5JA4A

Crystal structure of human tonsl and mcm2 hbds binding to a histone h3-h4 tetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
b'STELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title H4K20me0 marks post-replicative chromatin and recruits the TONSL-MMS22L DNA repair complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ja4A00
5AVCC 4KUDD 1P3BD 2HIOC 3C1CA 2IO5B 1HQ3B 3AFAA 4J8VC 3AZFB 1P34D 3MGSD 1P3FD 5DNNA 5E5AB 3WA9C 1KU5A 2YFWA 2F8NH 3VH6W 5F99A 3WAAA 5CHLB 5AV6A 3LELC 4XZQC 4X23C 5BNXB 5B33A 3X1VB 2NZDD 5B32D 5B2JC 5AV9A 3C1BB 5AY8D 3KXBB 5B24C 1P3GB 4WV4B 5AV9D 4Z2MH 1P3LD 2FJ7C 1WWIA 3AN2D 3MGPB 4NE3A 3AZFA 4NFTA 1HQ3D 5C3IB 5AV5D 5B0YB 3AFAC 3B0DC 5E5AA 5E5AD 5DNNC 3LZ1B 1M18C 3UTBB 3W97D 3AZJB 5GSUD 3AZMB 5F99C 3WAAC 5AV6C 4KGCC 3W98A 3X1VA 2FJ7A 1P3PD 1ID3B 3C1BA 3AZLD 3KXBA 4YM6B 1P3GA 5B33C 4EO5C 3X1SB 3MGPA 5B40D 1M1AD 1JFIB 3B6FD 5G49B 5B1LB 3UTAA 3AZFC 5B0YD 3AZNB 3LZ1A 3UTBA 4XUJB 3AZJA 3MGQC 3AZMA 3AV2D 3UTBD 4JJNC 1ID3A 1A7WA 3AZJD 4YM6A 5CP6B 3W98C 3X1VC 1ID3D 4QLCA 3REHD 3LZ0D 3AZHD 1B67A 3C1BC 3REKB 3X1SA 3AV1B 3KXBC 3MVDA 1P3GC 1JFIA 5AVCB 3WTPB 5G49A 4WU8B 5B1LA 2HIOB 5B0ZD 3MGRC 3MGPC 3TU4C 3LJAC 5B1LD 3AZNA 3NQUB 5C3IC 4WNNB 3UTAC 5GT3D 1B6WA 1KX3A 1EQZA 3KUYC 5AV8D 4XUJD 3LZ1C 3AZMC 3LELB 5BNVB 1F66B 5CP6A 3REKA 4YM6C 3AZED 1AOIB 5B24B 4J8XB 1KX4D 4QLCC 3W96D 3AV1D 3REKD 3WTPA 4H9SA 4WU8A 3X1SC 1TZYD 2HIOA 1S32A 3MVDC 4KHAB 5AVCD 4WU9A 2HIOD 3KWQB 3R45A 4CAYA 3NQUA 5B32G 4WNNA 4YS3B 3B0DB 2HUEB 4J8VD 3AZNC 5B31B 3WA9D 3B6GB 1M18B 3MNNC 5BNVA 1KX3C 1EQZC 1F66A 5F99B 5AV6B 4KGCB 4ZUXB 4M6BA 3LELD 5CP6C 2L5AA 4XZQD 4X23D 1AOIA 4J8XA 2NQBB 5B2JD 3X1UC 5CPIB 5B24D 2AROB 3RELB 4KHAA 3WTPC 4H9SC 4WU8C 3KWQA 3AYWC 2FJ7D 1S32C 4YS3A 3AZIA 4WU9C 1M19C 3C1CD 5BT1C 1HTAA 5B31A 3AFAD 3A6NC 3B6GA 1M18A 3MGQB 3AZKA 4KGCA 5DNND 4ZUXA 1M18D 2F8NB 4JJNB 5F99D 3WAAD 5AV6D 1F66C 4KGCD 3W98B 2NQBA 5CPIA 4G91B 3VH5T 4R8PB 2AROA 1AOIC 5B33D 3RELA 4J8XC 3MGRB 3TU4B 3KSYA 3LJAB 3KWQC 4YS3C 2HUEC 3AZIC 3UTAB 3AZFD 3MGQA 5CPJA 3KUYB 5B31C 5CPKA 4WZSB 3VH6A 2F8NA 3B6GC 4JJNA 4NE6A 4LD9C 3AZKC 2F8ND 4ZUXC 4JJND 4J8WB 4R8PA 1U35B 3X1VD 3W98D 2NQBC 4QLCB 3C1BD 5CPIC 3KXBD 4J8UA 2AROC 3MVDB 1P3GD 3MGRA 3RELC 3TU4A 3WKJA 3LJAA 1P3FC 4H9PB 3MGPD 3TU4D 3LJAD 3KUYA 3UTAD 3MNNB 3KUYD 5CPJC 1KX3B 1EQZB 5AVBC 2NZDC 5KDMB 5CPKC 3LZ1D 3AZMD 2BYMB 4J8WA 1U35A 3O62B 2PYOD 3X1UB 4G91C 3AN2C 4YM6D 4R8PC 2YFVB 4QLCD 3X1SD 4Z66B 4J8UC 3MVDD 3AYWB 4H9PA 3REJB 1S32B 3WKJC 4WU9B 2BYKB 1M19B 4Z5TB 3R45B 4CAYB 4DRBA 3AZGB 3A6NB 3MNNA 3AZND 5B2IB 2PYOB 5KDMA 3AZLC 5BO0B 3MNND 1KX3D 2BYMA 4G92C 1EQZD 3O62A 3X1UA 1P3OB 4J8WC 5CP6D 1U35C 2YFVA 5GT0B 1P3MB 4Z66A 3AYWA 1KX5B 3REJA 1BH9B 1P3KC 3WTPD 4WU8D 2BYKA 3AYWD 1M19A 5DNMB 4Z5TA 5GXQA 3AZGA 1S32D 1ZLAB 3A6NA 4WU9D 3AZIB 1M19D 2F8NK 5BT1D 5B2IA 3UT9A 2PYOA 2CV5A 3W99C 3VH5W 4ZBJB 5BO0A 5JRGB 4LD9B 3AZKB 1P3AC 3X1TA 1P3OA 1F66D 3O62C 2RVQC 5GT0A 4KUDB 1P3BB 1BH8B 1P3MA 1ULYA 1KX5A 1AOID 5B1MC 1BH9A 4J8XD 1N1JB 2F8NG 1P34B 3MGSB 4Z66C 5DNMA 1P3FB 1ZLAA 1P3IA 3REJC 3KWQD 4Z5TC 5GXQC 3AZGC 4YS3D 4UUZA 2LY8A 3AZID 5JRGA 5CPJB 4LD9A 5B2IC 5B31D 5AVBB 3UT9C 2PYOC 2NZDB 5CPKB 3B0BA 5B32B 2CV5C 3B6GD 5AY8B 4Z2MG 4LD9D 3AZKD 5JA4B 4ZUXD 4KUDA 1P3BA 1BH8A 1R4VA 5FUGB 3X1TC 3AN2B 1P3OC 2NQBD 5GT0C 1N1JA 5CPID 1P3MC 1P34A 4H9NB 3MGSA 5AV5B 1P3FA 4J8UB 2AROD 3NQJA 1KX5C 3RELD 3WKJB 5DNMC 1ZLAC 1P3IC 3W97B 2CWEA 5GSUB 4AWLC 5AVBA 2NZDA 1P3PB 5B32A 3AZLB 3REIC 4ZBJC 5AY8A 3B0CT 3MGQD 5CPJD 4G92B 5JRGC 5AVBD 5CPKD 5JA4A 5BS7A 4HGAC 5FUGA 1P3LA 3AN2A 5B40B 1M1AB 3B6FB 1TAFB 4KUDC 1P3BC 1HQ3A 4H9NA 5AV5A 4R8PD 1P3KB 3C1CC 1P34C 3MGSC 3V9RB 4J8UD 3MGRD 3W97A 3WKJD 4H9RB 5GSUA 3AV2B 4NE5A 1P3PA 3AZLA 3W99B 2JSSA 5BNXA 3REHB 3AZHB 3LZ0B 5B32C 5AY8C 3VH6T 1P3AB 5B40A 1M1AA 3B6FA 5AV9C 1TAFA 3WTPE 5BS7C 1P3LC 5B0ZB 4J8WD 1U35D 5B1MB 1P3KA 2IO5C 1HQ3C 4DRAA 5B0YA 3V9RA 5AV5C 4H9RA 5GT3B 1P3KD 3AV2A 5AV8B 5E5AC 5GXQB 1H3OB 3W97C 3W99A 5GSUC 4E44A 4H9OB 3REHA 3UT9B 3LZ0A 3AZHA 3W99D 1P3PC 2CV5B 1P3AA 3AZEB 1KX4B 3W96B 1P3AD 1TZYB 5B0ZA 3X1TB 3O62D 2RVQD 5B40C 1M1AC 3B6FC 5B1MA 5B31G 3X1UD 5B1MD 4J8VB 4CSRB 5GT3A 1Q9CA 5B0YC 4Z66D 5AV8A 3WA9B 3REJD 4XUJA 1P3IB 1H3OA 4AWLB 3AV2C 4H9OA 5GXQD 4Z5TD 3AZGD 3UTBC 3AZJC 3A6ND 4UUZB 3REIB 4XZQB 4X23B 5B2ID 3UT9D 3AZEA 1ID3C 3W96A 3REHC 3AZHC 3LZ0C 3AV1A 5B2JB 2CV5D 1KX4A 4E45A 1TZYA 4HGAB 1WWSA 5AVCA 4H9QB 2FJ7B 3X1TD 1P3OD 5B0ZC 4J8VA 4CSRA 5GT0D 5B1LC 3C1CB 1P3MD 1KX5D 3AFAB 3WA9A 3NQJB 3B0CW 1BFMA 5GT3C 1F1EA 5DNMD 1ZLAD 5AV8C 5DNNB 1P3ID 4XUJC 2YFWB 3LELA 3REIA 3WAAB 4XZQA 4X23A 3VH5A 5B2JA 3REID 5JRGD 5B24A 3AZEC 5B33B 3W96C 4EO5B 1KX4C 3AV1C 4H9QA 5AV9B 3REKC 1TZYC 1P3LB
