5JA4A

Crystal structure of human tonsl and mcm2 hbds binding to a histone h3-h4 tetramer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
78
structure length
78
Chain Sequence
STELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title H4K20me0 marks post-replicative chromatin and recruits the TONSL-MMS22L DNA repair complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 26
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 5ja4A00
4J8VA 1M18A 5DNMB 1H3OA 1JFIB 3WAAC 3LZ1A 4LD9D 4J8WB 3AZJA 2NQBB 5BNVB 5GSUA 5B2IC 3AV1D 2HIOC 5B32A 4KGCC 2HUEC 3X1VA 3AZEB 1P34B 5CPKC 1S32B 3B0CW 4DRBA 4ZBJC 1P3LB 5B24C 1KX3C 5B31B 4KUDA 1HTAA 5B33B 1AOIB 3MVDB 3MGSA 2CWEA 5JRGA 2PYOC 5CP6D 3AZKA 1F1EA 1P3KA 1A7WA 5G49B 5GT3A 1KX4B 5E5AC 5GT0D 1P3GD 3REJB 3REHC 5CPJC 3LZ0A 4KHAB 3W98B 3X1UC 3W97D 3AN2D 4J8UD 3AZIC 1ID3C 5B40B 5DNMA 5AV8B 2IO5B 4J8WA 3WTPD 3WKJC 4EO5B 5BNVA 1TAFA 1KX5B 3MGPC 5B0ZB 3AZNC 3UTBB 1P3OB 3KXBD 1KU5A 1P34C 4Z5TC 1S32A 5AV6B 3AV1A 2F8NB 1P3LA 1P3FC 5B31A 5B33A 3B6FB 1P3MB 3MVDC 5AV5B 3C1CB 2CV5D 4YM6D 5B1LC 1P3AB 3UTAC 3X1SC 1N1JB 5G49A 3AZFB 4WU8B 1KX4A 1ZLAD 3X1TD 3WA9B 3AZHB 4KHAA 3LELB 3REKC 5AVBC 3MGRD 1F66C 1P3ID 4XUJC 3VH5T 4H9QA 5GXQC 3O62D 3TU4C 4ZUXD 5AV8A 5GT0A 5F99C 3REID 5B40C 4Z66C 1P3PD 3UT9D 3RELD 4QLCD 3MNND 3LJAC 3AV2B 4XZQB 3MGQB 5B1MC 1P3IB 4J8UA 5B0ZC 3B0DC 4JJNC 3B6GB 4CSRA 3KUYB 3W99D 3MNNB 1M18B 1H3OB 2AROC 3NQJA 1ULYA 4J8XD 1WWIA 5GSUB 4G92B 1P3MA 2NZDB 3W96D 5AY8D 3B6FC 5AV5A 3C1CA 5B32B 1P3AA 5FUGA 4AWLB 1U35B 3WAAD 1R4VA 1N1JA 4X23D 3AZFA 4WU8A 5C3IC 4YS3B 3WA9A 5B2ID 4E45A 4KGCD 3AZHA 4KUDB 3LELA 3AZGC 1TZYB 3MGSB 5CPKD 5AVCB 5B2JC 3X1TA 3AZLB 3KWQB 3VH5W 5B24D 1KX3D 3C1BC 4XZQA 3MGRA 1EQZB 3VH5A 1P3IA 5AV9B 3LZ0B 1M19C 2PYOD 1M1AC 4WNNB 5BNXB 4ZUXA 3AYWC 1P3PA 3KUYA 3UT9A 4WV4B 1HQ3C 3MNNA 3A6NC 3AZMC 5E5AD 5B0YB 4J8VC 3REHD 5CPJD 3LZ1C 1P3BB 3AZJC 2NZDA 1TAFB 5GSUC 3X1UD 4Z2MH 3AZID 1ID3D 1U35A 3X1VC 4LD9B 4H9NA 3WKJD 4YS3A 4J8XA 1BH8B 3W96A 3AV1B 3MGPD 3AZND 5DNNC 1TZYA 3WAAA 5BS7A 4X23A 5AVCA 5JRGC 4Z5TD 3AZLA 4WU9D 3KWQA 3AZKC 1P3KC 1P3FD 5GT3C 4R8PC 1EQZA 2FJ7C 5AV9A 1BFMA 4UUZB 4WNNA 5BNXA 5B1LD 5CP6B 3UTAD 3X1SD 4H9QB 5B24A 5GT0B 5B0YA 1P3GB 5DNMC 1P3BA 2NQBC 4CAYB 4J8WC 3REKD 5AVBD 2YFWA 4DRAA 1F66D 3W97B 4XUJD 3AN2B 4J8UB 3TU4D 3V9RB 5F99D 4CSRB 4Z66D 3REHA 4LD9A 3WTPB 3AZEC 5CPJA 5CPID 3LJAD 1BH8A 1S32C 3NQJB 3X1UA 5B1MD 3AV1C 4JJND 1P3LC 5B31C 3KXBB 5B33C 2L5AA 1AOIC 5CPIB 5FUGB 2AROD 3MGPA 3AZNA 1KX4C 3B0BA 3REJC 4UUZA 2CV5B 5CP6A 4YM6B 1WWSA 4WU9A 3AFAD 3W98C 1ZLAB 3X1TB 1P3GA 2RVQC 5AV8C 2IO5C 5BO0B 4CAYA 4EO5C 5B1LA 2F8NG 3AZGD 4NE6A 3MGRB 1KX5C 3W97A 3X1SA 3AN2A 5B2JD 3V9RA 3O62B 4J8UC 4ZUXB 3UTBC 1P3PB 3REIB 1P3OC 3UT9B 3WTPA 3RELB 4QLCB 5KDMB 3C1BD 3REKA 2LY8A 1F66A 1M19D 5AV6C 4XUJA 1M1AD 4G91B 4Z2MG 5F99A 3AYWD 3KXBA 4Z66A 1P3MC 5CPIA 1HQ3D 3A6ND 5AV5C 3LJAA 5CHLB 2JSSA 3C1CC 3AZMD 3W99B 4J8VD 1P3AC 4H9SA 3R45A 4H9NB 4H9OA 3LZ1D 3AZFC 3AZJD 4WU8C 4J8XB 3W96B 5AY8B 3WA9C 2HIOD 2CV5A 4YM6A 3AZHC 3LELC 3X1VD 3WAAB 4X23B 4E44A 1ZLAA 5B2IB 5BT1C 5BO0A 4KGCB 2HUEB 5DNND 3AV2C 4XZQC 3AFAA 5CPKB 3MGQC 5JRGD 3O62A 3B0CT 1P3IC 1B67A 3REIA 3B6GC 3AZKD 3RELA 4ZBJB 4QLCA 3KUYC 1P3KD 5B24B 1KX3B 3VH6T 5GT3D 5KDMA 3MNNC 4H9PB 4M6BA 4R8PD 1M18C 2FJ7D 4HGAB 2PYOB 2YFWB 4G91C 2NZDC 4G92C 3W99A 5B32C 3C1BA 5E5AB 3REHB 5DNMD 4AWLC 1U35C 5CPJB 1M19A 2NQBD 4J8WD 4YS3C 3AYWA 5AY8A 3X1UB 3W96C 3A6NA 3AZIB 3AZMA 1ID3B 4KUDC 1BH9A 1TZYC 3MGSC 3AZED 5BS7C 1P34D 3WKJB 4X23C 5AVCC 5B2IA 2F8NK 3AZLC 1S32D 3KWQC 3MGPB 2HIOA 4KGCA 3AZNB 1P3LD 5B31D 5B33D 1AOID 3MVDD 1EQZC 5CPKA 5AV9C 3LZ0C 4Z5TB 4WU9B 4H9RB 1P3FB 1KX3A 1KX4D 5DNNA 4H9PA 5B0YC 4WZSB 3REJD 3VH6W 2PYOA 4HGAC 1P3BC 2BYMB 5B1LB 3UTAB 2BYKB 3W98D 3X1SB 5B31G 3VH6A 5GXQD 5E5AA 5B40D 2RVQD 4R8PA 5AV8D 2FJ7A 4LD9C 4NE5A 5AVBB 3REKB 1F66B 1KX5D 4XUJB 5B0ZD 3AZIA 5GXQB 1ID3A 3TU4B 3UTBD 5F99B 4Z66B 1P3OD 1JFIA 3WKJA 2NQBA 3LJAB 3R45B 5AV6D 4H9OB 5B1MB 2F8ND 5JA4B 3B0DB 4JJNB 3B6FD 1P3MD 3AZEA 1P34A 5AV5D 4Z5TA 3C1CD 1P3AD 5CP6C 4H9RA 2AROB 4WU9C 1P3FA 3AZFD 4WU8D 5GT0C 1P3GC 1AOIA 3WA9D 3MVDA 2BYMA 3AZHD 3LELD 3UTAA 2BYKA 3AFAB 3W97C 3AN2C 5C3IB 5BT1D 3REJA 3WTPC 4NE3A 5AVBA 3AV2D 3AZGB 4XZQD 3W98A 5GXQA 5B2JB 3MGQD 3TU4A 5B40A 3WTPE 2YFVB 3B6GD 3KXBC 3KSYA 3KUYD 5CPIC 3C1BB 1M18D 1M19B 1KX5A 5B1MA 4H9SC 3NQUB 5JA4A 5B0ZA 4JJNA 1M1AB 3UTBA 3AYWB 2NZDD 5GSUD 1P3OA 4NFTA 1HQ3B 3A6NB 3AZMB 5B32D 2CV5C 4YM6C 4J8VB 1BH9B 2AROA 1U35D 5AV6A 3LZ1B 2F8NA 3AZJB 1ZLAC 4YS3D 3X1TC 3B6FA 2HIOB 1Q9CA 4KUDD 3X1VB 3MGRC 1TZYD 3MGSD 3AFAC 5AVCD 3O62C 4ZUXC 1P3PC 5B32G 3REIC 3AZLD 3KWQD 3UT9C 3RELC 4QLCC 5DNNB 3AZGA 1B6WA 1EQZD 5B2JA 5JRGB 5AV9D 3LZ0D 2YFVA 3AZKB 1P3KB 5GT3B 3W99C 3AV2A 4R8PB 5B0YD 2FJ7B 3NQUA 1M1AA 3MGQA 1P3BD 4J8XC 2F8NH 3B6GA 5AY8C 1HQ3A
