5JA8B

Crystal structure of the higb2 toxin in complex with nb2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCISSSGGTTNYADSVKGRFTVSRDNAKNTVYLQMNSLKPEDTAVYYCVADFACPLIREYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin HigB-2
publication title Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Toxin
total genus 31
structure length 121
sequence length 121
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ja8B00
4X6FB 2IQ9L 2J6EA 2IH1B 1I7ZB 2DQTL 4HIIA 4GKZA 2FRGP 3WYRA 5FA4B 4ODHH 3GMQA 4OLXL 2I26N 4UQ2B 1YMHB 3GB7A 5GGVY 1KTRL 5E6ZA 1S7VA 4M02A 3MOAL 4U1HB 5IB1B 1DBKH 3DPBA 5D7LE 4P2CG 1L0YA 2QSTA 1F90L 4P9HL 1KGCE 3F12A 4UU9B 4TOYH 4LBEB 1FGVH 4DGVL 1UQSB 4HJJH 3FN0L 3PV7A 3HE7B 4JQXC 5EZJB 3NOIA 3WUWB 4DZ8B 2CRYA 3JZ7A 3ZTJG 1MRDH 3IJHA 3PHSA 4WFHE 2ZUUA 1DN0B 4G6FB 3TBSA 4GMSH 4NC1E 1S9YA 5DWUL 4Q9QL 3K8LA 2XKUA 4P4RB 4JQXA 3FRPG 2IADB 2W9DH 1RURL 4NWUL 1C08A 3GBML 3TNNA 5T5NG 3FOLB 4Y5YC 4OFIA 3ZDYE 4KGJA 5TDNB 1N64H 3PP3K 1HSAA 3KPNA 4X7CC 2VXSL 1NC2D 1R5IA 1JWSB 2VITA 1EJOH 5K9JL 1I8LC 5E4EC 3QG7L 2MTPA 3SKNB 1MCBA 2EYTA 4Y5YA 5E7BA 3EDDA 3I2CL 4LVNB 2HYMA 5ACMA 5J11B 5E8EA 2JCCA 4GG8A 3SN6N 2EDWA 5IB3A 2LAAA 4ERSL 3WFDH 5ITFB 3LMJL 4XWOC 4J1UB 5I8EB 3TO2A 1I8LA 2VAAB 4O00A 2AJSH 2WBWB 3D3VA 3UZQA 2ZKHL 1CG9B 4POZC 1J0JA 3SOBL 5MHSE 5JORB 3LKNA 4AY0A 4U1KB 1U8NB 3VFTA 4U1GB 4F37K 5DI8B 4YHYC 1OQXA 3MLVH 5F96H 4RFNC 5DEGA 2LVEA 3ARTA 1D5XB 3LPFA 2SEBB 2NR6D 3BO8A 4ZTPH 2LTQC 1CFVL 1FG2B 3O6LH 2IFGA 3HR5B 3QUZD 2NY2C 4UTBH 3CDYA 5IW6A 3D85A 1ORQB 4CVUA 1KIRA 1MHEA 3OKMB 3CH8A 3ULVE 4LNRA 4JN1L 4WUUA 1ZLVK 5EB9A 4G6AD 4MA1C 3RWEA 1ZVSB 4KKAD 5E1AB 5TF0A 3EO9H 3TJHD 3VXMD 2AK1L 4LRNL 4X7TA 4PJ5A 1UCBL 3E8UL 5C86A 3VWKC 1MUJB 4V2CB 4IHOA 1X3DA 3W9EA 3DUSA 2V9QA 3ARBC 3B4NA 4G7VH 3CDGA 2VXUH 3Q48A 1XF2A 4NJAH 3QDJE 3S35X 3AFLA 3MLRL 1GXEA 4NKOB 2H2PD 1GGIH 5L88H 5CHNB 1J1XL 5B4MC 3VWKA 5DS8B 1AD0B 2MPAL 1TNNA 1T1YA 1N59B 1JPSL 1C7TA 1PD6A 4ZSOB 3ARBA 5K93A 5D7SL 1ODAA 4YFLF 2K1MA 3TYGL 3PWLA 4U1SB 2BFVL 2VH5L 1MHPH 4XWGH 5EU3B 3S9DB 4K9EH 1A3QA 4NUJB 2WMPA 3HZYB 3QWRD 3OF6A 4XXDB 3JTSA 5I1JH 5DD6A 1NC2B 4GW1A 2NX5D 1YYLL 1MAJA 2ED7A 5FM5M 3KPSE 3MRNA 4HLZG 1QKZL 4ZFOB 3V79C 4QXGL 4PTUA 3QSKB 1F3RB 1LD9B 4QT5B 2W65A 4KKLC 4NN6B 4YIQA 1NDMA 1YMMD 4L4TE 3CD4A 3FOMB 5EOQL 4DVBA 3IFNL 5CSBA 4U1LB 4R96A 1G1YA 3HC4H 1A3RH 2XXCB 4JHAH 2X70B 3PIQB 1QFWM 3UTQA 1QA9B 3W2DH 3MLTA 1D9KD 2DLHA 4KC3B 3SE4C 1FAIL 3LEYH 3VFWB 5EO1A 5DJDB 4UTAL 4P4KA 4LU5H 1Y0LA 5GGTA 4DQOH 5BRZD 3I9GH 5JUEH 1T03H 1UB6B 4R4BB 5I75B 3FO0L 1H9VA 4XCCH 5DK3A 2F9BT 1VPOL 4HT1H 1KNOA 1E6OH 5DC4B 3OKKB 4WTZG 3V5KA 3QUZB 4XNMB 1ZGLM 4C4KT 3SE4A 4LLDB 1HH9B 1JHKL 3CUPB 4F57H 1JMXA 4BA8A 3ESUF 2H6PA 3L5WB 2YWZA 5FYLL 4LLWA 3BEVA 4M00A 4YDLB 1BQHG 1IGJA 2DM3A 4KUZH 1KCLA 1YEFL 1H3PH 4Y4FD 1JV5A 3VXMB 5DSCB 4KXZI 2YPLB 3LS5L 4YPGA 1ROWA 4JFFE 5KSUA 1FFQA 3ZHDA 1OB1B 1AJ7H 3LEXB 3PV6B 5ECJE 4I48B 4GOSA 1JGUH 4TNWF 2EDYA 3O2VH 2IAND 3TC9A 3OXRA 3RY4A 2ADJB 3MRJB 4MCZA 4WU7A 3BUTA 25C8H 1RZ7L 1BX2B 1ZT4A 4H0IA 4XCEB 1NLDL 4MNHB 1QZ1A 4Z95H 1XCQB 5EO0A 1PYWB 3F65A 1UWXH 2J5LC 3JXAA 1T3FB 1B4RA 1FNSH 1AGDB 2ZOLA 5EZLA 2JELH 3L5JA 2FHBA 2DBJA 1NAMH 1ZHKA 2NX5B 2XWTA 4UBDD 4GG6F 4PYHA 4O2FB 2X89A 4R2GC 1T7YA 3WLBB 3WN5C 4CKVX 2VJXA 3TJEH 5DFVC 5SV4A 3W0WE 2E7MA 3BIAX 5IB4B 1YMMB 4MQXC 1QLEH 5F9OL 4HCRA 2VLJE 1CL7H 1BD2D 3HCVB 4TSAH 3WN5A 3BDYH 5EA0L 1YNTA 3FT2A 1D9KB 2FO4B 3PDOB 5F7EH 3W82A 2AJXH 3MRRA 3WIFB 4UAOB 4PJXE 5F1KC 5BRZB 3BJLA 1BVLA 1CFNB 4IMLB 3MLUL 1HHIA 1A6WL 5T3ZH 5C0FB 3D6GA 3T2NH 1TCMA 2D7PA 2IPTL 3QWOB 5FM8A 1JNHA 3O3BA 1N6UA 1S7XB 2ATKB 5TPWH 3BKMH 3OBAA 5IJVA 3U0WL 2QQLH 1QG3A 3B9DA 4FQ1H 3X14B 4TYUA 1IM3B 3HG1B 1MCKA 2X40A 5TE7L 2FGZA 3JBG7 1LNUA 2HWZL 4Y4FB 3MRHB 5GS0L 3GBNL 2KL6A 3BGMB 4HK0A 1IEBB 3EJJX 3PDDA 1GIGH 4QHMA 3EUUA 1FIEA 3D0LA 3VXRA 3LH2L 1T04B 2RHEA 2FJGB 3GM8A 2XZQH 2F5BH 3D3VD 4OD2B 3AAZB 3W11C 1WAAF 3OJ2C 3MRLA 2IANB 3BT2L 1SMOA 1MCCA 3E6HB 3N85H 2VE6B 3RUGF 4XWOD 3OKEA 3TBWA 3V4VL 5SX4H 1NGQH 3T0EC 5EU7E 3QYCA 3DGGA 3O3DA 2WWMC 3RUGB 3BRDA 3VE0B 3NFPA 4POZD 2A73A 4KRLB 5FO7B 3RGVB 4X4YA 1UH2A 3HMXL 1LP9A 5IK3A 2MNUA 5D71H 5T3XE 3T0EA 4PJAA 1FSKB 3GB7B 4WUUD 3UPAA 3VFUA 2J8HA 1TIUA 4O02L 1C1EL 4H25B 1K5NA 1IAIM 2NY2D 3OB8A 3VH8A 2L7JA 4G6JH 4PJ5D 3T0VA 1U8PB 1Q8MA 4K7PX 4GO6B 2AKRB 3EOTL 1RU9H 2H3NB 3TWCL 1OP9A 2WBJD 3PGDA 1BD2B 3IJHB 1F4WL 5IMMB 3BSZH 3NTCH 3L3JA 3VWKD 3CFBA 5IV2A 4B50A 3VI4E 4S1QL 1Z2KA 3ARBD 2QQNL 4NCC1 1N4XH 4ZAKA 4LARH 2EH8L 3ZLQC 5IESH 1C08B 2XY1A 1FNHA 3QEGH 4HSQA 4DGYL 4FQLL 3FT4B 3QCUL 1Z0NA 4XI5C 2YSSA 1NMBH 5FK9B 5I1IL 1HHHB 2YEZB 5F88B 4N0CC 5B4MD 1JBJA 2A1WH 3OF6D 1RZIA 1HSAB 5FXCH 3KPNB 3W5NA 1R3IL 2BSTB 3T4AA 4PS4L 4A2LA 4N1EA 1MHHB 1SVZA 3QDAA 2JCCF 2GUOA 2EYTB 4DW2L 1MI5A 2R1XA 3P73A 4R3SA 4JRXE 4YDVB 1PEZA 5E8EB 3R1GH 4XBEL 1CLOL 4K7PH 2DQIL 4PUBH 3GUTA 4X98A 5JDJA 4N8VB 3PWPE 4HKZA 4M7KL 4X0KA 4IOFC 4LCCC 3GKWH 1JGVL 3HPJA 1X5ZA 4LASL 5DRNA 4NO5A 3PDGA 4PGZA 4KKLD 1CFQA 3JV5A 