chains in the Genus database with same CATH superfamily
5AVCC 4KUDD 1P3BD 2HIOC 3C1CA 2IO5B 1HQ3B 3AFAA 4J8VC 3AZFB 2BG1A 1P34D 3MGSD 1P3FD 5DNNA 5E5AB 3WA9C 1KU5A 2YFWA 2F8NH 3VH6W 5F99A 3WAAA 5CHLB 5AV6A 2G5HC 3LELC 2DF4C 3H0LC 4XZQC 4X23C 5BNXB 5B33A 3X1VB 2NZDD 5B32D 2Y2GA 5B2JC 5AV9A 3C1BB 5AY8D 3KXBB 5B24C 1P3GB 4WV4B 5AV9D 4Z2MH 1P3LD 2FJ7C 1WWIA 3AN2D 3AL0C 3MGPB 4NE3A 3AZFA 4NFTA 1HQ3D 5C3IB 5AV5D 5B0YB 3AFAC 3B0DC 5E5AA 5E5AD 5DNNC 3LZ1B 1M18C 3UTBB 3W97D 3AZJB 5GSUD 3AZMB 5F99C 3WAAC 5AV6C 4KGCC 3W98A 3X1VA 2FJ7A 1P3PD 1ID3B 3C1BA 3AZLD 3KXBA 4YM6B 1P3GA 5B33C 4EO5C 3X1SB 3MGPA 5B40D 1M1AD 1JFIB 3B6FD 3F6TA 5G49B 5B1LB 3UTAA 3AZFC 5B0YD 3AZNB 3LZ1A 3UTBA 4XUJB 3AZJA 3MGQC 3AZMA 3AV2D 2XD1A 3UTBD 4JJNC 1ID3A 1A7WA 3AZJD 4YM6A 5CP6B 3W98C 3X1VC 1ID3D 4QLCA 3REHD 3LZ0D 3AZHD 1B67A 3C1BC 3REKB 3X1SA 3AV1B 3KXBC 3MVDA 1P3GC 1JFIA 5AVCB 3WTPB 5G49A 1Z2CB 4WU8B 5B1LA 2HIOB 5B0ZD 3MGRC 3MGPC 3TU4C 3LJAC 5B1LD 3AZNA 3NQUB 5C3IC 4WNNB 3UTAC 5GT3D 1B6WA 1KX3A 1EQZA 3KUYC 5AV8D 4XUJD 3LZ1C 4DQYB 3AZMC 3LELB 5BNVB 1F66B 5CP6A 3REKA 4YM6C 3AZED 1AOIB 5B24B 4J8XB 1KX4D 4QLCC 3W96D 3AV1D 3REKD 3WTPA 4H9SA 4WU8A 3X1SC 1TZYD 2HIOA 1S32A 3MVDC 4KHAB 5AVCD 4WU9A 2HIOD 3KWQB 3EPLA 3R45A 4CAYA 3NQUA 5B32G 4WNNA 4YS3B 3B0DB 2HUEB 2F2AC 4J8VD 3AZNC 5B31B 3WA9D 3B6GB 1M18B 3MNNC 5BNVA 1KX3C 1EQZC 1F66A 5F99B 5AV6B 4KGCB 4ZUXB 4M6BA 3LELD 5CP6C 2L5AA 4XZQD 4X23D 1AOIA 4J8XA 2NQBB 5B2JD 3X1UC 5CPIB 2UWXA 2ZY4A 5B24D 2AROB 2JCHA 4KHAA 3RELB 3WTPC 4H9SC 3EPKA 4WU8C 3KWQA 3AYWC 2FJ7D 1S32C 4YS3A 3AZIA 4WU9C 1M19C 3C1CD 5BT1C 1HTAA 5B31A 3AFAD 3A6NC 3B6GA 1M18A 3MGQB 3AZKA 4KGCA 5DNND 4ZUXA 1M18D 2F8NB 4JJNB 5F99D 3WAAD 5AV6D 1F66C 4KGCD 3W98B 2W8SA 2NQBA 2Y2JA 5CPIA 4G91B 3VH5T 4R8PB 2AROA 1AOIC 5B33D 3RELA 4J8XC 3EG5B 2ZY3A 3MGRB 3TU4B 3KSYA 3LJAB 2XD5A 3KWQC 3KFUG 4YS3C 2HUEC 3AZIC 3UTAB 3AZFD 3MGQA 5CPJA 3KUYB 5B31C 5CPKA 4WZSB 3VH6A 2F8NA 3B6GC 4JJNA 4NE6A 4LD9C 3AZKC 2Y2IA 3A1IA 2F8ND 4ZUXC 4JJND 4J8WB 4R8PA 1U35B 3X1VD 3W98D 2NQBC 4QLCB 3C1BD 5CPIC 3KXBD 4J8UA 2AROC 3MVDB 1P3GD 3MGRA 3RELC 3TU4A 2ZY5A 3WKJA 3LJAA 1P3FC 4H9PB 3MGPD 3TU4D 3LJAD 3KUYA 3UTAD 3MNNB 3KUYD 5CPJC 1KX3B 1EQZB 5AVBC 2NZDC 5KDMB 5CPKC 3LZ1D 3AZMD 2BYMB 4J8WA 1U35A 3O62B 2PYOD 3X1UB 4G91C 3AN2C 4YM6D 4R8PC 2YFVB 4QLCD 3X1SD 4UPKA 4Z66B 4J8UC 3MVDD 3AYWB 4H9PA 3REJB 1S32B 1T3UA 3WKJC 2Y2NA 4WU9B 2BYKB 1M19B 2Y2MA 3R45B 4Z5TB 4CAYB 4DRBA 3AZGB 2Y2PA 3A6NB 3MNNA 3AZND 5B2IB 2PYOB 5KDMA 3AZLC 5BO0B 3MNND 3H0MC 2BYMA 4G92C 1KX3D 1EQZD 3O62A 2VQRA 3X1UA 1P3OB 4J8WC 5CP6D 1U35C 2YFVA 5GT0B 1P3MB 4Z66A 3AYWA 1KX5B 3REJA 1BH9B 1P3KC 3WTPD 4WU8D 2BYKA 3AYWD 1M19A 5DNMB 4Z5TA 5GXQA 3AZGA 1S32D 1ZLAB 3A6NA 4WU9D 3AZIB 2RIQA 1M19D 2F8NK 4WJ3C 5BT1D 5B2IA 3UT9A 2PYOA 2CV5A 3W99C 3VH5W 4ZBJB 5BO0A 2ZM5A 5JRGB 2Y2KA 4LD9B 3AZKB 1P3AC 3X1TA 1P3OA 1F66D 2JE5A 3O62C 2RVQC 5GT0A 4KUDB 1P3BB 1BH8B 1P3MA 1ULYA 1KX5A 1AOID 2G5IC 5B1MC 1BH9A 4J8XD 1N1JB 2F8NG 1P34B 3MGSB 4Z66C 5DNMA 1P3FB 1ZLAA 1P3IA 3REJC 3H0RC 3KWQD 4Z5TC 3P5JB 5GXQC 3AZGC 3A1KA 4YS3D 4UUZA 2Y2LA 2LY8A 3AZID 5JRGA 5CPJB 4LD9A 5B2IC 5B31D 5AVBB 3UT9C 2PYOC 2NZDB 5CPKB 3B0BA 5B32B 2CV5C 3B6GD 5AY8B 2Y2OA 4Z2MG 4LD9D 2FFFB 3AZKD 5JA4B 4ZUXD 4KUDA 1P3BA 1BH8A 1R4VA 5FUGB 3X1TC 3AN2B 1P3OC 2NQBD 5GT0C 1N1JA 5CPID 2Y2HA 1P3MC 1P34A 4H9NB 3MGSA 5AV5B 1P3FA 4J8UB 2AROD 3NQJA 1KX5C 3RELD 3WKJB 5DNMC 1ZLAC 1P3IC 3W97B 2CWEA 5GSUB 4AWLC 5AVBA 2NZDA 1P3PB 5B32A 3AZLB 3REIC 4ZBJC 5AY8A 3B0CT 3MGQD 5CPJD 4G92B 5JRGC 5AVBD 5CPKD 5JA4A 5BS7A 4HGAC 5FUGA 1P3LA 3AN2A 5B40B 1M1AB 3B6FB 1TAFB 4KUDC 1P3BC 1HQ3A 4H9NA 5AV5A 4R8PD 3EPHA 1P3KB 3C1CC 3EPJA 1P34C 3MGSC 3V9RB 4J8UD 3MGRD 3W97A 3WKJD 4H9RB 5GSUA 3AV2B 4NE5A 1P3PA 3AZLA 3W99B 2JSSA 5BNXA 3REHB 3AZHB 3LZ0B 5B32C 5AY8C 3VH6T 1P3AB 5B40A 1M1AA 3B6FA 5AV9C 1TAFA 3WTPE 1W2EA 5BS7C 1P3LC 5B0ZB 4J8WD 1U35D 5B1MB 1P3KA 2IO5C 1HQ3C 4DRAA 5B0YA 3V9RA 5AV5C 2Y2QA 4H9RA 5GT3B 1P3KD 3IP4C 3AV2A 5AV8B 5E5AC 5GXQB 1H3OB 3W97C 3W99A 5GSUC 1PZRA 4E44A 4H9OB 3REHA 3UT9B 3LZ0A 3AZHA 