chains in the Genus database with same CATH superfamily
4J8VA 1M18A 5DNMB 1H3OA 1JFIB 3WAAC 3LZ1A 4LD9D 4J8WB 3AZJA 2NQBB 5BNVB 5GSUA 5B2IC 3AV1D 2HIOC 5B32A 4KGCC 2HUEC 3X1VA 3AZEB 1P34B 5CPKC 1S32B 3B0CW 4DRBA 4ZBJC 1P3LB 5B24C 1KX3C 5B31B 4KUDA 1HTAA 5B33B 1AOIB 3MVDB 3MGSA 2CWEA 5JRGA 2PYOC 5CP6D 3AZKA 1F1EA 1P3KA 1A7WA 5G49B 5GT3A 3EG5B 1KX4B 5E5AC 5GT0D 2ZY2A 1P3GD 3REJB 2DF4C 3REHC 5CPJC 3LZ0A 2Y2OA 2Y2PA 4KHAB 3W98B 3X1UC 3W97D 3AN2D 4J8UD 3AZIC 1ID3C 5B40B 3H0RC 5AV8B 5DNMA 2IO5B 4J8WA 3WTPD 3WKJC 4EO5B 5BNVA 1TAFA 1KX5B 3AL0C 3MGPC 5B0ZB 2Y2LA 3AZNC 3UTBB 1P3OB 3KXBD 1KU5A 1P34C 4Z5TC 1S32A 5AV6B 3AV1A 2F8NB 1P3LA 1P3FC 5B31A 5B33A 3B6FB 1P3MB 3MVDC 5AV5B 3C1CB 2CV5D 4YM6D 5B1LC 1P3AB 3UTAC 3X1SC 1N1JB 5G49A 3AZFB 4WU8B 1KX4A 1ZLAD 3X1TD 3WA9B 3AZHB 4KHAA 3LELB 3REKC 5AVBC 3MGRD 1F66C 1P3ID 4XUJC 3VH5T 4H9QA 5GXQC 3O62D 3TU4C 4ZUXD 5AV8A 2Y2IA 5GT0A 5F99C 3REID 4Z66C 5B40C 1P3PD 3UT9D 3RELD 4QLCD 3MNND 3LJAC 3AV2B 4XZQB 3MGQB 5B1MC 1P3IB 4J8UA 5B0ZC 3B0DC 4JJNC 3B6GB 2XD1A 4CSRA 3KUYB 3W99D 3MNNB 1M18B 1H3OB 2AROC 3NQJA 1ULYA 2J8PA 2ZY5A 4J8XD 1WWIA 5GSUB 4G92B 1P3MA 2NZDB 3W96D 5AY8D 3B6FC 5AV5A 3C1CA 5B32B 1P3AA 5FUGA 4AWLB 1U35B 3WAAD 1R4VA 1N1JA 4X23D 3AZFA 4WU8A 5C3IC 4YS3B 3WA9A 5B2ID 4E45A 4KGCD 3AZHA 4KUDB 3LELA 3AZGC 1TZYB 3MGSB 3EPHA 5CPKD 5AVCB 5B2JC 3X1TA 3AZLB 3KWQB 2Y2GA 3VH5W 5B24D 1KX3D 3C1BC 4XZQA 4DQYB 3MGRA 1EQZB 3VH5A 1P3IA 5AV9B 3LZ0B 1M19C 2PYOD 1M1AC 4WNNB 2Y2HA 5BNXB 4ZUXA 3AYWC 1P3PA 3KUYA 3UT9A 4WV4B 1HQ3C 3MNNA 3A6NC 3AZMC 5E5AD 5B0YB 4J8VC 3REHD 5CPJD 3LZ1C 1P3BB 3AZJC 2NZDA 1TAFB 5GSUC 3X1UD 4Z2MH 3AZID 1ID3D 3P5JB 1U35A 3X1VC 4LD9B 4H9NA 3WKJD 4YS3A 4J8XA 1BH8B 3W96A 3AV1B 3MGPD 3AZND 5DNNC 1TZYA 2ZM5A 3WAAA 5BS7A 4X23A 5AVCA 5JRGC 4Z5TD 3AZLA 4WU9D 3KWQA 3AZKC 1P3KC 1P3FD 5GT3C 4R8PC 1EQZA 2FJ7C 5AV9A 1BFMA 3H0LC 4UUZB 4WNNA 5BNXA 5B1LD 5CP6B 3UTAD 3X1SD 4H9QB 5B24A 5GT0B 5B0YA 1P3GB 5DNMC 1P3BA 2NQBC 4CAYB 4J8WC 2G5HC 3REKD 5AVBD 2YFWA 4DRAA 1F66D 3W97B 4XUJD 3AN2B 4J8UB 3TU4D 3V9RB 5F99D 4CSRB 4Z66D 3REHA 4LD9A 3WTPB 3AZEC 5CPJA 5CPID 3LJAD 1BH8A 1S32C 3NQJB 3X1UA 5B1MD 3AV1C 4JJND 1P3LC 5B31C 2F2AC 3KXBB 2L5AA 5B33C 1AOIC 5CPIB 2ZY4A 5FUGB 2AROD 3MGPA 3AZNA 1KX4C 3B0BA 3REJC 4UUZA 2CV5B 5CP6A 1WWSA 4YM6B 4WU9A 3AFAD 3W98C 1ZLAB 3X1TB 1W2EA 1P3GA 2RVQC 5AV8C 2IO5C 5BO0B 4CAYA 4EO5C 5B1LA 2F8NG 3AZGD 4NE6A 3MGRB 1KX5C 3W97A 3X1SA 3AN2A 5B2JD 3V9RA 3O62B 4J8UC 4ZUXB 3UTBC 1P3PB 3REIB 2Y2KA 1P3OC 3UT9B 3WTPA 2XD5A 3RELB 4QLCB 5KDMB 3C1BD 3REKA 2LY8A 1F66A 1M19D 5AV6C 4XUJA 1M1AD 4G91B 4Z2MG 5F99A 3AYWD 4WJ3C 3KXBA 4Z66A 1P3MC 5CPIA 1HQ3D 3A6ND 5AV5C 3LJAA 5CHLB 2JSSA 3C1CC 3AZMD 1Z2CB 3W99B 4J8VD 1P3AC 3FDDA 4H9SA 3R45A 2Y2JA 4H9NB 4H9OA 3LZ1D 3AZFC 3AZJD 4WU8C 4J8XB 3W96B 5AY8B 3WA9C 2HIOD 2CV5A 4UPKA 4YM6A 3AZHC 3LELC 3EPLA 3X1VD 3WAAB 4X23B 4E44A 1ZLAA 5B2IB 5BT1C 5BO0A 4KGCB 2HUEB 5DNND 1PZRA 3AV2C 4XZQC 3AFAA 5CPKB 3MGQC 5JRGD 3O62A 3B0CT 1P3IC 1B67A 3REIA 3B6GC 3AZKD 3RELA 4ZBJB 4QLCA 3H0MC 3KUYC 5B24B 1P3KD 3VH6T 5GT3D 5KDMA 1KX3B 3MNNC 4H9PB 4M6BA 4R8PD 1M18C 2FJ7D 4HGAB 2PYOB 2YFWB 4G91C 2NZDC 4G92C 3W99A 5B32C 3C1BA 5E5AB 3REHB 5DNMD 4AWLC 1U35C 5CPJB 1M19A 2NQBD 4J8WD 2FFFB 4YS3C 3AYWA 5AY8A 3X1UB 3W96C 3A6NA 3AZIB 3AZMA 1ID3B 4KUDC 1BH9A 2BG1A 1TZYC 3MGSC 3AZED 2UWXA 5BS7C 1P34D 3WKJB 4X23C 5AVCC 5B2IA 2F8NK 3AZLC 1S32D 2RIQA 3KWQC 3MGPB 2HIOA 4KGCA 3AZNB 1P3LD 5B31D 2JE5A 5B33D 1AOID 3MVDD 1EQZC 5CPKA 3KFUG 5AV9C 2ZY3A 3LZ0C 4Z5TB 4WU9B 4H9RB 2Y2NA 1P3FB 1KX3A 1KX4D 5DNNA 4H9PA 5B0YC 4WZSB 3REJD 3VH6W 2PYOA 4HGAC 1P3BC 2BYMB 5B1LB 3UTAB 2BYKB 3W98D 5B31G 3X1SB 3VH6A 5GXQD 5E5AA 5B40D 2RVQD 4R8PA 5AV8D 2G5IC 2FJ7A 4LD9C 4NE5A 5AVBB 3REKB 3A1KA 1F66B 1KX5D 4XUJB 5B0ZD 3AZIA 5GXQB 1ID3A 3TU4B 3UTBD 5F99B 1T3UA 4Z66B 1P3OD 1JFIA 3WKJA 2NQBA 3LJAB 3R45B 5AV6D 4H9OB 5B1MB 2F8ND 5JA4B 3B0DB 4JJNB 3B6FD 1P3MD 3AZEA 3EPJA 1P34A 5AV5D 4Z5TA 3C1CD 1P3AD 5CP6C 4H9RA 2AROB 4WU9C 1P3FA 3AZFD 