4FMFA 1E4JA 4U1JA 1SBSL 1VKXB 3HNSL 2QHLA 5HJ3A 2V9TA 1A9BB 4OLZL 4PJ8C 4OLYL 3EYOB 4JQVC 4YFDB 4LCCA 5DVNA 5F1NB 5ESAA 1INQB 4CVXA 4UT9L 4LQFH 1IGIH 1XGRA 4XAKD 5ELIA 1BLNA 3KPRD 3RNQA 4J4PC 1ZHLB 2DQHH 3DX6A 5DJ8B 5IW6B 5CJQL 4LL9A 4M62L 5K9OA 1MHEB 1OAQL 4RFNB 1MF2L 1I1FA 4LNRB 4PJ8A 4JQVA 3OGOE 2JB6A 1LDSA 2XY2A 4QNPE 2LTQB 3S35L 3ZDXE 3RWEB 4J4PA 12E8H 2NY2B 4YXKL 1L7IH 4YXLL 5FO8B 4UOJA 4LAQL 4X7TB 5CZKA 4WUKL 4PJ5B 1JZ7A 2Z93B 4C56B 2QSQA 3BPLC 3DUSB 1NEZB 3K4AA 4KHXH 4PRBA 4ZYKB 2WBJB 4AQ1B 3CDGB 4HUVB 4XPHL 1KTLB 3TCLA 3MGTA 5BQ7A 3KNBB 2X6MA 5CUSL 4KK8C 1FVDA 3EW3B 1FNEA 1MFCL 2VXQL 4DN4H 2A77H 1WWCA 1NUDA 4DKEL 1ONQA 3VWKB 1U2HA 1N6VA 3TH4T 5B3JF 3ARBB 5AZ2H 4C59B 5EUOE 1UJ3B 4U31A 3PWLB 5DZOA 4NWTH 4MNQE 3ARGC 3VFGL 3VRJA 2VN7A 4QTHA 3D39E 4L4JA 1KB9J 1JPTH 4FHBD 2X4UA 5IOPA 4KPHH 5KVMC 1NBZB 3ECBB 3NIFF 4NKDA 5BMFH 4YDKH 4GW1B 3QQ9D 5IR1A 1OWRM 3ARGA 3MROB 1QHOA 3U36A 1PZ5B 3I6LE 2R39A 1ZT1A 4MSWB 4TUJA 3WUZA 2D31A 4Z7NF 3ZTJH 4M4RA 4D9RE 1MFDL 2VNCA 4YIQB 2ED9A 4M61A 2EIEA 3BXNA 2EIBA 5FUOL 4XX1E 5FEBA 2X7LA 3R06A 3I75A 3JWDL 4G3YH 1MFAH 2FD6L 1TJHL 4ELMA 1X7QA 3NACL 4KJQC 1RK1A 1BJMA 4Z6AT 5JQ6L 3MLTB 1FP5A 5DFVD 3A6BH 3FMGL 1RSFA 4F58L 1CBVH 5EO1B 1Y0LB 2EO9A 4MQTB 1JP5A 1UG9A 1YJDL 2XTJC 1I3UA 3EYUL 1KNOB 5I76B 3KPRB 3KYOA 2IBBA 4M9PA 4JRYD 4MZ2A 1MFBL 1NMAL 2F53E 3Q2CA 5DA0B 4YH6A 4HIEA 2C3GA 4KMLB 2FHFA 1EFQA 4LVEA 4LLWB 3BEVB 3ZL4L 1AQDA 5DEZA 2B4CL 2H1PH 5J13B 4TRPH 3EZJB 1V5JA 1CR9L 3EJYC 4FQPA 1C5DA 4H8WL 4WCYH 1NCBL 3GKZA 1TJGH 3PP3H 4R4FH 5DYOA 4UILH 3DJ9A 1F4XH 2APBA 2GFBA 4F7MA 2AK4A 3RVWC 1HI6A 4GRLD 3MXVH 1CVRA 5HGHB 1SM3L 3QUKA 4OCLC 1NANI 1BWMA 3MBEC 1KJVA 4KMTL 3VRLF 3OXRB 4NRYA 1B0WA 4LSPL 4MCZB 5E4IA 5C07E 5DT1H 1A1MA 2Z9TA 3U7WL 2C1OA 1D5MA 4ZFFA 2GYSA 3UROR 2P45B 5MERB 1YEIL 5A2FA 1E27B 4NC0B 3MBEA 5E0QA 3QQNA 4PJBB 5MEOB 3AB0C 1RJYB 5FDWA 1FGNL 2CGRH 2ZOLB 1PVHA 1DL7H 5EZLB 3T0ED 1I3GH 2E9WA 2XWTB 2WWMD 1HZHH 2AJVL 4HGKC 1CE6B 2ENSA 2EKSA 2J5LB 1BIIB 3LRHA 1VDGA 2FGWH 4UZGA 3EOBA 2V5TA 3N1GC 5F1IB 5FA3B 3ABZA 3LEVL 1F58L 3IDXL 7FABH 4DK6A 1YEEH 4WJ5B 4JG0H 4BSWA 2MHAA 3BN9C 4LLVB 1ZLVH 3UC0H 3SDXA 1L0XA 4HS6A 3WN5B 4N90E 3QXUA 1YNTB 1M6OB 3FT2B 1VGKA 4KDWA 2VWEE 4GUPB 3BDBA 1P7HL 2GQHA 3OGCA 4DN3H 1H15A 2VB5A 5CGYC 1FCGA 3MUGA 1U3JA 1HHIB 5HYJB 4JEGB 1P4IH 3IRZA 4HLZH 5JO5B 5ANMB 1JNHB 4JRYB 1DBAL 1FJ1B 1JWUB 4X9IA 1ZEAL 1G7JA 1ZANL 3GSRA 5IJVB 4R90H 1MAML 2IGFH 2YD6A 4OJFL 4XNYL 3LS4H 4M1GL 5C09A 3UJIH 1ZLSH 1X5AA 4XI5D 1DZBA 5FV2A 4ACPA 3DYOA 4WI4A 4N0CD 5HI3D 3Q1SL 1NGZA 2F8XC 1Z9SA 3VFMA 1A6TA 2QSVA 2VDQL 3MCKA 4NBXB 4K8RD 3VA6A 2FECI 3IU4H 4GRLB 3MGOB 3IAQA 1HOCA 4R97C 2V2TB 1CXHA 4JO1H 4L1HA 1B4JL 1PY9A 1I1AC 3MRLB 1G9NC 3LOWA 3P0VH 3N50A 3GI8L 2PYFB 1G9ML 2I27N 3S4SB 1HHGA 4JO2H 3DECA 1MELA 3GMOA 5JW3H 3ALXA 3NCJH 3OKEB 3TBWB 3PABA 2BNQD 5L6YH 1JZ5A 1GOFA 5KJRL 1SJHB 3DGGB 3O3DB 5FHAH 1LP9F 1NCAL 4WEUD 2NYYC 1I1AA 5JIHA 1AY1H 4TN9A 4X4YB 1CDHA 4WWKC 4BZ2L 4PJAF 5LCVL 1LP9B 4E41A 5EOTA 1MFEH 4N9GA 1LE9A 1IL1B 2FH6A 5TE4H 1DQLL 4YHNB 3T0EB 2XV6B 2YD5A 4PJ8D 4NQSA 4PJAB 1R3KB 2R0ZH 1RUAL 2ZCLH 1Y6KR 4GXUN 1I9EA 4KKNA 2CK0L 2A9ML 4J4PD 4WWKA 4ZD3H 1HHKA 4GMTH 3O2DA 4E0RA 1VACA 1K4CA 3FT3B 4HGWA 2XN9A 4W6XB 3O6ML 4ZQKA 2KQMA 4KQ3L 2I5YH 4P9MH 3DSFL 1R0AH 3K46A 5J6GA 3PGDB 1U3HC 4LSDA 3BN3B 5FGBC 3OAZK 5CILL 3ULUH 4S0TD 4ZSOE 3VMOA 3RI5K 5MEPA 3NABL 2DMBA 3TT3L 5HHMD 3CXHK 3L3JB 4HKJA 2NXYB 3VG0H 5GGVH 5F6IC 2NQCA 3DV6A 1KN4L 3CFBB 2YD4A 1QTYT 4YHMH 3TT1H 5DUPL 4YHOL 2CKBH 4HFUH 2AXJA 4KK8D 1U3HA 5JMRA 1KFAH 5FGBA 3WFEL 2OK0H 3IYLW 4YXHL 1M7DA 2UY6A 4U6TA 3IDMA 5D1XD 4M6ML 1BREA 3E3QE 3U4BH 3P40A 5CP7A 5IVOA 4K7FB 3J7HA 5DJXA 4LVHC 5DHXB 1H0DA 5EFIA 2CR3A 5SWSA 3ARGD 2GUOB 1U95B 2R1XB 4R3SB 3MRMB 5EC1B 2NY6C 1T2JA 5GS1C 3OG4B 2IMMA 3CLEL 3GUTB 4MJ6B 3DVIA 5GRUL 3V6ZA 4X0KB 5CAYB 4CGTA 4YUEL 3TH2T 2XI9A 3FN9A 3HPJB 4QHUA 4PJHA 3B83A 1S9VA 1CFQB 1CF8L 1T2XA 2DLFL 5GS1A 5HVHC 5DK2B 4U1JB 5FGSA 4JLRA 5HJ3B 1PW3A 1RIUH 2AXGA 5FHBH 2VDML 2BNQB 1IBGL 3QHFL 1HQRB 3Q3GA 1P53A 5ESAB 4KGLA 4CVXB 1MH5B 4IEFB 1LO5B 4KJQD 1BLNB 1HSBA 5TFSL 1FZMA 4U6YA 1V3MA 3DX6B 1EEZB 4RAVB 4MD0A 3F5WB 5C7XL 3FN3A 3RX7A 5K9OB 4K2UL 2X5PA 1I1FB 2XTJD 1I7UA 4KHTH 3VXME 4I77L 3UYRH 4Y7MA 2WAHA 4D94A 4GRMA 4AL8H 3HRZA 1BZ7B 1CDBA 1ZT7A 5I8CA 1NSNL 4Y16D 1G7IA 2ICEA 2N7AA 5CGMA 1BEYH 1NDGA 5DLMH 4CMHB 1F4YL 1OVZA 1EXUA 5J9PB 2AK4D 1R3JB 2EH7H 5H35B 1XH3A 4XMPH 3TCLB 4BH7A 5F7LB 3I84A 4MJ2A 4U1IA 1FVDB 4ETQA 3DX9B 3QO1A 2CXGA 3GHBH 1FVEB 3EJYD 1RZJL 4FQQA 3QUMA 3ZE1F 4LIQE 3BPLB 1HXYA 5I1AA 5GZOC 4L8DB 3RVWD 3VFVA 1A7RH 2D9QB 4XT1C 4PB9H 5F70A 3OB0K 5AAMA 2H9GB 4X4ME 3MBED 3ILQC 2BDNH 2X4UB 4KVNL 3VH8G 3K1KC 4UUJA 2NX5E 5D1XB 1KB5H 3X13B 1KIPB 4GH7B 4Z8FL 2DIAA 3PP4L 5E2WL 1OP5K 4LKCB 2APXA 4LMQE 4H20L 1YEGL 1YMME 3U36B 1ZT1B 3L6FA 4WEBH 1W72A 3FHAA 2R56H 4NO2B 1BAFL 1CLYL 3BXNB 3KWWA 5ALCH 5IUSA 1FZOA 2Y5EA 2D7QA 4ELMF 4PJGA 2C7UB 2X7LB 3R06B 5GJTL 1YQVL 3I75B 2QSCL 1FO0H 5D96C 4LSTL 5AG9A 5HDQL 3IB4A 5C0DA 