3W99D 1P3PC 2CV5B 1P3AA 3AZEB 1KX4B 3W96B 2ZY2A 2DQNC 1P3AD 1TZYB 5B0ZA 3X1TB 3O62D 2RVQD 5B40C 1M1AC 3B6FC 5B1MA 5B31G 3X1UD 5B1MD 2J8PA 4J8VB 4CSRB 5GT3A 1Q9CA 5B0YC 4Z66D 5AV8A 3WA9B 3REJD 4XUJA 1P3IB 1H3OA 4AWLB 3AV2C 4H9OA 5GXQD 4Z5TD 3AZGD 3UTBC 3AZJC 3A6ND 4UUZB 3REIB 4XZQB 4X23B 5B2ID 3UT9D 3AZEA 1ID3C 3W96A 3REHC 3AZHC 3LZ0C 3AV1A 5B2JB 2CV5D 1KX4A 4E45A 1TZYA 4HGAB 1WWSA 5AVCA 4H9QB 2FJ7B 3X1TD 1P3OD 5B0ZC 4J8VA 3FDDA 4CSRA 5GT0D 5B1LC 3C1CB 1P3MD 1KX5D 3AFAB 3WA9A 3NQJB 3B0CW 1BFMA 5GT3C 1F1EA 5DNMD 1ZLAD 5AV8C 5DNNB 1P3ID 4XUJC 2YFWB 3LELA 3REIA 3WAAB 4XZQA 4X23A 3VH5A 5B2JA 3REID 5JRGD 5B24A 3AZEC 5B33B 3W96C 4EO5B 1KX4C 3AV1C 4H9QA 5AV9B 3REKC 1TZYC 1P3LB
chains in the Genus database with same CATH topology
5AVCC 4KUDD 1P3BD 2HIOC 3C1CA 2IO5B 1HQ3B 3AFAA 4J8VC 3AZFB 2BG1A 1P34D 3MGSD 1P3FD 5DNNA 5E5AB 3WA9C 1KU5A 2YFWA 2F8NH 3VH6W 5F99A 3WAAA 5CHLB 5AV6A 2G5HC 3LELC 2DF4C 3H0LC 4XZQC 4X23C 5BNXB 5B33A 3X1VB 2NZDD 5B32D 2Y2GA 5B2JC 5AV9A 3C1BB 5AY8D 3KXBB 5B24C 1P3GB 4WV4B 5AV9D 4Z2MH 1P3LD 2FJ7C 1WWIA 3AN2D 3AL0C 3MGPB 4NE3A 3AZFA 4NFTA 1HQ3D 5C3IB 5AV5D 5B0YB 3AFAC 3B0DC 5E5AA 5E5AD 5DNNC 3LZ1B 1M18C 3UTBB 3W97D 3AZJB 5GSUD 3AZMB 5F99C 3WAAC 5AV6C 4KGCC 3W98A 3X1VA 2FJ7A 1P3PD 1ID3B 3C1BA 3AZLD 3KXBA 4YM6B 1P3GA 5B33C 4EO5C 3X1SB 3MGPA 5B40D 1M1AD 1JFIB 3B6FD 3F6TA 5G49B 5B1LB 3UTAA 3AZFC 5B0YD 3AZNB 3LZ1A 3UTBA 4XUJB 3AZJA 3MGQC 3AZMA 3AV2D 2XD1A 3UTBD 4JJNC 1ID3A 1A7WA 3AZJD 4YM6A 5CP6B 3W98C 3X1VC 1ID3D 4QLCA 3REHD 3LZ0D 3AZHD 1B67A 3C1BC 3REKB 3X1SA 3AV1B 3KXBC 3MVDA 1P3GC 1JFIA 5AVCB 3WTPB 5G49A 1Z2CB 4WU8B 5B1LA 2HIOB 5B0ZD 3MGRC 3MGPC 3TU4C 3LJAC 5B1LD 3AZNA 3NQUB 5C3IC 4WNNB 3UTAC 5GT3D 1B6WA 1KX3A 1EQZA 3KUYC 5AV8D 4XUJD 3LZ1C 4DQYB 3AZMC 3LELB 5BNVB 1F66B 5CP6A 3REKA 4YM6C 3AZED 1AOIB 5B24B 4J8XB 1KX4D 4QLCC 3W96D 3AV1D 3REKD 3WTPA 4H9SA 4WU8A 3X1SC 1TZYD 2HIOA 1S32A 3MVDC 4KHAB 5AVCD 4WU9A 2HIOD 3KWQB 3EPLA 3R45A 4CAYA 3NQUA 5B32G 4WNNA 4YS3B 3B0DB 2HUEB 2F2AC 4J8VD 3AZNC 5B31B 3WA9D 3B6GB 1M18B 3MNNC 5BNVA 1KX3C 1EQZC 1F66A 5F99B 5AV6B 4KGCB 4ZUXB 4M6BA 3LELD 5CP6C 2L5AA 4XZQD 4X23D 1AOIA 4J8XA 2NQBB 5B2JD 3X1UC 5CPIB 2UWXA 2ZY4A 5B24D 2AROB 2JCHA 4KHAA 3RELB 3WTPC 4H9SC 3EPKA 4WU8C 3KWQA 3AYWC 2FJ7D 1S32C 4YS3A 3AZIA 4WU9C 1M19C 3C1CD 5BT1C 1HTAA 5B31A 3AFAD 3A6NC 3B6GA 1M18A 3MGQB 3AZKA 4KGCA 5DNND 4ZUXA 1M18D 2F8NB 4JJNB 5F99D 3WAAD 5AV6D 1F66C 4KGCD 3W98B 2W8SA 2NQBA 2Y2JA 5CPIA 4G91B 3VH5T 4R8PB 2AROA 1AOIC 5B33D 3RELA 4J8XC 3EG5B 2ZY3A 3MGRB 3TU4B 3KSYA 3LJAB 2XD5A 3KWQC 3KFUG 4YS3C 2HUEC 3AZIC 3UTAB 3AZFD 3MGQA 5CPJA 3KUYB 5B31C 5CPKA 4WZSB 3VH6A 2F8NA 3B6GC 4JJNA 4NE6A 4LD9C 3AZKC 2Y2IA 3A1IA 2F8ND 4ZUXC 4JJND 4J8WB 4R8PA 1U35B 3X1VD 3W98D 2NQBC 4QLCB 3C1BD 5CPIC 3KXBD 4J8UA 2AROC 3MVDB 1P3GD 3MGRA 3RELC 3TU4A 2ZY5A 3WKJA 3LJAA 1P3FC 4H9PB 3MGPD 3TU4D 3LJAD 3KUYA 3UTAD 3MNNB 3KUYD 5CPJC 1KX3B 1EQZB 5AVBC 2NZDC 5KDMB 5CPKC 3LZ1D 3AZMD 2BYMB 4J8WA 1U35A 3O62B 2PYOD 3X1UB 4G91C 3AN2C 4YM6D 4R8PC 2YFVB 4QLCD 3X1SD 4UPKA 4Z66B 4J8UC 3MVDD 3AYWB 4H9PA 3REJB 1S32B 1T3UA 3WKJC 2Y2NA 4WU9B 2BYKB 1M19B 2Y2MA 3R45B 4Z5TB 4CAYB 4DRBA 3AZGB 2Y2PA 3A6NB 3MNNA 3AZND 5B2IB 2PYOB 5KDMA 3AZLC 5BO0B 3MNND 3H0MC 2BYMA 4G92C 1KX3D 1EQZD 3O62A 2VQRA 3X1UA 1P3OB 4J8WC 5CP6D 1U35C 2YFVA 5GT0B 1P3MB 4Z66A 3AYWA 1KX5B 3REJA 1BH9B 1P3KC 3WTPD 4WU8D 2BYKA 3AYWD 1M19A 5DNMB 4Z5TA 5GXQA 3AZGA 1S32D 1ZLAB 3A6NA 4WU9D 3AZIB 2RIQA 1M19D 2F8NK 4WJ3C 5BT1D 5B2IA 3UT9A 2PYOA 2CV5A 3W99C 3VH5W 4ZBJB 5BO0A 2ZM5A 5JRGB 2Y2KA 4LD9B 3AZKB 1P3AC 3X1TA 1P3OA 1F66D 2JE5A 3O62C 2RVQC 5GT0A 4KUDB 1P3BB 1BH8B 1P3MA 1ULYA 1KX5A 1AOID 2G5IC 5B1MC 1BH9A 4J8XD 1N1JB 2F8NG 1P34B 3MGSB 4Z66C 5DNMA 1P3FB 1ZLAA 1P3IA 3REJC 3H0RC 3KWQD 4Z5TC 3P5JB 5GXQC 3AZGC 3A1KA 4YS3D 4UUZA 2Y2LA 2LY8A 3AZID 5JRGA 5CPJB 4LD9A 5B2IC 5B31D 5AVBB 3UT9C 2PYOC 2NZDB 5CPKB 3B0BA 5B32B 2CV5C 3B6GD 5AY8B 2Y2OA 4Z2MG 4LD9D 2FFFB 3AZKD 5JA4B 4ZUXD 4KUDA 1P3BA 1BH8A 1R4VA 5FUGB 3X1TC 3AN2B 1P3OC 2NQBD 5GT0C 1N1JA 5CPID 2Y2HA 1P3MC 1P34A 4H9NB 3MGSA 5AV5B 1P3FA 4J8UB 2AROD 3NQJA 1KX5C 3RELD 3WKJB 5DNMC 1ZLAC 1P3IC 3W97B 2CWEA 5GSUB 4AWLC 5AVBA 2NZDA 1P3PB 5B32A 3AZLB 3REIC 4ZBJC 5AY8A 3B0CT 3MGQD 5CPJD 4G92B 5JRGC 5AVBD 5CPKD 5JA4A 5BS7A 4HGAC 5FUGA 1P3LA 3AN2A 5B40B 1M1AB 3B6FB 1TAFB 4KUDC 1P3BC 1HQ3A 4H9NA 5AV5A 4R8PD 3EPHA 1P3KB 3C1CC 3EPJA 1P34C 3MGSC 3V9RB 4J8UD 