS8A 3UM7A 3T1HB 5H2FZ 4CS4A 3K59A 4KL1A 4TUYB 5BZBA 2F93B 2UXXA 4LF4O 2F4VO 4NXNO 1O9GA 1JR9A 2P22C 4DK0A 1J5EO 3TETA 3ZHQA 4IYHA 4NYKA 5LP6B 2WLKA 2YI9A 2Y0PA 2A3QA 3FB6C 1KP3A 5KX5A 3NXSA 2YI8A 4OX9O 3ABLC 1U97A 1KECA 3FAVA 5KA6A 1S76D 4X1YB 3CE2A 4MW8A 1GMGA 1S5HC 3C3SA 1YZBA 3GB7C 1R3LC 2YICA 2GTSA 5KAIZ 4KP4A 4JTAB 2W0FC 4I4TA 1VQ7V 4FK5C 1H2MA 4FZ0A 1HNXO 4AQYO 3LNMB 1QNMA 1SZXA 1FYJA 2YIAA 2AW9A 2QKSA 5B1OA 1IXMA 2FTKA 2LO1A 2PTMA 3BA9A 3ZRVA 1L8DA 1COWG 3CJHB 4JI4O 4LFBO 4LH6A 1HNZB 2MK3A 3DC5A 3ZHSA 3ETGA 4I50B 3IGAC 5FLXN 1FS0G 3CCLV 4NXMO 1H8EG 1VF7A 1DF5A 3CWBH 3VQYA 3U0ZA 4I0XB 4PA4A 4NTWA 5AG2A 5B1BB 1YF2A 4ZIBA 3TK1A 1NR1A 5FNVA 2ZNJA 1AR5A 3ZHTA 3CCEV 2HHHB 1DTOA 1LUWA 2VQEB 3CC4V 2ZXWC 4A5UB 3AG7A 2R9AA 4RO2A 4DW1A 2O57A 2RQ6A 3CCQV 3APQA 3FYEB 2UU9B 5LGNA 4J11A 3LSQA 4K8XA 4LF6B 3SGIA 3C3TA 4ZKIA 4JI6B 2NNUA 3ZHVA 3CP1A 3JATA 1Y76B 3AG2C 1QVFU 3L74H 4I0XA 5J2TA 5KHGA 2X0LA 2ZINA 2UUCO 3EVKA 4DR1B 2ZE5A 3QG5A 2DQ0A 3LNNA 1JCHA 2IU3A 2IJJA 4LFCO 4X64B 4IT5A 4B3RB 1YJ9V 3RYIA 3T4ZA 2EBOA 4K8ZA 4RQEA 4I55A 1F4NA 4OPHA 5EYPA 2W6IG 3ZBHA 2R9RB 2QM4A 4UCOA 1PNKA 4JASA 3QTCA 4GKJO 1PKXA 2GV9A 5IDJA 1W59A 4D6TH 2VS0A 2XAGA 4J7JA 1S77D 3RYCB 1P49A 4H33A 1YJWV 3WB2A 2PUSA 4IL6Z 3G4SV 1KQSU 4QPJA 1R6KA 5CBHA 1QLNA 5CA0A 1AP6A 1OV9A 1M57C 2JGUA 1XBLA 3ZMZA 2HFEC 4UV9A 2AHZA 4BIUA 2D3OW 4U3JA 5IYBO 1YCIA 2KB1A 3CRRA 2CTPA 2ATKC 1IBMO 1WAZA 2E75B 4IIJA 1XNRB 4MVRA 1AR1B 3FB5C 1F23A 2A06H 3CCUV 3E8BA 2EINC 5CA3A 1JX9A 3AK3A 4G2KA 4IYIA 5FPRA 2CAZC 1UJWB 4K0KO 1SZTA 3BY6A 1RM1C 1YJNV 3HKEB 2DYSC 4J9ZB 4L8JA 2DQ3A 4X88A 2HHHO 3RVYA 2W6JG 1D5NA 2UXDO 2UXCB 3K04A 5C93A 1AR4A 1HW7A 3AG2B 1WN7A 1ZWIC 4FLYA 4XBFA 1KMIZ 1XILA 2QWPB 3ZHUA 3ZCCA 2QDOA 3KKYA 1QCEA 3B2EE 2M6YA 4W4KA 4DR4B 3ZRSA 2N74A 2YC0A 3K5MA 4QE7A 3IAYA 3ETDA 1KU9A 1NT2B 1Z5VA 1Q6HA 5B66Z 3TXQA 3BHPA 1TUEB 1X4TA 2E76B 2YDEA 3EHBB 1G4YB 3SYOA 5EK0A 4CC5A 4FFBA 5IY5B 1N36O 1QU7A 3SYPA 1OHHG 3TXSA 3MD0A 5EBWC 4X1KB 2PYJA 3R65A 3ZN1A 4ZHQA 3G71V 1WPBA 1Y76A 1F51A 3CPWU 3VQXA 5CA1B 3WG7C 2M7WA 4HBNA 3RBZA 3H1LH 1MZEA 4LR3A 4MW3A 1CXZB 3OFNG 2Q9LA 4JI5B 1BT8A 2P67A 1U96A 1NI8A 4DV5B 3GVMA 1YTFD 4JV5B 1K3EA 1OCOC 2Y69B 3UQ8A 2UUBB 3B8MA 1GN6A 3K0GA 4NTYA 2LFRA 5LGTA 5KA5A 3GWOA 4UCRA 1AB3A 4LBEC 2VQFB 3THOA 2JIZG 2ETNA 1YXBA 1XI1A 1GM7A 1Q8IA 2OCCC 4E2LA 4B08A 4AILC 2CH7B 3AK1A 1D5AA 4ZHQB 3IC7A 3L73H 4MTGA 1Q86W 2E5LB 1IBLO 1K4DC 4UCVA 4BR6A 2JEUA 3UCSC 5ITZA 4UVAA 4LF7O 3HKCB 4I7ZB 2ZDIA 2RNBA 3CC7V 2RJZA 4ABMA 4N21A 2P5OA 2QR4A 4DR1O 2ZIOA 4FLWA 3JD2A 1AROP 1KBHA 3K9SA 1B6QA 4J10A 5BR8O 2ZT9B 3JD1A 5IYZB 3E2EA 4UCUA 1M56B 4DR2O 4LF6O 1VARA 1VF6C 4P30A 3SDLA 4UVBA 2QE7G 1BSMA 2DN9A 5KMGB 2DMXA 5EBMC 1AILA 4X1IA 3ABTA 4W4LA 5JH7B 1J95A 4B3MO 4YHHB 3I55V 4B3TB 1FKAO 3I56V 2OIEA 4DR6O 3CRQA 1SESA 4U3JB 3E86A 3SPIA 1ZAUA 4DRXA 4JI1O 1Y4MA 3RWRD 1R1BA 5LHGA 2AGAA 3H01A 2KG7B 1NH2D 4YJ3B 1K73W 3VQVA 2DJVA 3ASNB 5LMUO 5LMNB 3F7VC 1XL6A 5CBGA 1XMQO 1N32O 3SYAA 4B3MB 3W7XA 2IH3C 2Y69C 5JJNB 1QR8A 2GUZB 4Q6GA 3RVZA 4PA3A 2QWNB 1SQGA 4DR2B 5CMUA 3OT7A 1DF4A 5LA6A 5K1PA 3ZX6A 2ITCC 4TSFG 5LYJB 3MHSC 3BPZA 2XOKG 2YIBA 5JJJB 1LNQA 2ZE8A 4KUMA 5TISZ 1XMQB 4J42A 3QO7A 4JI8O 3ETEA 4Z1MG 1JFFB 3APOA 2Q0AA 2YXHA 4PA6A 2YXYA 2QWOB 2PI5A 2ADPA 2RMKB 5JWPA 1Q90D 4G28B 1S0VA 1K33A 4OXSA 1BCCH 1BQ0A 5B1AC 1HR0O 3OEEG 2GDSA 1PNMA 1OJHA 1DK1A 4O4HA 4DW0A 2A9HA 2LJ2A 5JQGA 2QKAA 2Q7GA 4JI3O 1SQXH 4JI0O 1R6TA 3U10A 5LHHA 3DXRB 4WFAV 2WSSG 4JI2O 4ASUG 5LXTA 4JYYA 1EN6A 4RAIA 2ZR2A 2JDIG 5KHHA 3T2MA 5GW7A 4XDLA 2GHYA 4MVOA 3JARB 3CX5F 3ZMTA 4JI2B 4JZGA 1IBMB 4Q20A 4CH4A 4UCSA 4AHCA 1L1FA 2WLHA 1UPGA 2A79B 1UFIA 2ZKOA 2HVKC 1VEWA 1DLBA 3LSSA 4UV8A 2ITDC 1BQZA 4J9YB 4I4TB 4DV0B 4LCUC 4GLXA 1Y6XA 2HP8A 4I55B 3N2GB 2VWJA 2ADQB 2XTAA 1V54B 4UUJC 2WLLB 4NR1A 3AG4C 2XAJA 2KKWA 3O65A 5BY1A 5DN6G 1R73A 2JK5C 1RFYA 3CRCA 5KAFZ 2ILMA 2A7WA 4JI8B 2JJ1G 3W7UA 3L72H 4EB6A 3FYIB 4YJ2A 2UUAB 2Q7EA 3WFVA 3D3IA 2PGGA 5KUKA 1VIBA 1N34O 5IJ9B 1DGSA 4RWUA 4I9WA 1SQQH 1Y74B 5IT9N 1WLEA 4FMTA 2CTWA 3BA8A 2FYUH 1FXKC 3BVOA 1M56C 3T1CA 3E8HA 2YIBD 5LBQA 3CCJV 1PM9A 1HDJA 4JI4B 3SPCA 1JFFA 1RPOA 3J7AU 1V9PA 4L87A 3S3WA 1EM1A 4X62B 3OD4A 3HB3B 5JCOA 4IIJB 4X62O 1HNXB 1NTMH 2QSAA 2F43G 1FXVA 2H8PC 2HEPA 3JAKA 2JVDA 4WFHA 4PA7A 2BTQB 2EZPA 2X6CA 1GO3F 3ETQA 4LP8A 2AXTZ 3OGCC 2QWQB 1RSOA 1OCZB 2YEVB 1PPJH 1KUQA 4FPPA 4FM2A 4QIWF 5EZYA 2VQEO 2FB5A 4D7TA 2QM7A 2OTLV 1AJPA 4B3TO 3J81N 4C7UA 4UB6Z 2LGQA 4XDJA 3RW0A 1N34B 1Z2GA 3G67A 4JI1B 1SQVH 3G80A 2QGNA 4TT3G 4QJFB 1OZ0A 1K92A 4LNUA 2XASA 3Q4HA 2A0LA 4WFBV 1FFXB 1XNQO 1WPXA 4FFKA 4EFEA 1ROPA 4D7SA 2V7QG 2HJFC 2UXDB 4TUYA 1IBKB 4X1YA 5KHJA 4JTDB 5BR8B 1RSOB 3PJSK 2LW7A 3W7TA 1PL4A 5JVDA 1CEZA 1YI2V 3STLC 1NTKH 3AG4B 1ZX3A 2OT5A 3H1JH 3DC6A 1TVKB 4TV8A 1QVGU 1JPXA 4DR3O 3BEHA 4DR3B 1XUQA 1NS1A 3JYCA 2CUGA 4TV9A 3X2QB 4LFAB 3I5DA 5A2QN 4FLVA 1R6NA 1OCZC 2DYRB 1SQBH 4O2BB 3ASOC 2Q67A 1HR0B 5KUMA 1G6UA 3AG1C 5LGUA 1MSDA 5GONA 1IBLB 1S5LZ 5LYJA 3ASNC 