5DJYA 4ELMB 3MXWL 4G5ZH 2XZZA 4JFHE 5BRZE 1JPFB 4JFZH 1Q9WA 2ZJSH 4ZODA 3B5TA 4I3RL 1D3CA 3FB7A 3KLAA 4AIOA 5INCB 1JZ6A 1WVZA 4FABH 1S9XA 3BN9D 3SDDC 3K3QA 3ARQA 3BP4B 1U8HA 3MJ9A 4NQED 5EORL 1A6VH 1O5DT 2Z0BA 3KYOB 3QA3A 1WWAX 3JVGC 1U8LB 2ITCA 4DTGL 5I6XC 2VDLH 4J6RH 4MAYB 3HG1E 3IFPA 2VOTA 4WEMB 2GJZA 3JWNC 5CGYD 4W4NA 1JUFA 4NFDA 2XTJB 3JV0A 2ID5A 3RVTD 3SDDA 1VGEH 5FUCE 4JPIA 3UPRA 4PJ9C 1AQDB 3JVGA 4PJ7B 3FQNA 1CGTA 1CE1L 4JDZA 4CDHA 4K3JL 1T22B 2Q86A 4ZOCA 4Y16B 2BERA 3FFDB 4OQTL 3T2OA 2EIDA 2ZNWA 4FP8H 4JKMA 4F7MB 1ED3A 5J4MA 2IANE 4G6KL 1AXTH 4NGHL 3MLSH 3VXOA 1YPZA 1Q9OA 1C5BL 1WAAE 1KJMA 4PJ9A 3CVHL 3VDCA 1ZTXL 1KJVB 2Q1EA 2W60A 3SY0A 3B9EA 4PB0L 4NRYB 2YMXL 3CH1B 3O3AA 2OMNA 1FVCB 4WHTA 3RUGE 3H3KA 3H9SA 2NY5H 4ZFFB 4H0HB 2HAZA 4AT6B 4NNPH 1I1AD 3UTTA 2V17L 4GAJL 2Q76B 3M45A 4EUPH 1LE5B 3EO0A 3HC3L 4E41D 4KV5F 2GSGA 1SYSA 4M3JA 5I2IB 5BO1H 1CDCA 1I8IA 1CD9B 3U0TB 2PTVA 5D7JC 2Q8AL 4QXTA 2DQGL 3VRIA 4MJ5A 3PGCA 4RWYH 5F44A 2NYYD 1WWBX 4MXVE 2WUCL 3LKPA 4WWKD 3AB0B 1RZKC 2OL3H 4BFBD 5LGKA 5E8PB 2XN9D 1CFTA 2J6EH 1BD2E 3MRDB 3SDXF 4LEOA 4JPWH 5D7JA 4WGWB 1WZLA 3UAJC 2QQKL 1XF5B 5JXAH 3AU1A 4NQDD 2ITDA 3L3GB 43CAA 2PCPA 4BSWB 1HKLL 2MHAB 1ZSDA 2R2EB 3O9WC 4ODTH 2E8YA 4HS6B 2OTUA 4WI9A 1FZKA 1LO0L 3DVGA 3HTLX 3ZYIA 4RQQA 3ZKND 1BBDL 1N8ZB 3VFOA 4C57C 3OGCB 2VDKL 1H15B 3FAWA 1IC4L 5CKAA 2IWGA 3GGWA 4KH2A 4C4KO 4JB9H 3O9WA 1U3HD 1KYOK 2DQFA 4NQEB 1EHAA 1SY6L 5HYSB 1C16A 1I9RL 1S7SA 1OW0C 1DQQB 2VDOH 1P69B 2YA2A 4HH9A 1XGUA 3QEQA 1HIML 4FQXC 1BQUA 3OXSA 2Y23A 1QBML 3G5VA 3EO1A 4H1LA 1CGYA 5E2TH 3AXLB 5DRWA 2JCCE 5SWSD 3R8QA 4PR5A 1IT9H 1JGDB 1OW0A 3HMWH 1NPUA 2YPVH 1QFUH 3VFMB 1ORSA 2HTKC 4AJ0A 1IGCH 3MCKB 3V0VA 1RIVL 1U92B 3FZUC 3S3JA 4LSRL 4NYLA 3U0PB 4K94H 3PJSA 3GRWA 3H6JA 3VXQA 4XVUC 4AH2A 5DJZB 1A9EB 3KPPA 5BXFB 2NY6D 5GZNC 3JUZA 1KTKE 3GMOB 5CZXC 4OCWL 5HGDA 2G5BA 2BVPA 2DI9A 3PABB 1LMKA 2APFA 4R97B 1S7UA 4P57A 1VEPA 3ROLA 4XMLH 2DM4A 1I1AB 5L9DL 3CFJA 3Q6GL 5HHXL 1AD9A 1INDL 1WIOA 5HYQB 3FO9A 1P84K 4E41B 4N9GB 1LE9B 5D7IA 1KCUH 4NQSB 1B6UA 1W0VB 1JFQH 4HQQH 3WFBH 4QHNB 3ZSSA 4PJ5E 2DBLH 4G6MH 2L0DA 1A4JA 4J23A 4WWKB 1OAUL 1EHNA 4AYFA 3UTSA 1VACB 1DDHA 4HGWB 2VR4A 4G8GD 3UJJL 3ZT7A 2V5MA 3BZFA 2R1YA 4NQDB 2EXYD 2HVKA 1U8IA 1S7WA 4Z7QF 1FH5L 1LVEA 2F15A 4ZS7L 4LLAA 3MV01 1B88A 4JR9H 3GSQB 4HMEA 2VDNH 1MVFA 2OP4L 5MEPB 5T1LD 2JIXA 1Z3GL 2V9RA 3WS3B 4HKJB 4R7NB 3HZVB 3QDGA 3VXSA 1VFUA 3DV6B 3RL1A 2FR4A 1FRGH 1S7QB 3WLWC 2X1XR 4W4OC 4XGZA 4NKMB 4XVJH 1J86A 5F9AC 1U3HB 2N4IA 5CEZD 5K9KA 1UEMA 1BFVL 1CU4H 1H8OA 4DFHA 5IGXH 3WDHA 1TZHA 5F6IB 5E7FA 1LO2L 1N7ML 1NAKH 2X4OA 1QP1A 5GZOD 2HTLC 4KJYA 3PL6C 4W4OA 3NA9H 5DJXB 3CZFA 1HYSC 1F02I 1H0DB 4HJGA 5SWSB 4RMTA 1YQ2A 4LNVA 2N7BA 5CINL 2IALB 4HBCL 5FYJH 4XHJC 4S2SA 3LY6A 5TF1H 3PL6A 3HI6H 4PJHF 4LVHB 4NRZB 4GLRI 2V7NA 4M7LL 3IETB 4MX7B 5DQDL 4QHUB 4PJHB 1QSVA 5KSBA 2NY6B 4M7LT 4QHKJ 3VCLB 5DQ9B 3RWIB 1A6AA 1T89C 3DXAA 3WIIL 1AR1C 3MO1A 3U79A 4D9QE 4XAKE 3KPRE 1ZS8A 1I1RA 1OPGL 2R0WH 4C54A 4Z78A 4X80L 4MDIB 1HSBB 4X5XB 1FZMB 4U6YB 1WIUA 2XKNB 2ERJC 3FQTB 1IC5L 1D5ZB 1QPPA 5HVHB 5IEHB 2Y06H 2EDQA 1QVOB 1T89A 4X8JA 5SWZA 2C1PA 4PGJA 2K9UA 4UINL 3U2SB 1I7UB 1IC7H 2P24B 3SDDD 2DJ4A 2X4SA 1D5IL 4OIIH 4XNXL 4DUWA 2OXHA 4MNGA 3HRZB 1A6UL 3C8HA 2HFEA 5GGRA 3TN0C 4NZUL 2ICEB 3KDMA 1NDGB 4G8GB 2BY1A 1EXUB 4LLUA 1QO3A 2ARWA 4LOUD 3SE9L 4KTEH 1J8HD 4PJFA 4ODWA 3RPKA 1KENL 4PJ9D 4IRZH 4OI9A 3X12A 4ETQB 3VRLE 1X6LA 5CJOH 4WVRA 1QEWA 3TN0A 5T1LB 4U3CA 2M26A 5E6YA 1JNLH 1HXMA 5DJAB 3H42L 5AZEH 1HXYB 1CK0L 3H9SD 3TM6A 4OM0H 4PJBE 2WUBL 4JKPH 4UDTA 2R0KH 5HHVL 1KJ2B 2P8LB 4OI8A 1B3JA 3UTTD 2UZIL 1UACL 5IFAL 2DQEH 3GJEA 3KPOA 4RISH 1MWAB 3V52L 3BE1H 3U4EA 4YWGL 1R3LA 3B3IA 4GFTB 2O61A 1D6VL 2EICA 3WHXB 4DOHB 1J10A 2X4NA 1P6AB 3L6FB 3NA4A 3MUZ1 3P30L 2R69L 5IQ7L 2Y6SC 1KJ3L 3KWWB 4HS8L 5BV7H 4QYOA 4NKIH 2R9HC 4UV7H 5D7JD 1T80A 5GRVK 1XAUA 1QD0A 4LKXA 3HC0A 5KOMC 5C0DB 5DJYB 2QKIB 2P49B 3LSOA 2VLRD 3P77B 1Q9WB 1NC4B 5BVPH 5ETUA 3WEXB 1T1ZB 1XGYL 2P8MB 4NN5C 5HYJE 5EWIH 4F3FA 1NBQA 4WRLA 5AEAA 3F7PC 2F74B 3BZ4B 3I3BA 3VD5A 4X9BA 5ANME 1YN7B 5D96B 4LSSL 3ZTNH 5JZ7C 4JRYE 4Y1AA 3IDYB 5DUMH 1U8HB 3OAZH 3MA9H 2ITCB 3D5OF 1WK0A 3ILPA 3IFPB 5EG6C 2GJZB 1T1WA 4CUCA 4JQIH 2A2QT 3SDDB 5E8DL 4HF5L 1E6JH 3UPRB 5ISZA 2IPKA 2R2CA 3FQNB 3GMRA 1GAFH 4FQXD 4JDZB 5I6XB 3VXNA 5GISL 4X99A 2H8PA 1YPZF 2ZP0T 1J8KA 1I4FA 4MB4A 4X6DF 2C5DC 3P3YA 5E2VL 5I15L 1F3DJ 4YFEA 4KMQA 4JFDD 1ACYL 1YYML 1J8HB 1MPAH 3VXOB 1YPZB 3SKMB 4PJ9B 3KYKL 4OZHA 4X6DB 4XB8A 4WU5A 2W60B 3BIBX 3SY0B 2XPGA 2HTKD 3HE6C 3ES6B 3O3AB 3FZUD 4HK3J 2RAMA 5ICZA 1LEKA 1BVZA 1IQDA 4RA0C 4U6HA 4NN7C 1LP9E 1AGBA 3IFOB 4XMKH 4XVUD 2CLZB 3UTTB 4YDIH 5GZND 3T0EE 4PJAE 5I8OH 3HE6A 4L3CA 3SDAC 4Z0XA 1YUHA 1N5YL 4X5LA 5CZXD 4NNXB 1A2YA 3U9UA 5IROC 3OHXB 4JFYA 2VLLA 2IAMB 1DSFH 5FYKH 3VRIB 3QQ3B 3PGCB 3A6CL 4ZXBC 4D9LH 1UZ6E 3LKPB 1FYHB 1OWWA 2P5WA 1NCDL 4OAWA 5GGQL 4AIXA 3SDAA 3UTSD 1T1XA 5GRXG 1CFTB 4X9HA 5IROA 5E5MA 2Z8VC 3WIHL 5CEXA 3O45A 3ULVL 