5JA8B

Crystal structure of the higb2 toxin in complex with nb2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCISSSGGTTNYADSVKGRFTVSRDNAKNTVYLQMNSLKPEDTAVYYCVADFACPLIREYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin HigB-2
publication title Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Toxin
total genus 31
structure length 121
sequence length 121
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ja8B00
1JI1A 1S9WB 1IM9A 2K7PA 2UYLB 2ZCHH 3OXRA 3HE7A 3BP7B 3VWJD 4H25B 4BKLA 4MB4A 4WRLA 1G7MB 1DP0A 3N1MC 5FYJH 1XIWA 3ARTA 2VXQH 4PD4K 1MCDA 4G8GE 3SE9L 1RZ8B 4MQTB 1BF8A 4JFDD 3U1SH 4RISH 5T3ZH 3G6JB 5JQ6H 3NACH 1P7HL 3MLUL 4ZMAT 1S9YB 3HCVB 5DURB 2XXCB 5L6YH 1N8ZA 3EYOB 1BD2D 4O9HH 4QLRA 3VRLF 1K5NB 1T5XB 2P7TB 2XQYG 4Z7OF 1U3JA 4AEIL 2GK0A 4GKZA 3FHQA 4QCIA 1FNSH 4L3CB 1EHNA 5D1XC 3F7VB 2H26A 3O6LH 4P46A 1B9ZA 1OSPL 2EC9T 1XZ0B 3RU8H 3SDXF 5CKAA 3D9AH 4KGJA 4N9GB 1SMAA 1I8LA 4JDVA 3MJ9H 3V6OC 3MV7E 3IDGA 4KQ3H 4RAUA 5GQBA 1I1YA 4FQJH 1JF5A 1OF2A 4Z5RA 2OK0L 3CFDA 4QXWA 1FVEB 1QBMH 3BYYA 2F54D 5JUEL 2WANA 2N56A 4JFFA 1H3UA 3QXAA 1MFAL 5D70H 4L4VA 5H35A 2FRGP 4YFDB 5HYJA 3C60B 3O9WD 2XA8H 4APQA 1QD0A 1ADQH 2F58L 4YH6A 1YNTB 4P99A 3RWFB 5DR5L 1YDPB 1HHHB 3VXMA 1CICC 1PQZA 5DHXB 1Z3GH 4LLYA 1E4WH 5T1MA 3UTSA 1WZ1L 4X7DC 5IEKB 4FFWD 2XXMB 3MGTA 2D7TH 3OAZH 3MRJB 1W72A 2O61B 3BDXA 3T2QA 1M6OA 3TLRA 4XCNA 4LU5H 3QO0B 5DEFB 1U8LB 1R6VA 1NGZB 3VXSB 1JNLH 4OJFL 4D8PB 1MIML 2VAJA 1J0KA 4HGMA 4PJCB 4XMPL 3OKMB 4AEHH 1KJMB 2FEEL 2W9LA 1EEYA 4GW4A 3NIDE 1IC4L 1ZT1A 5BVPL 3MACH 4DEPB 4OI9A 3E6FB 5KSBE 3RPIB 2XWBA 2RGSA 5IBUB 1KT2B 5FUZL 1DE4A 1PKQE 4NQUA 1AGFA 3SO3B 2OZ4L 2GITB 1JYNA 2VQ1A 3HUJA 4V1DA 3MV8A 4ZUSA 5I8OH 4TOYH 4ZUVB 1X7QB 2BVOB 4G6FD 3OPZL 4CJ0A 3QIUC 1JPSL 4EI6A 1IGFH 5CUSL 3CZJA 2DQHL 3QISA 1CBVH 2YD3A 1FIGH 5C0RL 3NFNA 5D93B 1YMHB 