1BMFG 4DV5O 1H8HG 3TGUH 4LWSA 4O4JB 3T4DA 3P3PA 1IDSA 1D2DA 1S3JA 3X2QC 4X64O 2QKCA 4TOIA 3JD4A 4MVZA 4PI2A 2P4KA 2DOSA 1Q3EA 1BL8A 2F66C 4LFAO 2EIMB 4BIZA 4N23A 4GX5A 4LNUB 3KZIZ 1JOYA 3BRCA 1W0JG 5EZYB 4JYCA 2F23A 1FXHA 1KC8W 4PDRA 1E79G 3QVNA 3HKCA 4JPRA 4PD4F 3TJTA 3HKBB 4O4HB 4GCZA 3UO3A 2HLDG 4DV1O 4J41A 1JA8A 2EJRA 4DV2O 2P6JA 1LR1A 4LWSB 2EILB 1OCRC 4R7CA 2K1EA 1AI5A 5DM6V 5C8YB 4MVSA 1IBKO 1VF5B 5LXTB 3Q4HB 1R3JC 5LP6C 1F7YA 5L3EA 4O4LA 2N04A 1Q6UA 2QTOA 2GTAA 1Q43A 4PHZA 3E8FA 2B9ZA 3ZRWB 1GN3A 4OPAA 5FNVB 5B3SB 4LF5B 5LMUB 5HFLA 3OEHG 2IU0A 4WF9V 5F2VO 4CBCA 2D2CB 3D36A 4NKGB 4J80A 3FB8C 1M93A 1OCOB 4EKWA 1YTFB 1SQPH 4RQFA 3ABKB 4FJCC 4K0KB 2PI4A 1EZJA 5JCOC 4TQDA 1SETA 3R66A 3CJHA 2F1MA 4X1KA 3P30A 1FXKA 2DWDC 1Q82W 2P4VA 1VQ8V 4DV2B 4GT1A 3SPGA 3ZN0A 4OX9B 3CHXA 4ZI7B 1XMOB 2Q0OC 4J7KA 4LF9B 5H5NA 4O4JA 5L3DA 4MT8A 4J7ZA 2AHYA 3CXCU 4EFBA 3BABA 1XNRO 4WBNB 1SF9A 3L75H 2WAMA 3OR6C 2JEXA 2KQXA 4F4LA 3A0RA 4JI0B 2UUAO 2OTJV 2ARHA 4JF3A 2WLMA 5IYCO 4U7OA 2P06A 2BTQA 4MTFA 1JQ0A 4RUFA 3B40A 5CA0B 5H6RA 4JI5O 4DO2A 1RPRA 2EJ7A 2P90A 3K5LA 4Z2WA 5LHIA 1H2LA 4O2AB 4JAVA 4UXNA 1Y67A 5LA6B 4DXWA 3SJQC 3CCSV 1SA0A 2BCCH 3F5TA 5L3CA 4JV5O 4PELA 3K5NA 1MOFA 3QO5A 4LF7B 2V1DA 3E83A 4WFEA 3JAWB 3PN1A 2OCCB 2EX3A 1XEQA 2HKOA 2EILC 2EIKC 1IXBA 4DR7B 4MSWC 2XT9A 2L6LA 3W7WA 3L9DA 1IZ3A 2VQFO 2W0XA 2WA3A 3K08A 2C2AA 5GTIZ 3ABLB 4DR4O 5IWAO 1BS3A 2XUMA 5CA1A 5KX5B 3QO8A 5KHKA 4DV3O 2ZNIA 3HPLC 3G6EV 3ZMVA 4PA9A 1RP3B 2UXCO 3JSNA 3ML0A 4EB6B 3SYCA 1PNLA 4MVUA 1V55C 2R70A 3ABKC 3SR2C 1NQTA 4DUZB 1EN5A 2NLJC 2QTSA 3OUSA 1NVPB 1ORQC 2HJDA 2WLLA 1FJGO 4NB5A 1H38A 5B1NA 1W2BU 2ZR3A 3JD3A 3JALA 3E22A 1XDCA 1BE3H 2Y4UA 1AI4A 3JASB 3K57A 4YIPA 4O4LB 4FIPC 2DYRC 4DR5O 3S3XA 2BTOA 3NR7A 2CE4A 5CBFA 1VQ6V 4MVQA 1N32B 2QJ1A 3CCVV 1N33O 2FMLA 1BHBA 4X20A 4HNAA 2EZOA 2V4DA 3JAWA 1KB9F 2YEVA 3BFRA 3DSQA 4HNAB 1G8MA 2OIGA 1ENVA 2YSUB 1MMMA 5L3GA 4LC1A 4U3FH 2UXBO 3CD6V 1VQOV 3ZHRA 1JJOA 3L70H 1GH6A 4PDVA 2BOCC 3HR0A 3K3WA 4MS2A 2PYLA 3T1HO 4F6RA 1N4CA 3OW2U 1MABG 1M90W 4I9QA 1FXKB 4U7NA 5EC1C 1O9HA 3H9VA 4DV4B 4FLUA 3BAAA 3HKDB 4XDKA 2JGDA 2ZE6A 1GK9A 2QA4V 4O2AA 3ZMUA 4X8AA 5L3BA 2B1GA 3CMEV 5B1AB 2HR3A 1WNSA 4JTCB 2NN4A 1K5SA 3CRMA 1VQ5V 4WBNA 1N0NA 5KLVH 1Z5WA 4LFCB 2XHBA 4TV9B 3K58A 2BSKA 5BMVB 1N8RW 3E8GA 5JH7A 3CRAA 3G6BA 2UUCB 1QLEC 1M5IA 1YDXA 2NR5A 1M1KW 4BIOA 4QPKA 1M4UA 5CN0A 2EULA 4KFMA 3LSUA 3SJCC 3MAQA 3IJ4A 1W0KG 2RCVA 1XNQB 1AI7A 4AI8A 3B8NA 2XNDG 4FFBB 2N05A 2CTRA 1WB8A 1SQFA 2DE0X 2PY5A 1NR7A 2WLIB 2Y0IA 3U11A 3N2KA 1H2KA 5LOVA 3A2FA 2G38A 1WJZA 4FLZA 3A0HZ 1TA8A 3OTOO 4AQYB 3UT5B 4NXMB 2ZXWB 4X1IB 3RYHA 3JCUZ 1H2SB 4WCEV 5JVDB 1WP7A 5J9PC 3KCXA 1VP7A 5D5QA 3HKEA 5E1AC 4LFBB 3D3QA 3H1KH 3B77A 2WA4A 1K97A 1HNWB 2QWRB 2IBZH 4PI0A 3N2GA 2Q4PA 4LH7A 1B04A 4KHPB 3AEIA 1EBOA 4FLXA 2CGNA 1F4MA 1SC5B 2X6AA 5LMNO 2OCHA 5BXZA 3CEIA 2IW5A 1Q81W 3KCYA 1K5QA 4DYLA 1GM9A 1TUBA 3RYFB 4JAAA 1J5EB 3JAMN 2BOBC 5B3SC 4NTXA 4B3SB 1I0HA 1SKVA 1M57B 3UT5A 3WU2Z 4DV4O 1NKDA 5FPOA 4P9PA 3OUFA 1A32A 1AJQA 2DWEC 1XOUA 5H6QA 4KXRA 1IVSA 4H37A 1EN4A 4GKJB 3FFQA 2E3CA 2EIMC 2WPDG 1P84F 1KKCA 1QLEB 4GX0A 3GWKC 2Z5UA 3C90A 1VQ4V 4PJ0Z 4YJ2B 4B3RO 2EIJB 2HVJC 2GSMB 3RYCA 2ZQMA 4LF8O 2Y48A 1QHTA 4BWAA 4F6RB 2ZM6O 2DW4A 4B3SO 2PZSA 4CH6A 4ZOLB 3SJBC 1XQ8A 4PV1B 3RYHB 3HKBA 1VQLV 1VQKV 3K0DA 4JYBA 4NXNB 5GTHZ 2Q68A 5LL6Y 2QM8A 3OM3B
chains in the Genus database with same CATH topology
3E2EA 1SETA 1M56B 3LUTB 3EFFK 4MVMA 2Z3YA 4GX2A 4P30A 3E89A 2QE7G 4UVBA 4BAYA 3P30A 5EBMC 3SPJA 1FXKA 2DWDC 4ZBMA 1Q82W 1VQ8V 3ABTA 4GT1A 2HG5C 1J95A 1P7BA 3SPGA 3ZN0A 1YSCA 3JD1A 4MTXA 1VQMV 3I55V 3ABUA 1JVMA 1E1RG 1I5XA 3I56V 5L3DA 1SESA 1AJNA 4MT8A 1GKFA 3E86A 2AHYA 3SPIA 3CXCU 1JJ2U 1P4RA 1Y4MA 3DGEA 3OMNB 4UVCA 5LHGA 3H01A 2WAMA 3OR6C 2JEXA 1K7DA 3A0RA 4P2ZA 4F4LA 1NH2D 2OTJV 1K4CC 2XAQA 1K73W 1H2GA 1VQ9V 3ASNB 5L3FA 4JF3A 3F7VC 1PL0A 2WLMA 5IYCO 1XL6A 4U7OA 5CBGA 3SYAA 4BW5A 1KD1W 2UXNA 1K34A 4QE9A 4MTFA 2P7TC 3JCZA 3W7XA 2IH3C 1JQ0A 2Y69C 2Q6AA 2EIKB 1SERA 1QR8A 4RUFA 3RVZA 4PA3A 5H6RA 3UM7A 5CMUA 4DO2A 3LDCA 1DF4A 2WWWA 5BZBA 1RPRA 2ITCC 3P32A 4TSFG 2P90A 3ABMC 1NVPD 2UXXA 5LHIA 4WFFA 3MHSC 4JAVA 4UXNA 4DXWA 2XOKG 3TETA 4WFGA 3SJQC 1LNQA 4KUMA 2WLKA 3FB7C 5H9CA 3CCRV 3LDEA 3CCSV 3QO7A 3ETEA 3SYQA 3FB6C 1KP3A 5L3CA 2IJHA 3NXSA 4Z1MG 4PELA 3VOUA 3ABLC 4G27B 4HZ3A 1V54C 3ZJZA 1MOFA 1KECA 3QO5A 4PA6A 3SPHA 5KA6A 2V1DA 1S76D 1NH2B 2PI5A 3E83A 4WFEA 2X7RB 1K8AW 3OMIB 4MW8A 1GMGA 1S5HC 2OCCB 1AI6A 4G28B 1S0VA 3OE7G 1K33A 3GB7C 1R3LC 4OXSA 2HKOA 2EILC 5B1AC 4KP4A 3OEEG 2EIKC 4JTAB 2W0FC 1PNMA 4MSWC 5HFMA 1VQ7V 1YHQV 4FK5C 3W7WA 2A9HA 4I5SA 5EBLC 3LNMB 2WLJA 1KP2A 2QKSA 1V55B 5B1OA 3K08A 1IXMA 2FTKA 2C2AA 3ZRVA 5LHHA 1COWG 3ABLB 4WFAV 2WSSG 2CK3G 4ASUG 4CZZA 2MK3A 3ETGA 2LFSA 1MG1A 3QO8A 3IGAC 4RAIA 2ZR2A 3DTUB 1FS0G 2JDIG 1FFTB 1BHAA 3T2MA 3HPLC 5GW7A 3CCLV 1NJIW 3G6EV 4XDLA 4PA9A 1H8EG 3ZMVA 3CMAV 4R8CA 2GHYA 1DF5A 4MVOA 4QNHB 4PA4A 3ZMTA 3ML0A 3SYCA 4Q20A 