4FNLL 4OCMC 5DGQA 43CAB 4ZXBA 3SCMC 1AGFA 1ZSDB 1T0MB 3SE3C 5JHLL 1FIGH 2XT1B 1FZKB 2VLRB 4IOSD 1IKFL 2JIXD 4S1DC 1QFWH 5FFLA 4BQCA 4EBQH 3QDGD 3VXSD 3VFOB 2W59A 3K4ZA 1J1OH 4EQ3A 3MUJA 3QNZA 2NY7H 4OM1L 4PRHB 1W8OA 3GGWB 1ZGLP 4JZNA 3BD3A 2UWEA 3SE3A 3EYSH 2Q7YB 1JHTA 3EFDL 1S7SB 2OJEA 3LHPL 1GOHA 4HH9B 3B8YA 2DKSA 3G5VB 3EO1B 4GRWF 4HIXH 4RWHA 3WLWD 3S96A 3RZWA 1CT8A 4H1LB 4JZJC 4PFEA 4QXUH 3TV3H 4L5FL 2ZG3A 4GRWB 5DDHA 4Q6IB 3STZA 3OB0H 1ZA3A 2R4SL 1A1OA 5FO9A 4FQXB 1JZ2A 1MCHA 1ORSB 2AABL 2LVCA 5JIPA 2CDGB 3CPLA 3V0VB 4OD3L 2NY0C 4M5ZH 3ZE0F 1YY9C 4JZJA 3N1FC 3BRFA 1HYSD 3RKPA 1KT2B 1OP5H 4D0BB 4JFDB 3PJSB 4U6VH 3RA7H 3VXQB 4P5MA 4FFYH 3M17B 4PRDA 2B1HL 5DR5H 4A6YL 2BNQE 4G8FB 2YC1A 2YUXA 1JJUA 3DXAD 3V4UL 2BJMH 2G5BB 2BVPB 3UBXI 2PW2A 4DZBB 4HFWA 1YEJH 4HWZA 4ZUUA 4FFVC 4P5TA 1S7UB 4OQ1A 4Y5XC 3HMXA 2PYEA 1QSFB 3MRQA 4MA7H 4AENB 1ZA6B 5TH2B 3QO0A 5B8CC 5D7IF 3CFJB 3N1PC 1QRNA 2OZ4H 1AD9B 3FO9B 3SKOA 3O6KH 1S5IL 1AR1D 5SWZD 4KY1L 1QBAA 4XCNA 2ZPKH 1K6QL 4NT6B 2FZ3A 5KSVA 1EUUA 5GGRY 1OAZH 1U8OA 3RNKA 3IDNB 2R2BA 1AE6H 2MFNA 5B8CA 3RPIA 1I8KA 3FO1A 4ZOAA 3QULA 3ELAT 3WL9A 2X2YA 2D0GA 3K4DA 1VADB 3VMNA 3MV7A 4XNUH 3N06B 4A2MA 2OSLA 5FAAA 1TXKA 4U7KA 3WXVH 3BZFB 2KH2B 3HI1A 4TSBL 2R1YB 5HHME 1IFHL 1QR1A 5DVLA 1FL6A 1F3JA 2N1KA 3BWAA 3IT8D 2JIXB 3ZE1E 4EOWL 5I30L 5IWLC 1Q0YL 2X4RA 3IF1A 4I0CC 3RL1B 2FR4B 5I1LA 4MZ3A 2AEQL 1GHFH 3OKLB 4QO1A 3EYFA 2AJYL 2NCMA 1FYTD 3GJFB 3GSNL 4UT6H 3ULSB 2Y07H 3QCTH 1WJ3A 2LU3A 3EOAB 3IU3A 5KVDL 4LPUA 5C6TH 5K9KB 4OLVL 3BPCB 4WW1B 1TZHB 5IWLA 4V1DB 4XP1L 4JPVL 2X4OB 4BUGA 5DD3L 5JW5A 1ZHBB 3BH9A 4K9EC 4NDMA 2NLJA 5L2JA 4HJGB 4M6NH 2ZUVA 1YC7A 2NY1C 4N8VG 2ZCKH 4AEHH 5GXBB 2ZZUT 4OD1L 3ARDB 4ORZC 3FRUA 4OGXH 1GZPB 3S37L 4ELME 1U91A 4XVSH 2CSPA 1A6ZB 5HGAA 4HK3N 4NM4H 4PGDB 4CW1A 4BJLA 4OCSL 2AQ2A 5KSBF 3GNML 4BSVA 1SMAA 2V7NB 3RWFA 3SE8L 1TTGA 1MCOL 2Y6SD 1KXVC 3E6FA 3NIGF 2R9HD 4D0DB 3GIZL 2JF1A 2CIIA 5F9JB 1UB5A 1C7SA 2Z31C 4Y1AD 4BYHA 3P11H 4MB5A 5FKAB 2G9HA 2OI9C 2A83A 2C26A 3MZTA 2OMBA 2CKNA 4N8PA 2VR5A 3OX8B 3WJLA 2XTJE 3H9ZA 3INUL 5EPMB 3AS3A 4PJEA 1RAMA 3DVFA 5SWZB 1A8JH 1UGNA 3VW3H 2ICWA 5DJ6A 4OBRA 5E95B 5EN2A 1JGEA 1U3YA 2Z31A 2X4SB 1KPUA 1NGPL 1PY4A 2Q6WB 4OCYH 4AEIL 2VL4A 1NUNB 4IRSC 1FLRH 4FXKA 5I9QC 3DETD 2GITA 3U6RA 5DHYA 4TUKH 4PJFF 4NBZB 5I0ZA 3OTTA 3UTOA 1KCRH 4LLUB 1QO3B 3WS6C 1F2QA 4UV4H 4B7LA 3QQ4A 4YNYA 3M8OL 3QG6B 3X12B 3KGRA 4HPYL 4JVWA 4OV5A 1KTDA 4IRSA 1URLA 1QEWB 4N68A 4MXWH 1B2WL 1IEAB 5C0NC 3NZ8B 4O58L 3DMMD 2DS4A 4MD4A 4Q0XL 3WS6A 4BZ1L 1FYTB 4U7SA 1ZWIB 3BESR 4MJ4A 2DLTA 2BOBB 1CQKA 1N6QH 4TVPH 3U7YL 3GSUA 4L8BA 1KLUB 3U4EB 1RZFL 1R3LB 3AROA 1WUNT 2HT2C 4M3KB 5CD3A 3CSBA 2UV3A 3BAEL 2HLFD 1IGMH 4JY5H 2X4NB 3D2UB 2OYPA 2P5WD 4NQVA 3QH3A 2PO6D 3SDAD 2DIBA 4HUXB 1YJDC 4HX1A 4QYOB 3ISWA 5DRXB 5T3XL 1U41A 1JYWA 1IGFL 5T5FH 3QUYC 4E5XA 4LKXB 2Q3AA 4JG1H 3T77B 3MRCA 5I66A 4Q9RL 4D8PB 1PLGL 2XZAL 5FB8B 1MCSA 4YHKH 4O2EA 2VDPH 5D5MA 4NQEE 5D8JL 3WSQL 2B4CC 3QUYA 3SCMD 4Z77A 4Y1AB 1CFBA 1CZ8H 3VJ6B 1RUMH 4FZ8L 5ID1B 3VXPA 4S1DD 4ZPVB 5IKCA 1XMWA 5TDOB 5IEKA 2M2DA 1RFDL 3N9GL 2BY2A 2BCKB 5TGBA 5ESVA 3KLHC 4K71C 1KBGL 3TGXA 6FABL 2P8PB 5ICYA 4CADB 2X1QA 3GMRB 1OD9A 1EZVX 5IIEA 1G7PA 5FUZH 3BWUC 1OSPL 2D0HA 1FFNA 3RX5A 3D0VA 5J57B 5BCAA 1FBIH 4OZHF 1ZMYA 2GW5A 4M1DL 2DJSA 4XCYA 3SDCB 3MRKA 2WBKA 3FFCA 4ONOA 2GT9B 4Y2DC 4OZHB 1MVUA 3ZKQD 1YECH 5KVEL 4WU5B 1BJ1J 4MWFB 1FDLL 2XPGB 4KVCH 1WFOA 3A67H 3WFZA 1WISA 1YY9D 3DMMB 1MOEA 2EIZA 1UZ8A 1TQBC 4AMKL 5C08A 3G6JB 3G5XA 2FX9L 4Y4HC 3CLFL 3BHBA 5BJTA 4Y2DA 4E41E 5EH1A 2AJ3A 4K3DL 2O93L 4J3VA 5J12C 1T2QH 2XQBL 2ILLA 3UTPD 3GK8L 4OCXL 1QRND 5ICXB 2DQDH 1Q94A 4L3CB 5B21A 1AFVL 1EFXD 4Z0BH 1A2YB 2YK1L 1TZGH 4FFVD 2VLLB 1SJXA 1PBYA 2WK2A 4Y4HA 4C55A 1FL3A 1AQKH 35C8H 3HS0B 1GGCL 2LU7A 3T09A 1UVQB 2PO6B 2VABA 1G9NH 3ZHLA 4N0FA 1T1XB 4NQDE 3RP1A 1VFAA 3MV7D 1OCWL 1W0WA 4D3CH 5E5MB 2MWCA 5CEXB 3O45B 1BOGB 2CK2A 1ND0A 9CGTA 4OKVB 3CFKA 4LHQB 3L3IA 1AGFB 3HNVL 3ZDZF 4G42B 4M7JH 1AIFB 3QXAB 2EYSA 1PX4A 3NBNA 4LHJB 3FQWA 2UWEF 5IHUL 1KN2L 4KZDL 4BQBA 1AHWC 4L3ED 4PG9A 4YX2L 4ALAL 2BSED 1TJIL 4UIMA 3SCMB 3DRTA 2ATPA 4KAQH 4UIKH 1KEGL 2UWEB 2PNDA 3T3PE 1LGVA 3DHJA 5D7KD 3B9KD 4PYGA 1I9IL 3T0AA 1JHTB 4GAFB 4NRXA 5C3TA 2OJEB 3O0RH 2D7TL 2FX8H 3STLA 5AAWA 3QHZH 5SWSE 2PF6A 1XZ0A 4XPGL 4LF3A 1CT8B 1AHWA 1BGXH 3WNNA 1GSMA 2NZ9C 3FJTA 3P9LA 4U1MB 1T0NB 5DDHB 4QRTB 1Z0MA 2ZUQB 2WQRA 5CFHA 4YBQC 3PQYA 1G7MA 1ZA3B 1A1OB 4ODSH 5FO9B 4P2RA 1DUYA 3CPLB 2D03H 2HMIC 4JZJB 5J1AA 4PJHE 1G6RL 3B9VA 3KYMA 1P4BL 3G9VA 1X9QA 3L5IA 2B0SL 2NY1D 4P5MB 3TIDA 4F7PB 4PRDB 3OKDA 4B41A 3PGFL 2MQCA 4IOIA 1Z9LA 2PW2B 3LIZH 3HAEA 5F71A 1NBYB 5E99L 5HHOD 1KIQA 4YR6A 3MRQB 5TE6L 1P6FA 3QO0B 4IIQB 4LVOC 5T1DL 1QRNB 1A47A 4LK4A 1JNNH 2ADIA 1EGJL 1AGEB 3SKOB 1EFXB 4XRCB 4MAUH 1JK8B 3BZEA 5ACZA 2QTEA 3DNKA 1PKOA 3ZT5A 2FZ3B 5KSVB 4QF1B 5E00A 4JKWA 4KI1A 4Y5XB 1KG0B 4Z7VF 5TQ2H 3L3HA 4K55A 4G8GE 4PP1C 1ITCA 3T65A 4PGEA 5B8CB 1I8KB 4OSUL 4NUGH 1A4KB 3FO1B 4DCQA 2HLAB 4XVTH 