5J9PC

Kcsa in vitro
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
96
structure length
96
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 35
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5j9pC00
2Q67A 2ZD9A 2WLNA 2ZXWC 3LUTB 3VOUA 5CBFA 2HVJC 4WFGA 3SPIA 3TETA 2X6BA 2WLKA 4LCUC 2Q6AA 1J95A 3E8GA 2BOBC 3SYCA 3FB6C 4MVQA 3K08A 2BOCC 4PDMA 1P7BA 1ZWIC 1R3KC 1K4CC 4J9YB 3IGAC 4LBEC 3E8BA 4MTOA 4OXSA 5E1AC 4X89A 3OGCC 3ABKC 2QKSA 4MTFA 4PDLA 4PA9A 3SYOA 3K06A 2EINC 4G28B 3AG3C 4MTGA 1OCRC 1JVMA 2IH3C 4GX1A 3R65A 3SPCA 3ZRSA 5IY5C 2ITDC 3X2QC 2EIMC 4GX2A 4MVUA 5EK0A 4RAIA 4PDVA 5EBWC 2Q68A 3ABLC 4UUJC 2ITCC 3BEHA 4XDKA 2OCCC 2WLIB 4MVRA 5CBGA 4RO2A 4RUEA 3RVZA 3E89A 3JYCA 1V54C 3ASOC 2WLJA 4PA6A 2HVKC 2X6AA 5EC1C 3T1CA 4BW5A 4P9PA 5KUKA 2A0LA 2H8PC 3OR6C 5CBHA 2ATKC 3T2MA 1R3LC 4TWKA 4H33A 3K03A 3LDCA 2EIKC 3AG4C 4HYOA 4R7CA 5EBLC 3T4DA 2WLLA 3UM7A 1BL8A 3HPLC 2X6CA 1M56C 4QE7A 3SPGA 3FB8C 3STLC 2W0FC 2AHYA 3FB5C 4MVSA 3SJQC 4PDRA 4MW3A 1OCZC 5J9PC 2A9HA 1LNQA 5EBMC 3SYPA 4CBCA 2A79B 3LNMB 1XL4A 4EKWA 4PA3A 4QNHB 5KUMA 3F7VC 4GX0A 5B1BC 1M57C 3E83A 4P9OA 2YEVA 4WFEA 5B3SC 4KFMA 3PJSK 4JTDB 1S5HC 4JTAB 5BZBA 3UKMA 4ZBMA 3AG1C 3K04A 4WFFA 1XL6A 2Y69C 3GB7C 2IH1C 2DWEC 4DXWA 2P7TC 3F7YC 4XDJA 3EFFK 1K4DC 3WG7C 3FB7C 1OCOC 2HG5C 4WFHA 2KB1A 2JK5C 3SPHA 2Q69A 3F5WC 3K0DA 4JTCB 3TCUA 4MVOA 4RUFA 4X88A 4MS2A 4GX5A 1QLEC 4MVMA 4PA4A 1R3JC 2HFEC 2R9RB 2AHZA 4R50A 4R8CA 1KKDA 3LDDA 2WLIA 3IFXA 3AG2C 2DWDC 2DYSC 4PA7A 3RBZA 3E86A 4X8AA 4P30A 3T4ZA 2WLHA 5B1AC 2EILC 3RVYA 1R3IC 3STZC 3LDEA 1OCCC 2NLJC 3OUSA 3SPJA 3ABMC 4I9WA 3SYQA 2EIJC 2QTOA 2WLMA 1V55C 3OR7C 3ASNC 1G4YB 3OUFA 4LP8A 4MSWC 1ORQC 2K1EA 4R6ZA 4F4LA 3ZJZA 4P2ZA 4G27B 3E8HA 3K0GA 4HZ3A 4MW8A 4QE9A 4J9ZB 3E8FA 4MVZA 4XDLA 5EC2C 2WLLB 3KG2A 2DYRC 3RW0A 4H37A 3SYAA 2HJFC
chains in the Genus database with same CATH superfamily
1AB3A 2PI5A 2ZD9A 1R6TA 3B4SA 1R6NA 2QWOB 1SESA 4NTYA 2Q6AA 1J95A 1V54B 4UCUA 4X1KB 2BSKB 4YXWG 4MTOA 2YEVB 4O2AB 3U10A 3JAKA 1J5EO 4GCZA 4PA9A 1M9NA 2P90A 1BCCH 4NYKA 3K5OA 4NVPA 1XI1A 1YJNV 3K58A 2ADPA 1HW7A 5IWAB 2EULA 1O9HA 2GBOA 3JSLA 1VF5B 1JX9A 2VRZA 4JI6O 4BIOA 1JR9A 3OD4A 1VIBA 2AW9A 4NB5A 4QPKA 1SQVH 2DMXA 4LNUA 1Q8IA 4B7KA 4DR2O 1KC8W 3P3PA 2W0XA 1OCZC 4J80A 4LF4O 2F93B 3U11A 1NTKH 1KBHA 2YUAA 2KG7B 4E2LA 2Y69C 3WG7B 2Q4PA 2QWQB 1QCEA 3F5WC 4JTCB 3ZRWB 4B3MO 4DR5O 2CTRA 1VQ5V 3K9SA 1I94O 1VP7A 1K9MW 1VQ6V 1H8HG 4P30A 5B1AB 1NR1A 3T4ZA 3ZMZA 1FKAO 1OCCB 3RVYA 3IAYA 3FYEB 2HLDG 1PNMA 1FJGB 3SYQA 1FAFA 3CCSV 2CAZC 2N74A 2QA4V 1YJ9V 4ABMA 3RYIB 1ORQC 3UCSC 2QE7G 3ZRXA 1WLEA 4MW8A 1M5IA 3CCRV 4U7NA 4WFGA 2P4VA 4BAYA 1VQOV 3FB6C 5GTHZ 1FPOA 2YXHA 4HAMA 4LH6A 3APQA 3WB2A 1IDSA 5L3GA 1N0JA 4LF8B 5FPOA 3CS5A 1OCRB 2YC0A 3C3TA 4MTGA 4FLZA 4X1YA 1E79G 5CA1B 1FYJA 2CH7A 1B06A 5EBWC 5EK0A 5EYPB 3JAWB 2WLIB 1SQXH 3E89A 4TUYA 5H5NA 1H2NA 1SERA 3WB0A 1Q43A 2H8PC 3L73H 4O4IB 5IYDO 4O2BA 4H33A 2V4DA 3K57A 1YXBA 5B1OA 1K7DA 3B8MA 4OGQB 4DW1A 2W0FC 2E5LB 2AHYA 4MVSA 1NZ6A 3EXAA 4I0XA 2Z0AA 5B3SB 3MHHC 4CH5A 2Y0PA 4HBNA 5LHIA 2C2AA 4MTXA 2R9IA 3WG7C 1HNXB 2HG5C 4ZOLB 3T1HB 2B5UA 4FLVA 4MVOA 1XUQA 3WFVA 2F4VB 2CDYA 2HFEC 3CHXA 3RYHB 4UV9A 4J42A 1A32A 3JATA 4KHPO 1VF6A 5B1AC 3OUSA 1OCCC 4WF9V 1NT2B 1EM1A 1IBLO 1NR7A 1GRJA 2N05A 4JPRA 1YI2V 2ILMA 2GTAA 2PYJA 1S5LZ 1FFTB 4D7TA 4X64O 2Z5UA 2WSSG 2HJFC 4JI5B 4HNAA 5L3BA 1MSDA 2HHHO 3IC9A 1K5SA 3ML0A 5LYJB 4MVQA 3E22B 1ZWIC 2ZE6A 1RM1B 3CC7V 4DV6B 2ZT9B 4DR3O 2ZNJA 1JFFA 5LOVB 1OCRC 2IBZH 2UUCO 2XNDG 2NR5A 1SC5B 4UUJC 2VWKA 5CBGA 4GT1A 2HVKC 2VQFB 2IU3A 1COWG 1BT8A 4JI8B 1EZVH 1D5AA 2ATKC 3OGIB 4DUZB 1Q90D 1GAXA 2WLLA 2HKOA 3CYOA 5HFMA 3APOA 3A0RA 3BY6A 2P22C 4X65O 4FLYA 3OEEG 4FFBB 4AI8A 4PI0A 1WN7A 1P7GA 3C90A 5B3SC 3RGBA 4GKJB 1VF6C 3GB7C 1AJQA 2IH1C 3KCYA 4DV4B 4JAVA 5JJJB 1XNRO 2KB1A 3SPHA 1THZA 2BE3A 4ZI7A 3D8CA 2QM7A 1MZFA 5GW7A 2Q0AA 5LMNO 3UO2A 2QKCA 5JVDA 3MD0A 1DTOA 4F6RB 1H2SB 4O4HA 2DYSB 1H2GA 2DWDC 2P06A 3W7UA 2G38A 2UUAB 5EZYA 2UU9B 5KX5B 4EB6A 4JI7O 3K5LA 3RW0A 1X59A 1ZTEA 2KKWA 4LWSB 2IM9A 2VQEB 2YICA 1S0VA 1Y4MA 1K34A 1RPRA 3H1LH 1SKVA 4IL6Z 1P7BA 3GWOA 2AZ2A 3IGAC 5LHGA 1URFA 4GKKO 2QM8A 1RM1C 4RWUA 2Q9LA 4G28B 5LP6B 1H38A 5ITZB 1BSMA 1JVMA 3R65A 1VQ4V 2E76B 2UXDO 1W2BU 4FM1A 3ZMSA 3Q4HB 1Q5OA 3RVZA 4NXNB 3QF7A 4PA6A 5EC1C 1TUBA 3T1CA 3TXSA 5LMUB 2AGAA 3CSXA 3CMEV 2HP8A 1BMFG 4J7JA 1WPXA 5DN6G 1TGOA 2PUSA 4UV8A 1EFRG 3TK1A 1JA8A 2ETNA 2JDIG 1KMIZ 4JV5B 3CMAV 3LSSA 5BZBA 1AP5A 1Z2GA 1XOUA 2BCCH 5IDJA 4Q6GA 2IU0A 1YDXA 1S77D 1ZX3A 2EBOA 1WAZA 2AHZA 2PY5A 5KHGA 4DV3B 3ABUA 1HNWB 3OE7G 1GH6A 3RT3C 2DYSC 4JI2O 2NLJC 3THOA 4LFBO 3KCXA 1V55B 4Z1MG 4D7SA 3CEIA 3OUFA 4CH6A 2QM4A 4JAAA 3SJCC 4PJ0Z 3T1YO 2PYLA 3KG2A 2OTLV 1GO3F 2OYQA 1HWYA 2ODMA 1KKCA 5LGNA 1DGSA 1R3KC 1K4CC 3E8BA 1IXBA 1YCIA 3VQWA 2JIZG 4NTXA 5LP6C 2A7WA 1AP6A 2ARHA 2ITDC 4B3TO 2JEUA 3J7AU 3CRMA 4RAIA 1M90W 3A0HZ 5IT9N 5D5PA 1GK9A 2LO1A 4X62B 1R73A 2OCCB 3EVKA 3BRCA 5LXTA 2JS5A 3CCEV 4BW5A 4P9PA 1ZLZA 3QTCA 3ETDA 4JI0B 3AG4B 5D5QA 4R7CA 3F5TA 2Y0IA 1H2MA 4GYCB 2X6CA 5GONA 1K3EA 4DYLA 4FMTA 2CTWA 1I7FA 5K1PA 2A79B 4DR1O 5KUMA 5B1BC 3EHBB 4K8XA 4DR6B 4J7ZA 1G1XB 4I50B 2JK5C 1Y76A 2QKAA 3JD4A 3QO7A 1YEWA 1XMOO 3SJBC 3N27A 2UXBB 1R3JC 2R9RB 1Q3EA 3HKCA 4BIUA 1WP8A 1IXMA 3UT5B 2ADQB 1I94B 1JPXA 2YXLA 1PL4A 1ZSPA 2FYUH 4PA7A 4I55B 1V55C 5BXZA 3B77A 2JGDA 2Q7HA 5C8YB 1Y6XA 4G27B 1B6QA 1SA0A 1WB8A 3W7TA 4WFAV 1VQNV 4DV2O 1P4RA 3HKDB 4FFKA 3SPIA 3HKBA 1L0NH 1YITV 4TV8A 4YJ3B 3ABKB 4IHJB 4DRXA 3OMIB 2ZIMA 3ZN0A 4X1IA 1N36B 3D36C 1ZL8B 1K92A 2JEXA 5KA6A 1TVKB 1YHQV 1OHHG 4DK1A 1NVPB 3W7WA 1QHTA 4DV1B 