1VQPV 5B1BB 1E1QG 1PNLA 1THZA 3TK1A 1NR1A 1L1FA 2WLHA 1HWYA 2A79B 4MVUA 1V55C 3CYOA 1R3IC 3ABKC 2HVKC 1R3KC 1DLBA 1NQTA 3LSSA 4UV8A 3MHHC 2ITDC 3CCEV 1DTOA 2H94A 2NLJC 2X6BA 3F5WC 4J9YB 3OUSA 1NVPB 1XL4A 1ORQC 2XAHA 2ZXWC 3CC4V 2WLLA 1H38A 4LCUC 5B1NA 1W2BU 2ZR3A 3JD3A 4RO2A 4HYOA 3CCQV 1AI4A 3FYEB 1V54B 4UUJC 5LGNA 3LSQA 2WLLB 4YXWG 3AG4C 4FIPC 2DYRC 2XAJA 4ZKIA 5DN6G 1R73A 2JK5C 2NNUA 5B1BC 1OCRB 5CBFA 3CP1A 2WLIA 3AG2C 1VQ6V 1QVFU 4MVQA 3LDDA 3UKMA 2X0LA 3CCVV 3TCUA 2JJ1G 3W7UA 1BHBA 3FYIB 2EZOA 3WFVA 2DQ0A 3D3IA 2YEVA 5KUKA 5IYDO 1JCHA 2JJ2G 2IU3A 2IJJA 3F7YC 4I9WA 1YJ9V 1G8MA 3T4ZA 1WLEA 4FMTA 1ENVA 1FXKC 1M56C 3T1CA 3E8HA 2EBOA 2YSUB 5LBQA 4RQEA 3CCJV 1F4NA 1NBMG 2W6IG 3SPCA 3M99B 5L3GA 1RPOA 2R9RB 4L87A 1PNKA 4JASA 1PKXA 4LC1A 3HB3B 2QEXV 4X89A 3CD6V 5IDJA 1VQOV 2F43G 1FXVA 3FKSG 2H8PC 2XAGA 3K03A 4WFHA 1VQNV 1S77D 4PA7A 4PDVA 4H33A 2BOCC 2EZPA 3K3WA 3ZRWA 1YJWV 4MS2A 2X6CA 3ABMB 1GO3F 3ZMSA 2DYSB 4LP8A 3OW2U 1MABG 1M90W 2R9IA 1FXKB 2IJKA 3G4SV 1KQSU 3OGCC 4QPJA 4U7NA 1OCZB 2YEVB 1R6KA 4GX1A 5EC1C 5CBHA 1QLNA 4TWKA 4FPPA 4QIWF 4XDKA 1M57C 1PD3A 2QA4V 1GK9A 1EZJA 2QM7A 2OTLV 4PDMA 3ZMZA 2HFEC 3K9AA 4RUEA 2B1IA 3ZMUA 1AJPA 4UV9A 4X8AA 5L3BA 2AHZA 2B1GA 3CMEV 4BIUA 2D3OW 5B1AB 2HR3A 5IYBO 4JTCB 2KB1A 1K5SA 1VQ5V 1CP9A 2ATKC 4XDJA 1GM8A 3RW0A 2B5UA 4MVRA 4TT3G 1AR1B 1OCCC 3AG3C 1OZ0A 1K92A 3FB5C 4QJFB 1F23A 2XASA 1N8RW 4R50A 3CCMV 2A0LA 3CCUV 4WFBV 3E8BA 2EINC 5CA3A 1WPXA 3E8GA 1ROPA 1JX9A 1QLEC 2V7QG 2HJFC 4G2KA 1M1KW 1UJWB 2ZDIC 4QPKA 5CN0A 4JTDB 1SZTA 3BY6A 1RM1C 3CC2V 4KFMA 1YJNV 3ZRXA 3PJSK 1GTOA 3ASOB 3W7TA 2DYSC 4J9ZB 1CEZA 4MTOA 2DQ3A 1W0KG 4X88A 1YI2V 1AI7A 3STLC 3B8NA 3AG4B 2XNDG 3K06A 3RVYA 2W6JG 1Q7YW 2OT5A 3K04A 1KKDA 5C93A 2IJIA 2ZD9A 1QVGU 1I5YA 1JPXA 3AG2B 1ZWIC 1K9MW 3BEHA 4XBFA 2EINB 1NR7A 1YITV 2WLIB 3ZCCA 1QCEA 3JYCA 3WG7B 5IY5C 3W7SA 5EC2C 3X2QB 3ZRSA 1R6NA 1OCZC 4QE7A 2DYRB 3ETDA 3ASOC 2ZXWB 2Q67A 2IH1C 3KG2A 4WCEV 5KUMA 3AG1C 5LGUA 1TUEB 5J9PC 2XAFA 5E1AC 3OAAG 1RM1B 5FL7G 3B77A 3EHBB 1QR9A 3ASNC 1G4YB 1K97A 3SYOA 5EK0A 1BMFG 1H8HG 4P9OA 5IY5B 4JAUA 1Y66A 3SYPA 3T4DA 3AEIA 1EBOA 1OHHG 1S3JA 1OCCB 3MD0A 5EBWC 3X2QC 1F4MA 2WLNA 3R65A 2X6AA 3ZN1A 3G71V 3JD4A 4MVZA 1Q81W 2IW5A 1F51A 1SRYA 3CPWU 1K5QA 1GM9A 1YIJV 3OR7C 1BL8A 2EIMB 4BIZA 4N23A 3WG7C 1M9NA 4GX5A 2M7WA 2BOBC 5B3SC 3RBZA 1QBZA 3AG1B 4MW3A 1JOYA 1M57B 3OFNG 1EFRG 3JD0A 1CPYA 1W0JG 3QNEA 2P67A 4JYCA 1FXHA 1KC8W 1NKDA 4P9PA 4PDRA 3OUFA 1YTFD 1E79G 1K3EA 4JPRA 1OCOC 1AJQA 2Y69B 4GCZA 2HLDG 1S72V 2DWEC 3B8MA 3K0GA 2LFRA 5H6QA 5LGTA 2EJRA 3ZIAG 5KA5A 4H37A 2P6JA 3GWOA 2EILB 4LBEC 3AG3B 1OCRC 2JIZG 4R7CA 2EIMC 2WPDG 2K1EA 1AI5A 1GM7A 2OCCC 5DM6V 4E2LA 4MVSA 1QLEB 4PDLA 4GX0A 3VBBA 3IC7A 1R3JC 2Z5UA 1VQ4V 3STZC 4MTGA 2EIJB 2HVJC 4R6ZA 5L3EA 1Q86W 2GSMB 2ZQMA 2QTOA 1K4DC 2Y48A 2JEUA 3E8FA 3IFXA 2DW4A 3ZRWB 4UVAA 3OMAB 5B3SB 2ZDIA 5HFLA 3OEHG 2IU0A 4WF9V 3CC7V 4N21A 4CBCA 3D36A 3FB8C 1MSWD 1VQLV 3JD2A 1VQKV 2LP7A 3K0DA 1AROP 1OCOB 4EKWA 1YTFB 4HAMA 1B6QA 3E35A 4JGSA 4RQFA 3ABKB 4JYBA 3K79A 2EIJC 2Q68A 4FJCC 2PI4A 2QM8A 2Q69A 3OM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3L C;  2R9R B;  2IH1 C;  4OXS A;  3KG2 A;  2EIL C;  3LUT B;  3AG1 C;  3EFF K;  5B1A C;  5KUM A;  5J9P C;  2EIK C;  4MVM A;  4X89 A;  4JTA B;  2W0F C;  5E1A C;  4GX2 A;  4P30 A;  4MSW C;  3E89 A;  2H8P C;  3ASN C;  1G4Y B;  2A9H A;  2DWD C;  3K03 A;  5EBM C;  5EK0 A;  4ZBM A;  3SPJ A;  3SYO A;  4WFH A;  5EBL C;  3LNM B;  2WLJ A;  4PA7 A;  4P9O A;  4PDV A;  4H33 A;  2BOC C;  2QKS A;  4MS2 A;  2X6C A;  3K08 A;  2HG5 C;  1J95 A;  3SYP A;  3T4D A;  4LP8 A;  1P7B A;  3SPG A;  5EBW C;  3X2Q C;  2WLN A;  3OGC C;  3R65 A;  5EC1 C;  2X6A A;  1JVM A;  4GX1 A;  5CBH A;  4TWK A;  4RAI A;  3IGA C;  4MVZ A;  3T2M A;  3E86 A;  1M57 C;  2AHY A;  3HPL C;  4XDK A;  3OR7 C;  4PA9 A;  1BL8 A;  4XDL A;  3SPI A;  4R8C A;  4PDM A;  3WG7 C;  2HFE C;  4GX5 A;  4MVO A;  4RUE A;  4QNH B;  2BOB C;  4PA4 A;  4X8A A;  5B3S C;  2AHZ A;  3RBZ A;  3SYC A;  4MW3 A;  3OR6 C;  4JTC B;  2KB1 A;  4F4L A;  4P2Z A;  2ATK C;  2WLH A;  1K4C C;  2A79 B;  4MVU A;  1V55 C;  4XDJ A;  1R3I C;  3ABK C;  4P9P A;  4PDR A;  3OUF A;  2HVK C;  3RW0 A;  1R3K C;  1OCO C;  4MVR A;  3F7V C;  2WLM A;  1OCC C;  1XL6 A;  2ITD C;  3AG3 C;  3FB5 C;  5CBG A;  2NLJ C;  2X6B A;  3F5W C;  4R50 A;  4J9Y B;  3OUS A;  2A0L A;  3SYA A;  1XL4 A;  1ORQ C;  2DWE C;  2ZXW C;  2EIN C;  2WLL A;  3E8B A;  3K0G A;  3E8G A;  4LCU C;  4QE9 A;  4H37 A;  1QLE C;  4HYO A;  2P7T C;  4MTF A;  4RO2 A;  2HJF C;  4LBE C;  2IH3 C;  1OCR C;  2Y69 C;  2Q6A A;  4RUF A;  4JTD B;  2EIM C;  4R7C A;  2K1E A;  4UUJ C;  3RVZ A;  4PA3 A;  4KFM A;  2WLL B;  3AG4 C;  3UM7 A;  2DYR C;  2OCC C;  4MVS A;  3PJS K;  4PDL A;  4GX0 A;  2JK5 C;  2DYS C;  4J9Z B;  5B1B C;  3LDC A;  1R3J C;  5BZB A;  5CBF A;  4MTO A;  3STZ C;  4X88 A;  2ITC C;  2WLI A;  3AG2 C;  3STL C;  3ABM C;  4MTG A;  2HVJ C;  4MVQ A;  4R6Z A;  3LDD A;  3RVY A;  3K06 A;  3UKM A;  2QTO A;  4WFF A;  1K4D C;  3K04 A;  1KKD A;  3TCU A;  4DXW A;  3TET A;  4WFG A;  3SJQ C;  2ZD9 A;  1LNQ A;  3E8F A;  3IFX A;  2WLK A;  3FB7 C;  1ZWI C;  3BEH A;  3LDE A;  2YEV A;  2WLI B;  3SYQ A;  3FB6 C;  5KUK A;  3JYC A;  3VOU A;  3ABL C;  4G27 B;  4HZ3 A;  1V54 C;  5IY5 C;  3ZJZ A;  4CBC A;  3F7Y C;  5EC2 C;  4I9W A;  3ZRS A;  4PA6 A;  3SPH A;  3T4Z A;  3FB8 C;  3E83 A;  4WFE A;  3K0D A;  1M56 C;  3T1C A;  3E8H A;  4EKW A;  1OCZ C;  4MW8 A;  1S5H C;  4QE7 A;  2EIJ C;  2Q68 A;  3SPC A;  4BW5 A;  3ASO C;  4G28 B;  2Q69 A;  2Q67 A;  3GB7 C; 