4Z7VB 3G08A 4P46C 3MV7B 2EDDA 2YBRA 2OSLB 3MACL 3V0AC 4W6YB 1J1PH 1OT2A 2F54A 3H9YA 5SWQA 3SKUD 2QBWA 5ADPL 1U93A 3DROB 1UH3A 2ZCHL 3QFJA 2DQJH 5HHNA 2FWOA 3OAUH 1Q1JL 4IRSD 3MV9A 5SX4I 4GBXC 4AG4H 1Q72H 4X7FC 2X4RB 3IF1B 4P46A 3KJ6H 1JRHL 3HI5L 5CEZE 3EYFB 4L3EB 4G9DA 4LSUL 1X4YA 3QEUA 1FPTH 1DQDH 4XPTH 4FQ2H 3B9KB 5ENWA 2R1WA 3L9RA 5EDXA 3T08A 4X83A 5I1KH 4JFEA 5KS9A 3CX2A 4GBXA 2Y4SA 1F2XK 3WFHA 5C0ND 1IAIL 2AJUH 1CIDA 2F58L 2W9LA 4DOHE 2RR3A 2OXGA 5JW5B 3KR3H 3QIWB 3QUMH 1JF5A 2NTFA 4OB5L 4K23H 3WNLA 5L2JB 2NLJB 1XGTA 1KEMH 1QNZL 3S34H 3AGVA 3DURA 1D6EB 5C2BL 1OTUC 4HWEL 4K3GA 5DQJA 3HUJA 1SYVA 3EHBC 3FRUB 1ZV5A 2BX5A 5C0BD 3VGGA 1VERA 1WITA 2VIRB 4KTDL 2R29L 2HT2D 5BZWA 3K2UL 4HG4K 1SEBB 3ZKMC 4BSVB 4QXWA 1MAKA 2NY1B 3DLQR 2VXVL 3RWFB 4R0LC 1WC7B 5GRJL 4YHIA 4WDIB 2X1PA 5T33H 4CJ0A 1OGTA 1HH6B 2RCSH 2KQNA 5FGCB 1GYAA 1II4E 2DI8A 4HIJA 5I17B 3CMOH 3ORJA 5HHOB 2G9HB 4R0LA 3MRPA 4X6EA 4IBLT 4PJEF 1BPVA 1UXWB 1OTTC 3MLWL 2R23B 3MR9A 4PLKC 4YGVA 2ORBH 4Y4KC 1CWVA 3IDGA 1MREL 4PJEB 4GAYB 2YWYA 1FFPA 3FRPA 3AS1A 4G8EA 2ICWB 1UCTA 2Y36H 4N8CL 5IQ9B 3LV3A 3NFSH 1BZ9A 1MLBB 2VZOA 3ZO0A 1UWGH 1KPUB 3JWOL 2Q8BH 5IMLB 3QIUD 5D1ZD 3MJ9H 4Y4KA 4PJDF 1DLFL 1J8HE 1P1ZA 3U6RB 1YPZE 2K7PA 4TSCH 5T3ZD 5BOZG 4X6DE 5TQ0H 3DRQB 5F7MC 3BFOA 4PJDB 3SDYH 3VGAC 1A5FL 1G0XA 2YRPA 2B1AL 5I8KH 4YNYB 4J2XA 4YO0A 5CSZB 1KTDB 3KYNA 4IRSB 4ZUWA 2EO1A 5DJCB 3CVIL 3DSNA 1P7QA 2IBZY 3LZFH 3PWNA 3UTTE 4MD4B 4JVPA 4ZPTA 3RVXC 1EA9C 4GXUM 1T4KA 3KPQB 1JZ3A 4Y2DD 5K59E 4O4YH 3WFCL 3C8KA 1K8IA 5EULV 4JDVA 1MJ8H 2XIDA 3GO1H 2WIIA 4QHKI 3GSUB 4P3CH 3UYOD 4MB3A 2BVEA 3WXWH 3C9NA 4BH8A 3AREC 2VLKA 2EC9T 2PTUA 4Y4HD 4JHWH 1S9WA 4EI6A 2VC2H 3MNWA 5EZOH 4QRRA 4L9LB 5A2IH 2RIKA 4YE4L 4NQVB 3QH3B 1A7PL 3L7EA 1XR9B 4UDUA 3AREA 5C0BB 5A3ID 4X8XA 4I5BB 4XP9H 2VLRE 5J3HC 4E5XB 1UYWH 3CU1A 1XCTA 5AG8A 1PKQA 3MRCB 4JHZA 3S88H 1TVDA 2D4DA 2APTA 4JVUA 3V0WL 5D5MF 1HWGB 5AWNL 5DUBA 4PRHE 3NPZB 5GIRA 1K2DB 1UKTA 5DO2C 1NAMB 4ZNEE 5JHDA 4ETYA 4O2EB 4Z7UB 5KANI 4ODVL 3X11A 2OR9H 4KQ4H 2R2HA 5LJYH 3V6OC 3RZCC 1B0RA 1I3RB 5D6CB 5GHWH 2BRRH 5KVGH 3IGAA 4HV8A 3SQOL 3ARFC 1FFOA 3H0TB 4EI5C 5IEKB 3MBXL 4GRWE 3A0OA 5TGBB 1RZKH 5ESVB 4LSQH 1DP0A 4QRQB 2DIJA 2E6QA 4PJCA 4ZFZB 3V6OA 3RZCA 3MRGA 4OQTA 3ARFA 3QIUB 5D1ZB 3GEWB 3THMH 4EI5A 5KW9H 4P2RD 3DX8B 4JFDE 4ZFOL 5ERWB 5ADOL 5LGJA 1CVSC 4QOKA 4YHZL 3MJ7B 4LHUB 4KXZH 5IG7A 1RUQL 4GSDL 4YBLC 4LP5A 1MVUB 2VERN 1J0KA 4YBQD 3IDIA 3CFEB 4H88H 2HRPL 1M05A 1QSFE 2HMID 4XPBH 4IDJL 4AIZA 1FAKT 4RX4A 1L7TL 3OJDA 1UWEH 3VDAA 5BJTB 2YXFA 5GGSB 4Y2DB 5EOCJ 3G5ZB 3IJSA 5E03A 4ONFL 3W81A 3DO7A 4X4XA 2DD8H 1Q94B 2G60L 1NLBH 4LPXA 4OLUL 2ENYA 4WV1B 5IVZB 2R8SL 1TQBB 3MNVA 4Y4HB 4XC1H 1U8KA 2IMNA 4WTZA 4K3HA 4FMKA 2XZCH 1YEKH 4PRNA 2IQ9H 3NZHL 4ZUSA 2VZ1A 2DQTH 1NKRA 4C83A 2VABB 4Y8AA 5EZIL 4OLXH 2AJZB 5IMKB 1W0WB 3A6OA 5AUMA 2F54D 3I6GB 3MOAH 5L7XL 4HS3A 3QFJD 3L3IB 1N0LA 4OLWL 2BVQB 4Y0GA 2FEEI 1QLRA 4PV8A 3MV9D 1F90H 4P9HH 2EYSB 1N0XL 4MVBC 3FB6A 3KPLA 4P46D 4J3UA 3GSWA 3NIDF 3IKCA 4DGVH 5HYSG 3QZWB 3FN0H 4PGBB 1SY6A 4F7EA 3BP6A 3HPLA 3ULUC 2ATPB 2EXWD 4NQUA 4V1DE 4JREC 5E6ID 1SJVA 3FQRB 4GAGL 1KPVA 1U36A 4OFPA 4RGND 4NRXB 3VMPA 2HT4C 4JRWA 5CWSB 1N5AA 4JM4L 1I7TA 5DWUH 4Q9QH 1CLCA 4LIQL 2HH0L 4E42A 1AHWB 4LSVL 1IAII 2HJFB 1A7NL 43C9A 1RURH 5E9DA 3V4PL 4NWUH 2FB4L 3RQ3A 3GBMH 4KK5C 5FYJU 1MCEA 3G5YB 2AEPL 4K3EL 1OF2A 1RZGA 4ODUA 4J3SA 2M8XA 3DX7A 4P2RB 1K85A 2VXSH 1UA6L 5L8LB 1DQML 4HUWB 2CKBA 4PLOB 4MQ7A 4ENEC 4MD5A 5IB5B 3R4DA 5J1AB 5K9JH 1UH4A 3QG7H 1MIML 2JB5L 3UXFA 4OGYL 3TIDB 1G7LB 1OTUD 3F8UB 3BUYA 3I2CH 1S7TA 2CRMA 3NIGE 2WZPD 4ORGA 4ERSH 3LMJH 5FCUL 1DEDA 4IOIB 3T4YA 3ZKMD 4U3XA 3IFLL 1KIQB 1DCLA 2BNRA 4N9OB 5JLZB 2ZKHH 5SWZE 1CICC 3SOBH 2W0FA 3BIKA 2Z4QB 3QUXB 5IT2L 2ADIB 4AM0A 1HQ4A 2DYPD 3BZEB 5ACZB 5H2BB 4PREB 2ZUSA 4FTVB 3C5SB 5C0CD 5AD0A 3MOBL 4I0PC 5E00B 2ZG2A 4Z7WB 4P2QA 1CFVH 3Q0HA 2V7HA 3L3HB 1CICA 3T65B 4F7TA 4PGEB 3OSKA 2FCBA 4LVOB 3VFNA 4J8RA 4R7DA 4YK4C 5B39A 4GXVL 4JDTL 4PJFE 3RGHA 3M1BB 4HGMA 4HWBL 1G7HB 1JWMA 1CTOA 4JN1H 4I0PA 4KROD 2F54B 2XA3A 3CDCA 5SWQB 2MQ3A 5EBWA 3TBTA 1VESA 1A7QL 3PHQA 2CDFA 4P59L 5HHNB 4ZO9A 4FQHA 1IGTA 2AK1H 4LRNH 1P7QD 1UCBH 3E8UH 5E94A 5HDBF 1FYTE 2BSSA 4P46B 3P0YL 4M4PA 3OPZL 5HHPA 1GC1L 2GI7A 4G9DB 3NN8A 5KS9F 1CDGA 1K4DB 1A7BA 1IAOA 1LO4L 3MLRH 1RHFA 3CX5J 5E6IB 1QLFB 5ENWB 4MA8L 4P3DB 3EDJA 5KS9B 4RGNB 1J1XH 2GJ6A 2DDQL 3WFHB 1KPRA 3MLZL 2MPAH 2GKIA 2VLKD 1JPSH 3JV4A 4XXCA 4BKLB 4IMKC 5D7SH 1CLZL 2CUMA 3TYGH 4EKXA 3BW9A 3HUJF 2BFVH 2VH5H 4XZUA 1P4LA 1XGTB 3DI3B 2DKUA 4QRRD 4M93C 2IC2A 4RFEB 2C9AA 3BQUB 3MTRA 1UKQA 4MGXA 3MRIA 3ARED 3O4OB 4IMKA 1PAMA 1YNLL 3ROOA 2DWEB 4X7SL 4BFIA 1YYLH 3BKJL 2YXMA 4M5YL 3UBXA 1QKZH 3LQAL 4QXGH 1KB5A 3O3EA 1IJ9A 1SJEB 3MMEB 4YHIB 2J7LA 1YC8A 5H94A 5CJXC 1OGTB 1OT1A 4I2XA 5EOQH 3AUVA 4Y1AE 3IFNH 1NMCB 2W92A 3U30B 2VXTL 4N1CA 1B9ZA 3S5LG 2XWBA 4UOW0 4AEEA 5J3HD 4HIJB 2JK5A 2NTSP 5BZDA 4KFZC 4HXBL 2Z92A 4RNRA 2EECA 4IRJC 4OZIF 1BQLL 2YRZA 5CJXA 3K7UA 2HJKB 