4X66B 3PN1A 1IX9A 2XOKG 1LUWA 3CJHB 2OCCC 4MVRA 4JI4O 3RYCA 5DECA 4TSFG 1W0KG 4N23A 4DUYB 2LGWA 4KL1A 2CK3G 1FXKB 3HKEB 5CA0A 3OR6C 5F2VO 1K33A 2LW1A 3AG4C 1BGYH 5AG2A 1AILA 4BR6A 3H1JH 2XASA 4PDRA 1H2LA 4UVCA 4GZRB 2VS0A 1KP3A 4U3JB 1HR0B 4LC1A 2X0LA 2BSKA 3E83A 4O2AA 2YEVA 4CS4A 1NKDA 3BABA 1NTZH 2W6JG 1XL6A 2YI8A 4XDJA 2BTQB 3OFNG 3JD2A 4WFHA 4DR4B 4X88A 2UXCB 4ZHQB 1NBMG 1M1KW 3H01A 1GMGA 1YZBA 4PI2A 5JJNB 2XAJA 1D2DA 4TV9B 1CEZA 4Q20A 1K8AW 1PM9A 3SPJA 2ZIOA 4H13B 1F4MA 4K35A 4G2KA 3VQVA 1K97A 4F4LA 2JJ2G 4P2ZA 4MVZA 2DYRB 4JI1B 1NI8A 1QQCA 1VQKV 1RFYA 1K73W 1KU9A 2CE4A 1VF7A 1N34O 3M7MX 4DR7O 3DC5A 4FK5C 1XHZA 2KG7A 4BIZA 5FLXN 5J2TB 3ABKC 3MAQA 3N2GB 1KP2A 5FNVB 3VBBA 1VQLV 4LF5O 1T5EA 1Y74B 4LF9O 2AXTZ 3ZRWA 2UUCB 4GX1A 4LF7B 4CH4A 4GX2A 3OW2U 1VQ9V 1AR5A 5H2FZ 1AI6A 2OTJV 2QR4A 3CX5F 4RO2A 1V54C 1YF2A 3FYIB 3TJTA 2H94A 2ZM6O 3DGEA 1FXKC 5KUKA 2AZ0A 3RYIA 3T2MA 5A9GA 4DV5O 1RP3B 4TWKA 4TOIA 2EIKB 1L1FA 3AK2A 4PD4F 2ZE5A 2FKXA 1I5XA 4X65B 3N2KB 1OV9A 4UVAA 3JALB 4K0KB 1AI7A 5KMGB 3LSUA 3DC6A 4CS3A 3JARB 4FPPA 4B3SO 4JI3O 3UKMA 1X4TA 1YSCA 1Y67A 1G6UA 3O9OA 2O57A 3S3XA 3H1HH 4JYAO 1TA8A 5CA1A 2OCHA 2QJ1A 1NJIW 3JAWA 1KKDA 4N21A 2WLIA 3IFXA 4UCTA 4UXNA 1VQ7V 3RYFA 3OTFA 4E4EA 3LDEA 3JCUZ 4O4IA 2WLMA 1G4YB 4LP8A 4R6ZA 3CRCA 5K1XA 5EC2C 1YVWA 4XDLA 4NXMB 2DYRC 2WLNA 5CBFA 2X6BA 4YJ2B 2GDSA 3SR2C 5IWAO 1XQ8A 1E1QG 4B3RB 3G4SV 4PDLA 2EJ7A 4ZOLA 4X9QA 5IYZB 1P84F 1Q81W 3G71V 3P32A 4JF3A 2IH3C 5KAFZ 1B04A 2UUBB 2D2CB 3RYHA 2QDOA 3CCQV 3BAAA 1K5QA 4YY3B 3AG7A 2V7QG 3K5NA 3IC7A 4JYYA 2X6AA 1XBLA 5KHKA 5LL6Y 2Y48A 3JCZA 2PGGA 3LDCA 2EIKC 5J2UA 3IJ4A 1M56B 3HPLC 5DM6V 4QE7A 2R72A 3FB8C 2M7WA 3JD1A 3STLC 2L35A 3K9AA 1JMKC 3G80A 1NH2B 1VQMV 4I4TB 2JVDA 1SQGA 5LYJA 4QNHB 3E22A 3F7VC 4EEQA 4AHCA 4EFBA 1MOFA 1FJGO 4LR3A 5LOVA 3QNEA 1H8EG 3DXRB 1O9GA 1N32B 2XAFA 3OMAB 3CD6V 1HNZO 2FTKA 3LDDA 4J10A 2LFSA 2WPDG 2LW7A 4ICGA 4JYBA 3ZHVA 2R70A 3STZC 4IIJB 2RN9A 3OR7C 2ZDIC 2QEXV 5JH7B 2EZPA 3AEIA 4LF8O 4HZ3A 1SS3A 3BHPA 3K0GA 1WNSA 2QWPB 1R6KA 1QBZA 4FFBA 2B1GA 1VQ8V 4PELA 1FFXB 3LUTB 5LBQA 1WA8B 3P3NA 3OTOO 4L87A 4I5SA 2BOCC 1N0NA 4U7OA 4OXSA 5KLVH 3ZHUA 3H1KH 1VEWA 1KUQA 1WP7A 1BS3A 2KSDA 1VMGA 2QWRB 4QGPA 2YS8A 3BVOA 2PF4E 2E5LO 2UXNA 2OT5A 4F6RA 4LF6B 2ITCC 3BPZA 3BEHA 3JASB 4XDKA 1NH2D 4JYCA 1US6A 4NR1A 3RWRD 1MNGA 2B1IA 3ASOB 5BR8B 1XNQO 4DV0B 1XMQO 2F95B 3B09A 5CBHA 5KX5A 2E3CA 3K03A 1HNXO 3T1HO 1PNLA 1M56C 3MDSA 5IJ9B 3SDLA 2F4VO 2A3QA 4CS2A 2OWOA 2EJRA 5JJEB 4WBNB 2F43G 2N04A 4JTAB 3L71H 4LH7A 2YXYA 5LP6A 4OX9B 3QG5A 5LGTA 5ITZA 3VQXA 2IJIA 2YSUB 2XAGA 1JOYA 4MS2A 1ZUQA 4MVMA 4UCSA 4CC5A 1Q6IA 2JRIA 4JI5O 1FXVA 3Q4HA 5GTIZ 4Z2WA 4LFCB 3ABMB 3ZMTA 1ENVA 2RJZA 3OM3B 4QJFB 4DV6O 3ASNB 4DV7B 1L0LH 3ZJZA 1Q82W 1U96A 2YI9A 4QE9A 3ETEA 5JQGB 1XEQA 4DV2B 2ZXWB 4H0LB 4YHHB 3TETA 3I56V 4LCUC 4LFAO 4O4LB 1BHBA 4BW9A 1WPBA 1BE3H 1WJZA 2VQFO 4JI8O 3JD0A 1B3QA 3SPCA 2EIMB 2GUZB 2PI4A 4PDVA 2Q68A 5IE9A 5CB4B 3ZEDA 2ZCEA 2ZE8A 3ASOC 1J5EB 1GN3A 3CCLV 4GKJO 3ZHRA 3A2FA 4IYHA 1MSWD 1UPGA 3UM7A 1BL8A 3SPGA 1SZXA 3FFQA 5EBMC 4B7EA 2LQTA 1BZKA 3B8NA 1NS1A 2F23A 1YTFB 3U0ZA 1DF5A 2CTQA 2UUAO 3D36A 4QIWF 1TUEB 1P49A 3QVNA 2UU9O 4JI6B 2P7TC 3F7YC 1W0JG 1OCOB 3FX7A 2VWJA 4UB8Z 3G6BA 1MMMA 4KUMA 1M4UA 4DR2B 2RNBA 1QLEB 1QVGU 4KP4A 4BWAA 2M6YA 4PV1B 4LF4B 2VQEO 1S3JA 1SQFA 3NXSA 5BMVB 1JQ0A 3ABMC 3ASNC 3ETQA 2ZR2A 5H9CA 3ZS8C 4IYIA 4B3MB 2P4KA 4DR5B 3UO3A 4JZGA 4ASUG 1SETA 5L3EA 1CP9A 2ZXWC 3UQ8A 5DEDA 3CRRA 3TXQA 1AR4A 1IBMO 5JCOC 2UXXA 3JSNA 2ZKOA 5LMUO 2GSMB 2WWWA 4I50A 2P6JA 2MW2B 4O4JB 4AQYO 2EINB 2JGUA 3WB1A 5LHHA 1V9PA 3D3IA 1RSOB 3ZRSA 2CGOA 3FAVB 1I5YA 5LA6B 2EIMC 3UT5A 5B66Z 1SRYA 3MHSC 3HR0A 3GWKC 4I55A 4JV5O 3JYCA 3OAAG 3A0BZ 5IJ0B 3S3WA 1YTFD 3J81N 1PNKA 1IBKO 5C8YA 1GKFA 4X20B 1CXZB 1JJOA 1Z5VA 3CE2A 2RQ6A 1S76D 3HKDA 3CCUV 3CXHF 1HNWO 1GN4A 4WFEA 4YJ3A 4KFMA 4IHJA 1S5HC 4ZBMA 1ZL8A 3JAKB 3QO5A 1OCOC 1AJPA 1PPJH 2NNUA 3I55V 2HEPA 1QLEC 4YIOA 1FXHA 1IZ3A 1PD3A 3CJHA 1VQPV 3WU2Z 4NTWA 3LSQA 3RBZA 4X1KA 4AILC 1FXKA 5E79Z 3HKEA 1N33O 4JAUA 1I08A 3ZIAG 4MSWC 2ZE7A 1D5NA 2GV9A 4JGSA 3NR7A 3L70H 4LNUB 1IURA 2Q67A 4U3JA 3VOUA 1GM8A 2F66C 3CPWU 4KHPB 4X62O 4TQFA 3OMNB 2V1DA 5E1AC 1IBLB 1S72V 3QO8A 2XAHA 2QKSA 1LUVA 1OJHA 2BTQA 2YIAA 3K5MA 1CPYA 3CC4V 2EINC 4JI0O 5TISZ 2ZINA 4X64B 3W7SA 2ZNIA 2W6IG 4ZHQA 3ZBHA 4MVUA 1NVPD 5HFLA 3FKSG 2HHHB 2YIBD 3BFRA 2DE0X 4TV9A 4PHZA 1N4CA 2DQ0A 4DR6O 2IW5A 4UFZA 1SQPH 2JS3A 4DR3B 3ZCCA 2Z3YA 3CRQA 2EZOA 1ROPA 3AK1A 4J11A 2BTOA 4JASA 1EN6A 4TT3G 1MZEA 4DO2A 2UXBO 4MW3A 2A9HA 1NTMH 4A5UB 3LNMB 4EKWA 2F1MA 2ZR3A 3ETGA 5J2TA 4JTDB 3BA9A 3N2GA 5FNVA 3K04A 4WFFA 1Y74A 4B08A 1Q6HA 2P67A 3CC2V 2RCVA 3TCUA 4RUFA 1HNZB 4FIPC 3CB2A 2ZQMA 4X1YB 4R8CA 3KZIZ 1G8MA 2CH7B 4CH3A 1YIJV 3AG2B 3K79A 1JCHA 1PV0A 4TUYB 3SGIA 1BQZA 5IYCO 1N36O 1F4NA 1XNRB 1EN5A 3JD3A 1F7YA 4O2BB 3N2KA 2LJ2A 5IYBO 3G6EV 3JALA 3J80N 3SYAA 3H1IH 5LMNB 5KMGA 4DV1O 2PTMA 5L3FA 4X66O 5EYPA 1LR1A 3JARA 3OTOB 2LP7A 2WLKA 4I0XB 1EBOA 2BOBC 4TQDA 4FZ0A 3RYFB 2QSAA 4DUYO 1BQ0A 1EZJA 2WA4A 3ZX6A 3B2EE 4JI7B 1AJNA 5H6QA 3K3WA 3ABLB 3BA8A 2QWNB 1BHAA 1HR0O 3JATB 1XNQB 1XREA 3M8AA 5BY1A 4GKKB 1XMQB 1S5JA 2ZDIA 3ZN1A 2HR3A 1XHXA 4GUNA 1Q7YW 4D6TH 1HP8A 2XAQA 4H44B 5EBLC 2Y4TA 4DR4O 4I7ZB 2XHBA 2DN9A 3M99B 4FVMA 2UXCO 3SJQC 2GTSA 1KQSU 2UXDB 4DK0A 5C93A 4HNAB 1GTOA 2R9AA 4PA3A 4YJ2A 4OPAA 4U3FH 4P9OA 1MG1A 3L75H 1AI4A 2A06H 4W4LA 5IYZA 5KHHA 3FB7C 1MABG 3DSQA 1JFFB 4QPJA 4NKGB 2Q69A 5J2UB 4GX5A 4JI1O 4R50A 3CCJV 1PP9H 4IGGA 3AG2C 4RQEA 3G67A 1R3IC 1E1RG 2EX3A 2H3OA 3C3SA 3ZRVA 1JJ2U 3E8HA 3L74H 4LF7O 2WLLB 5CA3A 1GM9A 4MT8A 4I4TA 4LFAB 