4WU8D 2DQNC 5GT0C 1P3GC 1AOIA 3WA9D 3MVDA 2BYMA 3AZHD 3LELD 3UTAA 2BYKA 3AFAB 3W97C 3AN2C 2VQRA 5C3IB 3IP4C 5BT1D 3REJA 3WTPC 4NE3A 5AVBA 3AV2D 3AZGB 4XZQD 3W98A 5GXQA 5B2JB 3MGQD 3TU4A 5B40A 3WTPE 2YFVB 3B6GD 3KXBC 3KSYA 3KUYD 5CPIC 3C1BB 1M18D 3F6TA 2Y2QA 1M19B 1KX5A 5B1MA 4H9SC 3NQUB 5JA4A 5B0ZA 4JJNA 1M1AB 3UTBA 3AYWB 2NZDD 5GSUD 1P3OA 4NFTA 1HQ3B 3A6NB 3AZMB 5B32D 2CV5C 4YM6C 4J8VB 1BH9B 2AROA 1U35D 5AV6A 3LZ1B 2F8NA 3AZJB 1ZLAC 4YS3D 3X1TC 3EPKA 3B6FA 2HIOB 1Q9CA 2Y2MA 4KUDD 3X1VB 3MGRC 1TZYD 3MGSD 3AFAC 5AVCD 3O62C 4ZUXC 1P3PC 5B32G 3REIC 3AZLD 3KWQD 3UT9C 3RELC 4QLCC 5DNNB 3AZGA 1B6WA 1EQZD 5B2JA 5JRGB 5AV9D 3LZ0D 2YFVA 3AZKB 2JCHA 1P3KB 5GT3B 3W99C 3AV2A 4R8PB 2W8SA 5B0YD 2FJ7B 3NQUA 1M1AA 3MGQA 1P3BD 4J8XC 2F8NH 3B6GA 5AY8C 1HQ3A 3A1IA
chains in the Genus database with same CATH topology
4J8VA 1M18A 5DNMB 1H3OA 1JFIB 3WAAC 3LZ1A 4LD9D 4J8WB 3AZJA 2NQBB 5BNVB 5GSUA 5B2IC 3AV1D 2HIOC 5B32A 4KGCC 2HUEC 3X1VA 3AZEB 1P34B 5CPKC 1S32B 3B0CW 4DRBA 4ZBJC 1P3LB 5B24C 1KX3C 5B31B 4KUDA 1HTAA 5B33B 1AOIB 3MVDB 3MGSA 2CWEA 5JRGA 2PYOC 5CP6D 3AZKA 1F1EA 1P3KA 1A7WA 5G49B 5GT3A 3EG5B 1KX4B 5E5AC 5GT0D 2ZY2A 1P3GD 3REJB 2DF4C 3REHC 5CPJC 3LZ0A 2Y2OA 2Y2PA 4KHAB 3W98B 3X1UC 3W97D 3AN2D 4J8UD 3AZIC 1ID3C 5B40B 3H0RC 5AV8B 5DNMA 2IO5B 4J8WA 3WTPD 3WKJC 4EO5B 5BNVA 1TAFA 1KX5B 3AL0C 3MGPC 5B0ZB 2Y2LA 3AZNC 3UTBB 1P3OB 3KXBD 1KU5A 1P34C 4Z5TC 1S32A 5AV6B 3AV1A 2F8NB 1P3LA 1P3FC 5B31A 5B33A 3B6FB 1P3MB 3MVDC 5AV5B 3C1CB 2CV5D 4YM6D 5B1LC 1P3AB 3UTAC 3X1SC 1N1JB 5G49A 3AZFB 4WU8B 1KX4A 1ZLAD 3X1TD 3WA9B 3AZHB 4KHAA 3LELB 3REKC 5AVBC 3MGRD 1F66C 1P3ID 4XUJC 3VH5T 4H9QA 5GXQC 3O62D 3TU4C 4ZUXD 5AV8A 2Y2IA 5GT0A 5F99C 3REID 4Z66C 5B40C 1P3PD 3UT9D 3RELD 4QLCD 3MNND 3LJAC 3AV2B 4XZQB 3MGQB 5B1MC 1P3IB 4J8UA 5B0ZC 3B0DC 4JJNC 3B6GB 2XD1A 4CSRA 3KUYB 3W99D 3MNNB 1M18B 1H3OB 2AROC 3NQJA 1ULYA 2J8PA 2ZY5A 4J8XD 1WWIA 5GSUB 4G92B 1P3MA 2NZDB 3W96D 5AY8D 3B6FC 5AV5A 3C1CA 5B32B 1P3AA 5FUGA 4AWLB 1U35B 3WAAD 1R4VA 1N1JA 4X23D 3AZFA 4WU8A 5C3IC 4YS3B 3WA9A 5B2ID 4E45A 4KGCD 3AZHA 4KUDB 3LELA 3AZGC 1TZYB 3MGSB 3EPHA 5CPKD 5AVCB 5B2JC 3X1TA 3AZLB 3KWQB 2Y2GA 3VH5W 5B24D 1KX3D 3C1BC 4XZQA 4DQYB 3MGRA 1EQZB 3VH5A 1P3IA 5AV9B 3LZ0B 1M19C 2PYOD 1M1AC 4WNNB 2Y2HA 5BNXB 4ZUXA 3AYWC 1P3PA 3KUYA 3UT9A 4WV4B 1HQ3C 3MNNA 3A6NC 3AZMC 5E5AD 5B0YB 4J8VC 3REHD 5CPJD 3LZ1C 1P3BB 3AZJC 2NZDA 1TAFB 5GSUC 3X1UD 4Z2MH 3AZID 1ID3D 3P5JB 1U35A 3X1VC 4LD9B 4H9NA 3WKJD 4YS3A 4J8XA 1BH8B 3W96A 3AV1B 3MGPD 3AZND 5DNNC 1TZYA 2ZM5A 3WAAA 5BS7A 4X23A 5AVCA 5JRGC 4Z5TD 3AZLA 4WU9D 3KWQA 3AZKC 1P3KC 1P3FD 5GT3C 4R8PC 1EQZA 2FJ7C 5AV9A 1BFMA 3H0LC 4UUZB 4WNNA 5BNXA 5B1LD 5CP6B 3UTAD 3X1SD 4H9QB 5B24A 5GT0B 5B0YA 1P3GB 5DNMC 1P3BA 2NQBC 4CAYB 4J8WC 2G5HC 3REKD 5AVBD 2YFWA 4DRAA 1F66D 3W97B 4XUJD 3AN2B 4J8UB 3TU4D 3V9RB 5F99D 4CSRB 4Z66D 3REHA 4LD9A 3WTPB 3AZEC 5CPJA 5CPID 3LJAD 1BH8A 1S32C 3NQJB 3X1UA 5B1MD 3AV1C 4JJND 1P3LC 5B31C 2F2AC 3KXBB 2L5AA 5B33C 1AOIC 5CPIB 2ZY4A 5FUGB 2AROD 3MGPA 3AZNA 1KX4C 3B0BA 3REJC 4UUZA 2CV5B 5CP6A 1WWSA 4YM6B 4WU9A 3AFAD 3W98C 1ZLAB 3X1TB 1W2EA 1P3GA 2RVQC 5AV8C 2IO5C 5BO0B 4CAYA 4EO5C 5B1LA 2F8NG 3AZGD 4NE6A 3MGRB 1KX5C 3W97A 3X1SA 3AN2A 5B2JD 3V9RA 3O62B 4J8UC 4ZUXB 3UTBC 1P3PB 3REIB 2Y2KA 1P3OC 3UT9B 3WTPA 2XD5A 3RELB 4QLCB 5KDMB 3C1BD 3REKA 2LY8A 1F66A 1M19D 5AV6C 4XUJA 1M1AD 4G91B 4Z2MG 5F99A 3AYWD 4WJ3C 3KXBA 4Z66A 1P3MC 5CPIA 1HQ3D 3A6ND 5AV5C 3LJAA 5CHLB 2JSSA 3C1CC 3AZMD 1Z2CB 3W99B 4J8VD 1P3AC 3FDDA 4H9SA 3R45A 2Y2JA 4H9NB 4H9OA 3LZ1D 3AZFC 3AZJD 4WU8C 4J8XB 3W96B 5AY8B 3WA9C 2HIOD 2CV5A 4UPKA 4YM6A 3AZHC 3LELC 3EPLA 3X1VD 3WAAB 4X23B 4E44A 1ZLAA 5B2IB 5BT1C 5BO0A 4KGCB 2HUEB 5DNND 1PZRA 3AV2C 4XZQC 3AFAA 5CPKB 3MGQC 5JRGD 3O62A 3B0CT 1P3IC 1B67A 3REIA 3B6GC 3AZKD 3RELA 4ZBJB 4QLCA 3H0MC 3KUYC 5B24B 1P3KD 3VH6T 5GT3D 5KDMA 1KX3B 3MNNC 4H9PB 4M6BA 4R8PD 1M18C 2FJ7D 4HGAB 2PYOB 2YFWB 4G91C 2NZDC 4G92C 3W99A 5B32C 3C1BA 5E5AB 3REHB 5DNMD 4AWLC 1U35C 5CPJB 1M19A 2NQBD 4J8WD 2FFFB 4YS3C 3AYWA 5AY8A 3X1UB 3W96C 3A6NA 3AZIB 3AZMA 1ID3B 4KUDC 1BH9A 2BG1A 1TZYC 3MGSC 3AZED 2UWXA 5BS7C 1P34D 3WKJB 4X23C 5AVCC 5B2IA 2F8NK 3AZLC 1S32D 2RIQA 3KWQC 3MGPB 2HIOA 4KGCA 3AZNB 1P3LD 5B31D 2JE5A 5B33D 1AOID 3MVDD 1EQZC 5CPKA 3KFUG 5AV9C 2ZY3A 3LZ0C 4Z5TB 4WU9B 4H9RB 2Y2NA 1P3FB 1KX3A 1KX4D 5DNNA 4H9PA 5B0YC 4WZSB 3REJD 3VH6W 2PYOA 4HGAC 1P3BC 2BYMB 5B1LB 3UTAB 2BYKB 