4YGVB 1DUZB 1OAYL 1FAIH 5GPRA 3ARWA 4WTXA 4UTAH 3GSVB 1FO0A 1PX3A 2DYPB 1YY8B 4OZIB 2VSDA 3FO0H 3O4LB 5C0CB 3LV3B 1VPOH 3B2VL 5TDPA 3W39A 3GMPB 1EPFA 5CZVL 4IRJA 3IXAB 4YFLI 3GMLB 3ARFD 3EJZD 1KC5L 4EI5D 1JHKH 1UM5L 2JKXA 3BDXA 4M43L 2O5XL 4OZHE 4DJMA 5MP6L 4OF0A 3LN5A 2IPUK 4QOKD 5FYLH 1LDPL 4UNVA 4KROB 3HAEG 4J3OC 1YEFH 4OKDA 2B5IC 4G9FA 4ZUWB 1CGXA 5JR1L 3G6JE 3LS5H 2NXZC 1P7QB 2AV1B 1CDIA 2WWKO 1L6ZA 4HWUA 5F3BB 4RX4D 2XOTA 4ZPTB 3SEPA 3VGAB 5CBEA 2ZSWB 2MJWA 1K8IB 3G6DL 2H32A 2NY5C 5F8RC 1GH7A 3C08L 1RZ7H 4BH8B 2VLKB 1KV3A 2HG5A 1T5WB 2IPUG 2ADGA 5FYKU 1NLDH 1MCPL 1EV2E 1S9WB 3RAJL 2UY7A 2V2WA 2QQQA 3L7FB 3LKQA 4QRRB 3KXFD 1J5OL 3MZGB 3L7EB 4UDUB 4FXGB 3AREB 5E24E 4RDQG 5F6HJ 4PD4J 1JE6A 1F8TL 4F37F 5D7LA 3H2WA 1P5UA 3HHRB 5E2UL 3ZDZE 1YN6A 3PUCA 3ARZA 5GIRB 2EDEA 4AZ8A 1Q0XL 3T3ME 2UWEE 2GK0A 4MMZC 4PY8J 3T04D 4QRUB 4ESKA 1A21A 1OAXL 5F9OH 4DUXA 3TEUA 2R2HB 1B0RB 2OL3A 3C09B 4TUOA 4WI5A 2DQCL 3QNYB 5EA0H 4TTDC 3IGAB 4MVBD 4DUVA 1TDQA 4XBGB 4PJCF 1LEGB 1FORL 5F1OB 4RA3A 2PW1B 3QHTC 1UXSA 2JJTC 4OT1L 3FAXA 1VSCA 5EIQA 3MLUH 1IILE 3ULUD 5E9DD 1A6WH 2CUHA 1CXKA 1U8QA 4PJCB 1A02N 2IPTH 3MRGB 1UM4L 4G8IA 3EZ8A 1INEL 5SV3A 4EI5B 1X4XA 1Q9KA 3U0WH 4PP2A 4QRPB 5LGJB 2JJTA 1X5KA 3BP5B 4QOKB 1NL0L 4ZUTA 1MQ8A 5IG7B 4KK5D 5TE7H 1I1YA 1T5XA 2HWZH 1NCNA 1LEIA 5GS0H 3GBNH 3IDIB 4LMQI 5GRWA 3BVNA 2GTZA 5EC2B 3L95A 1M05B 5J56B 2OJZL 2IF7A 4K94C 4APQC 3LH2H 4ENED 1LK3L 4AIZB 2AP2A 4NHCL 3BMWA 3OJDB 3UTPE 1QRNE 1AXSA 1RUPL 3IDJA 3W9DA 2BNRD 5EBLA 1YDPA 3IJSB 1V8HA 3BT2H 5GGTL 4X4XB 4KJPC 1IVLA 4OI7A 3ULVC 3G04A 4X9GA 4APQA 1P2CA 3V4VH 2EE2A 3LPWA 3V5DA 5EO9B 3UEZA 1U8KB 3O41A 3U82B 4P2QD 4Z7VE 4M9OA 1S8DA 1BF2A 3LRSA 3MV7E 1CICD 3KS0J 2QHRL 2BY3A 4LLYA 4PRNB 4YHPA 3KXFB 2XKSA 3HMXH 3S36X 5LGHL 2OQJA 4LFHG 1NBVL 3NCEB 5D70L 4FG6D 5ALBL 3VGDA 5KG9A 1BQHB 1AXIB 1CIUA 2UVEA 4I0PD 3QDMA 4YQXL 4O02H 1C1EH 4PV9B 2WLZA 4HS3B 1SBBA 1WZ1L 4L4VA 3ME0A 4PV8B 3MRFA 4JGJA 5CEYA 1KLGA 4L3EE 3FB6B 1C12B 3KPLB 4DVRL 5JXEC 3GSWB 2X9XA 4FQIL 2IG2L 3EOTH 4O9HL 3TWCH 3RIFK 5D7KE 1XF3B 3QDJA 4JZOB 1BFTA 3HPLB 1TVHB 3W5MA 1M7XA 3HFML 4KRNA 1XF4B 1AI1L 1F4WH 1XEDA 1Z5LB 4KTYA 3T0WA 4BZYA 2GJ6D 2VQ1A 2YD8A 3ULUF 5JXEA 4S1QH 1I85C 3SHSA 1S7RB 4HC1L 4NSKA 2VL5B 2DTML 3V6FA 2J3SA 2QQNH 2P47B 2DOCA 43C9B 5E9DB 2EH8H 4H26A 4DGYH 4FQLH 3QAZB 3QCUH 5I1IH 3T8XB 5CBAA 1OF2B 3F7VA 3QIBD 15C8L 5GSVA 1K8DA 1S78C 1U58A 1I85A 2CKBB 1R3IH 4MQ7B 4MD5B 4PS4H 1JHLL 2R4RL 1TQCC 3DIFA 5HVGB 4A6YA 5I1HL 5GSRA 2XA8L 5J89A 5C0AA 1T21A 5FGCE 2RFXA 4DW2H 4L4TA 5DJ0A 1I7RA 1EVTC 2FIKA 4WENB 1CLOH 3I6KA 4XBEH 2DQIH 4XP6L 3MJ8B 4HCRL 5HHOE 4TPRL 4IS6A 1J7VR 3PHOB 4U4BA 3T4YB 4M7KH 4BK5A 1VCAA 5HI4C 2A6JA 2VZUA 2UVFA 1LK2B 2XNAB 4PG2C 5IVNA 4KWUA 1JGVH 1J12A 1JPST 3QPXL 1G7QB 4LASH 4OZGA 4PJEE 1OARL 2CMRL 2W0FB 1SBSH 3Q5OA 4KUCD 3HNSH 1JGLL 4U6XA 2HP4A 4OLZH 4XP5L 4OLYH 4ZDHA 5FF6A 5C0RL 4PG2A 4UT9H 2YZ1A 4KRPC 4F15C 4IRJD 2L4OA 2CPCA 3LD8C 1CICB 3TFKC 3BZDA 1FZJB 4JANA 1NGYA 4PJDE 5CJQH 4BK4A 4M62H 1OAQH 4P4KC 2F19L 3C60C 1N3NA 1MF2H 2JJSC 2FYYB 1OD7A 1A7OL 4I0PB 4QY8A 5EBWB 3S35H 4F2MA 3PHQB 4EIZC 4YXKH 3L3OB 4YXLH 5DD5L 4LAQH 4FQHB 1J88A 4WUKH 5E94B 3X3GL 3GSNA 4L9DA 5EU5A 2BSSB 5IBTL 3C60A 4JY4B 1I8MA 5DA4A 2JJSA 2H26A 1R24A 3QCVL 3EYVA 5H8DA 4XPHH 4RIRA 3NN8B 4PPTA 4MJID 1CDUA 1PQZA 5CUSH 4JPKL 1MFCH 1CQYA 1HHJA 4RMWA 2VXQH 1EAPB 2NXZD 4DKEH 2GJ6B 1VA9A 1JPGB 1KB9K 3REVA 5EOCL 5HDOA 1ITBB 3TESA 2IFFL 4XPFL 3SGEI 5I1DA 1MFNA 3REWB 4UNTA 3VFGH 3MFGB 5C0BE 3G6AA 3QIBB 4JKLA 4JFQB 4XBPB 3IXTA 4NHUB 3MRIB 4RSVA 4Q6YA 4MA3A 1FCCA 4ZO7A 3P9MA 1F42A 5D7LD 1QFPA 1JZ4A 3O3EB 1KB5B 1T66C 2P5EA 4M93B 1HE7A 4GW5A 4Z7UE 1CS6A 1H3VA 5BV7C 4NBYB 3ALPA 1MFDH 2E5EA 4I2XB 5FUOH 1RD6A 2VQUA 2X4QA 1TNMA 2VLJA 4XC3L 3RVVD 2IBGA 3ARXA 3QJHA 3SPVA 1VFBA 4QGTA 4TVSa 3JWDH 2FD6H 3L5XL 1TJHH 4P3WA 3TZVC 3NACH 1P9MC 4KUCF 2AAVA 3QNXA 3TBYA 5D2NB 2FLBT 5JQ6H 3CU7A 4NO0A 4EZMA 3OG6B 3L3DB 3EGSA 4PJXA 3FMGH 4F58H 5F7UA 1FO0B 2GSIA 5DTFB 3RIAF 1FNFA 3B8SA 1YJDH 2ESVA 5GRZA 5A2KH 3LKOB 5TDPB 3TZVA 3EYUH 1P9MA 1ES0B 5IFJA 4IRJB 5BVJB 2IBZX 3RL2A 3RWJB 4L8CB 4OTXL 2EC9U 1NJ9B 1CFSA 4GG6B 1F5WA 1MFBH 1CD1B 4LCUA 5JA8B 1NMAH 1DBML 3LN5B 5DMKA 3DGCR 2J88L 4KJWC 3OMZA 1QR4A 1TETL 1QBLL 3ZL4H 3RU8L 4RZCB 2B4CH 5HDLA 1VFOA 4K8RL 3X17A 1CR9H 2BVYA 4JFPA 4H8WH 1NGXA 1NCBH 5DK0A 5EU7C 3K2MC 3O2WL 3NFNB 5DZNA 1SM3H 1Z9MA 3TBVB 3MYJA 3BEWA 5MHSD 5KAQG 4MJIB 5EU4B 2X42A 4Z7OF 3KHQA 3AS2A 4HIHA 4KMTH 2B5IB 5JNYB 4NO3A 2NXZB 4LSPH 3DVNB 1M4KA 5J6HB 4APQD 5B39G 3U7WH 2A6DA 2R0LL 2ADGB 1YEIH 2UYLA 5F7HA 4R8WL 2V2WB 1JZ8A 3LKQB 3VI3F 3RVUC 4KJPD 3CK0L 5I18L 2A9NL 2FL5B 3E2HB 2XFXB 2NY3C 5C6WH 1FGNH 4ONHB 5J06A 3BD5A 3QDMD 1OAKL 5B38G 1T20B 4EDXB 2AJVH 4EUPB 3UTZA 1BBJA 3HZMA 1YN6B 4L4VD 3V7AG 5F89A 2X4PA 3LEVH 5IBUG 5I1CL 1CDYA 1F58H 5FKPB 3IDXH 3QDJD 4RCAA 3BX7C 2HN7A 4HH8A 4NZTL 4HEPG 3DV4A 2X1WL 1IQWL 2OL3B 3IAGC 2HKHL 3ARYA 3AMKA 3D85D 1REIA 4HIIB 4GKZB 4HLJA 5JXED 3ZZ1A 4I3SL 3GMQB 4Y5VC 4UI2A 3ZDYF 4JO3L 2YN5A 1E4XL 