1QVFU 4KXRA 2PZSA 3SYCA 4JI2B 5L3DA 1TAEA 3B40A 5KA5A 4LFBB 1I0HA 4J41A 3K06A 2E75B 3T1YB 3AG3B 3DXRA 3X2QB 4ZI7B 3ABLC 4K0KO 1Z5WA 3ZMVA 5JVDB 4K3AA 4RUEA 4O4HB 4IIJA 5L3CA 1GN6A 5EZYB 3ICXA 2B9ZA 5JH7A 1R3LC 4CZZA 3OEHG 1L8DA 4DW0A 4B3TB 4EB6B 1FFXA 1NU1H 2Q7EA 1WA8A 2WAMA 2FL4A 4CBCA 1QR8A 1XL4A 3LNNA 1M57B 4ZKIA 4JZ2A 3PJSK 4UCVA 2FB5A 3AG1B 4K8ZA 3D3QA 2DWEC 3RN4A 3H9VA 1WB7A 3K0DA 4J7KA 4NXMO 3BCCH 4I9QA 3JASA 3CWBH 4LWSA 5KAIZ 4DR1B 5B1NA 5FPRA 1ZAUA 2OIGA 2EILB 1SF9A 4OPHA 2EIJB 3ZHQA 2QTOA 1TUBB 1NQTA 4B3RO 1KD1W 3CXCU 1DLBA 1AR1B 2FMLA 1XMOB 5IJ9A 3CCMV 2UUBO 2XTAA 1UJWB 2RMKB 4FLWA 2HVJC 4WBNA 2KQXA 1IBMB 4WCEV 2P5OA 3E8GA 4YY3O 3A8TA 1KECA 4X89A 3OGCC 4AQYB 1F51A 2JJ1G 3O65A 2IJJA 4UCOA 2E74B 2XUMA 3P30A 2LGQA 3AG3C 5IY5B 1UFIA 2CGNA 4FLUA 3X2QC 1XILA 1DK1A 5B1BB 3L9DA 3R66A 2WLJA 2Q7GA 1XDCA 1IBKB 2A0LA 4DUZO 3K59A 1Q6UA 3T4DA 4HYOA 5JQGA 4RQFA 5B5EZ 1N32O 2QGNA 3FB5C 3L72H 5J9PC 1LNQA 2IJHA 1PKXA 3ZHTA 4O4LA 1SZTA 4JI4B 3CRAA 1M57C 5JCOA 1U97A 3AG1C 4DXWA 2Q8VA 3EFFK 1AROP 3W7XA 1DF4A 4DV4O 3VQYA 2GUZA 1QR9A 1EN4A 5FL7G 4PA4A 1Q86W 5CB4A 5CMUA 3JAMN 5KHJA 4X8AA 1N33B 3ABTA 2EILC 4EFEA 5LXTB 2EIJC 2DW4A 1GM7A 4UVBA 1GN2A 2QTSA 1SQBH 1VARA 2K1EA 1RPOA 3E35A 2CUGA 2LFRA 4FLTA 5GONB 4LF6O 4FM2A 2IJKA 5KHIA 3K08A 5EIBD 4PDMA 4L8JA 3KKYA 4J9YB 4LBEC 4FZ1A 2K9PA 3CCVV 4IT5A 5BR8O 2D3OW 4DV0O 2DJVA 4MTFA 1F23A 3SYOA 1PL0A 1N8RW 1Y76B 5IY5C 3FD9A 2DQ3A 5JWPA 4GLXA 1AI5A 2HJDA 2WA3A 1N34B 3CP1A 1M93A 4UCRA 4DR7B 3HKCB 2RDCA 5EIBC 1IVSA 2YIDA 3AK3A 3GVMA 3HB3B 5BMVA 1OZ0A 4FLXA 5CN0A 4XBFA 4NXNO 3ZMUA 4FM0A 4W4KA 4LF5B 4LF9B 4OX9O 1AVMA 1R1BA 2JGDB 1QU7A 1QNMA 2NN4A 4UB6Z 2OIEA 1SA0B 4Z1VA 1Y66A 2XT9A 1OCZB 5LGUA 2Q73A 3RFRA 1FS0G 3SYPA 4YIPA 4FJCC 4GX0A 4F6EA 3HKBB 3SJAC 1SQQH 4C7UA 4TV8B 2ZM6B 4LFCO 3DTUB 4O4JA 2Y69B 1FD9A 4DRXB 4DV5B 3ZHSA 1K4DC 4X1IB 2YDEA 4CC6A 4WFBV 1RSOA 2Y4UA 4DV7O 1W59A 2Q0OC 3FAVA 2MK3A 5LA6A 2X7RB 2CTPA 1HDJA 2GHYA 1KYOF 4YHHO 4DV3O 1QLNA 3E86A 1H2KA 3OT7A 4B3SB 2Q5ZA 5IJ0A 2WLHA 4ZIBA 2DOSA 3RYCB 4JI3B 4I9WA 2L6LA 4X20A 5CA0B 3I5DA 3TGUH 1KB9F 3E2EA 1TVKA 4JYAB 5H6RA 5A2QN 1YJWV 4J9ZB 3E8FA 1MA1A 2YIBA 4H37A
chains in the Genus database with same CATH topology
1GO3F 2PI5A 2ZD9A 4PELA 3LUTB 5L3FA 5LBQA 1R6NA 2LP7A 1SESA 2WLKA 1EBOA 2Q6AA 1J95A 1HWYA 1V54B 2BOBC 4L87A 4I5SA 5LGNA 2BOCC 1R3KC 1K4CC 4MTOA 2YEVB 4OXSA 3E8BA 4U7OA 4YXWG 4GCZA 2JIZG 4PA9A 1EZJA 1M9NA 2P90A 1AJNA 2ITDC 5H6QA 3K3WA 2JEUA 4RAIA 2UXNA 3ABLB 2OT5A 1M90W 2ITCC 1GK9A 1BHAA 3BEHA 4XDKA 1NH2D 1R73A 2OCCB 4JYCA 1YJNV 2B1IA 3ASOB 2ZDIA 3CCEV 4BW5A 4P9PA 3ZN1A 5CBHA 3ETDA 2HR3A 1JX9A 1Q7YW 3K03A 2XAQA 3AG4B 5EBLC 4R7CA 4QPKA 1PNLA 2X6CA 1M56C 1KC8W 1K3EA 3M99B 3SJQC 4FMTA 1OCZC 1KQSU 5C93A 2A79B 1GTOA 2EJRA 4PA3A 5KUMA 5B1BC 3EHBB 4P9OA 2F43G 1MG1A 1AI4A 4JTAB 4E2LA 2Y69C 5LGTA 3WG7B 3FB7C 2IJIA 1MABG 2JK5C 3JD4A 2YSUB 4QPJA 1QCEA 2Q69A 2XAGA 3F5WC 3QO7A 4JTCB 3ZRWB 1JOYA 4MS2A 4GX5A 4MVMA 1R3JC 2R9RB 4R50A 4BIUA 1VQ5V 1IXMA 3CCJV 1FXVA 1JPXA 3AG2C 1K9MW 1VQ6V 4PA7A 1H8HG 4P30A 5B1AB 1NR1A 3T4ZA 3ZMZA 4RQEA 1OCCB 1R3IC 3RVYA 1E1RG 2HLDG 1PNMA 3ABMB 1ENVA 3FYEB 3ZMTA 3SYQA 3OM3B 4QJFB 3CCSV 1V55C 3ASNB 3B77A 2QA4V 1YJ9V 1ORQC 3ZRVA 2QE7G 3ZRXA 3ZJZA 1Q82W 1JJ2U 4G27B 3E8HA 1B6QA 4QE9A 1WLEA 4MW8A 3ETEA 3W7TA 2WLLB 3CCRV 5CA3A 1GM9A 4WFAV 1VQNV 4MT8A 2ZXWB 4U7NA 1P4RA 4WFGA 1QVFU 3SPIA 3TETA 3I56V 4LCUC 4BAYA 1VQOV 3SYCA 1YITV 3FB6C 5L3DA 1BHBA 5KA5A 3ABKB 3OMIB 4HAMA 3ZN0A 3JD0A 5L3GA 3K06A 1K92A 3AG3B 2JEXA 1OCRB 4MTGA 5KA6A 1YHQV 1OHHG 1NVPB 3SPCA 1E79G 3X2QB 3W7WA 2EIMB 5EK0A 5EBWC 4PDVA 2PI4A 2Q68A 3ABLC 2XOKG 3ZMVA 2OCCC 2WLIB 4MVRA 4RUEA 3E89A 4TSFG 1W0KG 4N23A 3ASOC 5L3CA 1SERA 2CK3G 1FXKB 3CCLV 2H8PC 3OR6C 5IYDO 1K33A 1R3LC 4H33A 4CZZA 3OEHG 3AG4C 1MSWD 5B1OA 3UM7A 1BL8A 1K7DA 3B8MA 3SPGA 2W0FC 2AHYA 2XASA 4MVSA 4PDRA 4UVCA 5EBMC 2WAMA 4CBCA 1QR8A 1XL4A 1KP3A 4LC1A 1M57B 2X0LA 3B8NA 3E83A 2YEVA 5B3SB 4ZKIA 3MHHC 3PJSK 1NKDA 1YTFB 1DF5A 5LHIA 3D36A 3AG1B 4QIWF 1TUEB 2C2AA 2W6JG 1XL6A 4MTXA 2DWEC 2R9IA 2P7TC 3F7YC 4XDJA 1W0JG 1OCOB 3OFNG 3WG7C 2HG5C 3JD2A 4WFHA 2B5UA 4KUMA 3K0DA 4MVOA 4X88A 3WFVA 1QLEB 1QVGU 2HFEC 4KP4A 1NBMG 4UV9A 1M1KW 3H01A 1GMGA 5B1NA 2XAJA 1S3JA 3NXSA 1CEZA 2EILB 5B1AC 4Q20A 1K8AW 3OUSA 1OCCC 3SPJA 1JQ0A 4WF9V 2EIJB 3ABMC 1F4MA 2QTOA 1NQTA 1NR7A 4JPRA 4G2KA 1YI2V 3ASNC 1KD1W 5H9CA 2ZR2A 1DLBA 3CXCU 1AR1B 1K97A 4F4LA 2JJ2G 4P2ZA 4MVZA 1FFTB 2DYRB 2Z5UA 3CCMV 2WSSG 2HJFC 1UJWB 4ASUG 1SETA 5L3EA 1VQKV 1K73W 1CP9A 2ZXWC 5L3BA 2HVJC 4FK5C 4WCEV 1K5SA 3E8GA 3ML0A 4MVQA 1KECA 1ZWIC 4BIZA 2UXXA 4X89A 3OGCC 1RM1B 3CC7V 3ABKC 1F51A 2GSMB 2JJ1G 2WWWA 2P6JA 1KP2A 3VBBA 1VQLV 2IJJA 2EINB 3P30A 3ZRWA 5LHHA 3AG3C 1OCRC 4GX1A 3D3IA 5IY5B 2XNDG 3ZRSA 3X2QC 1I5YA 2EIMC 4GX2A 3OW2U 1SRYA 1VQ9V 3MHSC 1AI6A 4UUJC 2OTJV 5B1BB 5CBGA 4RO2A 3JYCA 1V54C 3OAAG 4GT1A 2WLJA 2HVKC 3FYIB 2IU3A 1COWG 2H94A 3DGEA 1FXKC 5KUKA 2A0LA 1YTFD 2ATKC 3T2MA 1PNKA 1GKFA 4TWKA 2EIKB 1L1FA 3T4DA 4HYOA 4H37A 2WLLA 2HKOA 3CYOA 4RQFA 1I5XA 5HFMA 3A0RA 3BY6A 1S76D 4UVAA 3FB5C 3OEEG 5J9PC 1AI7A 1LNQA 2IJHA 1PKXA 3CCUV 1SZTA 1M57C 4WFEA 5B3SC 4KFMA 4FPPA 1S5HC 3UKMA 4ZBMA 3AG1C 4DXWA 3GB7C 1AJQA 1YSCA 2IH1C 3EFFK 3QO5A 4JAVA 1OCOC 1AROP 3W7XA 1AJPA 2KB1A 1DF4A 3SPHA 1THZA 2NNUA 1QR9A 2QM7A 3I55V 5FL7G 1QLEC 1NJIW 4PA4A 5GW7A 1FXHA 1Q86W 5CMUA 1KKDA 1PD3A 4N21A 3MD0A 1DTOA 2WLIA 3IFXA 1VQPV 2DYSB 1H2GA 2DWDC 4UXNA 3LSQA 3RBZA 1VQ7V 4X8AA 3ABTA 3W7UA 2EILC 1FXKA 3LDEA 2EIJC 2DW4A 1GM7A 4UVBA 2WLMA 4JAUA 1G4YB 3ZIAG 4LP8A 4MSWC 2K1EA 4R6ZA 1RPOA 3E35A 5EC2C 4XDLA 4JGSA 2LFRA 2DYRC 3RW0A 2Q67A 2WLNA 3VOUA 1GM8A 