3W98D 5B31G 3X1SB 3VH6A 5GXQD 5E5AA 5B40D 2RVQD 4R8PA 5AV8D 2G5IC 2FJ7A 4LD9C 4NE5A 5AVBB 3REKB 3A1KA 1F66B 1KX5D 4XUJB 5B0ZD 3AZIA 5GXQB 1ID3A 3TU4B 3UTBD 5F99B 1T3UA 4Z66B 1P3OD 1JFIA 3WKJA 2NQBA 3LJAB 3R45B 5AV6D 4H9OB 5B1MB 2F8ND 5JA4B 3B0DB 4JJNB 3B6FD 1P3MD 3AZEA 3EPJA 1P34A 5AV5D 4Z5TA 3C1CD 1P3AD 5CP6C 4H9RA 2AROB 4WU9C 1P3FA 3AZFD 4WU8D 2DQNC 5GT0C 1P3GC 1AOIA 3WA9D 3MVDA 2BYMA 3AZHD 3LELD 3UTAA 2BYKA 3AFAB 3W97C 3AN2C 2VQRA 5C3IB 3IP4C 5BT1D 3REJA 3WTPC 4NE3A 5AVBA 3AV2D 3AZGB 4XZQD 3W98A 5GXQA 5B2JB 3MGQD 3TU4A 5B40A 3WTPE 2YFVB 3B6GD 3KXBC 3KSYA 3KUYD 5CPIC 3C1BB 1M18D 3F6TA 2Y2QA 1M19B 1KX5A 5B1MA 4H9SC 3NQUB 5JA4A 5B0ZA 4JJNA 1M1AB 3UTBA 3AYWB 2NZDD 5GSUD 1P3OA 4NFTA 1HQ3B 3A6NB 3AZMB 5B32D 2CV5C 4YM6C 4J8VB 1BH9B 2AROA 1U35D 5AV6A 3LZ1B 2F8NA 3AZJB 1ZLAC 4YS3D 3X1TC 3EPKA 3B6FA 2HIOB 1Q9CA 2Y2MA 4KUDD 3X1VB 3MGRC 1TZYD 3MGSD 3AFAC 5AVCD 3O62C 4ZUXC 1P3PC 5B32G 3REIC 3AZLD 3KWQD 3UT9C 3RELC 4QLCC 5DNNB 3AZGA 1B6WA 1EQZD 5B2JA 5JRGB 5AV9D 3LZ0D 2YFVA 3AZKB 2JCHA 1P3KB 5GT3B 3W99C 3AV2A 4R8PB 2W8SA 5B0YD 2FJ7B 3NQUA 1M1AA 3MGQA 1P3BD 4J8XC 2F8NH 3B6GA 5AY8C 1HQ3A 3A1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8V A;  1M18 A;  5DNM B;  1H3O A;  1JFI B;  3WAA C;  3LZ1 A;  4LD9 D;  4J8W B;  3AZJ A;  2NQB B;  5BNV B;  5GSU A;  5B2I C;  3AV1 D;  2HIO C;  5B32 A;  4KGC C;  2HUE C;  3X1V A;  3AZE B;  1P34 B;  5CPK C;  1S32 B;  3B0C W;  4DRB A;  4ZBJ C;  1P3L B;  5B24 C;  1KX3 C;  5B31 B;  4KUD A;  1HTA A;  5B33 B;  1AOI B;  3MVD B;  3MGS A;  2CWE A;  5JRG A;  2PYO C;  5CP6 D;  3AZK A;  1F1E A;  1P3K A;  1A7W A;  5G49 B;  5GT3 A;  1KX4 B;  5E5A C;  5GT0 D;  1P3G D;  3REJ B;  3REH C;  5CPJ C;  3LZ0 A;  4KHA B;  3W98 B;  3X1U C;  3W97 D;  3AN2 D;  4J8U D;  3AZI C;  1ID3 C;  5B40 B;  5DNM A;  5AV8 B;  2IO5 B;  4J8W A;  3WTP D;  3WKJ C;  4EO5 B;  5BNV A;  1TAF A;  1KX5 B;  3MGP C;  5B0Z B;  3AZN C;  3UTB B;  1P3O B;  3KXB D;  1KU5 A;  1P34 C;  4Z5T C;  1S32 A;  5AV6 B;  3AV1 A;  2F8N B;  1P3L A;  1P3F C;  5B31 A;  5B33 A;  3B6F B;  1P3M B;  3MVD C;  5AV5 B;  3C1C B;  2CV5 D;  4YM6 D;  5B1L C;  1P3A B;  3UTA C;  3X1S C;  1N1J B;  5G49 A;  3AZF B;  4WU8 B;  1KX4 A;  1ZLA D;  3X1T D;  3WA9 B;  3AZH B;  4KHA A;  3LEL B;  3REK C;  5AVB C;  3MGR D;  1F66 C;  1P3I D;  4XUJ C;  3VH5 T;  4H9Q A;  5GXQ C;  3O62 D;  3TU4 C;  4ZUX D;  5AV8 A;  5GT0 A;  5F99 C;  3REI D;  5B40 C;  4Z66 C;  1P3P D;  3UT9 D;  3REL D;  4QLC D;  3MNN D;  3LJA C;  3AV2 B;  4XZQ B;  3MGQ B;  5B1M C;  1P3I B;  4J8U A;  5B0Z C;  3B0D C;  4JJN C;  3B6G B;  4CSR A;  3KUY B;  3W99 D;  3MNN B;  1M18 B;  1H3O B;  2ARO C;  3NQJ A;  1ULY A;  4J8X D;  1WWI A;  5GSU B;  4G92 B;  1P3M A;  2NZD B;  3W96 D;  5AY8 D;  3B6F C;  5AV5 A;  3C1C A;  5B32 B;  1P3A A;  5FUG A;  4AWL B;  1U35 B;  3WAA D;  1R4V A;  1N1J A;  4X23 D;  3AZF A;  4WU8 A;  5C3I C;  4YS3 B;  3WA9 A;  5B2I D;  4E45 A;  4KGC D;  3AZH A;  4KUD B;  3LEL A;  3AZG C;  1TZY B;  3MGS B;  5CPK D;  5AVC B;  5B2J C;  3X1T A;  3AZL B;  3KWQ B;  3VH5 W;  5B24 D;  1KX3 D;  3C1B C;  4XZQ A;  3MGR A;  1EQZ B;  3VH5 A;  1P3I A;  5AV9 B;  3LZ0 B;  1M19 C;  2PYO D;  1M1A C;  4WNN B;  5BNX B;  4ZUX A;  3AYW C;  1P3P A;  3KUY A;  3UT9 A;  4WV4 B;  1HQ3 C;  3MNN A;  3A6N C;  3AZM C;  5E5A D;  5B0Y B;  4J8V C;  3REH D;  5CPJ D;  3LZ1 C;  1P3B B;  3AZJ C;  2NZD A;  1TAF B;  5GSU C;  3X1U D;  4Z2M H;  3AZI D;  1ID3 D;  1U35 A;  3X1V C;  4LD9 B;  4H9N A;  3WKJ D;  4YS3 A;  4J8X A;  1BH8 B;  3W96 A;  3AV1 B;  3MGP D;  3AZN D;  5DNN C;  1TZY A;  3WAA A;  5BS7 A;  4X23 A;  5AVC A;  5JRG C;  4Z5T D;  3AZL A;  4WU9 D;  3KWQ A;  3AZK C;  1P3K C;  1P3F D;  5GT3 C;  4R8P C;  1EQZ A;  2FJ7 C;  5AV9 A;  1BFM A;  4UUZ B;  4WNN A;  5BNX A;  5B1L D;  5CP6 B;  3UTA D;  3X1S D;  4H9Q B;  5B24 A;  5GT0 B;  5B0Y A;  1P3G B;  5DNM C;  1P3B A;  2NQB C;  4CAY B;  4J8W C;  3REK D;  5AVB D;  2YFW A;  4DRA A;  1F66 D;  3W97 B;  4XUJ D;  3AN2 B;  4J8U B;  3TU4 D;  3V9R B;  5F99 D;  4CSR B;  4Z66 D;  3REH A;  4LD9 A;  3WTP B;  3AZE C;  5CPJ A;  5CPI D;  3LJA D;  1BH8 A;  1S32 C;  3NQJ B;  3X1U A;  5B1M D;  3AV1 C;  4JJN D;  1P3L C;  5B31 C;  3KXB B;  5B33 C;  2L5A A;  1AOI C;  5CPI B;  5FUG B;  2ARO D;  3MGP A;  3AZN A;  1KX4 C;  3B0B A;  3REJ C;  4UUZ A;  2CV5 B;  5CP6 A;  4YM6 B;  1WWS A;  4WU9 A;  3AFA D;  3W98 C;  1ZLA B;  3X1T B;  1P3G A;  2RVQ C;  5AV8 C;  