#chains in the Genus database with same CATH topology
 1I08 A;  3N2K B;  5LOV B;  4X66 O;  3LUT B;  3EFF K;  4DR5 B;  4MVM A;  2ZCE A;  4GX2 A;  3RT3 C;  2Y4T A;  3E89 A;  3SPJ A;  4X9Q A;  4X20 B;  3B09 A;  1GN4 A;  4JI7 B;  2LW1 A;  4MTX A;  1VQM V;  3RYI B;  1BZK A;  1I5X A;  2VWK A;  5A9G A;  1AJN A;  3RGB A;  3OMN B;  2PF4 E;  3HKD A;  5JJE B;  2XAQ A;  3CB2 A;  5IWA B;  4H13 B;  1PL0 A;  1TGO A;  3JAK B;  4JI7 O;  4BW5 A;  4NVP A;  2UXN A;  1K34 A;  1N36 B;  2P7T C;  3JCZ A;  4JI6 O;  2Q6A A;  2EIK B;  4FLT A;  1SER A;  1NTZ H;  4JYA O;  4OGQ B;  1PV0 A;  1H2N A;  2OWO A;  4DR7 O;  5IJ0 B;  4UCT A;  1EZV H;  4X66 B;  1Q5O A;  3LDC A;  2WWW A;  1X59 A;  3P32 A;  3JAL B;  4O4I B;  3ABM C;  3A0B Z;  1NVP D;  4WFF A;  5CB4 B;  2L35 A;  4WFG A;  2CH7 A;  3FB7 C;  3FD9 A;  4FM0 A;  5H9C A;  4TQF A;  3CCR V;  3LDE A;  3SYQ A;  1GAX A;  2IJH A;  1TVK A;  3VOU A;  4HZ3 A;  4ICG A;  4G27 B;  2MW2 B;  1V54 C;  1ZUQ A;  3ZJZ A;  4LF4 B;  2F4V B;  3P3N A;  4B7K A;  3SPH A;  1NH2 B;  4DR6 B;  2X7R B;  1K8A W;  4UB8 Z;  4E4E A;  3OMI B;  3RYF A;  3ZS8 C;  3FAV B;  5GON B;  3JAR A;  1AI6 A;  1KYO F;  3OE7 G;  2Q8V A;  4QGP A;  2ODM A;  2K9P A;  5HFM A;  3B4S A;  1YHQ V;  4H44 B;  2BE3 A;  5CB4 A;  4I5S A;  4DUY O;  4TV8 B;  5EBL C;  2WLJ A;  1KP2 A;  3CSX A;  4IGG A;  1V55 B;  4DRX B;  3CS5 A;  2CK3 G;  5EIB C;  4CZZ A;  4H0L B;  3OTF A;  2LFS A;  1GRJ A;  1MG1 A;  3DTU B;  1G1X B;  1BHA A;  1FFT B;  1NJI W;  1ZTE A;  3CMA V;  4R8C A;  4QNH B;  4O2B A;  4ZI7 A;  1VQP V;  1FFX A;  2JS5 A;  1E1Q G;  1THZ A;  1N33 B;  1HWY A;  3CYO A;  1R3I C;  4DUY B;  4X65 B;  1R3K C;  2RN9 A;  5B5E Z;  3MHH C;  2H94 A;  2X6B A;  3F5W C;  1XL4 A;  2XAH A;  4HYO A;  3DXR A;  2CTQ A;  3QF7 A;  4YXW G;  1JMK C;  1QQC A;  1MA1 A;  2OYQ A;  5B1B C;  1OCR B;  1XHZ A;  1I94 O;  2ZIM A;  2WLI A;  2UUB O;  3LDD A;  4DV7 B;  3UKM A;  3TCU A;  1Y74 A;  3ZED A;  5IYD O;  4LF5 O;  2JJ2 G;  4YY3 B;  5DED A;  3F7Y C;  4CH3 A;  2Q7H A;  3T1Y B;  1MZF A;  3E22 B;  1NBM G;  1AP5 A;  4JYA B;  3M99 B;  3N27 A;  3H1I H;  2QEX V;  4FM1 A;  4X89 A;  4DV6 O;  5EYP B;  3FKS G;  3K03 A;  4EEQ A;  5KHI A;  4KHP O;  1VQN V;  1GN2 A;  3K5O A;  3OTO B;  3ZRW A;  3ABM B;  3ZMS A;  2GUZ A;  1US6 A;  2DYS B;  1HNW O;  3JSL A;  2KSD A;  2R9I A;  2IJK A;  4ZOL A;  4DV6 B;  3FX7 A;  4GX1 A;  1XHX A;  4YIO A;  3VQW A;  4TWK A;  1FD9 A;  2YUA A;  1L0L H;  1PD3 A;  4PDM A;  3K9A A;  4RUE A;  4YJ3 A;  2B1I A;  1VF6 A;  4DV7 O;  5LP6 A;  4DK1 A;  4CS3 A;  2JS3 A;  1CP9 A;  1GM8 A;  1IX9 A;  4YY3 O;  2B5U A;  4GKK O;  1OCC C;  3AG3 C;  1MNG A;  3BCC H;  1SS3 A;  4R50 A;  3CCM V;  5KMG A;  4DV3 B;  5IJ0 A;  3EXA A;  3IC9 A;  1L0N H;  2ZDI C;  4O4I A;  2FKX A;  3CC2 V;  5K1X A;  3ZRX A;  1WA8 B;  1GTO A;  3ASO B;  4MTO A;  3MDS A;  1ZSP A;  3JAS A;  3K06 A;  1Q7Y W;  4JZ2 A;  3T1Y O;  1KKD A;  4GYC B;  2IJI A;  2ZD9 A;  4K35 A;  1I5Y A;  1XRE A;  4B7E A;  1K9M W;  1TAE A;  2EIN B;  5E79 Z;  4GKK B;  3WB0 A;  2LQT A;  3AK2 A;  3RFR A;  1YIT V;  3ICX A;  4X65 O;  3WG7 B;  5IY5 C;  3W7S A;  1I7F A;  5EC2 C;  1TUB B;  2Z0A A;  1B3Q A;  3J80 N;  2F95 B;  2JRI A;  4CH5 A;  2IM9 A;  4GZR B;  2IH1 C;  3KG2 A;  2ZM6 B;  1I94 B;  2Q73 A;  2XAF A;  3OAA G;  1RM1 B;  1YVW A;  5FL7 G;  3WB1 A;  1QR9 A;  4P9O A;  4JAU A;  1Y66 A;  4I50 A;  1OCC B;  5JQG B;  2WLN A;  2UXB B;  3D8C A;  2KG7 A;  1SRY A;  1N0J A;  4BW9 A;  1YIJ V;  3OR7 C;  1M9N A;  1ZL8 B;  4FZ1 A;  1QBZ A;  3AG1 B;  1EFR G;  3JD0 A;  1CPY A;  2H3O A;  3CXH F;  3QNE A;  1ZL8 A;  3D36 C;  1B06 A;  2LGW A;  2RDC A;  1Q6I A;  1WA8 A;  4GUN A;  1S72 V;  3ZIA G;  1FJG B;  3AG3 B;  3L71 H;  5IYZ A;  4DUZ O;  1VMG A;  5BMV A;  2ZE7 A;  2UU9 O;  5J2T B;  3O9O A;  1BGY H;  4PDL A;  1NZ6 A;  4CS2 A;  3VBB A;  4DV1 B;  1ZLZ A;  3STZ C;  3SJA C;  3H1H H;  4IHJ B;  3RN4 A;  4R6Z A;  1WP8 A;  4FVM A;  5IJ9 A;  3IFX A;  2E74 B;  3M8A A;  1PP9 H;  1NU1 H;  3OMA B;  2VRZ A;  2YXL A;  1P7G A;  1FAF A;  5ITZ B;  5DEC A;  1MSW D;  2LP7 A;  3M7M X;  4CC6 A;  4HAM A;  3E35 A;  4JGS A;  1S5J A;  1HNZ O;  3K79 A;  2EIJ C;  2AZ2 A;  4YHH O;  2Q69 A;  4UFZ A;  1HP8 A;  5C8Y A;  2CDY A;  3OGI B;  2Z3Y A;  4IHJ A;  3JAT B;  5EIB D;  4BAY A;  1YEW A;  4ZBM A;  2GBO A;  4DV0 O;  5J2U A;  4K3A A;  2HG5 C;  1P7B A;  2Q5Z A;  1YSC A;  1WB7 A;  2JGD B;  3A8T A;  3ABU A;  4F6E A;  1JVM A;  2AZ0 A;  5J2U B;  