5CBFA 3CPWU 2X6BA 2IJKA 1S0VA 1Y4MA 1K34A 1RPRA 3K08A 3OMNB 4PDMA 1P7BA 3GWOA 4J9YB 2V1DA 4LBEC 3IGAC 5E1AC 5LHGA 3CCVV 2D3OW 1S72V 1E1QG 3QO8A 2QM8A 2XAHA 1RM1C 2QKSA 4MTFA 3G4SV 4PDLA 1F23A 3CC4V 3SYOA 1CPYA 4G28B 2EINC 1PL0A 1H38A 1Q81W 3G71V 3P32A 1JVMA 2IH3C 4JF3A 1N8RW 3R65A 3W7SA 5IY5C 1VQ4V 2DQ3A 2W6IG 4MVUA 1NVPD 1AI5A 5HFLA 3CP1A 3FKSG 3CCQV 1W2BU 3ZMSA 1K5QA 3HB3B 3RVZA 1OZ0A 2V7QG 3IC7A 4PA6A 2DQ0A 2X6AA 5EC1C 5CN0A 2IW5A 4XBFA 3T1CA 3ZMUA 3ZCCA 2Z3YA 2EZOA 1ROPA 2Y48A 3JCZA 3LDCA 2EIKC 4JASA 3CMEV 1M56B 3HPLC 4TT3G 4QE7A 5DM6V 1BMFG 3FB8C 1Y66A 2M7WA 3JD1A 3STLC 4DO2A 1WPXA 1OCZB 5DN6G 3K9AA 4MW3A 5LGUA 2A9HA 1NH2B 4UV8A 1FS0G 1VQMV 3SYPA 1EFRG 3LNMB 4FJCC 3TK1A 4EKWA 2JDIG 4QNHB 3F7VC 4GX0A 2ZR3A 3CMAV 3ETGA 3LSSA 4JTDB 5BZBA 1MOFA 3DTUB 2Y69B 3K04A 4WFFA 1K4DC 2P67A 3CC2V 3QNEA 4WFBV 5IDJA 2IU0A 3TCUA 1H8EG 1S77D 2MK3A 4RUFA 2XAFA 2EBOA 3OMAB 4FIPC 3CD6V 2ZQMA 2X7RB 4R8CA 2AHZA 2GHYA 1G8MA 2FTKA 3LDDA 1YIJV 2LFSA 3ABUA 2WPDG 3AG2B 3K79A 3OE7G 1JCHA 4JYBA 2DYSC 1QLNA 3E86A 2WLHA 3STZC 2NLJC 4I9WA 1V55B 4Z1MG 3OR7C 2ZDIC 5IYCO 2QEXV 1F4NA 3OUFA 2EZPA 3E2EA 3AEIA 3JD3A 5H6RA 4HZ3A 3K0GA 1YJWV 4J9ZB 3E8FA 5IYBO 3G6EV 1R6KA 3KG2A 2OTLV 1QBZA 3SYAA 2B1GA 1VQ8V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q67 A;  2ZD9 A;  2WLN A;  2ZXW C;  3LUT B;  3VOU A;  5CBF A;  2HVJ C;  4WFG A;  3SPI A;  3TET A;  2X6B A;  2WLK A;  4LCU C;  2Q6A A;  1J95 A;  3E8G A;  2BOB C;  3SYC A;  3FB6 C;  4MVQ A;  3K08 A;  2BOC C;  4PDM A;  1P7B A;  1ZWI C;  1R3K C;  1K4C C;  4J9Y B;  3IGA C;  4LBE C;  3E8B A;  4MTO A;  4OXS A;  5E1A C;  4X89 A;  3OGC C;  3ABK C;  2QKS A;  4MTF A;  4PDL A;  4PA9 A;  3SYO A;  3K06 A;  2EIN C;  4G28 B;  3AG3 C;  4MTG A;  1OCR C;  1JVM A;  2IH3 C;  4GX1 A;  3R65 A;  3SPC A;  3ZRS A;  5IY5 C;  2ITD C;  3X2Q C;  2EIM C;  4GX2 A;  4MVU A;  5EK0 A;  4RAI A;  4PDV A;  5EBW C;  2Q68 A;  3ABL C;  4UUJ C;  2ITC C;  3BEH A;  4XDK A;  2OCC C;  2WLI B;  4MVR A;  5CBG A;  4RO2 A;  4RUE A;  3RVZ A;  3E89 A;  3JYC A;  1V54 C;  3ASO C;  2WLJ A;  4PA6 A;  2HVK C;  2X6A A;  5EC1 C;  3T1C A;  4BW5 A;  4P9P A;  5KUK A;  2A0L A;  2H8P C;  3OR6 C;  5CBH A;  2ATK C;  3T2M A;  1R3L C;  4TWK A;  4H33 A;  3K03 A;  3LDC A;  2EIK C;  3AG4 C;  4HYO A;  4R7C A;  5EBL C;  3T4D A;  2WLL A;  3UM7 A;  1BL8 A;  3HPL C;  2X6C A;  1M56 C;  4QE7 A;  3SPG A;  3FB8 C;  3STL C;  2W0F C;  2AHY A;  3FB5 C;  4MVS A;  3SJQ C;  4PDR A;  4MW3 A;  1OCZ C;  5J9P C;  2A9H A;  1LNQ A;  5EBM C;  3SYP A;  4CBC A;  2A79 B;  3LNM B;  1XL4 A;  4EKW A;  4PA3 A;  4QNH B;  5KUM A;  3F7V C;  4GX0 A;  5B1B C;  1M57 C;  3E83 A;  4P9O A;  2YEV A;  4WFE A;  5B3S C;  4KFM A;  3PJS K;  4JTD B;  1S5H C;  4JTA B;  5BZB A;  3UKM A;  4ZBM A;  3AG1 C;  3K04 A;  4WFF A;  1XL6 A;  2Y69 C;  3GB7 C;  2IH1 C;  2DWE C;  4DXW A;  2P7T C;  3F7Y C;  4XDJ A;  3EFF K;  1K4D C;  3WG7 C;  3FB7 C;  1OCO C;  2HG5 C;  4WFH A;  2KB1 A;  2JK5 C;  3SPH A;  2Q69 A;  3F5W C;  3K0D A;  4JTC B;  3TCU A;  4MVO A;  4RUF A;  4X88 A;  4MS2 A;  4GX5 A;  1QLE C;  4MVM A;  4PA4 A;  1R3J C;  2HFE C;  2R9R B;  2AHZ A;  4R50 A;  4R8C A;  1KKD A;  3LDD A;  2WLI A;  3IFX A;  3AG2 C;  2DWD C;  2DYS C;  4PA7 A;  3RBZ A;  3E86 A;  4X8A A;  4P30 A;  3T4Z A;  2WLH A;  5B1A C;  2EIL C;  3RVY A;  1R3I C;  3STZ C;  3LDE A;  1OCC C;  2NLJ C;  3OUS A;  3SPJ A;  3ABM C;  4I9W A;  3SYQ A;  2EIJ C;  2QTO A;  2WLM A;  1V55 C;  3OR7 C;  3ASN C;  1G4Y B;  3OUF A;  4LP8 A;  4MSW C;  1ORQ C;  2K1E A;  4R6Z A;  4F4L A;  3ZJZ A;  4P2Z A;  4G27 B;  3E8H A;  3K0G A;  4HZ3 A;  4MW8 A;  4QE9 A;  4J9Z B;  3E8F A;  4MVZ A;  4XDL A;  5EC2 C;  2WLL B;  3KG2 A;  2DYR C;  3RW0 A;  4H37 A;  3SYA A;  2HJF C; 
#chains in the Genus database with same CATH topology
 1AB3 A;  2PI5 A;  2ZD9 A;  1R6T A;  3B4S A;  1R6N A;  2QWO B;  1SES A;  4NTY A;  2Q6A A;  1J95 A;  1V54 B;  4UCU A;  4X1K B;  2BSK B;  4YXW G;  4MTO A;  2YEV B;  4O2A B;  3U10 A;  3JAK A;  1J5E O;  4GCZ A;  4PA9 A;  1M9N A;  2P90 A;  1BCC H;  4NYK A;  3K5O A;  4NVP A;  1XI1 A;  1YJN V;  3K58 A;  2ADP A;  1HW7 A;  5IWA B;  2EUL A;  1O9H A;  2GBO A;  3JSL A;  1VF5 B;  1JX9 A;  2VRZ A;  4JI6 O;  4BIO A;  1JR9 A;  3OD4 A;  1VIB A;  2AW9 A;  4NB5 A;  4QPK A;  1SQV H;  2DMX A;  4LNU A;  1Q8I A;  4B7K A;  4DR2 O;  1KC8 W;  3P3P A;  2W0X A;  1OCZ C;  4J80 A;  4LF4 O;  2F93 B;  3U11 A;  1NTK H;  1KBH A;  2YUA A;  2KG7 B;  4E2L A;  2Y69 C;  3WG7 B;  2Q4P A;  2QWQ B;  1QCE A;  3F5W C;  4JTC B;  3ZRW B;  4B3M O;  4DR5 O;  2CTR A;  1VQ5 V;  3K9S A;  1I94 O;  1VP7 A;  1K9M W;  1VQ6 V;  1H8H G;  4P30 A;  5B1A B;  1NR1 A;  3T4Z A;  3ZMZ A;  1FKA O;  1OCC B;  3RVY A;  3IAY A;  3FYE B;  2HLD G;  1PNM A;  1FJG B;  3SYQ A;  1FAF A;  3CCS V;  2CAZ C;  2N74 A;  2QA4 V;  1YJ9 V;  4ABM A;  3RYI B;  1ORQ C;  3UCS C;  2QE7 G;  3ZRX A;  1WLE A;  4MW8 A;  1M5I A;  3CCR V;  4U7N A;  4WFG A;  2P4V A;  4BAY A;  1VQO V;  3FB6 C;  5GTH Z;  1FPO A;  2YXH A;  4HAM A;  4LH6 A;  3APQ A;  3WB2 A;  1IDS A;  5L3G A;  1N0J A;  4LF8 B;  5FPO A;  3CS5 A;  1OCR B;  2YC0 A;  3C3T A;  4MTG A;  4FLZ A;  4X1Y A;  1E79 G;  5CA1 B;  1FYJ A;  2CH7 A;  1B06 A;  5EBW C;  5EK0 A;  5EYP B;  3JAW B;  2WLI B;  1SQX H;  3E89 A;  4TUY A;  5H5N A;  1H2N A;  1SER A;  3WB0 A;  1Q43 A;  2H8P C;  3L73 H;  4O4I B;  5IYD O;  4O2B A;  4H33 A;  2V4D A;  3K57 A;  1YXB A;  5B1O A;  1K7D A;  3B8M A;  4OGQ B;  4DW1 A;  2W0F C;  2E5L B;  2AHY A;  4MVS A;  1NZ6 A;  3EXA A;  4I0X A;  2Z0A A;  5B3S B;  3MHH C;  4CH5 A;  2Y0P A;  4HBN A;  5LHI A;  2C2A A;  4MTX A;  2R9I A;  3WG7 C;  1HNX B;  2HG5 C;  4ZOL B;  3T1H