2IO5 C;  5BO0 B;  4CAY A;  4EO5 C;  5B1L A;  2F8N G;  3AZG D;  4NE6 A;  3MGR B;  1KX5 C;  3W97 A;  3X1S A;  3AN2 A;  5B2J D;  3V9R A;  3O62 B;  4J8U C;  4ZUX B;  3UTB C;  1P3P B;  3REI B;  1P3O C;  3UT9 B;  3WTP A;  3REL B;  4QLC B;  5KDM B;  3C1B D;  3REK A;  2LY8 A;  1F66 A;  1M19 D;  5AV6 C;  4XUJ A;  1M1A D;  4G91 B;  4Z2M G;  5F99 A;  3AYW D;  3KXB A;  4Z66 A;  1P3M C;  5CPI A;  1HQ3 D;  3A6N D;  5AV5 C;  3LJA A;  5CHL B;  2JSS A;  3C1C C;  3AZM D;  3W99 B;  4J8V D;  1P3A C;  4H9S A;  3R45 A;  4H9N B;  4H9O A;  3LZ1 D;  3AZF C;  3AZJ D;  4WU8 C;  4J8X B;  3W96 B;  5AY8 B;  3WA9 C;  2HIO D;  2CV5 A;  4YM6 A;  3AZH C;  3LEL C;  3X1V D;  3WAA B;  4X23 B;  4E44 A;  1ZLA A;  5B2I B;  5BT1 C;  5BO0 A;  4KGC B;  2HUE B;  5DNN D;  3AV2 C;  4XZQ C;  3AFA A;  5CPK B;  3MGQ C;  5JRG D;  3O62 A;  3B0C T;  1P3I C;  1B67 A;  3REI A;  3B6G C;  3AZK D;  3REL A;  4ZBJ B;  4QLC A;  3KUY C;  1P3K D;  5B24 B;  1KX3 B;  3VH6 T;  5GT3 D;  5KDM A;  3MNN C;  4H9P B;  4M6B A;  4R8P D;  1M18 C;  2FJ7 D;  4HGA B;  2PYO B;  2YFW B;  4G91 C;  2NZD C;  4G92 C;  3W99 A;  5B32 C;  3C1B A;  5E5A B;  3REH B;  5DNM D;  4AWL C;  1U35 C;  5CPJ B;  1M19 A;  2NQB D;  4J8W D;  4YS3 C;  3AYW A;  5AY8 A;  3X1U B;  3W96 C;  3A6N A;  3AZI B;  3AZM A;  1ID3 B;  4KUD C;  1BH9 A;  1TZY C;  3MGS C;  3AZE D;  5BS7 C;  1P34 D;  3WKJ B;  4X23 C;  5AVC C;  5B2I A;  2F8N K;  3AZL C;  1S32 D;  3KWQ C;  3MGP B;  2HIO A;  4KGC A;  3AZN B;  1P3L D;  5B31 D;  5B33 D;  1AOI D;  3MVD D;  1EQZ C;  5CPK A;  5AV9 C;  3LZ0 C;  4Z5T B;  4WU9 B;  4H9R B;  1P3F B;  1KX3 A;  1KX4 D;  5DNN A;  4H9P A;  5B0Y C;  4WZS B;  3REJ D;  3VH6 W;  2PYO A;  4HGA C;  1P3B C;  2BYM B;  5B1L B;  3UTA B;  2BYK B;  3W98 D;  3X1S B;  5B31 G;  3VH6 A;  5GXQ D;  5E5A A;  5B40 D;  2RVQ D;  4R8P A;  5AV8 D;  2FJ7 A;  4LD9 C;  4NE5 A;  5AVB B;  3REK B;  1F66 B;  1KX5 D;  4XUJ B;  5B0Z D;  3AZI A;  5GXQ B;  1ID3 A;  3TU4 B;  3UTB D;  5F99 B;  4Z66 B;  1P3O D;  1JFI A;  3WKJ A;  2NQB A;  3LJA B;  3R45 B;  5AV6 D;  4H9O B;  5B1M B;  2F8N D;  5JA4 B;  3B0D B;  4JJN B;  3B6F D;  1P3M D;  3AZE A;  1P34 A;  5AV5 D;  4Z5T A;  3C1C D;  1P3A D;  5CP6 C;  4H9R A;  2ARO B;  4WU9 C;  1P3F A;  3AZF D;  4WU8 D;  5GT0 C;  1P3G C;  1AOI A;  3WA9 D;  3MVD A;  2BYM A;  3AZH D;  3LEL D;  3UTA A;  2BYK A;  3AFA B;  3W97 C;  3AN2 C;  5C3I B;  5BT1 D;  3REJ A;  3WTP C;  4NE3 A;  5AVB A;  3AV2 D;  3AZG B;  4XZQ D;  3W98 A;  5GXQ A;  5B2J B;  3MGQ D;  3TU4 A;  5B40 A;  3WTP E;  2YFV B;  3B6G D;  3KXB C;  3KSY A;  3KUY D;  5CPI C;  3C1B B;  1M18 D;  1M19 B;  1KX5 A;  5B1M A;  4H9S C;  3NQU B;  5JA4 A;  5B0Z A;  4JJN A;  1M1A B;  3UTB A;  3AYW B;  2NZD D;  5GSU D;  1P3O A;  4NFT A;  1HQ3 B;  3A6N B;  3AZM B;  5B32 D;  2CV5 C;  4YM6 C;  4J8V B;  1BH9 B;  2ARO A;  1U35 D;  5AV6 A;  3LZ1 B;  2F8N A;  3AZJ B;  1ZLA C;  4YS3 D;  3X1T C;  3B6F A;  2HIO B;  1Q9C A;  4KUD D;  3X1V B;  3MGR C;  1TZY D;  3MGS D;  3AFA C;  5AVC D;  3O62 C;  4ZUX C;  1P3P C;  5B32 G;  3REI C;  3AZL D;  3KWQ D;  3UT9 C;  3REL C;  4QLC C;  5DNN B;  3AZG A;  1B6W A;  1EQZ D;  5B2J A;  5JRG B;  5AV9 D;  3LZ0 D;  2YFV A;  3AZK B;  1P3K B;  5GT3 B;  3W99 C;  3AV2 A;  4R8P B;  5B0Y D;  2FJ7 B;  3NQU A;  1M1A A;  3MGQ A;  1P3B D;  4J8X C;  2F8N H;  3B6G A;  5AY8 C;  1HQ3 A; 
#chains in the Genus database with same CATH topology
 4J8V A;  1M18 A;  5DNM B;  1H3O A;  1JFI B;  3WAA C;  3LZ1 A;  4LD9 D;  4J8W B;  3AZJ A;  2NQB B;  5BNV B;  5GSU A;  5B2I C;  3AV1 D;  2HIO C;  5B32 A;  4KGC C;  2HUE C;  3X1V A;  3AZE B;  1P34 B;  5CPK C;  1S32 B;  3B0C W;  4DRB A;  4ZBJ C;  1P3L B;  5B24 C;  1KX3 C;  5B31 B;  4KUD A;  1HTA A;  5B33 B;  1AOI B;  3MVD B;  3MGS A;  2CWE A;  5JRG A;  2PYO C;  5CP6 D;  3AZK A;  1F1E A;  1P3K A;  1A7W A;  5G49 B;  5GT3 A;  3EG5 B;  1KX4 B;  5E5A C;  5GT0 D;  2ZY2 A;  1P3G D;  3REJ B;  2DF4 C;  3REH C;  5CPJ C;  3LZ0 A;  2Y2O A;  2Y2P A;  4KHA B;  3W98 B;  3X1U C;  3W97 D;  3AN2 D;  4J8U D;  3AZI C;  1ID3 C;  5B40 B;  3H0R C;  5AV8 B;  5DNM A;  2IO5 B;  4J8W A;  3WTP D;  3WKJ C;  4EO5 B;  5BNV A;  1TAF A;  1KX5 B;  3AL0 C;  3MGP C;  5B0Z B;  2Y2L A;  3AZN C;  3UTB B;  1P3O B;  3KXB D;  1KU5 A;  1P34 C;  4Z5T C;  1S32 A;  5AV6 B;  3AV1 A;  2F8N B;  1P3L A;  1P3F C;  5B31 A;  5B33 A;  3B6F B;  1P3M B;  3MVD C;  5AV5 B;  3C1C B;  2CV5 D;  4YM6 D;  5B1L C;  1P3A B;  