1E1R G;  1URF A;  2R72 A;  5IE9 A;  1GKF A;  1JJ2 U;  1P4R A;  3DGE A;  4LF8 B;  2YID A;  4UVC A;  5D5P A;  2BSK B;  1T5E A;  1K7D A;  4P2Z A;  4LF9 O;  1K4C C;  1XMO O;  1SA0 B;  1H2G A;  1VQ9 V;  5L3F A;  2E5L O;  1LUV A;  1AVM A;  1KD1 W;  4Z1V A;  1FPO A;  2FL4 A;  4QE9 A;  4JI3 B;  1IUR A;  2CGO A;  3UO2 A;  2YS8 A;  3UM7 A;  3T1H B;  5H2F Z;  4CS4 A;  3K59 A;  4KL1 A;  4TUY B;  5BZB A;  2F93 B;  2UXX A;  4LF4 O;  2F4V O;  4NXN O;  1O9G A;  1JR9 A;  2P22 C;  4DK0 A;  1J5E O;  3TET A;  3ZHQ A;  4IYH A;  4NYK A;  5LP6 B;  2WLK A;  2YI9 A;  2Y0P A;  2A3Q A;  3FB6 C;  1KP3 A;  5KX5 A;  3NXS A;  2YI8 A;  4OX9 O;  3ABL C;  1U97 A;  1KEC A;  3FAV A;  5KA6 A;  1S76 D;  4X1Y B;  3CE2 A;  4MW8 A;  1GMG A;  1S5H C;  3C3S A;  1YZB A;  3GB7 C;  1R3L C;  2YIC A;  2GTS A;  5KAI Z;  4KP4 A;  4JTA B;  2W0F C;  4I4T A;  1VQ7 V;  4FK5 C;  1H2M A;  4FZ0 A;  1HNX O;  4AQY O;  3LNM B;  1QNM A;  1SZX A;  1FYJ A;  2YIA A;  2AW9 A;  2QKS A;  5B1O A;  1IXM A;  2FTK A;  2LO1 A;  2PTM A;  3BA9 A;  3ZRV A;  1L8D A;  1COW G;  3CJH B;  4JI4 O;  4LFB O;  4LH6 A;  1HNZ B;  2MK3 A;  3DC5 A;  3ZHS A;  3ETG A;  4I50 B;  3IGA C;  5FLX N;  1FS0 G;  3CCL V;  4NXM O;  1H8E G;  1VF7 A;  1DF5 A;  3CWB H;  3VQY A;  3U0Z A;  4I0X B;  4PA4 A;  4NTW A;  5AG2 A;  5B1B B;  1YF2 A;  4ZIB A;  3TK1 A;  1NR1 A;  5FNV A;  2ZNJ A;  1AR5 A;  3ZHT A;  3CCE V;  2HHH B;  1DTO A;  1LUW A;  2VQE B;  3CC4 V;  2ZXW C;  4A5U B;  3AG7 A;  2R9A A;  4RO2 A;  4DW1 A;  2O57 A;  2RQ6 A;  3CCQ V;  3APQ A;  3FYE B;  2UU9 B;  5LGN A;  4J11 A;  3LSQ A;  4K8X A;  4LF6 B;  3SGI A;  3C3T A;  4ZKI A;  4JI6 B;  2NNU A;  3ZHV A;  3CP1 A;  3JAT A;  1Y76 B;  3AG2 C;  1QVF U;  3L74 H;  4I0X A;  5J2T A;  5KHG A;  2X0L A;  2ZIN A;  2UUC O;  3EVK A;  4DR1 B;  2ZE5 A;  3QG5 A;  2DQ0 A;  3LNN A;  1JCH A;  2IU3 A;  2IJJ A;  4LFC O;  4X64 B;  4IT5 A;  4B3R B;  1YJ9 V;  3RYI A;  3T4Z A;  2EBO A;  4K8Z A;  4RQE A;  4I55 A;  1F4N A;  4OPH A;  5EYP A;  2W6I G;  3ZBH A;  2R9R B;  2QM4 A;  4UCO A;  1PNK A;  4JAS A;  3QTC A;  4GKJ O;  1PKX A;  2GV9 A;  5IDJ A;  1W59 A;  4D6T H;  2VS0 A;  2XAG A;  4J7J A;  1S77 D;  3RYC B;  1P49 A;  4H33 A;  1YJW V;  3WB2 A;  2PUS A;  4IL6 Z;  3G4S V;  1KQS U;  4QPJ A;  1R6K A;  5CBH A;  1QLN A;  5CA0 A;  1AP6 A;  1OV9 A;  1M57 C;  2JGU A;  1XBL A;  3ZMZ A;  2HFE C;  4UV9 A;  2AHZ A;  4BIU A;  2D3O W;  4U3J A;  5IYB O;  1YCI A;  2KB1 A;  3CRR A;  2CTP A;  2ATK C;  1IBM O;  1WAZ A;  2E75 B;  4IIJ A;  1XNR B;  4MVR A;  1AR1 B;  3FB5 C;  1F23 A;  2A06 H;  3CCU V;  3E8B A;  2EIN C;  5CA3 A;  1JX9 A;  3AK3 A;  4G2K A;  4IYI A;  5FPR A;  2CAZ C;  1UJW B;  4K0K O;  1SZT A;  3BY6 A;  1RM1 C;  1YJN V;  3HKE B;  2DYS C;  4J9Z B;  4L8J A;  2DQ3 A;  4X88 A;  2HHH O;  3RVY A;  2W6J G;  1D5N A;  2UXD O;  2UXC B;  3K04 A;  5C93 A;  1AR4 A;  1HW7 A;  3AG2 B;  1WN7 A;  1ZWI C;  4FLY A;  4XBF A;  1KMI Z;  1XIL A;  2QWP B;  3ZHU A;  3ZCC A;  2QDO A;  3KKY A;  1QCE A;  3B2E E;  2M6Y A;  4W4K A;  4DR4 B;  3ZRS A;  2N74 A;  2YC0 A;  3K5M A;  4QE7 A;  3IAY A;  3ETD A;  1KU9 A;  1NT2 B;  1Z5V A;  1Q6H A;  5B66 Z;  3TXQ A;  3BHP A;  1TUE B;  1X4T A;  2E76 B;  2YDE A;  3EHB B;  1G4Y B;  3SYO A;  5EK0 A;  4CC5 A;  4FFB A;  5IY5 B;  1N36 O;  1QU7 A;  3SYP A;  1OHH G;  3TXS A;  3MD0 A;  5EBW C;  4X1K B;  2PYJ A;  3R65 A;  3ZN1 A;  4ZHQ A;  3G71 V;  1WPB A;  1Y76 A;  1F51 A;  3CPW U;  3VQX A;  5CA1 B;  3WG7 C;  2M7W A;  4HBN A;  3RBZ A;  3H1L H;  1MZE A;  4LR3 A;  4MW3 A;  1CXZ B;  3OFN G;  2Q9L A;  4JI5 B;  1BT8 A;  2P67 A;  1U96 A;  1NI8 A;  4DV5 B;  3GVM A;  1YTF D;  4JV5 B;  1K3E A;  1OCO C;  2Y69 B;  3UQ8 A;  2UUB B;  3B8M A;  1GN6 A;  3K0G A;  4NTY A;  2LFR A;  5LGT A;  5KA5 A;  3GWO A;  4UCR A;  1AB3 A;  4LBE C;  2VQF B;  3THO A;  2JIZ G;  2ETN A;  1YXB A;  1XI1 A;  1GM7 A;  1Q8I A;  2OCC C;  4E2L A;  4B08 A;  4AIL C;  2CH7 B;  3AK1 A;  1D5A A;  4ZHQ B;  3IC7 A;  3L73 H;  4MTG A;  1Q86 W;  2E5L B;  1IBL O;  1K4D C;  4UCV A;  4BR6 A;  2JEU A;  3UCS C;  5ITZ A;  4UVA A;  4LF7 O;  3HKC B;  4I7Z B;  2ZDI A;  2RNB A;  3CC7 V;  2RJZ A;  4ABM A;  4N21 A;  2P5O A;  2QR4 A;  4DR1 O;  2ZIO A;  4FLW A;  3JD2 A;  1ARO P;  1KBH A;  3K9S A;  1B6Q A;  4J10 A;  5BR8 O;  2ZT9 B;  3JD1 A;  5IYZ B;  3E2E A;  4UCU A;  1M56 B;  4DR2 O;  4LF6 O;  1VAR A;  1VF6 C;  4P30 A;  3SDL A;  4UVB A;  2QE7 G;  1BSM A;  2DN9 A;  5KMG B;  2DMX A;  5EBM C;  1AIL A;  4X1I A;  3ABT A;  4W4L A;  5JH7 B;  1J95 A;  4B3M O;  4YHH B;  3I55 V;  4B3T B;  1FKA O;  3I56 V;  2OIE A;  4DR6 O;  3CRQ A;  1SES A;  4U3J B;  3E86 A;  3SPI A;  1ZAU A;  4DRX A;  4JI1 O;  1Y4M A;  3RWR D;  1R1B A;  5LHG A;  2AGA A;  3H01 A;  2KG7 B;  1NH2 D;  4YJ3 B;  1K73 W;  3VQV A;  2DJV A;  3ASN B;  5LMU O;  5LMN B;  3F7V C;  1XL6 A;  5CBG A;  1XMQ O;  1N32 O;  3SYA A;  4B3M B;  3W7X A;  2IH3 C;  2Y69 C;  5JJN B;  1QR8 A;  2GUZ B;  4Q6G A;  3RVZ A;  4PA3 A;  2QWN B;  1SQG A;  4DR2 B;  5CMU A;  3OT7 A;  1DF4 A;  5LA6 A;  5K1P A;  3ZX6 A;  2ITC