B;  2B5U A;  4FLV A;  4MVO A;  1XUQ A;  3WFV A;  2F4V B;  2CDY A;  2HFE C;  3CHX A;  3RYH B;  4UV9 A;  4J42 A;  1A32 A;  3JAT A;  4KHP O;  1VF6 A;  5B1A C;  3OUS A;  1OCC C;  4WF9 V;  1NT2 B;  1EM1 A;  1IBL O;  1NR7 A;  1GRJ A;  2N05 A;  4JPR A;  1YI2 V;  2ILM A;  2GTA A;  2PYJ A;  1S5L Z;  1FFT B;  4D7T A;  4X64 O;  2Z5U A;  2WSS G;  2HJF C;  4JI5 B;  4HNA A;  5L3B A;  1MSD A;  2HHH O;  3IC9 A;  1K5S A;  3ML0 A;  5LYJ B;  4MVQ A;  3E22 B;  1ZWI C;  2ZE6 A;  1RM1 B;  3CC7 V;  4DV6 B;  2ZT9 B;  4DR3 O;  2ZNJ A;  1JFF A;  5LOV B;  1OCR C;  2IBZ H;  2UUC O;  2XND G;  2NR5 A;  1SC5 B;  4UUJ C;  2VWK A;  5CBG A;  4GT1 A;  2HVK C;  2VQF B;  2IU3 A;  1COW G;  1BT8 A;  4JI8 B;  1EZV H;  1D5A A;  2ATK C;  3OGI B;  4DUZ B;  1Q90 D;  1GAX A;  2WLL A;  2HKO A;  3CYO A;  5HFM A;  3APO A;  3A0R A;  3BY6 A;  2P22 C;  4X65 O;  4FLY A;  3OEE G;  4FFB B;  4AI8 A;  4PI0 A;  1WN7 A;  1P7G A;  3C90 A;  5B3S C;  3RGB A;  4GKJ B;  1VF6 C;  3GB7 C;  1AJQ A;  2IH1 C;  3KCY A;  4DV4 B;  4JAV A;  5JJJ B;  1XNR O;  2KB1 A;  3SPH A;  1THZ A;  2BE3 A;  4ZI7 A;  3D8C A;  2QM7 A;  1MZF A;  5GW7 A;  2Q0A A;  5LMN O;  3UO2 A;  2QKC A;  5JVD A;  3MD0 A;  1DTO A;  4F6R B;  1H2S B;  4O4H A;  2DYS B;  1H2G A;  2DWD C;  2P06 A;  3W7U A;  2G38 A;  2UUA B;  5EZY A;  2UU9 B;  5KX5 B;  4EB6 A;  4JI7 O;  3K5L A;  3RW0 A;  1X59 A;  1ZTE A;  2KKW A;  4LWS B;  2IM9 A;  2VQE B;  2YIC A;  1S0V A;  1Y4M A;  1K34 A;  1RPR A;  3H1L H;  1SKV A;  4IL6 Z;  1P7B A;  3GWO A;  2AZ2 A;  3IGA C;  5LHG A;  1URF A;  4GKK O;  2QM8 A;  1RM1 C;  4RWU A;  2Q9L A;  4G28 B;  5LP6 B;  1H38 A;  5ITZ B;  1BSM A;  1JVM A;  3R65 A;  1VQ4 V;  2E76 B;  2UXD O;  1W2B U;  4FM1 A;  3ZMS A;  3Q4H B;  1Q5O A;  3RVZ A;  4NXN B;  3QF7 A;  4PA6 A;  5EC1 C;  1TUB A;  3T1C A;  3TXS A;  5LMU B;  2AGA A;  3CSX A;  3CME V;  2HP8 A;  1BMF G;  4J7J A;  1WPX A;  5DN6 G;  1TGO A;  2PUS A;  4UV8 A;  1EFR G;  3TK1 A;  1JA8 A;  2ETN A;  2JDI G;  1KMI Z;  4JV5 B;  3CMA V;  3LSS A;  5BZB A;  1AP5 A;  1Z2G A;  1XOU A;  2BCC H;  5IDJ A;  4Q6G A;  2IU0 A;  1YDX A;  1S77 D;  1ZX3 A;  2EBO A;  1WAZ A;  2AHZ A;  2PY5 A;  5KHG A;  4DV3 B;  3ABU A;  1HNW B;  3OE7 G;  1GH6 A;  3RT3 C;  2DYS C;  4JI2 O;  2NLJ C;  3THO A;  4LFB O;  3KCX A;  1V55 B;  4Z1M G;  4D7S A;  3CEI A;  3OUF A;  4CH6 A;  2QM4 A;  4JAA A;  3SJC C;  4PJ0 Z;  3T1Y O;  2PYL A;  3KG2 A;  2OTL V;  1GO3 F;  2OYQ A;  1HWY A;  2ODM A;  1KKC A;  5LGN A;  1DGS A;  1R3K C;  1K4C C;  3E8B A;  1IXB A;  1YCI A;  3VQW A;  2JIZ G;  4NTX A;  5LP6 C;  2A7W A;  1AP6 A;  2ARH A;  2ITD C;  4B3T O;  2JEU A;  3J7A U;  3CRM A;  4RAI A;  1M90 W;  3A0H Z;  5IT9 N;  5D5P A;  1GK9 A;  2LO1 A;  4X62 B;  1R73 A;  2OCC B;  3EVK A;  3BRC A;  5LXT A;  2JS5 A;  3CCE V;  4BW5 A;  4P9P A;  1ZLZ A;  3QTC A;  3ETD A;  4JI0 B;  3AG4 B;  5D5Q A;  4R7C A;  3F5T A;  2Y0I A;  1H2M A;  4GYC B;  2X6C A;  5GON A;  1K3E A;  4DYL A;  4FMT A;  2CTW A;  1I7F A;  5K1P A;  2A79 B;  4DR1 O;  5KUM A;  5B1B C;  3EHB B;  4K8X A;  4DR6 B;  4J7Z A;  1G1X B;  4I50 B;  2JK5 C;  1Y76 A;  2QKA A;  3JD4 A;  3QO7 A;  1YEW A;  1XMO O;  3SJB C;  3N27 A;  2UXB B;  1R3J C;  2R9R B;  1Q3E A;  3HKC A;  4BIU A;  1WP8 A;  1IXM A;  3UT5 B;  2ADQ B;  1I94 B;  1JPX A;  2YXL A;  1PL4 A;  1ZSP A;  2FYU H;  4PA7 A;  4I55 B;  1V55 C;  5BXZ A;  3B77 A;  2JGD A;  2Q7H A;  5C8Y B;  1Y6X A;  4G27 B;  1B6Q A;  1SA0 A;  1WB8 A;  3W7T A;  4WFA V;  1VQN V;  4DV2 O;  1P4R A;  3HKD B;  4FFK A;  3SPI A;  3HKB A;  1L0N H;  1YIT V;  4TV8 A;  4YJ3 B;  3ABK B;  4IHJ B;  4DRX A;  3OMI B;  2ZIM A;  3ZN0 A;  4X1I A;  1N36 B;  3D36 C;  1ZL8 B;  1K92 A;  2JEX A;  5KA6 A;  1TVK B;  1YHQ V;  1OHH G;  4DK1 A;  1NVP B;  3W7W A;  1QHT A;  4DV1 B;  4X66 B;  3PN1 A;  1IX9 A;  2XOK G;  1LUW A;  3CJH B;  2OCC C;  4MVR A;  4JI4 O;  3RYC A;  5DEC A;  4TSF G;  1W0K G;  4N23 A;  4DUY B;  2LGW A;  4KL1 A;  2CK3 G;  1FXK B;  3HKE B;  5CA0 A;  3OR6 C;  5F2V O;  1K33 A;  2LW1 A;  3AG4 C;  1BGY H;  5AG2 A;  1AIL A;  4BR6 A;  3H1J H;  2XAS A;  4PDR A;  1H2L A;  4UVC A;  4GZR B;  2VS0 A;  1KP3 A;  4U3J B;  1HR0 B;  4LC1 A;  2X0L A;  2BSK A;  3E83 A;  4O2A A;  2YEV A;  4CS4 A;  1NKD A;  3BAB A;  1NTZ H;  2W6J G;  1XL6 A;  2YI8 A;  4XDJ A;  2BTQ B;  3OFN G;  3JD2 A;  4WFH A;  4DR4 B;  4X88 A;  2UXC B;  4ZHQ B;  1NBM G;  1M1K W;  3H01 A;  1GMG A;  1YZB A;  4PI2 A;  5JJN B;  2XAJ A;  1D2D A;  4TV9 B;  1CEZ A;  4Q20 A;  1K8A W;  1PM9 A;  3SPJ A;  2ZIO A;  4H13 B;  1F4M A;  4K35 A;  4G2K A;  3VQV A;  1K97 A;  4F4L A;  2JJ2 G;  4P2Z A;  4MVZ A;  2DYR B;  4JI1 B;  1NI8 A;  1QQC A;  1VQK V;  1RFY A;  1K73 W;  1KU9 A;  2CE4 A;  1VF7 A;  1N34 O;  3M7M X;  4DR7 O;  3DC5 A;  4FK5 C;  1XHZ A;  2KG7 A;  4BIZ A;  5FLX N;  5J2T B;  3ABK C;  3MAQ A;  3N2G B;  1KP2 A;  5FNV B;  3VBB A;  1VQL V;  4LF5 O;  1T5E A;  1Y74 B;  4LF9 O;  2AXT Z;  3ZRW A;  2UUC B;  4GX1 A;  4LF7 B;  4CH4 A;  4GX2 A;  3OW2 U;  1VQ9 V;  1AR5 A;  5H2F Z;  1AI6 A;  2OTJ V;  2QR4 A;  3CX5 F;  4RO2 A;  1V54 C;  1YF2 A;  3FYI B;  3TJT A;  2H94 A;  2ZM6 O;  3DGE A;  1FXK C;  5KUK A;  2AZ0 A;  3RYI A;  3T2M A;  5A9G A;  4DV5 O;  1RP3 B;  4TWK A;  4TOI A;  2EIK B;  1L1F A;  3AK2 A;  4PD4 F;  2ZE5 A;  2FKX A;  1I5X A;  4X65 B;  3N2K B;  1OV9 A;  4UVA A;  3JAL B;  4K0K B;  1AI7 A;  5KMG B;  3LSU A;  3DC6 A;  4CS3 A;  3JAR B;  4FPP A;  4B3S O;  4JI3 O;  3UKM A;  1X4T A;  1YSC A;  1Y67 A;  1G6U A;  3O9O A;  2O57 A;  3S3X A;  3H1H H;  4JYA O;  1TA8 A;  5CA1 A;  2OCH A;  2QJ1 A;  1NJI W;  3JAW A;  1KKD A;  4N21 A;  2WLI A;  3IFX A;  4UCT A;  4UXN A;  1VQ7 V;  3RYF A;  3OTF A;  4E4E A;  3LDE A;  