3UTA C;  3X1S C;  1N1J B;  5G49 A;  3AZF B;  4WU8 B;  1KX4 A;  1ZLA D;  3X1T D;  3WA9 B;  3AZH B;  4KHA A;  3LEL B;  3REK C;  5AVB C;  3MGR D;  1F66 C;  1P3I D;  4XUJ C;  3VH5 T;  4H9Q A;  5GXQ C;  3O62 D;  3TU4 C;  4ZUX D;  5AV8 A;  2Y2I A;  5GT0 A;  5F99 C;  3REI D;  4Z66 C;  5B40 C;  1P3P D;  3UT9 D;  3REL D;  4QLC D;  3MNN D;  3LJA C;  3AV2 B;  4XZQ B;  3MGQ B;  5B1M C;  1P3I B;  4J8U A;  5B0Z C;  3B0D C;  4JJN C;  3B6G B;  2XD1 A;  4CSR A;  3KUY B;  3W99 D;  3MNN B;  1M18 B;  1H3O B;  2ARO C;  3NQJ A;  1ULY A;  2J8P A;  2ZY5 A;  4J8X D;  1WWI A;  5GSU B;  4G92 B;  1P3M A;  2NZD B;  3W96 D;  5AY8 D;  3B6F C;  5AV5 A;  3C1C A;  5B32 B;  1P3A A;  5FUG A;  4AWL B;  1U35 B;  3WAA D;  1R4V A;  1N1J A;  4X23 D;  3AZF A;  4WU8 A;  5C3I C;  4YS3 B;  3WA9 A;  5B2I D;  4E45 A;  4KGC D;  3AZH A;  4KUD B;  3LEL A;  3AZG C;  1TZY B;  3MGS B;  3EPH A;  5CPK D;  5AVC B;  5B2J C;  3X1T A;  3AZL B;  3KWQ B;  2Y2G A;  3VH5 W;  5B24 D;  1KX3 D;  3C1B C;  4XZQ A;  4DQY B;  3MGR A;  1EQZ B;  3VH5 A;  1P3I A;  5AV9 B;  3LZ0 B;  1M19 C;  2PYO D;  1M1A C;  4WNN B;  2Y2H A;  5BNX B;  4ZUX A;  3AYW C;  1P3P A;  3KUY A;  3UT9 A;  4WV4 B;  1HQ3 C;  3MNN A;  3A6N C;  3AZM C;  5E5A D;  5B0Y B;  4J8V C;  3REH D;  5CPJ D;  3LZ1 C;  1P3B B;  3AZJ C;  2NZD A;  1TAF B;  5GSU C;  3X1U D;  4Z2M H;  3AZI D;  1ID3 D;  3P5J B;  1U35 A;  3X1V C;  4LD9 B;  4H9N A;  3WKJ D;  4YS3 A;  4J8X A;  1BH8 B;  3W96 A;  3AV1 B;  3MGP D;  3AZN D;  5DNN C;  1TZY A;  2ZM5 A;  3WAA A;  5BS7 A;  4X23 A;  5AVC A;  5JRG C;  4Z5T D;  3AZL A;  4WU9 D;  3KWQ A;  3AZK C;  1P3K C;  1P3F D;  5GT3 C;  4R8P C;  1EQZ A;  2FJ7 C;  5AV9 A;  1BFM A;  3H0L C;  4UUZ B;  4WNN A;  5BNX A;  5B1L D;  5CP6 B;  3UTA D;  3X1S D;  4H9Q B;  5B24 A;  5GT0 B;  5B0Y A;  1P3G B;  5DNM C;  1P3B A;  2NQB C;  4CAY B;  4J8W C;  2G5H C;  3REK D;  5AVB D;  2YFW A;  4DRA A;  1F66 D;  3W97 B;  4XUJ D;  3AN2 B;  4J8U B;  3TU4 D;  3V9R B;  5F99 D;  4CSR B;  4Z66 D;  3REH A;  4LD9 A;  3WTP B;  3AZE C;  5CPJ A;  5CPI D;  3LJA D;  1BH8 A;  1S32 C;  3NQJ B;  3X1U A;  5B1M D;  3AV1 C;  4JJN D;  1P3L C;  5B31 C;  2F2A C;  3KXB B;  2L5A A;  5B33 C;  1AOI C;  5CPI B;  2ZY4 A;  5FUG B;  2ARO D;  3MGP A;  3AZN A;  1KX4 C;  3B0B A;  3REJ C;  4UUZ A;  2CV5 B;  5CP6 A;  1WWS A;  4YM6 B;  4WU9 A;  3AFA D;  3W98 C;  1ZLA B;  3X1T B;  1W2E A;  1P3G A;  2RVQ C;  5AV8 C;  2IO5 C;  5BO0 B;  4CAY A;  4EO5 C;  5B1L A;  2F8N G;  3AZG D;  4NE6 A;  3MGR B;  1KX5 C;  3W97 A;  3X1S A;  3AN2 A;  5B2J D;  3V9R A;  3O62 B;  4J8U C;  4ZUX B;  3UTB C;  1P3P B;  3REI B;  2Y2K A;  1P3O C;  3UT9 B;  3WTP A;  2XD5 A;  3REL B;  4QLC B;  5KDM B;  3C1B D;  3REK A;  2LY8 A;  1F66 A;  1M19 D;  5AV6 C;  4XUJ A;  1M1A D;  4G91 B;  4Z2M G;  5F99 A;  3AYW D;  4WJ3 C;  3KXB A;  4Z66 A;  1P3M C;  5CPI A;  1HQ3 D;  3A6N D;  5AV5 C;  3LJA A;  5CHL B;  2JSS A;  3C1C C;  3AZM D;  1Z2C B;  3W99 B;  4J8V D;  1P3A C;  3FDD A;  4H9S A;  3R45 A;  2Y2J A;  4H9N B;  4H9O A;  3LZ1 D;  3AZF C;  3AZJ D;  4WU8 C;  4J8X B;  3W96 B;  5AY8 B;  3WA9 C;  2HIO D;  2CV5 A;  4UPK A;  4YM6 A;  3AZH C;  3LEL C;  3EPL A;  3X1V D;  3WAA B;  4X23 B;  4E44 A;  1ZLA A;  5B2I B;  5BT1 C;  5BO0 A;  4KGC B;  2HUE B;  5DNN D;  1PZR A;  3AV2 C;  4XZQ C;  3AFA A;  5CPK B;  3MGQ C;  5JRG D;  3O62 A;  3B0C T;  1P3I C;  1B67 A;  3REI A;  3B6G C;  3AZK D;  3REL A;  4ZBJ B;  4QLC A;  3H0M C;  3KUY C;  5B24 B;  1P3K D;  3VH6 T;  5GT3 D;  5KDM A;  1KX3 B;  3MNN C;  4H9P B;  4M6B A;  4R8P D;  1M18 C;  2FJ7 D;  4HGA B;  2PYO B;  2YFW B;  4G91 C;  2NZD C;  4G92 C;  3W99 A;  5B32 C;  3C1B A;  5E5A B;  3REH B;  5DNM D;  4AWL C;  1U35 C;  5CPJ B;  1M19 A;  2NQB D;  4J8W D;  2FFF B;  4YS3 C;  3AYW A;  5AY8 A;  3X1U B;  3W96 C;  3A6N A;  3AZI B;  3AZM A;  1ID3 B;  4KUD C;  1BH9 A;  2BG1 A;  1TZY C;  3MGS C;  3AZE D;  2UWX A;  5BS7 C;  1P34 D;  3WKJ B;  4X23 C;  5AVC C;  5B2I A;  2F8N K;  3AZL C;  1S32 D;  2RIQ A;  3KWQ C;  3MGP B;  2HIO A;  4KGC A;  3AZN B;  1P3L D;  5B31 D;  2JE5 A;  5B33 D;  1AOI D;  3MVD D;  1EQZ C;  5CPK A;  3KFU G;  5AV9 C;  2ZY3 A;  3LZ0 C;  4Z5T B;  4WU9 B;  4H9R B;  2Y2N A;  1P3F B;  1KX3 A;  1KX4 D;  5DNN A;  4H9P A;  5B0Y C;  4WZS B;  3REJ D;  3VH6 W;  2PYO A;  4HGA C;  1P3B C;  2BYM B;  5B1L B;  3UTA B;  2BYK B;  3W98 D;  5B31 G;  3X1S B;  3VH6 A;  5GXQ D;  5E5A A;  5B40 D;  2RVQ D;  4R8P