3MGRD 3W97A 3WKJD 4H9RB 5GSUA 3AV2B 4NE5A 1P3PA 3AZLA 3W99B 2JSSA 5BNXA 3REHB 3AZHB 3LZ0B 5B32C 5AY8C 3VH6T 1P3AB 5B40A 1M1AA 3B6FA 5AV9C 1TAFA 3WTPE 1W2EA 5BS7C 1P3LC 5B0ZB 4J8WD 1U35D 5B1MB 1P3KA 2IO5C 1HQ3C 4DRAA 5B0YA 3V9RA 5AV5C 2Y2QA 4H9RA 5GT3B 1P3KD 3IP4C 3AV2A 5AV8B 5E5AC 5GXQB 1H3OB 3W97C 3W99A 5GSUC 1PZRA 4E44A 4H9OB 3REHA 3UT9B 3LZ0A 3AZHA 3W99D 1P3PC 2CV5B 1P3AA 3AZEB 1KX4B 3W96B 2ZY2A 2DQNC 1P3AD 1TZYB 5B0ZA 3X1TB 3O62D 2RVQD 5B40C 1M1AC 3B6FC 5B1MA 5B31G 3X1UD 5B1MD 2J8PA 4J8VB 4CSRB 5GT3A 1Q9CA 5B0YC 4Z66D 5AV8A 3WA9B 3REJD 4XUJA 1P3IB 1H3OA 4AWLB 3AV2C 4H9OA 5GXQD 4Z5TD 3AZGD 3UTBC 3AZJC 3A6ND 4UUZB 3REIB 4XZQB 4X23B 5B2ID 3UT9D 3AZEA 1ID3C 3W96A 3REHC 3AZHC 3LZ0C 3AV1A 5B2JB 2CV5D 1KX4A 4E45A 1TZYA 4HGAB 1WWSA 5AVCA 4H9QB 2FJ7B 3X1TD 1P3OD 5B0ZC 4J8VA 3FDDA 4CSRA 5GT0D 5B1LC 3C1CB 1P3MD 1KX5D 3AFAB 3WA9A 3NQJB 3B0CW 1BFMA 5GT3C 1F1EA 5DNMD 1ZLAD 5AV8C 5DNNB 1P3ID 4XUJC 2YFWB 3LELA 3REIA 3WAAB 4XZQA 4X23A 3VH5A 5B2JA 3REID 5JRGD 5B24A 3AZEC 5B33B 3W96C 4EO5B 1KX4C 3AV1C 4H9QA 5AV9B 3REKC 1TZYC 1P3LB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVC C;  4KUD D;  1P3B D;  2HIO C;  3C1C A;  2IO5 B;  1HQ3 B;  3AFA A;  4J8V C;  3AZF B;  1P34 D;  3MGS D;  1P3F D;  5DNN A;  5E5A B;  3WA9 C;  1KU5 A;  2YFW A;  2F8N H;  3VH6 W;  5F99 A;  3WAA A;  5CHL B;  5AV6 A;  3LEL C;  4XZQ C;  4X23 C;  5BNX B;  5B33 A;  3X1V B;  2NZD D;  5B32 D;  5B2J C;  5AV9 A;  3C1B B;  5AY8 D;  3KXB B;  5B24 C;  1P3G B;  4WV4 B;  5AV9 D;  4Z2M H;  1P3L D;  2FJ7 C;  1WWI A;  3AN2 D;  3MGP B;  4NE3 A;  3AZF A;  4NFT A;  1HQ3 D;  5C3I B;  5AV5 D;  5B0Y B;  3AFA C;  3B0D C;  5E5A A;  5E5A D;  5DNN C;  3LZ1 B;  1M18 C;  3UTB B;  3W97 D;  3AZJ B;  5GSU D;  3AZM B;  5F99 C;  3WAA C;  5AV6 C;  4KGC C;  3W98 A;  3X1V A;  2FJ7 A;  1P3P D;  1ID3 B;  3C1B A;  3AZL D;  3KXB A;  4YM6 B;  1P3G A;  5B33 C;  4EO5 C;  3X1S B;  3MGP A;  5B40 D;  1M1A D;  1JFI B;  3B6F D;  5G49 B;  5B1L B;  3UTA A;  3AZF C;  5B0Y D;  3AZN B;  3LZ1 A;  3UTB A;  4XUJ B;  3AZJ A;  3MGQ C;  3AZM A;  3AV2 D;  3UTB D;  4JJN C;  1ID3 A;  1A7W A;  3AZJ D;  4YM6 A;  5CP6 B;  3W98 C;  3X1V C;  1ID3 D;  4QLC A;  3REH D;  3LZ0 D;  3AZH D;  1B67 A;  3C1B C;  3REK B;  3X1S A;  3AV1 B;  3KXB C;  3MVD A;  1P3G C;  1JFI A;  5AVC B;  3WTP B;  5G49 A;  4WU8 B;  5B1L A;  2HIO B;  5B0Z D;  3MGR C;  3MGP C;  3TU4 C;  3LJA C;  5B1L D;  3AZN A;  3NQU B;  5C3I C;  4WNN B;  3UTA C;  5GT3 D;  1B6W A;  1KX3 A;  1EQZ A;  3KUY C;  5AV8 D;  4XUJ D;  3LZ1 C;  3AZM C;  3LEL B;  5BNV B;  1F66 B;  5CP6 A;  3REK A;  4YM6 C;  3AZE D;  1AOI B;  5B24 B;  4J8X B;  1KX4 D;  4QLC C;  3W96 D;  3AV1 D;  3REK D;  3WTP A;  4H9S A;  4WU8 A;  3X1S C;  1TZY D;  2HIO A;  1S32 A;  3MVD C;  4KHA B;  5AVC D;  4WU9 A;  2HIO D;  3KWQ B;  3R45 A;  4CAY A;  3NQU A;  5B32 G;  4WNN A;  4YS3 B;  3B0D B;  2HUE B;  4J8V D;  3AZN C;  5B31 B;  3WA9 D;  3B6G B;  1M18 B;  3MNN C;  5BNV A;  1KX3 C;  1EQZ C;  1F66 A;  5F99 B;  5AV6 B;  4KGC B;  4ZUX B;  4M6B A;  3LEL D;  5CP6 C;  2L5A A;  4XZQ D;  4X23 D;  1AOI A;  4J8X A;  2NQB B;  5B2J D;  3X1U C;  5CPI B;  5B24 D;  2ARO B;  3REL B;  4KHA A;  3WTP C;  4H9S C;  4WU8 C;  3KWQ A;  3AYW C;  2FJ7 D;  1S32 C;  4YS3 A;  3AZI A;  4WU9 C;  1M19 C;  3C1C D;  5BT1 C;  1HTA A;  5B31 A;  3AFA D;  3A6N C;  3B6G A;  1M18 A;  3MGQ B;  3AZK A;  4KGC A;  5DNN D;  4ZUX A;  1M18 D;  2F8N B;  4JJN B;  5F99 D;  3WAA D;  5AV6 D;  1F66 C;  4KGC D;  3W98 B;  2NQB A;  5CPI A;  4G91 B;  3VH5 T;  4R8P B;  2ARO A;  1AOI C;  5B33 D;  3REL A;  4J8X C;  3MGR B;  3TU4 B;  3KSY A;  3LJA B;  3KWQ C;  4YS3 C;  2HUE C;  3AZI C;  3UTA B;  3AZF D;  3MGQ A;  5CPJ A;  3KUY B;  5B31 C;  5CPK A;  4WZS B;  3VH6 A;  2F8N A;  3B6G C;  4JJN A;  4NE6 A;  4LD9 C;  3AZK C;  2F8N D;  4ZUX C;  4JJN D;  4J8W B;  4R8P A;  1U35 B;  3X1V D;  3W98 D;  2NQB C;  4QLC B;  3C1B D;  5CPI C;  3KXB D;  4J8U A;  2ARO C;  3MVD B;  1P3G D;  3MGR A;  3REL C;  3TU4 A;  3WKJ A;  3LJA A;  1P3F C;  4H9P B;  3MGP D;  3TU4 D;  3LJA D;  3KUY A;  3UTA D;  3MNN B;  3KUY D;  5CPJ C;  1KX3 B;  1EQZ B;  5AVB C;  2NZD C;  5KDM B;  5CPK C;  3LZ1 D;  3AZM D;  2BYM B;  4J8W A;  1U35 A;  3O62 B;  2PYO D;  3X1U B;  4G91 C;  3AN2 C;  4YM6 D;  4R8P C;  2YFV B;  4QLC D;  3X1S D;  4Z66 B;  4J8U C;  3MVD D;  3AYW B;  4H9P A;  3REJ B;  1S32 B;  3WKJ C;  4WU9 B;  2BYK B;  1M19 