3JCU Z;  4O4I A;  2WLM A;  1G4Y B;  4LP8 A;  4R6Z A;  3CRC A;  5K1X A;  5EC2 C;  1YVW A;  4XDL A;  4NXM B;  2DYR C;  2WLN A;  5CBF A;  2X6B A;  4YJ2 B;  2GDS A;  3SR2 C;  5IWA O;  1XQ8 A;  1E1Q G;  4B3R B;  3G4S V;  4PDL A;  2EJ7 A;  4ZOL A;  4X9Q A;  5IYZ B;  1P84 F;  1Q81 W;  3G71 V;  3P32 A;  4JF3 A;  2IH3 C;  5KAF Z;  1B04 A;  2UUB B;  2D2C B;  3RYH A;  2QDO A;  3CCQ V;  3BAA A;  1K5Q A;  4YY3 B;  3AG7 A;  2V7Q G;  3K5N A;  3IC7 A;  4JYY A;  2X6A A;  1XBL A;  5KHK A;  5LL6 Y;  2Y48 A;  3JCZ A;  2PGG A;  3LDC A;  2EIK C;  5J2U A;  3IJ4 A;  1M56 B;  3HPL C;  5DM6 V;  4QE7 A;  2R72 A;  3FB8 C;  2M7W A;  3JD1 A;  3STL C;  2L35 A;  3K9A A;  1JMK C;  3G80 A;  1NH2 B;  1VQM V;  4I4T B;  2JVD A;  1SQG A;  5LYJ A;  4QNH B;  3E22 A;  3F7V C;  4EEQ A;  4AHC A;  4EFB A;  1MOF A;  1FJG O;  4LR3 A;  5LOV A;  3QNE A;  1H8E G;  3DXR B;  1O9G A;  1N32 B;  2XAF A;  3OMA B;  3CD6 V;  1HNZ O;  2FTK A;  3LDD A;  4J10 A;  2LFS A;  2WPD G;  2LW7 A;  4ICG A;  4JYB A;  3ZHV A;  2R70 A;  3STZ C;  4IIJ B;  2RN9 A;  3OR7 C;  2ZDI C;  2QEX V;  5JH7 B;  2EZP A;  3AEI A;  4LF8 O;  4HZ3 A;  1SS3 A;  3BHP A;  3K0G A;  1WNS A;  2QWP B;  1R6K A;  1QBZ A;  4FFB A;  2B1G A;  1VQ8 V;  4PEL A;  1FFX B;  3LUT B;  5LBQ A;  1WA8 B;  3P3N A;  3OTO O;  4L87 A;  4I5S A;  2BOC C;  1N0N A;  4U7O A;  4OXS A;  5KLV H;  3ZHU A;  3H1K H;  1VEW A;  1KUQ A;  1WP7 A;  1BS3 A;  2KSD A;  1VMG A;  2QWR B;  4QGP A;  2YS8 A;  3BVO A;  2PF4 E;  2E5L O;  2UXN A;  2OT5 A;  4F6R A;  4LF6 B;  2ITC C;  3BPZ A;  3BEH A;  3JAS B;  4XDK A;  1NH2 D;  4JYC A;  1US6 A;  4NR1 A;  3RWR D;  1MNG A;  2B1I A;  3ASO B;  5BR8 B;  1XNQ O;  4DV0 B;  1XMQ O;  2F95 B;  3B09 A;  5CBH A;  5KX5 A;  2E3C A;  3K03 A;  1HNX O;  3T1H O;  1PNL A;  1M56 C;  3MDS A;  5IJ9 B;  3SDL A;  2F4V O;  2A3Q A;  4CS2 A;  2OWO A;  2EJR A;  5JJE B;  4WBN B;  2F43 G;  2N04 A;  4JTA B;  3L71 H;  4LH7 A;  2YXY A;  5LP6 A;  4OX9 B;  3QG5 A;  5LGT A;  5ITZ A;  3VQX A;  2IJI A;  2YSU B;  2XAG A;  1JOY A;  4MS2 A;  1ZUQ A;  4MVM A;  4UCS A;  4CC5 A;  1Q6I A;  2JRI A;  4JI5 O;  1FXV A;  3Q4H A;  5GTI Z;  4Z2W A;  4LFC B;  3ABM B;  3ZMT A;  1ENV A;  2RJZ A;  3OM3 B;  4QJF B;  4DV6 O;  3ASN B;  4DV7 B;  1L0L H;  3ZJZ A;  1Q82 W;  1U96 A;  2YI9 A;  4QE9 A;  3ETE A;  5JQG B;  1XEQ A;  4DV2 B;  2ZXW B;  4H0L B;  4YHH B;  3TET A;  3I56 V;  4LCU C;  4LFA O;  4O4L B;  1BHB A;  4BW9 A;  1WPB A;  1BE3 H;  1WJZ A;  2VQF O;  4JI8 O;  3JD0 A;  1B3Q A;  3SPC A;  2EIM B;  2GUZ B;  2PI4 A;  4PDV A;  2Q68 A;  5IE9 A;  5CB4 B;  3ZED A;  2ZCE A;  2ZE8 A;  3ASO C;  1J5E B;  1GN3 A;  3CCL V;  4GKJ O;  3ZHR A;  3A2F A;  4IYH A;  1MSW D;  1UPG A;  3UM7 A;  1BL8 A;  3SPG A;  1SZX A;  3FFQ A;  5EBM C;  4B7E A;  2LQT A;  1BZK A;  3B8N A;  1NS1 A;  2F23 A;  1YTF B;  3U0Z A;  1DF5 A;  2CTQ A;  2UUA O;  3D36 A;  4QIW F;  1TUE B;  1P49 A;  3QVN A;  2UU9 O;  4JI6 B;  2P7T C;  3F7Y C;  1W0J G;  1OCO B;  3FX7 A;  2VWJ A;  4UB8 Z;  3G6B A;  1MMM A;  4KUM A;  1M4U A;  4DR2 B;  2RNB A;  1QLE B;  1QVG U;  4KP4 A;  4BWA A;  2M6Y A;  4PV1 B;  4LF4 B;  2VQE O;  1S3J A;  1SQF A;  3NXS A;  5BMV B;  1JQ0 A;  3ABM C;  3ASN C;  3ETQ A;  2ZR2 A;  5H9C A;  3ZS8 C;  4IYI A;  4B3M B;  2P4K A;  4DR5 B;  3UO3 A;  4JZG A;  4ASU G;  1SET A;  5L3E A;  1CP9 A;  2ZXW C;  3UQ8 A;  5DED A;  3CRR A;  3TXQ A;  1AR4 A;  1IBM O;  5JCO C;  2UXX A;  3JSN A;  2ZKO A;  5LMU O;  2GSM B;  2WWW A;  4I50 A;  2P6J A;  2MW2 B;  4O4J B;  4AQY O;  2EIN B;  2JGU A;  3WB1 A;  5LHH A;  1V9P A;  3D3I A;  1RSO B;  3ZRS A;  2CGO A;  3FAV B;  1I5Y A;  5LA6 B;  2EIM C;  3UT5 A;  5B66 Z;  1SRY A;  3MHS C;  3HR0 A;  3GWK C;  4I55 A;  4JV5 O;  3JYC A;  3OAA G;  3A0B Z;  5IJ0 B;  3S3W A;  1YTF D;  3J81 N;  1PNK A;  1IBK O;  5C8Y A;  1GKF A;  4X20 B;  1CXZ B;  1JJO A;  1Z5V A;  3CE2 A;  2RQ6 A;  1S76 D;  3HKD A;  3CCU V;  3CXH F;  1HNW O;  1GN4 A;  4WFE A;  4YJ3 A;  4KFM A;  4IHJ A;  1S5H C;  4ZBM A;  1ZL8 A;  3JAK B;  3QO5 A;  1OCO C;  1AJP A;  1PPJ H;  2NNU A;  3I55 V;  2HEP A;  1QLE C;  4YIO A;  1FXH A;  1IZ3 A;  1PD3 A;  3CJH A;  1VQP V;  3WU2 Z;  4NTW A;  3LSQ A;  3RBZ A;  4X1K A;  4AIL C;  1FXK A;  5E79 Z;  3HKE A;  1N33 O;  4JAU A;  1I08 A;  3ZIA G;  4MSW C;  2ZE7 A;  1D5N A;  2GV9 A;  4JGS A;  3NR7 A;  3L70 H;  4LNU B;  1IUR A;  2Q67 A;  4U3J A;  3VOU A;  1GM8 A;  2F66 C;  3CPW U;  4KHP B;  4X62 O;  4TQF A;  3OMN B;  2V1D A;  5E1A C;  1IBL B;  1S72 V;  3QO8 A;  2XAH A;  2QKS A;  1LUV A;  1OJH A;  2BTQ A;  2YIA A;  3K5M A;  1CPY A;  3CC4 V;  2EIN C;  4JI0 O;  5TIS Z;  2ZIN A;  4X64 B;  3W7S A;  2ZNI A;  2W6I G;  4ZHQ A;  3ZBH A;  4MVU A;  1NVP D;  5HFL A;  3FKS G;  2HHH B;  2YIB D;  3BFR A;  2DE0 X;  4TV9 A;  4PHZ A;  1N4C A;  2DQ0 A;  4DR6 O;  2IW5 A;  4UFZ A;  1SQP H;  2JS3 A;  4DR3 B;  3ZCC A;  2Z3Y A;  3CRQ A;  2EZO A;  1ROP A;  3AK1 A;  4J11 A;  2BTO A;  4JAS A;  1EN6 A;  4TT3 G;  1MZE A;  4DO2 A;  2UXB O;  4MW3 A;  2A9H A;  1NTM H;  4A5U B;  3LNM B;  4EKW A;  2F1M A;  2ZR3 A;  3ETG A;  5J2T A;  4JTD B;  3BA9 A;  3N2G A;  5FNV A;  3K04 A;  4WFF A;  1Y74 A;  4B08 A;  1Q6H A;  2P67 A;  3CC2 V;  2RCV A;  3TCU A;  4RUF A;  1HNZ B;  4FIP C;  3CB2 A;  2ZQM A;  4X1Y B;  4R8C A;  3KZI Z;  1G8M A;  2CH7 B;  4CH3 A;  1YIJ V;  3AG2 B;  3K79 A;  1JCH A;  1PV0 A;  4TUY B;  3SGI A;  1BQZ A;  5IYC O;  1N36 O;  1F4N A;  1XNR B;  1EN5 A;  3JD3 A;  1F7Y A;  4O2B B;  3N2K A;  2LJ2 A;  5IYB O;  3G6E V;  3JAL A;  3J80 N;  3SYA A;  3H1I H;  5LMN B;  5KMG A;  4DV1 O;  2PTM A;  5L3F A;  4X66 O;  5EYP A;  1LR1 A;  3JAR A;  3OTO B;  2LP7 A;  2WLK A;  4I0X B;  1EBO A;  2BOB C;  4TQD A;  