A;  5AV8 D;  2G5I C;  2FJ7 A;  4LD9 C;  4NE5 A;  5AVB B;  3REK B;  3A1K A;  1F66 B;  1KX5 D;  4XUJ B;  5B0Z D;  3AZI A;  5GXQ B;  1ID3 A;  3TU4 B;  3UTB D;  5F99 B;  1T3U A;  4Z66 B;  1P3O D;  1JFI A;  3WKJ A;  2NQB A;  3LJA B;  3R45 B;  5AV6 D;  4H9O B;  5B1M B;  2F8N D;  5JA4 B;  3B0D B;  4JJN B;  3B6F D;  1P3M D;  3AZE A;  3EPJ A;  1P34 A;  5AV5 D;  4Z5T A;  3C1C D;  1P3A D;  5CP6 C;  4H9R A;  2ARO B;  4WU9 C;  1P3F A;  3AZF D;  4WU8 D;  2DQN C;  5GT0 C;  1P3G C;  1AOI A;  3WA9 D;  3MVD A;  2BYM A;  3AZH D;  3LEL D;  3UTA A;  2BYK A;  3AFA B;  3W97 C;  3AN2 C;  2VQR A;  5C3I B;  3IP4 C;  5BT1 D;  3REJ A;  3WTP C;  4NE3 A;  5AVB A;  3AV2 D;  3AZG B;  4XZQ D;  3W98 A;  5GXQ A;  5B2J B;  3MGQ D;  3TU4 A;  5B40 A;  3WTP E;  2YFV B;  3B6G D;  3KXB C;  3KSY A;  3KUY D;  5CPI C;  3C1B B;  1M18 D;  3F6T A;  2Y2Q A;  1M19 B;  1KX5 A;  5B1M A;  4H9S C;  3NQU B;  5JA4 A;  5B0Z A;  4JJN A;  1M1A B;  3UTB A;  3AYW B;  2NZD D;  5GSU D;  1P3O A;  4NFT A;  1HQ3 B;  3A6N B;  3AZM B;  5B32 D;  2CV5 C;  4YM6 C;  4J8V B;  1BH9 B;  2ARO A;  1U35 D;  5AV6 A;  3LZ1 B;  2F8N A;  3AZJ B;  1ZLA C;  4YS3 D;  3X1T C;  3EPK A;  3B6F A;  2HIO B;  1Q9C A;  2Y2M A;  4KUD D;  3X1V B;  3MGR C;  1TZY D;  3MGS D;  3AFA C;  5AVC D;  3O62 C;  4ZUX C;  1P3P C;  5B32 G;  3REI C;  3AZL D;  3KWQ D;  3UT9 C;  3REL C;  4QLC C;  5DNN B;  3AZG A;  1B6W A;  1EQZ D;  5B2J A;  5JRG B;  5AV9 D;  3LZ0 D;  2YFV A;  3AZK B;  2JCH A;  1P3K B;  5GT3 B;  3W99 C;  3AV2 A;  4R8P B;  2W8S A;  5B0Y D;  2FJ7 B;  3NQU A;  1M1A A;  3MGQ A;  1P3B D;  4J8X C;  2F8N H;  3B6G A;  5AY8 C;  1HQ3 A;  3A1I A; 
#chains in the Genus database with same CATH homology
 4J8V A;  1M18 A;  5DNM B;  1H3O A;  1JFI B;  3WAA C;  3LZ1 A;  4LD9 D;  4J8W B;  3AZJ A;  2NQB B;  5BNV B;  5GSU A;  5B2I C;  3AV1 D;  2HIO C;  5B32 A;  4KGC C;  2HUE C;  3X1V A;  3AZE B;  1P34 B;  5CPK C;  1S32 B;  3B0C W;  4DRB A;  4ZBJ C;  1P3L B;  5B24 C;  1KX3 C;  5B31 B;  4KUD A;  1HTA A;  5B33 B;  1AOI B;  3MVD B;  3MGS A;  2CWE A;  5JRG A;  2PYO C;  5CP6 D;  3AZK A;  1F1E A;  1P3K A;  1A7W A;  5G49 B;  5GT3 A;  3EG5 B;  1KX4 B;  5E5A C;  5GT0 D;  2ZY2 A;  1P3G D;  3REJ B;  2DF4 C;  3REH C;  5CPJ C;  3LZ0 A;  2Y2O A;  2Y2P A;  4KHA B;  3W98 B;  3X1U C;  3W97 D;  3AN2 D;  4J8U D;  3AZI C;  1ID3 C;  5B40 B;  3H0R C;  5AV8 B;  5DNM A;  2IO5 B;  4J8W A;  3WTP D;  3WKJ C;  4EO5 B;  5BNV A;  1TAF A;  1KX5 B;  3AL0 C;  3MGP C;  5B0Z B;  2Y2L A;  3AZN C;  3UTB B;  1P3O B;  3KXB D;  1KU5 A;  1P34 C;  4Z5T C;  1S32 A;  5AV6 B;  3AV1 A;  2F8N B;  1P3L A;  1P3F C;  5B31 A;  5B33 A;  3B6F B;  1P3M B;  3MVD C;  5AV5 B;  3C1C B;  2CV5 D;  4YM6 D;  5B1L C;  1P3A B;  3UTA C;  3X1S C;  1N1J B;  5G49 A;  3AZF B;  4WU8 B;  1KX4 A;  1ZLA D;  3X1T D;  3WA9 B;  3AZH B;  4KHA A;  3LEL B;  3REK C;  5AVB C;  3MGR D;  1F66 C;  1P3I D;  4XUJ C;  3VH5 T;  4H9Q A;  5GXQ C;  3O62 D;  3TU4 C;  4ZUX D;  5AV8 A;  2Y2I A;  5GT0 A;  5F99 C;  3REI D;  4Z66 C;  5B40 C;  1P3P D;  3UT9 D;  3REL D;  4QLC D;  3MNN D;  3LJA C;  3AV2 B;  4XZQ B;  3MGQ B;  5B1M C;  1P3I B;  4J8U A;  5B0Z C;  3B0D C;  4JJN C;  3B6G B;  2XD1 A;  4CSR A;  3KUY B;  3W99 D;  3MNN B;  1M18 B;  1H3O B;  2ARO C;  3NQJ A;  1ULY A;  2J8P A;  2ZY5 A;  4J8X D;  1WWI A;  5GSU B;  4G92 B;  1P3M A;  2NZD B;  3W96 D;  5AY8 D;  3B6F C;  5AV5 A;  3C1C A;  5B32 B;  1P3A A;  5FUG A;  4AWL B;  1U35 B;  3WAA D;  1R4V A;  1N1J A;  4X23 D;  3AZF A;  4WU8 A;  5C3I C;  4YS3 B;  3WA9 A;  5B2I D;  4E45 A;  4KGC D;  3AZH A;  4KUD B;  3LEL A;  3AZG C;  1TZY B;  3MGS B;  3EPH A;  5CPK D;  5AVC B;  5B2J C;  3X1T A;  3AZL B;  3KWQ B;  2Y2G A;  3VH5 W;  5B24 D;  1KX3 D;  3C1B C;  4XZQ A;  4DQY B;  3MGR A;  1EQZ B;  3VH5 A;  1P3I A;  5AV9 B;  3LZ0 B;  1M19 C;  2PYO D;  1M1A C;  4WNN B;  2Y2H A;  5BNX B;  4ZUX A;  3AYW C;  1P3P A;  3KUY A;  3UT9 A;  4WV4 B;  1HQ3 C;  3MNN A;  3A6N C;  3AZM C;  5E5A D;  5B0Y B;  4J8V C;  3REH D;  5CPJ D;  3LZ1 C;  1P3B B;  3AZJ C;  2NZD A;  1TAF B;  5GSU C;  3X1U D;  4Z2M H;  3AZI D;  1ID3 D;  3P5J B;  1U35 A;  3X1V C;  4LD9 B;  4H9N A;  3WKJ D;  4YS3 A;  4J8X A;  1BH8 B;  3W96 A;  3AV1 B;  3MGP D;  3AZN D;  5DNN C;  1TZY A;  2ZM5 A;  3WAA A;  5BS7 A;  4X23 A;  5AVC A;  5JRG C;  4Z5T D;  3AZL A;  4WU9 D;  3KWQ A;  3AZK C;  1P3K C;  1P3F D;  5GT3 C;  4R8P C;  1EQZ A;  2FJ7 C;  5AV9 A;  1BFM A;  3H0L