C;  4TSF G;  5LYJ B;  3MHS C;  3BPZ A;  2XOK G;  2YIB A;  5JJJ B;  1LNQ A;  2ZE8 A;  4KUM A;  5TIS Z;  1XMQ B;  4J42 A;  3QO7 A;  4JI8 O;  3ETE A;  4Z1M G;  1JFF B;  3APO A;  2Q0A A;  2YXH A;  4PA6 A;  2YXY A;  2QWO B;  2PI5 A;  2ADP A;  2RMK B;  5JWP A;  1Q90 D;  4G28 B;  1S0V A;  1K33 A;  4OXS A;  1BCC H;  1BQ0 A;  5B1A C;  1HR0 O;  3OEE G;  2GDS A;  1PNM A;  1OJH A;  1DK1 A;  4O4H A;  4DW0 A;  2A9H A;  2LJ2 A;  5JQG A;  2QKA A;  2Q7G A;  4JI3 O;  1SQX H;  4JI0 O;  1R6T A;  3U10 A;  5LHH A;  3DXR B;  4WFA V;  2WSS G;  4JI2 O;  4ASU G;  5LXT A;  4JYY A;  1EN6 A;  4RAI A;  2ZR2 A;  2JDI G;  5KHH A;  3T2M A;  5GW7 A;  4XDL A;  2GHY A;  4MVO A;  3JAR B;  3CX5 F;  3ZMT A;  4JI2 B;  4JZG A;  1IBM B;  4Q20 A;  4CH4 A;  4UCS A;  4AHC A;  1L1F A;  2WLH A;  1UPG A;  2A79 B;  1UFI A;  2ZKO A;  2HVK C;  1VEW A;  1DLB A;  3LSS A;  4UV8 A;  2ITD C;  1BQZ A;  4J9Y B;  4I4T B;  4DV0 B;  4LCU C;  4GLX A;  1Y6X A;  2HP8 A;  4I55 B;  3N2G B;  2VWJ A;  2ADQ B;  2XTA A;  1V54 B;  4UUJ C;  2WLL B;  4NR1 A;  3AG4 C;  2XAJ A;  2KKW A;  3O65 A;  5BY1 A;  5DN6 G;  1R73 A;  2JK5 C;  1RFY A;  3CRC A;  5KAF Z;  2ILM A;  2A7W A;  4JI8 B;  2JJ1 G;  3W7U A;  3L72 H;  4EB6 A;  3FYI B;  4YJ2 A;  2UUA B;  2Q7E A;  3WFV A;  3D3I A;  2PGG A;  5KUK A;  1VIB A;  1N34 O;  5IJ9 B;  1DGS A;  4RWU A;  4I9W A;  1SQQ H;  1Y74 B;  5IT9 N;  1WLE A;  4FMT A;  2CTW A;  3BA8 A;  2FYU H;  1FXK C;  3BVO A;  1M56 C;  3T1C A;  3E8H A;  2YIB D;  5LBQ A;  3CCJ V;  1PM9 A;  1HDJ A;  4JI4 B;  3SPC A;  1JFF A;  1RPO A;  3J7A U;  1V9P A;  4L87 A;  3S3W A;  1EM1 A;  4X62 B;  3OD4 A;  3HB3 B;  5JCO A;  4IIJ B;  4X62 O;  1HNX B;  1NTM H;  2QSA A;  2F43 G;  1FXV A;  2H8P C;  2HEP A;  3JAK A;  2JVD A;  4WFH A;  4PA7 A;  2BTQ B;  2EZP A;  2X6C A;  1GO3 F;  3ETQ A;  4LP8 A;  2AXT Z;  3OGC C;  2QWQ B;  1RSO A;  1OCZ B;  2YEV B;  1PPJ H;  1KUQ A;  4FPP A;  4FM2 A;  4QIW F;  5EZY A;  2VQE O;  2FB5 A;  4D7T A;  2QM7 A;  2OTL V;  1AJP A;  4B3T O;  3J81 N;  4C7U A;  4UB6 Z;  2LGQ A;  4XDJ A;  3RW0 A;  1N34 B;  1Z2G A;  3G67 A;  4JI1 B;  1SQV H;  3G80 A;  2QGN A;  4TT3 G;  4QJF B;  1OZ0 A;  1K92 A;  4LNU A;  2XAS A;  3Q4H A;  2A0L A;  4WFB V;  1FFX B;  1XNQ O;  1WPX A;  4FFK A;  4EFE A;  1ROP A;  4D7S A;  2V7Q G;  2HJF C;  2UXD B;  4TUY A;  1IBK B;  4X1Y A;  5KHJ A;  4JTD B;  5BR8 B;  1RSO B;  3PJS K;  2LW7 A;  3W7T A;  1PL4 A;  5JVD A;  1CEZ A;  1YI2 V;  3STL C;  1NTK H;  3AG4 B;  1ZX3 A;  2OT5 A;  3H1J H;  3DC6 A;  1TVK B;  4TV8 A;  1QVG U;  1JPX A;  4DR3 O;  3BEH A;  4DR3 B;  1XUQ A;  1NS1 A;  3JYC A;  2CUG A;  4TV9 A;  3X2Q B;  4LFA B;  3I5D A;  5A2Q N;  4FLV A;  1R6N A;  1OCZ C;  2DYR B;  1SQB H;  4O2B B;  3ASO C;  2Q67 A;  1HR0 B;  5KUM A;  1G6U A;  3AG1 C;  5LGU A;  1MSD A;  5GON A;  1IBL B;  1S5L Z;  5LYJ A;  3ASN C;  1BMF G;  4DV5 O;  1H8H G;  3TGU H;  4LWS A;  4O4J B;  3T4D A;  3P3P A;  1IDS A;  1D2D A;  1S3J A;  3X2Q C;  4X64 O;  2QKC A;  4TOI A;  3JD4 A;  4MVZ A;  4PI2 A;  2P4K A;  2DOS A;  1Q3E A;  1BL8 A;  2F66 C;  4LFA O;  2EIM B;  4BIZ A;  4N23 A;  4GX5 A;  4LNU B;  3KZI Z;  1JOY A;  3BRC A;  1W0J G;  5EZY B;  4JYC A;  2F23 A;  1FXH A;  1KC8 W;  4PDR A;  1E79 G;  3QVN A;  3HKC A;  4JPR A;  4PD4 F;  3TJT A;  3HKB B;  4O4H B;  4GCZ A;  3UO3 A;  2HLD G;  4DV1 O;  4J41 A;  1JA8 A;  2EJR A;  4DV2 O;  2P6J A;  1LR1 A;  4LWS B;  2EIL B;  1OCR C;  4R7C A;  2K1E A;  1AI5 A;  5DM6 V;  5C8Y B;  4MVS A;  1IBK O;  1VF5 B;  5LXT B;  3Q4H B;  1R3J C;  5LP6 C;  1F7Y A;  5L3E A;  4O4L A;  2N04 A;  1Q6U A;  2QTO A;  2GTA A;  1Q43 A;  4PHZ A;  3E8F A;  2B9Z A;  3ZRW B;  1GN3 A;  4OPA A;  5FNV B;  5B3S B;  4LF5 B;  5LMU B;  5HFL A;  3OEH G;  2IU0 A;  4WF9 V;  5F2V O;  4CBC A;  2D2C B;  3D36 A;  4NKG B;  4J80 A;  3FB8 C;  1M93 A;  1OCO B;  4EKW A;  1YTF B;  1SQP H;  4RQF A;  3ABK B;  4FJC C;  4K0K B;  2PI4 A;  1EZJ A;  5JCO C;  4TQD A;  1SET A;  3R66 A;  3CJH A;  2F1M A;  4X1K A;  3P30 A;  1FXK A;  2DWD C;  1Q82 W;  2P4V A;  1VQ8 V;  4DV2 B;  4GT1 A;  3SPG A;  3ZN0 A;  4OX9 B;  3CHX A;  4ZI7 B;  1XMO B;  2Q0O C;  4J7K A;  4LF9 B;  5H5N A;  4O4J A;  5L3D A;  4MT8 A;  4J7Z A;  2AHY A;  3CXC U;  4EFB A;  3BAB A;  1XNR O;  4WBN B;  1SF9 A;  3L75 H;  2WAM A;  3OR6 C;  2JEX A;  2KQX A;  4F4L A;  3A0R A;  4JI0 B;  2UUA O;  2OTJ V;  2ARH A;  4JF3 A;  2WLM A;  5IYC O;  4U7O A;  2P06 A;  2BTQ A;  4MTF A;  1JQ0 A;  4RUF A;  3B40 A;  5CA0 B;  5H6R A;  4JI5 O;  4DO2 A;  1RPR A;  2EJ7 A;  2P90 A;  3K5L A;  4Z2W A;  5LHI A;  1H2L A;  4O2A B;  4JAV A;  4UXN A;  1Y67 A;  5LA6 B;  4DXW A;  3SJQ C;  3CCS V;  1SA0 A;  2BCC H;  3F5T A;  5L3C A;  4JV5 O;  4PEL A;  3K5N A;  1MOF A;  3QO5 A;  4LF7 B;  2V1D A;  3E83 A;  4WFE A;  3JAW B;  3PN1 A;  2OCC B;  2EX3 A;  1XEQ A;  2HKO A;  2EIL C;  2EIK C;  1IXB A;  4DR7 B;  4MSW C;  2XT9 A;  2L6L A;  3W7W A;  3L9D A;  1IZ3 A;  2VQF O;  2W0X A;  2WA3 A;  3K08 A;  2C2A A;  5GTI Z;  3ABL B;  4DR4 O;  5IWA O;  1BS3 A;  2XUM A;  5CA1 A;  5KX5 B;  3QO8 A;  