1EH9A 4LPWA 1S7VB 5DZLA 4P2RE 1RULL 3UBXG 4JAMA 1A0QL 4N0RA 4JFXA 4G8IB 4FA8A 3RIAK 1DBAH 3BP7A 1TCRA 1G0DA 3F12B 4XH2A 4Y5VA 1ZEAH 3OAYK 1ZANH 4PP2B 5DD1L 1MCFA 2X1OA 1MAMH 1XIWA 4OJFH 4XNYH 5A2LH 2V2XA 4M1GH 4HKXA 4ZAKC 4GKNA 4JRXA 5C0AD 5F97E 4HPOL 2FX7L 2P46B 2FATL 4L4TD 1ZGLA 1LEIB 2MSPA 1LHZA 3Q1SH 4X5WA 3TBSB 4UNUA 2VDQH 4LLMA 1S78D 3C2AL 3SBWC 1S9YB 3L95B 2NW3A 3DUHA 4F33A 5LAXA 5FYJD 1RIHL 2BVOA 1AXSB 32C2A 3IDJB 1B4JH 1CXEA 3TNNB 1YDPB 3FONA 3GI8H 2FJHA 3S36L 1G9MH 4FTVE 3T2PA 4U49A 1KCVL 3OJMB 1NUFA 3SBWA 4I4WA 4Z7WE 5E70A 5C0GA 1RJZA 2C3VA 1CD8A 4APQB 1P2CB 1R5IB 2VITB 1HEZA 5HI4D 3NCFB 4OFVA 1XR8A 1TTUA 5KJRH 1NCAH 5CKGA 3ULVF 1H3UA 3HAEH 4L29A 4Y5YB 3OJVC 4LLYB 1GPOL 4EXPX 4YHPB 2MCPL 4BZ2H 5LCVH 2FECL 1HINL 4LPVA 2JCCB 2F54E 4GG8B 4NZJA 3ZYZA 3HNTL 5IB3B 4LEXL 1DQLH 3DYPA 4UB0L 5KG9B 4NJ9L 1RUAH 3D1MC 2XWJA 1Y18A 3QDMB 3TO2B 5E4EB 4KRPD 5INDA 2ARJQ 5ACLA 2OZ4A 1EO5A 3D3VB 2CK0H 4MS8C 1NEUA 2A9MH 4L4VB 3TFKD 2I9LA 2VLMD 3LKNB 4HMDA 3VFTB 1KLGB 1CDJA 5IVXA 2EDXA 4P4KD 3I02A 2KBGA 3O6MH 4UOW1 3QRFM 4KQ3H 5DEGB 4CU6A 3DSFH 4QCIA 5KS9E 4RGNE 3BO8B 5I1EL 1DQJA 5CILH 5KBNC 1SEQL 3NABH 3TT3H 4S1SL 3U1SL 3D85B 2VQ1B 1KN4H 5EUOA 1KIRB 4YHYB 1ETZA 4OF5A 1DLHA 2E6JA 1LO3L 1JI2A 5DUPH 2W1NA 4WUUB 4YHOH 1WFUA 3D39A 3LKSA 4IM8A 4H26B 3WFEH 4YXHH 1ZLWK 2FHCA 1MQKL 4M6MH 1G6RA 5GSVB 1MJ7L 5F72S 3RWDA 4IHOB 3W9EB 4FFZL 1KCSL 3GSXA 3DIFB 1XF2B 4MA1B 2JJUA 5C0AB 2P5ED 2RFXB 5I1GL 1U9KA 3ALWA 1ADQL 4M8VA 5JPNA 1TPXC 3I6KB 3IJYA 1EO8L 3CLEH 4IS6B 2VLJD 3QT2A 2FDBP 1T1YB 4N0YL 4ELKA 5GRUH 4OZGF 4C58B 3AC0A 2BVUA 3ARUA 4MDJA 1TQCB 5D1QC 4YUEH 3PWUA 1MRCL 1T66D 3GSOA 4OZGB 4TULL 4OZIE 4NO0D 4KZEL 1CF8H 2DLFH 4OV6F 2AI0L 3O4LE 2E27L 5C0CE 3QDHA 3JTSB 5DD6B 1IAMA 4LDEB 2VDMH 4N5EC 5GRYA 1IBGH 5D1QA 3QHFH 4ZDHB 4LCIL 2ESVD 2J8OA 3DBXA 3MRNB 3TZVD 1F11A 2X89D 2RGSA 2HVJA 4PTUB 1A3LL 1A14L 2YPKA 4OZFG 1ZHNA 5TFSH 2F53A 2W65B 3ARPA 1NGYB 5C7XH 1NDMB 1NFKA 4DVBB 3C5JA 4GKSA 4K2UH 4YEFA 4HJ0C 4R96B 5MEQA 4ZFGL 2E9BA 5HHQA 3H8NA 4UT7L 4I77H 2B20A 4R2GD 4KRPB 1QBBA 3LD8B 3UTQB 5I16A 4HKBA 3MFFA 3BD4A 4LCWA 1NSNH 4MQXD 5EU5B 1GOGA 4P4KB 3UZVB 1I8MB 1F4YH 4WFGE 2OTPA 2H26B 2BC4A 2DQUL 3DO3A 4J3XA 3WMSA 2CLRA 3OQ3B 2WP3T 3PXHA 2P42B 1HHJB 1U3ZA 3V5KB 2VLKE 4G43A 2WSKA 1KELL 4LAJH 1RZJH 4F7CA 1PZUB 4ISVA 1SVCP 4X6FA 3CFDA 2IH1A 1I7ZA 3REVB 2ZNXA 4QRRE 3QB7C 2H6PB 4I8DA 3CSPA 1PG7L 4UQ2A 1YMHA 1IGJB 4NM8L 5JIIA 4OIBA 1JV5B 4TNVK 4KVNH 5IB1A 4YPGB 5KSUB 2J1KA 3VXRD 4Z8FH 3PP4H 5E2WH 2D3VA 2X09A 4UU9A 5B3NA 2DLGA 3C6SA 2W9EL 4H20H 1YEGH 1UQSA 2Y25A 2EDJA 1RMFL 3O2DL 2P5EB 5EZJA 3WUWA 2C3HA 3PXJA 4DZ8A 1BAFH 2KUTA 3X3FL 1CLYH 2NY3D 1G9EA 5BS0A 5FYKD 2XRAL 4WU7B 4GLRH 1I9JL 1DN0A 2VQTA 1EMTL 5GJTH 1ZT4B 1YQVH 3JWOC 2QSCH 4KKCC 5F3HA 2A0LC 4LSTH 3W11D 4PJXF 5HDQH 5EO0B 3MXWH 1WBXA 4P4RA 1NCUA 2IADA 5BV7B 4MQSB 5GGUA 4NO0B 3F7QA 3QRGL 3BISA 4I3RH 3P4OA 3FOLA 4NCC2 4PJCE 3V6OE 3WDJA 2E7BA 4LVNC 5J11C 5TDNA 2B2XL 3D69A 2OLDA 4H5SA 1ZHKB 2ESVB 4OBSA 2OTWA 2JE8A 3TZVB 5EORH 5IFJB 1E4XI 4HXAL 5LG1A 4QRPE 2VO5A 4DTGH 1QRKA 4QOKE 3SKNA 4LCUB 3ZKSD 3BKCL 4PJIA 3RI5F 2MMXA 1E28A 5IFHL 5DMKB 3V8CA 2BRQA 4U1GC 2PETA 4PLJC 5JOFA 1J9CT 3VFPA 2FIRT 5ITFA 4R2GB 4JRXD 5I8EA 5DFTA 3F58L 2VAAA 4O5LL 1CE1H 4BQ6A 2Y5TA 4K3JH 2X4TA 1NGXB 3MRRB 3D9AL 1CG9A 1R3HA 4OQTH 3VGHA 4EDWL 5JORA 5DK0B 1DR9A 1GGUA 1V7NL 3MV8A 1U8NA 4U1KA 1BVLB 3MLYL 4G6KH 3SO5A 5DI8A 4ZAKD 4NGHH 3MYJB 1TVBA 1C5BH 3LCYA 3CVHH 1D5XA 3GHEL 1ZTXH 2CIKA 2SEBA 1GRWA 1JYNA 4PB0H 5E08L 1FG2A 3L3KA 2YMXH 3O3BB 1L0QA 1WZKA 3I50L 4JJ5A 2A6DB 4XPAL 2O5YL 5FCSH 3KXFE 2UYLB 1H3TA 1LNUB 1MI5D 2V17H 1JVKA 4GAJH 2EEDA 1ZVSA 3VGBA 3HC3H 4HK0B 5E1AA 4QHMB 3D0LB 3VXRB 4KDTC 3WKML 3CFCL 2Q8AH 2DQGH 4PRIA 4XCFL 2ZUTA 1J0YA 3UTZB 1BBJB 2WUCH 2EDTA 3ZMRA 5F89B 1C5CL 1UM6L 2KKQA 2NY3B 2HFGL 2EEBA 4KDTA 4IOFD 5DS8A 2QQKH 3M07A 1RI8A 1JYVA 1HKLH 3Q5TA 4ZSOA 4MS8D 3DV4B 3NFPB 2A73B 1LO0H 4U1SA 3OKNA 3GM0A 4I13B 5EBMA 1XFPA 3ULUE 5E9DE 1BBDH 1MJJA 4M6AA 5IK3B 1FQ9C 4HZLA 3DHMA 1KJ2L 2VDKH 3HZYA 4M6OL 1IC4H 3NAAL 3VDBA 3VFUB 3SKJL 2AEWA 3D39D 5CEZL 1MWAL 1K5NB 1SY6H 4HEME 3VH8B 1I9RH 4ZFOA 1HIMH 1TCRB 4Y5VB 3RDTC 1QBMH 4QT5A 4NKQB 2LV4A 3FOMA 1DBJL 1W72L 2OM5A 3R0MA 2YOCA 3CXDL 4GKNB 4D9RD 4RFOL 1OLLA 5I75C 1F6AA 5DD0L 3QI9C 1YEHL 2X70A 3PIQA 4X5WB 1QYGL 3RDTA 1RIVH 1GGBL 5F6HI 5IV2B 4QTIL 4R26L 4LSRH 5DJDA 2RJMA 32C2B 4JY6A 1JN6A 4ZAKB 4R4BA 2YSSB 3QI9A 5I19L 2DWDA 3OKKA 4I4WB 1RZIB 5EIVA 4UMGA 4PY8I 1RJZB 4PRAA 2C3VB 4OCWH 1L6XA 4LLDA 4NP4L 2MKLC 5D1QD 5LBSL 3T4AB 1UC6A 4CJ1A 3LN9A 4MXQC 1NCTA 5JQHC 1MI5B 5L9DH 3Q6GH 3P73B 5EIIA 5HHXH 1INDH 4EJ1C 3WD5L 4X98B 3DWTA 5DSCA 4N5ED 3N0PB 2YPLA 4HKZB 3BI9X 2XWJB 5INDB 1OB1A 3PV6A 5IVXF 2ED8A 5DRNB 2Y9RT 1OAUH 2I9LB 3QZWG 4NO5B 5C6PB 5ILTL 4LCWD 5IVXB 3UJJH 4HJ0D 1MCLA 3MRJA 5D72L 3OWEA 4LCCB 4QCIB 3UJTL 2GJ6E 1BX2A 2WANA 2YKLL 2XG5A 1PSKL 1XGRB 1FH5H 4ZS7H 5EUOF 3RNQB 1WEJL 1XCQA 2OP4H 1PYWA 1Z3GH 4NZRL 1GL4B 1MCDA 4J3TA 5C70A 4CVWA 1T3FA 1ETZB 4PJ8B 1AGDA 3NPSC 4X4MA 2JB6B 4MHHG 