C;  4UUZ B;  4WNN A;  5BNX A;  5B1L D;  5CP6 B;  3UTA D;  3X1S D;  4H9Q B;  5B24 A;  5GT0 B;  5B0Y A;  1P3G B;  5DNM C;  1P3B A;  2NQB C;  4CAY B;  4J8W C;  2G5H C;  3REK D;  5AVB D;  2YFW A;  4DRA A;  1F66 D;  3W97 B;  4XUJ D;  3AN2 B;  4J8U B;  3TU4 D;  3V9R B;  5F99 D;  4CSR B;  4Z66 D;  3REH A;  4LD9 A;  3WTP B;  3AZE C;  5CPJ A;  5CPI D;  3LJA D;  1BH8 A;  1S32 C;  3NQJ B;  3X1U A;  5B1M D;  3AV1 C;  4JJN D;  1P3L C;  5B31 C;  2F2A C;  3KXB B;  2L5A A;  5B33 C;  1AOI C;  5CPI B;  2ZY4 A;  5FUG B;  2ARO D;  3MGP A;  3AZN A;  1KX4 C;  3B0B A;  3REJ C;  4UUZ A;  2CV5 B;  5CP6 A;  1WWS A;  4YM6 B;  4WU9 A;  3AFA D;  3W98 C;  1ZLA B;  3X1T B;  1W2E A;  1P3G A;  2RVQ C;  5AV8 C;  2IO5 C;  5BO0 B;  4CAY A;  4EO5 C;  5B1L A;  2F8N G;  3AZG D;  4NE6 A;  3MGR B;  1KX5 C;  3W97 A;  3X1S A;  3AN2 A;  5B2J D;  3V9R A;  3O62 B;  4J8U C;  4ZUX B;  3UTB C;  1P3P B;  3REI B;  2Y2K A;  1P3O C;  3UT9 B;  3WTP A;  2XD5 A;  3REL B;  4QLC B;  5KDM B;  3C1B D;  3REK A;  2LY8 A;  1F66 A;  1M19 D;  5AV6 C;  4XUJ A;  1M1A D;  4G91 B;  4Z2M G;  5F99 A;  3AYW D;  4WJ3 C;  3KXB A;  4Z66 A;  1P3M C;  5CPI A;  1HQ3 D;  3A6N D;  5AV5 C;  3LJA A;  5CHL B;  2JSS A;  3C1C C;  3AZM D;  1Z2C B;  3W99 B;  4J8V D;  1P3A C;  3FDD A;  4H9S A;  3R45 A;  2Y2J A;  4H9N B;  4H9O A;  3LZ1 D;  3AZF C;  3AZJ D;  4WU8 C;  4J8X B;  3W96 B;  5AY8 B;  3WA9 C;  2HIO D;  2CV5 A;  4UPK A;  4YM6 A;  3AZH C;  3LEL C;  3EPL A;  3X1V D;  3WAA B;  4X23 B;  4E44 A;  1ZLA A;  5B2I B;  5BT1 C;  5BO0 A;  4KGC B;  2HUE B;  5DNN D;  1PZR A;  3AV2 C;  4XZQ C;  3AFA A;  5CPK B;  3MGQ C;  5JRG D;  3O62 A;  3B0C T;  1P3I C;  1B67 A;  3REI A;  3B6G C;  3AZK D;  3REL A;  4ZBJ B;  4QLC A;  3H0M C;  3KUY C;  5B24 B;  1P3K D;  3VH6 T;  5GT3 D;  5KDM A;  1KX3 B;  3MNN C;  4H9P B;  4M6B A;  4R8P D;  1M18 C;  2FJ7 D;  4HGA B;  2PYO B;  2YFW B;  4G91 C;  2NZD C;  4G92 C;  3W99 A;  5B32 C;  3C1B A;  5E5A B;  3REH B;  5DNM D;  4AWL C;  1U35 C;  5CPJ B;  1M19 A;  2NQB D;  4J8W D;  2FFF B;  4YS3 C;  3AYW A;  5AY8 A;  3X1U B;  3W96 C;  3A6N A;  3AZI B;  3AZM A;  1ID3 B;  4KUD C;  1BH9 A;  2BG1 A;  1TZY C;  3MGS C;  3AZE D;  2UWX A;  5BS7 C;  1P34 D;  3WKJ B;  4X23 C;  5AVC C;  5B2I A;  2F8N K;  3AZL C;  1S32 D;  2RIQ A;  3KWQ C;  3MGP B;  2HIO A;  4KGC A;  3AZN B;  1P3L D;  5B31 D;  2JE5 A;  5B33 D;  1AOI D;  3MVD D;  1EQZ C;  5CPK A;  3KFU G;  5AV9 C;  2ZY3 A;  3LZ0 C;  4Z5T B;  4WU9 B;  4H9R B;  2Y2N A;  1P3F B;  1KX3 A;  1KX4 D;  5DNN A;  4H9P A;  5B0Y C;  4WZS B;  3REJ D;  3VH6 W;  2PYO A;  4HGA C;  1P3B C;  2BYM B;  5B1L B;  3UTA B;  2BYK B;  3W98 D;  5B31 G;  3X1S B;  3VH6 A;  5GXQ D;  5E5A A;  5B40 D;  2RVQ D;  4R8P A;  5AV8 D;  2G5I C;  2FJ7 A;  4LD9 C;  4NE5 A;  5AVB B;  3REK B;  3A1K A;  1F66 B;  1KX5 D;  4XUJ B;  5B0Z D;  3AZI A;  5GXQ B;  1ID3 A;  3TU4 B;  3UTB D;  5F99 B;  1T3U A;  4Z66 B;  1P3O D;  1JFI A;  3WKJ A;  2NQB A;  3LJA B;  3R45 B;  5AV6 D;  4H9O B;  5B1M B;  2F8N D;  5JA4 B;  3B0D B;  4JJN B;  3B6F D;  1P3M D;  3AZE A;  3EPJ A;  1P34 A;  5AV5 D;  4Z5T A;  3C1C D;  1P3A D;  5CP6 C;  4H9R A;  2ARO B;  4WU9 C;  1P3F A;  3AZF D;  4WU8 D;  2DQN C;  5GT0 C;  1P3G C;  1AOI A;  3WA9 D;  3MVD A;  2BYM A;  3AZH D;  3LEL D;  3UTA A;  2BYK A;  3AFA B;  3W97 C;  3AN2 C;  2VQR A;  5C3I B;  3IP4 C;  5BT1 D;  3REJ A;  3WTP C;  4NE3 A;  5AVB A;  3AV2 D;  3AZG B;  4XZQ D;  3W98 A;  5GXQ A;  5B2J B;  3MGQ D;  3TU4 A;  5B40 A;  3WTP E;  2YFV B;  3B6G D;  3KXB C;  3KSY A;  3KUY D;  5CPI C;  3C1B B;  1M18 D;  3F6T A;  2Y2Q A;  1M19 B;  1KX5 A;  5B1M A;  4H9S C;  3NQU B;  5JA4 A;  5B0Z A;  4JJN A;  1M1A B;  3UTB A;  3AYW B;  2NZD D;  5GSU D;  1P3O A;  4NFT A;  1HQ3 B;  3A6N B;  3AZM B;  5B32 D;  2CV5 C;  4YM6 C;  4J8V B;  1BH9 B;  2ARO A;  1U35 D;  5AV6 A;  3LZ1 B;  2F8N A;  3AZJ B;  1ZLA C;  4YS3 D;  3X1T C;  3EPK A;  3B6F A;  2HIO B;  1Q9C A;  2Y2M A;  4KUD D;  3X1V B;  3MGR C;  1TZY D;  3MGS D;  3AFA C;  5AVC D;  3O62 C;  4ZUX C;  1P3P C;  5B32 G;  3REI C;  3AZL D;  3KWQ D;  3UT9 C;  3REL C;  4QLC C;  5DNN B;  3AZG A;  1B6W A;  1EQZ D;  5B2J A;  5JRG B;  5AV9 D;  3LZ0 D;  2YFV A;  3AZK B;  2JCH A;  1P3K B;  5GT3 B;  3W99 C;  3AV2 A;  4R8P B;  2W8S A;  5B0Y D;  2FJ7 B;  3NQU A;  1M1A A;  3MGQ A;  1P3B D;  4J8X C;  2F8N H;  3B6G A;  5AY8 C;  1HQ3 A;  3A1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...