B;  4Z5T B;  3R45 B;  4CAY B;  4DRB A;  3AZG B;  3A6N B;  3MNN A;  3AZN D;  5B2I B;  2PYO B;  5KDM A;  3AZL C;  5BO0 B;  3MNN D;  1KX3 D;  2BYM A;  4G92 C;  1EQZ D;  3O62 A;  3X1U A;  1P3O B;  4J8W C;  5CP6 D;  1U35 C;  2YFV A;  5GT0 B;  1P3M B;  4Z66 A;  3AYW A;  1KX5 B;  3REJ A;  1BH9 B;  1P3K C;  3WTP D;  4WU8 D;  2BYK A;  3AYW D;  1M19 A;  5DNM B;  4Z5T A;  5GXQ A;  3AZG A;  1S32 D;  1ZLA B;  3A6N A;  4WU9 D;  3AZI B;  1M19 D;  2F8N K;  5BT1 D;  5B2I A;  3UT9 A;  2PYO A;  2CV5 A;  3W99 C;  3VH5 W;  4ZBJ B;  5BO0 A;  5JRG B;  4LD9 B;  3AZK B;  1P3A C;  3X1T A;  1P3O A;  1F66 D;  3O62 C;  2RVQ C;  5GT0 A;  4KUD B;  1P3B B;  1BH8 B;  1P3M A;  1ULY A;  1KX5 A;  1AOI D;  5B1M C;  1BH9 A;  4J8X D;  1N1J B;  2F8N G;  1P34 B;  3MGS B;  4Z66 C;  5DNM A;  1P3F B;  1ZLA A;  1P3I A;  3REJ C;  3KWQ D;  4Z5T C;  5GXQ C;  3AZG C;  4YS3 D;  4UUZ A;  2LY8 A;  3AZI D;  5JRG A;  5CPJ B;  4LD9 A;  5B2I C;  5B31 D;  5AVB B;  3UT9 C;  2PYO C;  2NZD B;  5CPK B;  3B0B A;  5B32 B;  2CV5 C;  3B6G D;  5AY8 B;  4Z2M G;  4LD9 D;  3AZK D;  5JA4 B;  4ZUX D;  4KUD A;  1P3B A;  1BH8 A;  1R4V A;  5FUG B;  3X1T C;  3AN2 B;  1P3O C;  2NQB D;  5GT0 C;  1N1J A;  5CPI D;  1P3M C;  1P34 A;  4H9N B;  3MGS A;  5AV5 B;  1P3F A;  4J8U B;  2ARO D;  3NQJ A;  1KX5 C;  3REL D;  3WKJ B;  5DNM C;  1ZLA C;  1P3I C;  3W97 B;  2CWE A;  5GSU B;  4AWL C;  5AVB A;  2NZD A;  1P3P B;  5B32 A;  3AZL B;  3REI C;  4ZBJ C;  5AY8 A;  3B0C T;  3MGQ D;  5CPJ D;  4G92 B;  5JRG C;  5AVB D;  5CPK D;  5JA4 A;  5BS7 A;  4HGA C;  5FUG A;  1P3L A;  3AN2 A;  5B40 B;  1M1A B;  3B6F B;  1TAF B;  4KUD C;  1P3B C;  1HQ3 A;  4H9N A;  5AV5 A;  4R8P D;  1P3K B;  3C1C C;  1P34 C;  3MGS C;  3V9R B;  4J8U D;  3MGR D;  3W97 A;  3WKJ D;  4H9R B;  5GSU A;  3AV2 B;  4NE5 A;  1P3P A;  3AZL A;  3W99 B;  2JSS A;  5BNX A;  3REH B;  3AZH B;  3LZ0 B;  5B32 C;  5AY8 C;  3VH6 T;  1P3A B;  5B40 A;  1M1A A;  3B6F A;  5AV9 C;  1TAF A;  3WTP E;  5BS7 C;  1P3L C;  5B0Z B;  4J8W D;  1U35 D;  5B1M B;  1P3K A;  2IO5 C;  1HQ3 C;  4DRA A;  5B0Y A;  3V9R A;  5AV5 C;  4H9R A;  5GT3 B;  1P3K D;  3AV2 A;  5AV8 B;  5E5A C;  5GXQ B;  1H3O B;  3W97 C;  3W99 A;  5GSU C;  4E44 A;  4H9O B;  3REH A;  3UT9 B;  3LZ0 A;  3AZH A;  3W99 D;  1P3P C;  2CV5 B;  1P3A A;  3AZE B;  1KX4 B;  3W96 B;  1P3A D;  1TZY B;  5B0Z A;  3X1T B;  3O62 D;  2RVQ D;  5B40 C;  1M1A C;  3B6F C;  5B1M A;  5B31 G;  3X1U D;  5B1M D;  4J8V B;  4CSR B;  5GT3 A;  1Q9C A;  5B0Y C;  4Z66 D;  5AV8 A;  3WA9 B;  3REJ D;  4XUJ A;  1P3I B;  1H3O A;  4AWL B;  3AV2 C;  4H9O A;  5GXQ D;  4Z5T D;  3AZG D;  3UTB C;  3AZJ C;  3A6N D;  4UUZ B;  3REI B;  4XZQ B;  4X23 B;  5B2I D;  3UT9 D;  3AZE A;  1ID3 C;  3W96 A;  3REH C;  3AZH C;  3LZ0 C;  3AV1 A;  5B2J B;  2CV5 D;  1KX4 A;  4E45 A;  1TZY A;  4HGA B;  1WWS A;  5AVC A;  4H9Q B;  2FJ7 B;  3X1T D;  1P3O D;  5B0Z C;  4J8V A;  4CSR A;  5GT0 D;  5B1L C;  3C1C B;  1P3M D;  1KX5 D;  3AFA B;  3WA9 A;  3NQJ B;  3B0C W;  1BFM A;  5GT3 C;  1F1E A;  5DNM D;  1ZLA D;  5AV8 C;  5DNN B;  1P3I D;  4XUJ C;  2YFW B;  3LEL A;  3REI A;  3WAA B;  4XZQ A;  4X23 A;  3VH5 A;  5B2J A;  3REI D;  5JRG D;  5B24 A;  3AZE C;  5B33 B;  3W96 C;  4EO5 B;  1KX4 C;  3AV1 C;  4H9Q A;  5AV9 B;  3REK C;  1TZY C;  1P3L B; 
#chains in the Genus database with same CATH topology
 5AVC C;  4KUD D;  1P3B D;  2HIO C;  3C1C A;  2IO5 B;  1HQ3 B;  3AFA A;  4J8V C;  3AZF B;  2BG1 A;  1P34 D;  3MGS D;  1P3F D;  5DNN A;  5E5A B;  3WA9 C;  1KU5 A;  2YFW A;  2F8N H;  3VH6 W;  5F99 A;  3WAA A;  5CHL B;  5AV6 A;  2G5H C;  3LEL C;  2DF4 C;  3H0L C;  4XZQ C;  4X23 C;  5BNX B;  5B33 A;  3X1V B;  2NZD D;  5B32 D;  2Y2G A;  5B2J C;  5AV9 A;  3C1B B;  5AY8 D;  3KXB B;  5B24 C;  1P3G B;  4WV4 B;  5AV9 D;  4Z2M H;  1P3L D;  2FJ7 C;  1WWI A;  3AN2 D;  3AL0 C;  3MGP B;  4NE3 A;  3AZF A;  4NFT A;  1HQ3 D;  5C3I B;  5AV5 D;  5B0Y B;  3AFA C;  3B0D C;  5E5A A;  5E5A D;  5DNN C;  3LZ1 B;  1M18 C;  3UTB B;  3W97 D;  3AZJ B;  5GSU D;  3AZM B;  5F99 C;  3WAA C;  5AV6 C;  4KGC C;  3W98 A;  3X1V A;  2FJ7 A;  1P3P D;  1ID3 B;  3C1B A;  3AZL D;  3KXB A;  4YM6 B;  1P3G A;  5B33 C;  4EO5 C;  3X1S B;  3MGP A;  5B40 D;  1M1A D;  1JFI B;  3B6F D;  3F6T A;  5G49 B;  5B1L B;  3UTA A;  3AZF C;  5B0Y D;  3AZN B;  3LZ1 A;  3UTB A;  4XUJ B;  3AZJ A;  3MGQ C;  3AZM A;  3AV2 D;  2XD1 A;  3UTB D;  4JJN C;  1ID3 A;  