4FZ0 A;  3RYF B;  2QSA A;  4DUY O;  1BQ0 A;  1EZJ A;  2WA4 A;  3ZX6 A;  3B2E E;  4JI7 B;  1AJN A;  5H6Q A;  3K3W A;  3ABL B;  3BA8 A;  2QWN B;  1BHA A;  1HR0 O;  3JAT B;  1XNQ B;  1XRE A;  3M8A A;  5BY1 A;  4GKK B;  1XMQ B;  1S5J A;  2ZDI A;  3ZN1 A;  2HR3 A;  1XHX A;  4GUN A;  1Q7Y W;  4D6T H;  1HP8 A;  2XAQ A;  4H44 B;  5EBL C;  2Y4T A;  4DR4 O;  4I7Z B;  2XHB A;  2DN9 A;  3M99 B;  4FVM A;  2UXC O;  3SJQ C;  2GTS A;  1KQS U;  2UXD B;  4DK0 A;  5C93 A;  4HNA B;  1GTO A;  2R9A A;  4PA3 A;  4YJ2 A;  4OPA A;  4U3F H;  4P9O A;  1MG1 A;  3L75 H;  1AI4 A;  2A06 H;  4W4L A;  5IYZ A;  5KHH A;  3FB7 C;  1MAB G;  3DSQ A;  1JFF B;  4QPJ A;  4NKG B;  2Q69 A;  5J2U B;  4GX5 A;  4JI1 O;  4R50 A;  3CCJ V;  1PP9 H;  4IGG A;  3AG2 C;  4RQE A;  3G67 A;  1R3I C;  1E1R G;  2EX3 A;  2H3O A;  3C3S A;  3ZRV A;  1JJ2 U;  3E8H A;  3L74 H;  4LF7 O;  2WLL B;  5CA3 A;  1GM9 A;  4MT8 A;  4I4T A;  4LFA B;  1QVF U;  4KXR A;  2PZS A;  3SYC A;  4JI2 B;  5L3D A;  1TAE A;  3B40 A;  5KA5 A;  4LFB B;  1I0H A;  4J41 A;  3K06 A;  2E75 B;  3T1Y B;  3AG3 B;  3DXR A;  3X2Q B;  4ZI7 B;  3ABL C;  4K0K O;  1Z5W A;  3ZMV A;  5JVD B;  4K3A A;  4RUE A;  4O4H B;  4IIJ A;  5L3C A;  1GN6 A;  5EZY B;  3ICX A;  2B9Z A;  5JH7 A;  1R3L C;  4CZZ A;  3OEH G;  1L8D A;  4DW0 A;  4B3T B;  4EB6 B;  1FFX A;  1NU1 H;  2Q7E A;  1WA8 A;  2WAM A;  2FL4 A;  4CBC A;  1QR8 A;  1XL4 A;  3LNN A;  1M57 B;  4ZKI A;  4JZ2 A;  3PJS K;  4UCV A;  2FB5 A;  3AG1 B;  4K8Z A;  3D3Q A;  2DWE C;  3RN4 A;  3H9V A;  1WB7 A;  3K0D A;  4J7K A;  4NXM O;  3BCC H;  4I9Q A;  3JAS A;  3CWB H;  4LWS A;  5KAI Z;  4DR1 B;  5B1N A;  5FPR A;  1ZAU A;  2OIG A;  2EIL B;  1SF9 A;  4OPH A;  2EIJ B;  3ZHQ A;  2QTO A;  1TUB B;  1NQT A;  4B3R O;  1KD1 W;  3CXC U;  1DLB A;  1AR1 B;  2FML A;  1XMO B;  5IJ9 A;  3CCM V;  2UUB O;  2XTA A;  1UJW B;  2RMK B;  4FLW A;  2HVJ C;  4WBN A;  2KQX A;  1IBM B;  4WCE V;  2P5O A;  3E8G A;  4YY3 O;  3A8T A;  1KEC A;  4X89 A;  3OGC C;  4AQY B;  1F51 A;  2JJ1 G;  3O65 A;  2IJJ A;  4UCO A;  2E74 B;  2XUM A;  3P30 A;  2LGQ A;  3AG3 C;  5IY5 B;  1UFI A;  2CGN A;  4FLU A;  3X2Q C;  1XIL A;  1DK1 A;  5B1B B;  3L9D A;  3R66 A;  2WLJ A;  2Q7G A;  1XDC A;  1IBK B;  2A0L A;  4DUZ O;  3K59 A;  1Q6U A;  3T4D A;  4HYO A;  5JQG A;  4RQF A;  5B5E Z;  1N32 O;  2QGN A;  3FB5 C;  3L72 H;  5J9P C;  1LNQ A;  2IJH A;  1PKX A;  3ZHT A;  4O4L A;  1SZT A;  4JI4 B;  3CRA A;  1M57 C;  5JCO A;  1U97 A;  3AG1 C;  4DXW A;  2Q8V A;  3EFF K;  1ARO P;  3W7X A;  1DF4 A;  4DV4 O;  3VQY A;  2GUZ A;  1QR9 A;  1EN4 A;  5FL7 G;  4PA4 A;  1Q86 W;  5CB4 A;  5CMU A;  3JAM N;  5KHJ A;  4X8A A;  1N33 B;  3ABT A;  2EIL C;  4EFE A;  5LXT B;  2EIJ C;  2DW4 A;  1GM7 A;  4UVB A;  1GN2 A;  2QTS A;  1SQB H;  1VAR A;  2K1E A;  1RPO A;  3E35 A;  2CUG A;  2LFR A;  4FLT A;  5GON B;  4LF6 O;  4FM2 A;  2IJK A;  5KHI A;  3K08 A;  5EIB D;  4PDM A;  4L8J A;  3KKY A;  4J9Y B;  4LBE C;  4FZ1 A;  2K9P A;  3CCV V;  4IT5 A;  5BR8 O;  2D3O W;  4DV0 O;  2DJV A;  4MTF A;  1F23 A;  3SYO A;  1PL0 A;  1N8R W;  1Y76 B;  5IY5 C;  3FD9 A;  2DQ3 A;  5JWP A;  4GLX A;  1AI5 A;  2HJD A;  2WA3 A;  1N34 B;  3CP1 A;  1M93 A;  4UCR A;  4DR7 B;  3HKC B;  2RDC A;  5EIB C;  1IVS A;  2YID A;  3AK3 A;  3GVM A;  3HB3 B;  5BMV A;  1OZ0 A;  4FLX A;  5CN0 A;  4XBF A;  4NXN O;  3ZMU A;  4FM0 A;  4W4K A;  4LF5 B;  4LF9 B;  4OX9 O;  1AVM A;  1R1B A;  2JGD B;  1QU7 A;  1QNM A;  2NN4 A;  4UB6 Z;  2OIE A;  1SA0 B;  4Z1V A;  1Y66 A;  2XT9 A;  1OCZ B;  5LGU A;  2Q73 A;  3RFR A;  1FS0 G;  3SYP A;  4YIP A;  4FJC C;  4GX0 A;  4F6E A;  3HKB B;  3SJA C;  1SQQ H;  4C7U A;  4TV8 B;  2ZM6 B;  4LFC O;  3DTU B;  4O4J A;  2Y69 B;  1FD9 A;  4DRX B;  4DV5 B;  3ZHS A;  1K4D C;  4X1I B;  2YDE A;  4CC6 A;  4WFB V;  1RSO A;  2Y4U A;  4DV7 O;  1W59 A;  2Q0O C;  3FAV A;  2MK3 A;  5LA6 A;  2X7R B;  2CTP A;  1HDJ A;  2GHY A;  1KYO F;  4YHH O;  4DV3 O;  1QLN A;  3E86 A;  1H2K A;  3OT7 A;  4B3S B;  2Q5Z A;  5IJ0 A;  2WLH A;  4ZIB A;  2DOS A;  3RYC B;  4JI3 B;  4I9W A;  2L6L A;  4X20 A;  5CA0 B;  3I5D A;  3TGU H;  1KB9 F;  3E2E A;  1TVK A;  4JYA B;  5H6R A;  5A2Q N;  1YJW V;  4J9Z B;  3E8F A;  1MA1 A;  2YIB A;  4H37 A; 
#chains in the Genus database with same CATH homology
 1GO3 F;  2PI5 A;  2ZD9 A;  4PEL A;  3LUT B;  5L3F A;  5LBQ A;  1R6N A;  2LP7 A;  1SES A;  2WLK A;  1EBO A;  2Q6A A;  1J95 A;  1HWY A;  1V54 B;  2BOB C;  4L87 A;  4I5S A;  5LGN A;  2BOC C;  1R3K C;  1K4C C;  4MTO A;  2YEV B;  4OXS A;  3E8B A;  4U7O A;  4YXW G;  4GCZ A;  2JIZ G;  4PA9 A;  1EZJ A;  1M9N A;  2P90 A;  1AJN A;  2ITD C;  5H6Q A;  3K3W A;  2JEU A;  4RAI A;  2UXN A;  3ABL B;  2OT5 A;  1M90 W;  2ITC C;  1GK9 A;  1BHA A;  3BEH A;  4XDK A;  1NH2 D;  1R73 A;  2OCC B;  4JYC A;  1YJN V;  2B1I A;  3ASO B;  2ZDI A;  3CCE V;  4BW5 A;  4P9P A;  3ZN1 A;  5CBH A;  3ETD A;  2HR3 A;  1JX9 A;  1Q7Y W;  3K03 A;  2XAQ A;  3AG4 B;  5EBL C;  4R7C A;  4QPK A;  1PNL A;  2X6C A;  1M56 C;  1KC8 W;  1K3E A;  3M99 B;  3SJQ C;  4FMT A;  1OCZ C;  1KQS U;  5C93 A;  2A79 B;  1GTO A;  2EJR A;  4PA3 A;  5KUM A;  5B1B C;  3EHB B;  4P9O A;  2F43 G;  1MG1 A;  1AI4 A;  4JTA B;  4E2L A;  2Y69 C;  5LGT A;  3WG7 B;  3FB7 C;  2IJI A;  1MAB G;  2JK5 C;  3JD4 A;  2YSU B;  4QPJ A;  1QCE A;  2Q69 A;  2XAG A;  3F5W C;  3QO7 A;  4JTC B;  3ZRW B;  1JOY A;  4MS2 A;  4GX5 A;  4MVM A;  1R3J C;  2R9R B;  4R50 A;  4BIU A;  1VQ5 V;  1IXM A;  3CCJ V;  1FXV A;  1JPX A;  3AG2 C;  1K9M W;  1VQ6 V;  4PA7 A;  1H8H G;  4P30 A;  5B1A B;  1NR1 A;  3T4Z A;  3ZMZ A;  4RQE A;  1OCC B;  1R3I C;  3RVY A;  1E1R G;  2HLD G;  1PNM A;  3ABM B;  1ENV A;  3FYE B;  3ZMT