1YNKL 2Z91A 4XP4L 3QP3A 1BFVH 1AC0A 3BOVA 1LO2H 1N7MH 1IMHC 1D9KC 2YN3A 3GSXB 4PRBB 1YMMA 5HVWA 4UAOC 1X5HA 3MGTB 5BQ7B 4TVPD 2ADFL 4I2XE 1FNEB 5CINH 4HBCH 1O7SA 1BM3L 5HHMB 3HCVA 5I0DA 1ONQB 5BS0D 4PLNC 3MCLL 4R4NC 1RVFL 1D9KA 2FO4A 3AY4C 5D2NE 4MDJB 1HNFA 2EYRA 4J3WA 2HKFL 1U6AL 4M7LH 5F7KC 3NCYS 1NFIA 7CGTA 3GSOB 3HA0A 4IMLA 4M48L 4QTHB 5DQDH 3VRJB 4OLEA 3J8F7 5C0FA 5IOPB 4S1RL 1TPXB 3TIEA 2FBJL 3WIIH 3VXTA 4NKDB 3AY4A 4PBXA 1MNUL 4P23C 2ATKA 1R5WA 1OPGH 2G2RA 4KKCD 5D1QB 2A0LD 2ICWJ 1CI5A 3NH7L 4GG6E 5IR1B 4HUMB 1L4IA 3DBXB 4X80H 1F11B 1CGSL 3ARGB 2CJUL 4TUJB 2Q7NA 1BVKA 2D31B 1ZHNB 3X14A 3HG1A 5DMIL 1IC5H 3JUYA 3T0BA 4M61B 3V5HA 2BY0A 3C5JB 5LKNA 4JFOA 4FZEL 4P23A 3BGMA 1IEBA 5HHQB 4UINH 4PBWD 4RGOL 1D5IH 1X7QB 2FJGA 4XNXH 3WDIA 1F13A 1RK1B 1F00I 1A6UH 4OD2A 3AAZA 1EJ6A 4NZUH 1WFTA 4LCWB 3RGVC 4MJIE 3LQZA 5LQBL 3VA2C 3R0NA 2YA0A 2DI7A 3MV8D 3GRWL 2FBOJ 3E6HA 3OAYH 2BC4B 2VE6A 5L2KA 3BGFC 2O5ZL 4O51A 1XGPA 3SE9H 1KENH 1MRFL 4HD9A 4Z7OE 1FSKC 4Q58C 4CNIA 2Z8SA 4P0DA 4UBDC 5J1SC 4F7CB 5KVFL 3RGVA 5FO7A 3H42H 3CFDB 1CK0H 3LB6C 4HIEB 3LQAC 1MJUL 3VD9A 2WUBH 5HHVH 3BJ91 5C09D 1ERNA 3UO1L 2UZIH 1UACH 5KANG 3VI3E 5F8QC 1V7ML 2VISA 5IFAH 1Q38A 4H25A 1QQDA 3V52H 5DXWA 1C5DB 2WM0A 3MPCA 1GGYA 5DYOB 4YWGH 1BFOA 2GFBB 2H32H 2AK4B 1HI6B 2HA1A 1U8PA 2Z35A 3NCBB 4PRID 3QUKB 2AKRA 3C6SB 1D6VH 2H3NA 5HPMA 5IQ7H 3P30H 2R69H 5D6DC 1BD2A 1KJ3H 5BS0B 5IMMA 4HS8H 1A1MB 1EZVY 1E4WL 2C1OB 1D5MB 5F3HB 1EDQA 1WBXB 3MBEB 4G7YL 5D6DA 5GGUB 5FDWB 1XGYH 3FT4A 3P4OB 3QWQB 5FK9A 4ZTOL 1HHHA 1A22B 2YEZA 5F88A 1FE8L 3DTXA 5LXGL 3D69B 2C4FT 4H5SB 5D93C 4LSSH 1YZZA 4ONGL 1WT5C 2OTWB 2BSTA 5DMGC 2EKSB 2E6PA 4PJIF 1MHHA 1IM9A 1YA5A 1T6WA 2Y7QA 4OUUA 3EOBB 1CD0A 3RHWK 4PJIB 4XX1G 3P0GB 4YDVA 1E28B 4D0CA 4DAGL 3OR6A 5JOFB 4RAUA 1WT5A 3VFPB 4N8VA 4Q97A 5E8DH 4HF5H 1AP2A 3SDXB 3BYTA 3IRPX 1ZLWH 1VGKB 2Y5TB 3RDTD 2X4TB 5GISH 1R3HB 5A40E 2J4WL 3MV8B 1QPXA 3BH8A 5E2VH 3KYAA 5I15H 1VKXA 4JJHA 5DVKA 3MUGB 1EEYA 1ACYH 1YYMH 4RRPG 1TVBB 1A9BA 3KYKH 3EYOA 5F1NA 3QI9D 2CIKB 1INQA 5H37G 1F45A 1RV6X 3DI2B 4OZFH 3L3KB 1ZHLA 4MMXC 1G7JB 4KK9C 3RTQC 3GSRB 5E8NA 4JJ5B 5DJ8A 4H0GA 3GI9L 1RY7B 5C09B 2WBJC 3H3BC 4NNYA 1QSEA 5D2LA 1NGZB 3QDME 4JO4L 1S3KL 1A6TB 3RJDA 1N5YH 5FO8A 3UMTA 3D3VE 3RTQA 2FNBA 2I60L 3L1OL 1OM3L 2PR4L 2YPLD 4L4VE 2JLLA 2Z93A 4C56A 1HOCB 4PRIB 1O0VA 3A6CH 4MXQD 1NEZA 1KIUA 1KSRA 4ZYKA 1QACA 2WBJA 1UJ3C 4HUVA 5KOVC 5K9QI 1KTLA 4RBPK 3U7AA 4DGIL 4YAQA 3KNBA 1NCDH 4NZDA 5GGQH 4OZ4A 1HHGB 4TQEL 3IS1X 3ARSA 3ARRA 1FNGA 3WIHH 1NCWL 5KTEL 3ULVH 5HI5C 3G9AB 4FNLH 2VDRL 4WY7L 5KSAC 3V8OA 3EDFA 4P9HC 4PRPA 1UJ3A 5JHLH 3OKNB 1MEXL 1IKFH 2CR6A 4WUUE 5HYIA 5EBMB 4LGPB 5EOTB 1MJJB 2NPLX 4HZLB 1MIEL 3MLXL 1NBZA 3MUHL 4OM1H 3ECBA 2FJFA 4DEPC 4GJTB 5KSAA 1DBBL 2VYRE 3OZ9L 3EFDH 2L7UA 1HHKB 3LHPH 3WUWG 3MROA 1PZ5A 4MSWA 4E0RB 1K4CB 5ITBL 2XN9B 5C0AE 4ZQKB 4CU7A 2ZSVA 4L5FH 5J6GB 4FOMA 3V7MA 1KLFA 1F6AB 1W0YT 5LWYL 3U9PL 1ZXQA 1X5JA 2R4SH 3VFRA 5JIKA 2AABH 5EUKA 5FYJE 3RDTB 5B3JE 4OD3H 3QBTB 1BFSA 1EHLL 1WWWX 4KU1A 4OZGE 3BPNC 4CN4A 4DKFL 4JFHD 4JY6B 1JN6B 5E1HB 1M7DB 2B1HH 2BK8A 3QI9B 3BGAA 4A6YH 1RUKL 3IDMB 1TTFA 5JA9A 2DWDB 5I76A 3KPRA 4R4ND 3NIFE 4PRAB 3V4UH 4WFFD 5J13C 2IQAA 5CP7B 3QXDA 3RFZC 5HYFA 2AGJL 5EFIB 4Z7NE 4XAWL 1DVFC 3ILQD 3VG9C 3H3PL 3HG1D 5EIIB 4LLQA 3BKYL 1KOAA 1S5IH 4KY1H 4GS7C 3OKYA 4P23D 1K6QH 3V6ZB 2I24N 4HULB 2VLME 1OY3B 4YHLL 2CRZA 4L8SC 1DVFA 3NGBC 5GJSL 5HGHA 5M94B 4FQCL 1S9VB 4ODXA 5GS1B 4GQ9L 3IKKA 5IF0A 3S37X 4JLRB 5MENA 2AXGB 2GCYA 5L2KD 5DVOA 4TSBH 3Q3GB 5DHVH 4L8SA 1WICA 1IFHH 2CO6B 3T0XA 4FQJL 5MERA 3WNOA 1E27A 4HC1A 3QQ9C 5I30H 4MD0B 3MODL 5AYUL 3RGVD 1Q0YH 4EOWH 4PJBA 5MEOA 1RJYA 2EZ0C 3P4NA 2AEQH 2AJYH 3GSNH 2Z91B 3QXTA 5KVDH 4GRMB 4PBVC 4OLVH 1CE6A 4OCRL 1ZT7B 5CCKL 5I8CB 1BIIA 1F97A 1DN2A 4XP1H 1G7IB 2F5AL 4JPVH 2KZ1B 3LB6D 3K81A 2P5EE 5DD3H 4RMSA 3NPSB 5F1IA 1NCCL 5FA3A 1XH3B 2WV3A 4BH7B 4U1IB 1IAKA 4WJ5A 1G84A 3KJ4C 3QO1B 4OD1H 4LLVA 2H45A 1DFBL 3EAKA 5JW4M 4FQQB 3QUMB 3S37H 1M6OA 5I1AB 3VFVB 3S7GA 4OCSH 4GUPA 2EYRB 3GNMH 4ODHL 5JDSA 4PTTA 1DQTA 3TA3C 1NFIB 3K8MA 3QISA 3SE8H 1WTGT 3MCG1 4WHYG 5F7WC 3DOSA 5HYJA 1BP3B 1MCOH 4E9LA 3HLAA 4UUJB 2HJLA 2ESVE 3TIEB 5JO5A 1DBKL 5F93C 5ANMA 3VXTB 3GIZH 4JRYA 1FJ1A 1JWUA 1R5WB 2G2RB 4TOYL 1FGVL 3TA3A 1KACB 4HJJL 4GRLC 1BVKB 1IM9D 5I73C 4PJGF 1W72B 5IW1A 1JNJA 2V6HA 3INUH 1MRDL 3V5HB 3UZEA 1FZOB 2IEPA 4BQ9A 4PJGB 4OF7A 4JFOB 4P23B 4GMSL 4BM7A 2PXYC 1FHGA 5DMGD 4GRLA 1NGPH 3MGOA 4AEIH 2W9DL 2V2TA 1WIPA 2VSCA 2DICA 3O11A 1GVIA 3LQZB 3FB7B 3KLAB 2PYFA 3I85A 4XNQA 3S4SA 3LN4A 3UAJD 1N64L 2PXYA 5L2KB 4TNWK 1S9XB 4O51B 1XGPB 2QV2A 3O9WD 3M8OH 4HPYH 3D18A 4CNIB 1EJOL 3QA3B 1SJHA 1B2WH 3QEQD 4Z18A 4O58H 3SGDI 4FXLA 4GT7A 4Q0XH 1CXLA 1JUFB 3BGFB 4BZ1H 1IL1A 3WFDL 4YHNA 2P43B 2CDEA 4JPIB 1R3KA 2F8OA 3U4AA 3VXRE 2VISB 2AJSL 3U7YH 1QSED 5A2JH 1QQDB 4MXVF 2Q86B 5FOJA 4KK9D 3RTQD 1RZFH 1J0HA 4XHQA 5CP3H 1BFOB 2APVA 1AKJA 1ED3B 2NXYC 3SQBA 3FT3A 2Z35B 1ZLUK 4C56D 5J0BA 3BAEH 4S10A 3MLVL 1Q9OB 5F96L