5KHK A;  4DV3 O;  2ZNI A;  3HPL C;  3G6E V;  3ZMV A;  4PA9 A;  1RP3 B;  2UXC O;  3JSN A;  3ML0 A;  4EB6 B;  3SYC A;  1PNL A;  4MVU A;  1V55 C;  2R70 A;  3ABK C;  3SR2 C;  1NQT A;  4DUZ B;  1EN5 A;  2NLJ C;  2QTS A;  3OUS A;  1NVP B;  1ORQ C;  2HJD A;  2WLL A;  1FJG O;  4NB5 A;  1H38 A;  5B1N A;  1W2B U;  2ZR3 A;  3JD3 A;  3JAL A;  3E22 A;  1XDC A;  1BE3 H;  2Y4U A;  1AI4 A;  3JAS B;  3K57 A;  4YIP A;  4O4L B;  4FIP C;  2DYR C;  4DR5 O;  3S3X A;  2BTO A;  3NR7 A;  2CE4 A;  5CBF A;  1VQ6 V;  4MVQ A;  1N32 B;  2QJ1 A;  3CCV V;  1N33 O;  2FML A;  1BHB A;  4X20 A;  4HNA A;  2EZO A;  2V4D A;  3JAW A;  1KB9 F;  2YEV A;  3BFR A;  3DSQ A;  4HNA B;  1G8M A;  2OIG A;  1ENV A;  2YSU B;  1MMM A;  5L3G A;  4LC1 A;  4U3F H;  2UXB O;  3CD6 V;  1VQO V;  3ZHR A;  1JJO A;  3L70 H;  1GH6 A;  4PDV A;  2BOC C;  3HR0 A;  3K3W A;  4MS2 A;  2PYL A;  3T1H O;  4F6R A;  1N4C A;  3OW2 U;  1MAB G;  1M90 W;  4I9Q A;  1FXK B;  4U7N A;  5EC1 C;  1O9H A;  3H9V A;  4DV4 B;  4FLU A;  3BAA A;  3HKD B;  4XDK A;  2JGD A;  2ZE6 A;  1GK9 A;  2QA4 V;  4O2A A;  3ZMU A;  4X8A A;  5L3B A;  2B1G A;  3CME V;  5B1A B;  2HR3 A;  1WNS A;  4JTC B;  2NN4 A;  1K5S A;  3CRM A;  1VQ5 V;  4WBN A;  1N0N A;  5KLV H;  1Z5W A;  4LFC B;  2XHB A;  4TV9 B;  3K58 A;  2BSK A;  5BMV B;  1N8R W;  3E8G A;  5JH7 A;  3CRA A;  3G6B A;  2UUC B;  1QLE C;  1M5I A;  1YDX A;  2NR5 A;  1M1K W;  4BIO A;  4QPK A;  1M4U A;  5CN0 A;  2EUL A;  4KFM A;  3LSU A;  3SJC C;  3MAQ A;  3IJ4 A;  1W0K G;  2RCV A;  1XNQ B;  1AI7 A;  4AI8 A;  3B8N A;  2XND G;  4FFB B;  2N05 A;  2CTR A;  1WB8 A;  1SQF A;  2DE0 X;  2PY5 A;  1NR7 A;  2WLI B;  2Y0I A;  3U11 A;  3N2K A;  1H2K A;  5LOV A;  3A2F A;  2G38 A;  1WJZ A;  4FLZ A;  3A0H Z;  1TA8 A;  3OTO O;  4AQY B;  3UT5 B;  4NXM B;  2ZXW B;  4X1I B;  3RYH A;  3JCU Z;  1H2S B;  4WCE V;  5JVD B;  1WP7 A;  5J9P C;  3KCX A;  1VP7 A;  5D5Q A;  3HKE A;  5E1A C;  4LFB B;  3D3Q A;  3H1K H;  3B77 A;  2WA4 A;  1K97 A;  1HNW B;  2QWR B;  2IBZ H;  4PI0 A;  3N2G A;  2Q4P A;  4LH7 A;  1B04 A;  4KHP B;  3AEI A;  1EBO A;  4FLX A;  2CGN A;  1F4M A;  1SC5 B;  2X6A A;  5LMN O;  2OCH A;  5BXZ A;  3CEI A;  2IW5 A;  1Q81 W;  3KCY A;  1K5Q A;  4DYL A;  1GM9 A;  1TUB A;  3RYF B;  4JAA A;  1J5E B;  3JAM N;  2BOB C;  5B3S C;  4NTX A;  4B3S B;  1I0H A;  1SKV A;  1M57 B;  3UT5 A;  3WU2 Z;  4DV4 O;  1NKD A;  5FPO A;  4P9P A;  3OUF A;  1A32 A;  1AJQ A;  2DWE C;  1XOU A;  5H6Q A;  4KXR A;  1IVS A;  4H37 A;  1EN4 A;  4GKJ B;  3FFQ A;  2E3C A;  2EIM C;  2WPD G;  1P84 F;  1KKC A;  1QLE B;  4GX0 A;  3GWK C;  2Z5U A;  3C90 A;  1VQ4 V;  4PJ0 Z;  4YJ2 B;  4B3R O;  2EIJ B;  2HVJ C;  2GSM B;  3RYC A;  2ZQM A;  4LF8 O;  2Y48 A;  1QHT A;  4BWA A;  4F6R B;  2ZM6 O;  2DW4 A;  4B3S O;  2PZS A;  4CH6 A;  4ZOL B;  3SJB C;  1XQ8 A;  4PV1 B;  3RYH B;  3HKB A;  1VQL V;  1VQK V;  3K0D A;  4JYB A;  4NXN B;  5GTH Z;  2Q68 A;  5LL6 Y;  2QM8 A;  3OM3 B; 
#chains in the Genus database with same CATH homology
 3E2E A;  1SET A;  1M56 B;  3LUT B;  3EFF K;  4MVM A;  2Z3Y A;  4GX2 A;  4P30 A;  3E89 A;  2QE7 G;  4UVB A;  4BAY A;  3P30 A;  5EBM C;  3SPJ A;  1FXK A;  2DWD C;  4ZBM A;  1Q82 W;  1VQ8 V;  3ABT A;  4GT1 A;  2HG5 C;  1J95 A;  1P7B A;  3SPG A;  3ZN0 A;  1YSC A;  3JD1 A;  4MTX A;  1VQM V;  3I55 V;  3ABU A;  1JVM A;  1E1R G;  1I5X A;  3I56 V;  5L3D A;  1SES A;  1AJN A;  4MT8 A;  1GKF A;  3E86 A;  2AHY A;  3SPI A;  3CXC U;  1JJ2 U;  1P4R A;  1Y4M A;  3DGE A;  3OMN B;  4UVC A;  5LHG A;  3H01 A;  2WAM A;  3OR6 C;  2JEX A;  1K7D A;  3A0R A;  4P2Z A;  4F4L A;  1NH2 D;  2OTJ V;  1K4C C;  2XAQ A;  1K73 W;  1H2G A;  1VQ9 V;  3ASN B;  5L3F A;  4JF3 A;  3F7V C;  1PL0 A;  2WLM A;  5IYC O;  1XL6 A;  4U7O A;  5CBG A;  3SYA A;  4BW5 A;  1KD1 W;  2UXN A;  1K34 A;  4QE9 A;  4MTF A;  2P7T C;  3JCZ A;  3W7X A;  2IH3 C;  1JQ0 A;  2Y69 C;  2Q6A A;  2EIK B;  1SER A;  1QR8 A;  4RUF A;  3RVZ A;  4PA3 A;  5H6R A;  3UM7 A;  5CMU A;  4DO2 A;  3LDC A;  1DF4 A;  2WWW A;  5BZB A;  1RPR A;  2ITC C;  3P32 A;  4TSF G;  2P90 A;  3ABM C;  1NVP D;  2UXX A;  5LHI A;  4WFF A;  3MHS C;  4JAV A;  4UXN A;  4DXW A;  2XOK G;  3TET A;  4WFG A;  3SJQ C;  1LNQ A;  4KUM A;  2WLK A;  3FB7 C;  5H9C A;  3CCR V;  3LDE A;  3CCS V;  3QO7 A;  3ETE A;  3SYQ A;  3FB6 C;  1KP3 A;  5L3C A;  2IJH A;  3NXS A;  4Z1M G;  4PEL A;  3VOU A;  3ABL C;  4G27 B;  4HZ3 A;  1V54 C;  3ZJZ A;  1MOF A;  1KEC A;  3QO5 A;  4PA6 A;  3SPH A;  5KA6 A;  2V1D A;  1S76 D;  1NH2 B;  2PI5 A;  3E83 A;  4WFE A;  2X7R B;  1K8A W;  3OMI B;  4MW8 A;  1GMG A;  1S5H C;  2OCC B;  1AI6 A;  4G28 B;  1S0V A;  3OE7 G;  1K33 A;  3GB7 C;  1R3L C;  4OXS A;  2HKO A;  2EIL C;  5B1A C;  4KP4 A;  3OEE G;  2EIK C;  4JTA B;  2W0F C;  1PNM A;  4MSW C;  5HFM A;  1VQ7 V;  1YHQ V;  4FK5 C;  3W7W A;  2A9H A;  4I5S A;  5EBL C;  3LNM B;  2WLJ A;  1KP2 A;  2QKS A;  1V55 B;  5B1O A;  3K08 A;  1IXM A;  2FTK A;  2C2A A;  3ZRV A;  5LHH A;  1COW G;  3ABL B;  4WFA V;  2WSS G;  2CK3 G;  4ASU G;  4CZZ A;  2MK3 A;  