1A7W A;  3AZJ D;  4YM6 A;  5CP6 B;  3W98 C;  3X1V C;  1ID3 D;  4QLC A;  3REH D;  3LZ0 D;  3AZH D;  1B67 A;  3C1B C;  3REK B;  3X1S A;  3AV1 B;  3KXB C;  3MVD A;  1P3G C;  1JFI A;  5AVC B;  3WTP B;  5G49 A;  1Z2C B;  4WU8 B;  5B1L A;  2HIO B;  5B0Z D;  3MGR C;  3MGP C;  3TU4 C;  3LJA C;  5B1L D;  3AZN A;  3NQU B;  5C3I C;  4WNN B;  3UTA C;  5GT3 D;  1B6W A;  1KX3 A;  1EQZ A;  3KUY C;  5AV8 D;  4XUJ D;  3LZ1 C;  4DQY B;  3AZM C;  3LEL B;  5BNV B;  1F66 B;  5CP6 A;  3REK A;  4YM6 C;  3AZE D;  1AOI B;  5B24 B;  4J8X B;  1KX4 D;  4QLC C;  3W96 D;  3AV1 D;  3REK D;  3WTP A;  4H9S A;  4WU8 A;  3X1S C;  1TZY D;  2HIO A;  1S32 A;  3MVD C;  4KHA B;  5AVC D;  4WU9 A;  2HIO D;  3KWQ B;  3EPL A;  3R45 A;  4CAY A;  3NQU A;  5B32 G;  4WNN A;  4YS3 B;  3B0D B;  2HUE B;  2F2A C;  4J8V D;  3AZN C;  5B31 B;  3WA9 D;  3B6G B;  1M18 B;  3MNN C;  5BNV A;  1KX3 C;  1EQZ C;  1F66 A;  5F99 B;  5AV6 B;  4KGC B;  4ZUX B;  4M6B A;  3LEL D;  5CP6 C;  2L5A A;  4XZQ D;  4X23 D;  1AOI A;  4J8X A;  2NQB B;  5B2J D;  3X1U C;  5CPI B;  2UWX A;  2ZY4 A;  5B24 D;  2ARO B;  2JCH A;  4KHA A;  3REL B;  3WTP C;  4H9S C;  3EPK A;  4WU8 C;  3KWQ A;  3AYW C;  2FJ7 D;  1S32 C;  4YS3 A;  3AZI A;  4WU9 C;  1M19 C;  3C1C D;  5BT1 C;  1HTA A;  5B31 A;  3AFA D;  3A6N C;  3B6G A;  1M18 A;  3MGQ B;  3AZK A;  4KGC A;  5DNN D;  4ZUX A;  1M18 D;  2F8N B;  4JJN B;  5F99 D;  3WAA D;  5AV6 D;  1F66 C;  4KGC D;  3W98 B;  2W8S A;  2NQB A;  2Y2J A;  5CPI A;  4G91 B;  3VH5 T;  4R8P B;  2ARO A;  1AOI C;  5B33 D;  3REL A;  4J8X C;  3EG5 B;  2ZY3 A;  3MGR B;  3TU4 B;  3KSY A;  3LJA B;  2XD5 A;  3KWQ C;  3KFU G;  4YS3 C;  2HUE C;  3AZI C;  3UTA B;  3AZF D;  3MGQ A;  5CPJ A;  3KUY B;  5B31 C;  5CPK A;  4WZS B;  3VH6 A;  2F8N A;  3B6G C;  4JJN A;  4NE6 A;  4LD9 C;  3AZK C;  2Y2I A;  3A1I A;  2F8N D;  4ZUX C;  4JJN D;  4J8W B;  4R8P A;  1U35 B;  3X1V D;  3W98 D;  2NQB C;  4QLC B;  3C1B D;  5CPI C;  3KXB D;  4J8U A;  2ARO C;  3MVD B;  1P3G D;  3MGR A;  3REL C;  3TU4 A;  2ZY5 A;  3WKJ A;  3LJA A;  1P3F C;  4H9P B;  3MGP D;  3TU4 D;  3LJA D;  3KUY A;  3UTA D;  3MNN B;  3KUY D;  5CPJ C;  1KX3 B;  1EQZ B;  5AVB C;  2NZD C;  5KDM B;  5CPK C;  3LZ1 D;  3AZM D;  2BYM B;  4J8W A;  1U35 A;  3O62 B;  2PYO D;  3X1U B;  4G91 C;  3AN2 C;  4YM6 D;  4R8P C;  2YFV B;  4QLC D;  3X1S D;  4UPK A;  4Z66 B;  4J8U C;  3MVD D;  3AYW B;  4H9P A;  3REJ B;  1S32 B;  1T3U A;  3WKJ C;  2Y2N A;  4WU9 B;  2BYK B;  1M19 B;  2Y2M A;  3R45 B;  4Z5T B;  4CAY B;  4DRB A;  3AZG B;  2Y2P A;  3A6N B;  3MNN A;  3AZN D;  5B2I B;  2PYO B;  5KDM A;  3AZL C;  5BO0 B;  3MNN D;  3H0M C;  2BYM A;  4G92 C;  1KX3 D;  1EQZ D;  3O62 A;  2VQR A;  3X1U A;  1P3O B;  4J8W C;  5CP6 D;  1U35 C;  2YFV A;  5GT0 B;  1P3M B;  4Z66 A;  3AYW A;  1KX5 B;  3REJ A;  1BH9 B;  1P3K C;  3WTP D;  4WU8 D;  2BYK A;  3AYW D;  1M19 A;  5DNM B;  4Z5T A;  5GXQ A;  3AZG A;  1S32 D;  1ZLA B;  3A6N A;  4WU9 D;  3AZI B;  2RIQ A;  1M19 D;  2F8N K;  4WJ3 C;  5BT1 D;  5B2I A;  3UT9 A;  2PYO A;  2CV5 A;  3W99 C;  3VH5 W;  4ZBJ B;  5BO0 A;  2ZM5 A;  5JRG B;  2Y2K A;  4LD9 B;  3AZK B;  1P3A C;  3X1T A;  1P3O A;  1F66 D;  2JE5 A;  3O62 C;  2RVQ C;  5GT0 A;  4KUD B;  1P3B B;  1BH8 B;  1P3M A;  1ULY A;  1KX5 A;  1AOI D;  2G5I C;  5B1M C;  1BH9 A;  4J8X D;  1N1J B;  2F8N G;  1P34 B;  3MGS B;  4Z66 C;  5DNM A;  1P3F B;  1ZLA A;  1P3I A;  3REJ C;  3H0R C;  3KWQ D;  4Z5T C;  3P5J B;  5GXQ C;  3AZG C;  3A1K A;  4YS3 D;  4UUZ A;  2Y2L A;  2LY8 A;  3AZI D;  5JRG A;  5CPJ B;  4LD9 A;  5B2I C;  5B31 D;  5AVB B;  3UT9 C;  2PYO C;  2NZD B;  5CPK B;  3B0B A;  5B32 B;  2CV5 C;  3B6G D;  5AY8 B;  2Y2O A;  4Z2M G;  4LD9 D;  2FFF B;  3AZK D;  5JA4 B;  4ZUX D;  4KUD A;  1P3B A;  1BH8 A;  1R4V A;  5FUG B;  3X1T C;  3AN2 B;  1P3O C;  2NQB D;  5GT0 C;  1N1J A;  5CPI D;  2Y2H A;  1P3M C;  1P34 A;  4H9N B;  3MGS A;  5AV5 B;  1P3F A;  4J8U B;  2ARO D;  3NQJ A;  1KX5 C;  3REL D;  3WKJ B;  5DNM C;  1ZLA C;  1P3I C;  3W97 B;  2CWE A;  5GSU B;  4AWL C;  5AVB A;  2NZD A;  1P3P B;  5B32 A;  3AZL B;  3REI C;  4ZBJ C;  5AY8 A;  3B0C T;  3MGQ D;  5CPJ D;  4G92 B;  5JRG C;  5AVB D;  5CPK D;  5JA4 A;  5BS7 A;  4HGA C;  5FUG A;  1P3L A;  3AN2 A;  5B40 B;  1M1A B;  3B6F B;  1TAF B;  4KUD C;  1P3B C;  1HQ3 A;  4H9N A;  5AV5 A;  4R8P D;  3EPH A;  1P3K B;  3C1C C;  3EPJ A;  1P34 C;  3MGS C;  3V9R B;  4J8U D;  3MGR