A;  3SYQ A;  3OM3 B;  4QJF B;  3CCS V;  1V55 C;  3ASN B;  3B77 A;  2QA4 V;  1YJ9 V;  1ORQ C;  3ZRV A;  2QE7 G;  3ZRX A;  3ZJZ A;  1Q82 W;  1JJ2 U;  4G27 B;  3E8H A;  1B6Q A;  4QE9 A;  1WLE A;  4MW8 A;  3ETE A;  3W7T A;  2WLL B;  3CCR V;  5CA3 A;  1GM9 A;  4WFA V;  1VQN V;  4MT8 A;  2ZXW B;  4U7N A;  1P4R A;  4WFG A;  1QVF U;  3SPI A;  3TET A;  3I56 V;  4LCU C;  4BAY A;  1VQO V;  3SYC A;  1YIT V;  3FB6 C;  5L3D A;  1BHB A;  5KA5 A;  3ABK B;  3OMI B;  4HAM A;  3ZN0 A;  3JD0 A;  5L3G A;  3K06 A;  1K92 A;  3AG3 B;  2JEX A;  1OCR B;  4MTG A;  5KA6 A;  1YHQ V;  1OHH G;  1NVP B;  3SPC A;  1E79 G;  3X2Q B;  3W7W A;  2EIM B;  5EK0 A;  5EBW C;  4PDV A;  2PI4 A;  2Q68 A;  3ABL C;  2XOK G;  3ZMV A;  2OCC C;  2WLI B;  4MVR A;  4RUE A;  3E89 A;  4TSF G;  1W0K G;  4N23 A;  3ASO C;  5L3C A;  1SER A;  2CK3 G;  1FXK B;  3CCL V;  2H8P C;  3OR6 C;  5IYD O;  1K33 A;  1R3L C;  4H33 A;  4CZZ A;  3OEH G;  3AG4 C;  1MSW D;  5B1O A;  3UM7 A;  1BL8 A;  1K7D A;  3B8M A;  3SPG A;  2W0F C;  2AHY A;  2XAS A;  4MVS A;  4PDR A;  4UVC A;  5EBM C;  2WAM A;  4CBC A;  1QR8 A;  1XL4 A;  1KP3 A;  4LC1 A;  1M57 B;  2X0L A;  3B8N A;  3E83 A;  2YEV A;  5B3S B;  4ZKI A;  3MHH C;  3PJS K;  1NKD A;  1YTF B;  1DF5 A;  5LHI A;  3D36 A;  3AG1 B;  4QIW F;  1TUE B;  2C2A A;  2W6J G;  1XL6 A;  4MTX A;  2DWE C;  2R9I A;  2P7T C;  3F7Y C;  4XDJ A;  1W0J G;  1OCO B;  3OFN G;  3WG7 C;  2HG5 C;  3JD2 A;  4WFH A;  2B5U A;  4KUM A;  3K0D A;  4MVO A;  4X88 A;  3WFV A;  1QLE B;  1QVG U;  2HFE C;  4KP4 A;  1NBM G;  4UV9 A;  1M1K W;  3H01 A;  1GMG A;  5B1N A;  2XAJ A;  1S3J A;  3NXS A;  1CEZ A;  2EIL B;  5B1A C;  4Q20 A;  1K8A W;  3OUS A;  1OCC C;  3SPJ A;  1JQ0 A;  4WF9 V;  2EIJ B;  3ABM C;  1F4M A;  2QTO A;  1NQT A;  1NR7 A;  4JPR A;  4G2K A;  1YI2 V;  3ASN C;  1KD1 W;  5H9C A;  2ZR2 A;  1DLB A;  3CXC U;  1AR1 B;  1K97 A;  4F4L A;  2JJ2 G;  4P2Z A;  4MVZ A;  1FFT B;  2DYR B;  2Z5U A;  3CCM V;  2WSS G;  2HJF C;  1UJW B;  4ASU G;  1SET A;  5L3E A;  1VQK V;  1K73 W;  1CP9 A;  2ZXW C;  5L3B A;  2HVJ C;  4FK5 C;  4WCE V;  1K5S A;  3E8G A;  3ML0 A;  4MVQ A;  1KEC A;  1ZWI C;  4BIZ A;  2UXX A;  4X89 A;  3OGC C;  1RM1 B;  3CC7 V;  3ABK C;  1F51 A;  2GSM B;  2JJ1 G;  2WWW A;  2P6J A;  1KP2 A;  3VBB A;  1VQL V;  2IJJ A;  2EIN B;  3P30 A;  3ZRW A;  5LHH A;  3AG3 C;  1OCR C;  4GX1 A;  3D3I A;  5IY5 B;  2XND G;  3ZRS A;  3X2Q C;  1I5Y A;  2EIM C;  4GX2 A;  3OW2 U;  1SRY A;  1VQ9 V;  3MHS C;  1AI6 A;  4UUJ C;  2OTJ V;  5B1B B;  5CBG A;  4RO2 A;  3JYC A;  1V54 C;  3OAA G;  4GT1 A;  2WLJ A;  2HVK C;  3FYI B;  2IU3 A;  1COW G;  2H94 A;  3DGE A;  1FXK C;  5KUK A;  2A0L A;  1YTF D;  2ATK C;  3T2M A;  1PNK A;  1GKF A;  4TWK A;  2EIK B;  1L1F A;  3T4D A;  4HYO A;  4H37 A;  2WLL A;  2HKO A;  3CYO A;  4RQF A;  1I5X A;  5HFM A;  3A0R A;  3BY6 A;  1S76 D;  4UVA A;  3FB5 C;  3OEE G;  5J9P C;  1AI7 A;  1LNQ A;  2IJH A;  1PKX A;  3CCU V;  1SZT A;  1M57 C;  4WFE A;  5B3S C;  4KFM A;  4FPP A;  1S5H C;  3UKM A;  4ZBM A;  3AG1 C;  4DXW A;  3GB7 C;  1AJQ A;  1YSC A;  2IH1 C;  3EFF K;  3QO5 A;  4JAV A;  1OCO C;  1ARO P;  3W7X A;  1AJP A;  2KB1 A;  1DF4 A;  3SPH A;  1THZ A;  2NNU A;  1QR9 A;  2QM7 A;  3I55 V;  5FL7 G;  1QLE C;  1NJI W;  4PA4 A;  5GW7 A;  1FXH A;  1Q86 W;  5CMU A;  1KKD A;  1PD3 A;  4N21 A;  3MD0 A;  1DTO A;  2WLI A;  3IFX A;  1VQP V;  2DYS B;  1H2G A;  2DWD C;  4UXN A;  3LSQ A;  3RBZ A;  1VQ7 V;  4X8A A;  3ABT A;  3W7U A;  2EIL C;  1FXK A;  3LDE A;  2EIJ C;  2DW4 A;  1GM7 A;  4UVB A;  2WLM A;  4JAU A;  1G4Y B;  3ZIA G;  4LP8 A;  4MSW C;  2K1E A;  4R6Z A;  1RPO A;  3E35 A;  5EC2 C;  4XDL A;  4JGS A;  2LFR A;  2DYR C;  3RW0 A;  2Q67 A;  2WLN A;  3VOU A;  1GM8 A;  5CBF A;  3CPW U;  2X6B A;  2IJK A;  1S0V A;  1Y4M A;  1K34 A;  1RPR A;  3K08 A;  3OMN B;  4PDM A;  1P7B A;  3GWO A;  4J9Y B;  2V1D A;  4LBE C;  3IGA C;  5E1A C;  5LHG A;  3CCV V;  2D3O W;  1S72 V;  1E1Q G;  3QO8 A;  2QM8 A;  2XAH A;  1RM1 C;  2QKS A;  4MTF A;  3G4S V;  4PDL A;  1F23 A;  3CC4 V;  3SYO A;  1CPY A;  4G28 B;  2EIN C;  1PL0 A;  1H38 A;  1Q81 W;  3G71 V;  3P32 A;  1JVM A;  2IH3 C;  4JF3 A;  1N8R W;  3R65 A;  3W7S A;  5IY5 C;  1VQ4 V;  2DQ3 A;  2W6I G;  4MVU A;  1NVP D;  1AI5 A;  5HFL A;  3CP1 A;  3FKS G;  3CCQ V;  1W2B U;  3ZMS A;  1K5Q A;  3HB3 B;  3RVZ A;  1OZ0 A;  2V7Q G;  3IC7 A;  4PA6 A;  2DQ0 A;  2X6A A;  5EC1 C;  5CN0 A;  2IW5 A;  4XBF A;  3T1C A;  3ZMU A;  3ZCC A;  2Z3Y A;  2EZO A;  1ROP A;  2Y48 A;  3JCZ A;  3LDC A;  2EIK C;  4JAS A;  3CME V;  1M56 B;  3HPL C;  4TT3 G;  4QE7 A;  5DM6 V;  1BMF G;  3FB8 C;  1Y66 A;  2M7W A;  3JD1 A;  3STL C;  4DO2 A;  1WPX A;  1OCZ B;  5DN6 G;  3K9A A;  4MW3 A;  5LGU A;  2A9H A;  1NH2 B;  4UV8 A;  1FS0 G;  1VQM V;  3SYP A;  1EFR G;  3LNM B;  4FJC C;  3TK1 A;  4EKW A;  2JDI G;  4QNH B;  3F7V C;  4GX0 A;  2ZR3 A;  3CMA V;  3ETG A;  3LSS A;  4JTD B;  5BZB A;  1MOF A;  3DTU B;  2Y69 B;  3K04 A;  4WFF A;  1K4D C;  2P67 A;  3CC2 V;  3QNE A;  4WFB V;  5IDJ A;  2IU0 A;  3TCU A;  1H8E G;  1S77 D;  2MK3 A;  4RUF A;  2XAF A;  2EBO A;  3OMA B;  4FIP C;  3CD6 V;  2ZQM A;  2X7R B;  4R8C A;  2AHZ A;  2GHY A;  1G8M A;  2FTK A;  3LDD A;  1YIJ V;  2LFS A;  3ABU A;  2WPD G;  3AG2 B;  3K79 A;  3OE7 G;  1JCH A;  4JYB A;  2DYS C;  1QLN A;  3E86 A;  2WLH A;  3STZ C;  2NLJ C;  4I9W A;  1V55 B;  4Z1M G;  3OR7 C;  2ZDI C;  5IYC O;  2QEX V;  1F4N A;  3OUF A;  2EZP A;  3E2E A;  3AEI A;  3JD3 A;  5H6R A;  4HZ3 A;  3K0G A;  1YJW V;  4J9Z B;  3E8F A;  5IYB O;  3G6E V;  1R6K A;  3KG2 A;  2OTL V;  1QBZ A;  3SYA A;  2B1G A;  1VQ8 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...