3ETG A;  2LFS A;  1MG1 A;  3QO8 A;  3IGA C;  4RAI A;  2ZR2 A;  3DTU B;  1FS0 G;  2JDI G;  1FFT B;  1BHA A;  3T2M A;  3HPL C;  5GW7 A;  3CCL V;  1NJI W;  3G6E V;  4XDL A;  4PA9 A;  1H8E G;  3ZMV A;  3CMA V;  4R8C A;  2GHY A;  1DF5 A;  4MVO A;  4QNH B;  4PA4 A;  3ZMT A;  3ML0 A;  3SYC A;  4Q20 A;  1VQP V;  5B1B B;  1E1Q G;  1PNL A;  1THZ A;  3TK1 A;  1NR1 A;  1L1F A;  2WLH A;  1HWY A;  2A79 B;  4MVU A;  1V55 C;  3CYO A;  1R3I C;  3ABK C;  2HVK C;  1R3K C;  1DLB A;  1NQT A;  3LSS A;  4UV8 A;  3MHH C;  2ITD C;  3CCE V;  1DTO A;  2H94 A;  2NLJ C;  2X6B A;  3F5W C;  4J9Y B;  3OUS A;  1NVP B;  1XL4 A;  1ORQ C;  2XAH A;  2ZXW C;  3CC4 V;  2WLL A;  1H38 A;  4LCU C;  5B1N A;  1W2B U;  2ZR3 A;  3JD3 A;  4RO2 A;  4HYO A;  3CCQ V;  1AI4 A;  3FYE B;  1V54 B;  4UUJ C;  5LGN A;  3LSQ A;  2WLL B;  4YXW G;  3AG4 C;  4FIP C;  2DYR C;  2XAJ A;  4ZKI A;  5DN6 G;  1R73 A;  2JK5 C;  2NNU A;  5B1B C;  1OCR B;  5CBF A;  3CP1 A;  2WLI A;  3AG2 C;  1VQ6 V;  1QVF U;  4MVQ A;  3LDD A;  3UKM A;  2X0L A;  3CCV V;  3TCU A;  2JJ1 G;  3W7U A;  1BHB A;  3FYI B;  2EZO A;  3WFV A;  2DQ0 A;  3D3I A;  2YEV A;  5KUK A;  5IYD O;  1JCH A;  2JJ2 G;  2IU3 A;  2IJJ A;  3F7Y C;  4I9W A;  1YJ9 V;  1G8M A;  3T4Z A;  1WLE A;  4FMT A;  1ENV A;  1FXK C;  1M56 C;  3T1C A;  3E8H A;  2EBO A;  2YSU B;  5LBQ A;  4RQE A;  3CCJ V;  1F4N A;  1NBM G;  2W6I G;  3SPC A;  3M99 B;  5L3G A;  1RPO A;  2R9R B;  4L87 A;  1PNK A;  4JAS A;  1PKX A;  4LC1 A;  3HB3 B;  2QEX V;  4X89 A;  3CD6 V;  5IDJ A;  1VQO V;  2F43 G;  1FXV A;  3FKS G;  2H8P C;  2XAG A;  3K03 A;  4WFH A;  1VQN V;  1S77 D;  4PA7 A;  4PDV A;  4H33 A;  2BOC C;  2EZP A;  3K3W A;  3ZRW A;  1YJW V;  4MS2 A;  2X6C A;  3ABM B;  1GO3 F;  3ZMS A;  2DYS B;  4LP8 A;  3OW2 U;  1MAB G;  1M90 W;  2R9I A;  1FXK B;  2IJK A;  3G4S V;  1KQS U;  3OGC C;  4QPJ A;  4U7N A;  1OCZ B;  2YEV B;  1R6K A;  4GX1 A;  5EC1 C;  5CBH A;  1QLN A;  4TWK A;  4FPP A;  4QIW F;  4XDK A;  1M57 C;  1PD3 A;  2QA4 V;  1GK9 A;  1EZJ A;  2QM7 A;  2OTL V;  4PDM A;  3ZMZ A;  2HFE C;  3K9A A;  4RUE A;  2B1I A;  3ZMU A;  1AJP A;  4UV9 A;  4X8A A;  5L3B A;  2AHZ A;  2B1G A;  3CME V;  4BIU A;  2D3O W;  5B1A B;  2HR3 A;  5IYB O;  4JTC B;  2KB1 A;  1K5S A;  1VQ5 V;  1CP9 A;  2ATK C;  4XDJ A;  1GM8 A;  3RW0 A;  2B5U A;  4MVR A;  4TT3 G;  1AR1 B;  1OCC C;  3AG3 C;  1OZ0 A;  1K92 A;  3FB5 C;  4QJF B;  1F23 A;  2XAS A;  1N8R W;  4R50 A;  3CCM V;  2A0L A;  3CCU V;  4WFB V;  3E8B A;  2EIN C;  5CA3 A;  1WPX A;  3E8G A;  1ROP A;  1JX9 A;  1QLE C;  2V7Q G;  2HJF C;  4G2K A;  1M1K W;  1UJW B;  2ZDI C;  4QPK A;  5CN0 A;  4JTD B;  1SZT A;  3BY6 A;  1RM1 C;  3CC2 V;  4KFM A;  1YJN V;  3ZRX A;  3PJS K;  1GTO A;  3ASO B;  3W7T A;  2DYS C;  4J9Z B;  1CEZ A;  4MTO A;  2DQ3 A;  1W0K G;  4X88 A;  1YI2 V;  1AI7 A;  3STL C;  3B8N A;  3AG4 B;  2XND G;  3K06 A;  3RVY A;  2W6J G;  1Q7Y W;  2OT5 A;  3K04 A;  1KKD A;  5C93 A;  2IJI A;  2ZD9 A;  1QVG U;  1I5Y A;  1JPX A;  3AG2 B;  1ZWI C;  1K9M W;  3BEH A;  4XBF A;  2EIN B;  1NR7 A;  1YIT V;  2WLI B;  3ZCC A;  1QCE A;  3JYC A;  3WG7 B;  5IY5 C;  3W7S A;  5EC2 C;  3X2Q B;  3ZRS A;  1R6N A;  1OCZ C;  4QE7 A;  2DYR B;  3ETD A;  3ASO C;  2ZXW B;  2Q67 A;  2IH1 C;  3KG2 A;  4WCE V;  5KUM A;  3AG1 C;  5LGU A;  1TUE B;  5J9P C;  2XAF A;  5E1A C;  3OAA G;  1RM1 B;  5FL7 G;  3B77 A;  3EHB B;  1QR9 A;  3ASN C;  1G4Y B;  1K97 A;  3SYO A;  5EK0 A;  1BMF G;  1H8H G;  4P9O A;  5IY5 B;  4JAU A;  1Y66 A;  3SYP A;  3T4D A;  3AEI A;  1EBO A;  1OHH G;  1S3J A;  1OCC B;  3MD0 A;  5EBW C;  3X2Q C;  1F4M A;  2WLN A;  3R65 A;  2X6A A;  3ZN1 A;  3G71 V;  3JD4 A;  4MVZ A;  1Q81 W;  2IW5 A;  1F51 A;  1SRY A;  3CPW U;  1K5Q A;  1GM9 A;  1YIJ V;  3OR7 C;  1BL8 A;  2EIM B;  4BIZ A;  4N23 A;  3WG7 C;  1M9N A;  4GX5 A;  2M7W A;  2BOB C;  5B3S C;  3RBZ A;  1QBZ A;  3AG1 B;  4MW3 A;  1JOY A;  1M57 B;  3OFN G;  1EFR G;  3JD0 A;  1CPY A;  1W0J G;  3QNE A;  2P67 A;  4JYC A;  1FXH A;  1KC8 W;  1NKD A;  4P9P A;  4PDR A;  3OUF A;  1YTF D;  1E79 G;  1K3E A;  4JPR A;  1OCO C;  1AJQ A;  2Y69 B;  4GCZ A;  2HLD G;  1S72 V;  2DWE C;  3B8M A;  3K0G A;  2LFR A;  5H6Q A;  5LGT A;  2EJR A;  3ZIA G;  5KA5 A;  4H37 A;  2P6J A;  3GWO A;  2EIL B;  4LBE C;  3AG3 B;  1OCR C;  2JIZ G;  4R7C A;  2EIM C;  2WPD G;  2K1E A;  1AI5 A;  1GM7 A;  2OCC C;  5DM6 V;  4E2L A;  4MVS A;  1QLE B;  4PDL A;  4GX0 A;  3VBB A;  3IC7 A;  1R3J C;  2Z5U A;  1VQ4 V;  3STZ C;  4MTG A;  2EIJ B;  2HVJ C;  4R6Z A;  5L3E A;  1Q86 W;  2GSM B;  2ZQM A;  2QTO A;  1K4D C;  2Y48 A;  2JEU A;  3E8F A;  3IFX A;  2DW4 A;  3ZRW B;  4UVA A;  3OMA B;  5B3S B;  2ZDI A;  5HFL A;  3OEH G;  2IU0 A;  4WF9 V;  3CC7 V;  4N21 A;  4CBC A;  3D36 A;  3FB8 C;  1MSW D;  1VQL V;  3JD2 A;  1VQK V;  2LP7 A;  3K0D A;  1ARO P;  1OCO B;  4EKW A;  1YTF B;  4HAM A;  1B6Q A;  3E35 A;  4JGS A;  4RQF A;  3ABK B;  4JYB A;  3K79 A;  2EIJ C;  2Q68 A;  4FJC C;  2PI4 A;  2QM8 A;  2Q69 A;  3OM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...