D;  3W97 A;  3WKJ D;  4H9R B;  5GSU A;  3AV2 B;  4NE5 A;  1P3P A;  3AZL A;  3W99 B;  2JSS A;  5BNX A;  3REH B;  3AZH B;  3LZ0 B;  5B32 C;  5AY8 C;  3VH6 T;  1P3A B;  5B40 A;  1M1A A;  3B6F A;  5AV9 C;  1TAF A;  3WTP E;  1W2E A;  5BS7 C;  1P3L C;  5B0Z B;  4J8W D;  1U35 D;  5B1M B;  1P3K A;  2IO5 C;  1HQ3 C;  4DRA A;  5B0Y A;  3V9R A;  5AV5 C;  2Y2Q A;  4H9R A;  5GT3 B;  1P3K D;  3IP4 C;  3AV2 A;  5AV8 B;  5E5A C;  5GXQ B;  1H3O B;  3W97 C;  3W99 A;  5GSU C;  1PZR A;  4E44 A;  4H9O B;  3REH A;  3UT9 B;  3LZ0 A;  3AZH A;  3W99 D;  1P3P C;  2CV5 B;  1P3A A;  3AZE B;  1KX4 B;  3W96 B;  2ZY2 A;  2DQN C;  1P3A D;  1TZY B;  5B0Z A;  3X1T B;  3O62 D;  2RVQ D;  5B40 C;  1M1A C;  3B6F C;  5B1M A;  5B31 G;  3X1U D;  5B1M D;  2J8P A;  4J8V B;  4CSR B;  5GT3 A;  1Q9C A;  5B0Y C;  4Z66 D;  5AV8 A;  3WA9 B;  3REJ D;  4XUJ A;  1P3I B;  1H3O A;  4AWL B;  3AV2 C;  4H9O A;  5GXQ D;  4Z5T D;  3AZG D;  3UTB C;  3AZJ C;  3A6N D;  4UUZ B;  3REI B;  4XZQ B;  4X23 B;  5B2I D;  3UT9 D;  3AZE A;  1ID3 C;  3W96 A;  3REH C;  3AZH C;  3LZ0 C;  3AV1 A;  5B2J B;  2CV5 D;  1KX4 A;  4E45 A;  1TZY A;  4HGA B;  1WWS A;  5AVC A;  4H9Q B;  2FJ7 B;  3X1T D;  1P3O D;  5B0Z C;  4J8V A;  3FDD A;  4CSR A;  5GT0 D;  5B1L C;  3C1C B;  1P3M D;  1KX5 D;  3AFA B;  3WA9 A;  3NQJ B;  3B0C W;  1BFM A;  5GT3 C;  1F1E A;  5DNM D;  1ZLA D;  5AV8 C;  5DNN B;  1P3I D;  4XUJ C;  2YFW B;  3LEL A;  3REI A;  3WAA B;  4XZQ A;  4X23 A;  3VH5 A;  5B2J A;  3REI D;  5JRG D;  5B24 A;  3AZE C;  5B33 B;  3W96 C;  4EO5 B;  1KX4 C;  3AV1 C;  4H9Q A;  5AV9 B;  3REK C;  1TZY C;  1P3L B; 
#chains in the Genus database with same CATH homology
 5AVC C;  4KUD D;  1P3B D;  2HIO C;  3C1C A;  2IO5 B;  1HQ3 B;  3AFA A;  4J8V C;  3AZF B;  2BG1 A;  1P34 D;  3MGS D;  1P3F D;  5DNN A;  5E5A B;  3WA9 C;  1KU5 A;  2YFW A;  2F8N H;  3VH6 W;  5F99 A;  3WAA A;  5CHL B;  5AV6 A;  2G5H C;  3LEL C;  2DF4 C;  3H0L C;  4XZQ C;  4X23 C;  5BNX B;  5B33 A;  3X1V B;  2NZD D;  5B32 D;  2Y2G A;  5B2J C;  5AV9 A;  3C1B B;  5AY8 D;  3KXB B;  5B24 C;  1P3G B;  4WV4 B;  5AV9 D;  4Z2M H;  1P3L D;  2FJ7 C;  1WWI A;  3AN2 D;  3AL0 C;  3MGP B;  4NE3 A;  3AZF A;  4NFT A;  1HQ3 D;  5C3I B;  5AV5 D;  5B0Y B;  3AFA C;  3B0D C;  5E5A A;  5E5A D;  5DNN C;  3LZ1 B;  1M18 C;  3UTB B;  3W97 D;  3AZJ B;  5GSU D;  3AZM B;  5F99 C;  3WAA C;  5AV6 C;  4KGC C;  3W98 A;  3X1V A;  2FJ7 A;  1P3P D;  1ID3 B;  3C1B A;  3AZL D;  3KXB A;  4YM6 B;  1P3G A;  5B33 C;  4EO5 C;  3X1S B;  3MGP A;  5B40 D;  1M1A D;  1JFI B;  3B6F D;  3F6T A;  5G49 B;  5B1L B;  3UTA A;  3AZF C;  5B0Y D;  3AZN B;  3LZ1 A;  3UTB A;  4XUJ B;  3AZJ A;  3MGQ C;  3AZM A;  3AV2 D;  2XD1 A;  3UTB D;  4JJN C;  1ID3 A;  1A7W A;  3AZJ D;  4YM6 A;  5CP6 B;  3W98 C;  3X1V C;  1ID3 D;  4QLC A;  3REH D;  3LZ0 D;  3AZH D;  1B67 A;  3C1B C;  3REK B;  3X1S A;  3AV1 B;  3KXB C;  3MVD A;  1P3G C;  1JFI A;  5AVC B;  3WTP B;  5G49 A;  1Z2C B;  4WU8 B;  5B1L A;  2HIO B;  5B0Z D;  3MGR C;  3MGP C;  3TU4 C;  3LJA C;  5B1L D;  3AZN A;  3NQU B;  5C3I C;  4WNN B;  3UTA C;  5GT3 D;  1B6W A;  1KX3 A;  1EQZ A;  3KUY C;  5AV8 D;  4XUJ D;  3LZ1 C;  4DQY B;  3AZM C;  3LEL B;  5BNV B;  1F66 B;  5CP6 A;  3REK A;  4YM6 C;  3AZE D;  1AOI B;  5B24 B;  4J8X B;  1KX4 D;  4QLC C;  3W96 D;  3AV1 D;  3REK D;  3WTP A;  4H9S A;  4WU8 A;  3X1S C;  1TZY D;  2HIO A;  1S32 A;  3MVD C;  4KHA B;  5AVC D;  4WU9 A;  2HIO D;  3KWQ B;  3EPL A;  3R45 A;  4CAY A;  3NQU A;  5B32 G;  4WNN A;  4YS3 B;  3B0D B;  2HUE B;  2F2A C;  4J8V D;  3AZN C;  5B31 B;  3WA9 D;  3B6G B;  1M18 B;  3MNN C;  5BNV A;  1KX3 C;  1EQZ C;  1F66 A;  5F99 B;  5AV6 B;  4KGC B;  4ZUX B;  4M6B A;  3LEL D;  5CP6 C;  2L5A A;  4XZQ D;  4X23 D;  1AOI A;  4J8X A;  2NQB B;  5B2J D;  3X1U C;  5CPI B;  2UWX A;  2ZY4 A;  5B24 D;  2ARO B;  2JCH A;  4KHA A;  3REL B;  3WTP C;  4H9S C;  3EPK A;  4WU8 C;  3KWQ A;  3AYW C;  2FJ7 D;  1S32 C;  4YS3 A;  3AZI A;  4WU9 C;  1M19 C;  3C1C D;  5BT1 C;  1HTA A;  5B31 A;  3AFA D;  3A6N C;  3B6G A;  1M18 A;  3MGQ B;  3AZK A;  4KGC A;  5DNN D;  4ZUX A;  1M18 D;  2F8N B;  4JJN B;  5F99 D;  3WAA D;  5AV6 D;  1F66 C;  4KGC D;  3W98 B;  2W8S A;  2NQB A;  2Y2J A;  5CPI A;  4G91 B;  3VH5 T;  4R8P B;  2ARO A;  1AOI C;  5B33 D;  3REL A;  4J8X C;  3EG5 B;  2ZY3 A;  3MGR B;  3TU4 B;  3KSY A;  3LJA B;  2XD5 A;  3KWQ C;  3KFU G;  4YS3 C;  2HUE C;  3AZI C;  3UTA B;  3AZF D;  3MGQ A;  5CPJ A;  3KUY B;  5B31 C;  5CPK A;  4WZS B;  3VH6 A;  2F8N A;  3B6G C;  4JJN A;  4NE6 A;  4LD9 C;  3AZK C;  2Y2I A;  3A1I A;  2F8N D;  4ZUX C;  4JJN D;  4J8W B;  4R8P A;  1U35 B;  3X1V D;  3W98 D;  2NQB C;  4QLC B;  3C1B D;  5CPI C;  3KXB D;  4J8U A;  2ARO C;  3MVD B;  1P3G D;  3MGR A;  3REL C;  3TU4 A;  2ZY5 A;  3WKJ A;  3LJA A;  1P3F C;  4H9P B;  3MGP D;  3TU4 D;  3LJA D;  3KUY A;  3UTA D;  3MNN B;  3KUY D;  5CPJ C;  1KX3 B;  1EQZ B;  5AVB C;  2NZD C;  5KDM B;  5CPK C;  3LZ1 D;  3AZM D;  2BYM B;  4J8W A;  1U35 A;  3O62 B;  2PYO D;  3X1U B;  4G91 C;  3AN2 C;  4YM6 D;  4R8P C;  2YFV B;  4QLC D;  3X1S D;  4UPK A;  4Z66 B;  4J8U C;  3MVD D;  3AYW B;  4H9P A;  3REJ B;  1S32 B;  1T3U A;  3WKJ C;  2Y2N A;  4WU9 B;  2BYK B;  1M19 B;  2Y2M A;  3R45 B;  4Z5T B;  4CAY B;  4DRB A;  3AZG B;  2Y2P A;  3A6N B;  3MNN A;  3AZN D;  5B2I B;  2PYO B;  5KDM A;  3AZL C;  5BO0 B;  3MNN D;  3H0M C;  2BYM A;  4G92 C;  1KX3 D;  1EQZ D;  3O62 A;  2VQR A;  3X1U A;  1P3O B;  4J8W C;  5CP6 D;  1U35 C;  2YFV A;  5GT0 B;  1P3M B;  4Z66 A;  3AYW A;  1KX5 B;  3REJ A;  1BH9 B;  1P3K C;  3WTP D;  4WU8 D;  2BYK A;  3AYW D;  1M19 A;  5DNM B;  4Z5T A;  5GXQ A;  3AZG A;  1S32 D;  1ZLA B;  3A6N A;  4WU9 D;  3AZI B;  2RIQ A;  1M19 D;  2F8N K;  4WJ3 C;  5BT1 D;  5B2I A;  3UT9 A;  2PYO A;  2CV5 A;  3W99 C;  3VH5 W;  4ZBJ B;  5BO0 A;  2ZM5 A;  5JRG B;  2Y2K A;  4LD9 B;  3AZK B;  1P3A C;  3X1T A;  1P3O A;  1F66 D;  2JE5 A;  3O62 C;  2RVQ C;  5GT0 A;  4KUD B;  1P3B B;  1BH8 B;  1P3M A;  1ULY A;  1KX5 A;  1AOI D;  2G5I C;  5B1M C;  1BH9 A;  4J8X D;  1N1J B;  2F8N G;  1P34 B;  3MGS B;  4Z66 C;  5DNM A;  1P3F B;  1ZLA A;  1P3I A;  3REJ C;  3H0R C;  3KWQ D;  4Z5T C;  3P5J B;  5GXQ C;  3AZG C;  3A1K A;  4YS3 D;  4UUZ A;  2Y2L A;  2LY8 A;  3AZI D;  5JRG A;  5CPJ B;  4LD9 A;  5B2I C;  5B31 D;  5AVB B;  3UT9 C;  2PYO C;  2NZD B;  5CPK B;  3B0B A;  5B32 B;  2CV5 C;  3B6G D;  5AY8 B;  2Y2O A;  4Z2M G;  4LD9 D;  2FFF B;  3AZK D;  5JA4 B;  4ZUX D;  4KUD A;  1P3B A;  1BH8 A;  1R4V A;  5FUG B;  3X1T C;  3AN2 B;  1P3O C;  2NQB D;  5GT0 C;  1N1J A;  5CPI D;  2Y2H A;  1P3M C;  1P34 A;  4H9N B;  3MGS A;  5AV5 B;  1P3F A;  4J8U B;  2ARO D;  3NQJ A;  1KX5 C;  3REL D;  3WKJ B;  5DNM C;  1ZLA C;  1P3I C;  3W97 B;  2CWE A;  5GSU B;  4AWL C;  5AVB A;  2NZD A;  1P3P B;  5B32 A;  3AZL B;  3REI C;  4ZBJ C;  5AY8 A;  3B0C T;  3MGQ D;  5CPJ D;  4G92 B;  5JRG C;  5AVB D;  5CPK D;  5JA4 A;  5BS7 A;  4HGA C;  5FUG A;  1P3L A;  3AN2 A;  5B40 B;  1M1A B;  3B6F B;  1TAF B;  4KUD C;  1P3B C;  1HQ3 A;  4H9N A;  5AV5 A;  4R8P D;  3EPH A;  1P3K B;  3C1C C;  3EPJ A;  1P34 C;  3MGS C;  3V9R B;  4J8U D;  3MGR D;  3W97 A;  3WKJ D;  4H9R B;  5GSU A;  3AV2 B;  4NE5 A;  1P3P A;  3AZL A;  3W99 B;  2JSS A;  5BNX A;  3REH B;  3AZH B;  3LZ0 B;  5B32 C;  5AY8 C;  3VH6 T;  1P3A B;  5B40 A;  1M1A A;  3B6F A;  5AV9 C;  1TAF A;  3WTP E;  1W2E A;  5BS7 C;  1P3L C;  5B0Z B;  4J8W D;  1U35 D;  5B1M B;  1P3K A;  2IO5 C;  1HQ3 C;  4DRA A;  5B0Y A;  3V9R A;  5AV5 C;  2Y2Q A;  4H9R A;  5GT3 B;  1P3K D;  3IP4 C;  3AV2 A;  5AV8 B;  5E5A C;  5GXQ B;  1H3O B;  3W97 C;  3W99 A;  5GSU C;  1PZR A;  4E44 A;  4H9O B;  3REH A;  3UT9 B;  3LZ0 A;  3AZH A;  3W99 D;  1P3P C;  2CV5 B;  1P3A A;  3AZE B;  1KX4 B;  3W96 B;  2ZY2 A;  2DQN C;  1P3A D;  1TZY B;  5B0Z A;  3X1T B;  3O62 D;  2RVQ D;  5B40 C;  1M1A C;  3B6F C;  5B1M A;  5B31 G;  3X1U D;  5B1M D;  2J8P A;  4J8V B;  4CSR B;  5GT3 A;  1Q9C A;  5B0Y C;  4Z66 D;  5AV8 A;  3WA9 B;  3REJ D;  4XUJ A;  1P3I B;  1H3O A;  4AWL B;  3AV2 C;  4H9O A;  5GXQ D;  4Z5T D;  3AZG D;  3UTB C;  3AZJ C;  3A6N D;  4UUZ B;  3REI B;  4XZQ B;  4X23 B;  5B2I D;  3UT9 D;  3AZE A;  1ID3 C;  3W96 A;  3REH C;  3AZH C;  3LZ0 C;  3AV1 A;  5B2J B;  2CV5 D;  1KX4 A;  4E45 A;  1TZY A;  4HGA B;  1WWS A;  5AVC A;  4H9Q B;  2FJ7 B;  3X1T D;  1P3O D;  5B0Z C;  4J8V A;  3FDD A;  4CSR A;  5GT0 D;  5B1L C;  3C1C B;  1P3M D;  1KX5 D;  3AFA B;  3WA9 A;  3NQJ B;  3B0C W;  1BFM A;  5GT3 C;  1F1E A;  5DNM D;  1ZLA D;  5AV8 C;  5DNN B;  1P3I D;  4XUJ C;  2YFW B;  3LEL A;  3REI A;  3WAA B;  4XZQ A;  4X23 A;  3VH5 A;  5B2J A;  3REI D;  5JRG D;  5B24 A;  3AZE C;  5B33 B;  3W96 C;  4EO5 B;  1KX4 C;  3AV1 C;  4H9Q A;  5AV9 B;  3REK C;  1TZY C;  1P3L B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...