4XP9L 2KZ1B 3VXTB 2QL1A 2R0ZH 3LCYA 5DUMH 3U9PH 2ADJA 2E9BA 2W0FB 4P3DA 1JI2A 4JDZA 2J6EA 1X5XA 1NKOA 5JHLL 1P6AB 2BXZA 3KPPA 2BNRB 2P8MB 3OKOA 3OR6B 5HSFA 5FKAA 5DJYB 5CJQH 3B2UC 4R90L 5T1KB 4F37F 4LVHC 3CDFA 3F6IA 4WCYH 1NDMB 4MMZC 1GIGL 1F4YL 1CQYA 2VITB 5M95B 5TE7L 5KG9B 4WFHD 2WP3O 3PHSA 1EHLH 4YK4B 3VWJA 2YEZB 4QHKI 4MNGE 2YD7A 1TMCB 5J13B 3GBMH 4K3EL 3F12B 1EERB 4GUPB 2DAVA 3O0RH 3QWOB 1NSNL 1RURL 4TQEL 5B3JE 5E94B 3O2DH 4JFDA 4OGZA 3CD4A 4X8JA 2P48B 1KJ3L 5DJ0B 2FIKB 4U7SA 1YEDA 4YX2L 3BSZL 1BD2A 4YC2B 5J56B 3AROA 4OQTH 3ARWA 2P43B 5KVGH 1AC6A 4P23B 2NPLX 2MQ3A 1DUYB 3RVUD 3T0EE 4LCUB 1CLOH 3SE3A 1GVIA 3V8OA 5TDNB 1CDCA 5HHPA 5I1HH 4Z77B 1FSKC 1C08A 5H2BB 3LRHA 4D3CH 1A7RL 3QEUA 3QUZB 4TUOA 4WGWB 3ESVF 1FNEA 2HT4D 1P1ZB 4UBDC 5CLTA 2DQTH 1OGAD 3LN4A 1EO5A 1F4AA 3I3DA 4YE4L 2APWA 1R3JB 2NZ9C 1QYGH 5AZEH 5BS0D 4GQ9H 4PJHB 1QNZH 3CK0L 5MEPB 4IOSD 3ILPA 4FTVB 4YEFA 5AD0B 5C8JA 4HFWA 1FHGA 3MRQA 4WI3A 1ZLVH 3W9EB 2HJFB 2ATKB 4JFFE 5IEHB 1NCWH 2IH1B 2F54A 1L0QA 1BIIB 1KC5H 3MGAA 1FFQA 4J3SA 4L4VE 4GS7B 1PEZA 2GJ6D 3SEPA 3MV9B 4RGNC 3B8YA 1A9BA 1UQSA 1PLGH 3O9WA 5DMKA 3ELAT 1I8MB 3VXME 4RZCB 4X6BB 4DW2L 2R2BB 1A6VL 5KN5B 3GI8H 3MBEB 3GO1L 1N6UA 3BKYH 1V5JA 3B4NA 3SGEH 3DRTB 4GRWF 4Q9BA 4K3JL 3ZDZE 2V2TA 3H7BB 2E6PA 3EGSB 4GRWH 3A6CL 2AQ1A 5TFSH 2PO6D 4TULH 3U0TA 2ED8A 5JA9A 3G08B 5JR1L 5BZDB 3OJDB 3G6DL 2NY6C 4CN1A 3DX6B 1WISA 5D1XB 4MXQC 4LNRA 1ZK9A 1GGYA 4MJ5B 4XNMA 2XV6B 3SKOA 3CFJA 1CS6A 1AGCB 4XP6H 4YXHL 4LLDA 3O41A 2RR3A 3MV8E 2HJLB 3BZDA 3QP3A 5F8QC 5IW1A 1NC2B 2AJSL 15C8H 3MREA 4JY4A 3H9SB 2P49B 4LCIH 1LVEA 3VFPA 5I0DA 4JO2L 1XF5B 5T3XE 1FL6A 3VG0L 3T2PA 3U46B 1NLBH 1AC0A 3SE4A 5HHME 1ZS8B 4M9OA 1U8JA 5M94B 3BFOA 1S7UB 1TIUA 1NMBH 2EDFA 2WBJC 3ECBB 2EYRB 1T66C 3VFWA 1NLDL 2AV1B 1GGCL 3TWCH 3WCYA 4DQOL 2R2HB 4LOUC 1HI6B 3D5OF 5GGQL 3AREC 3TIEB 4MD0B 2E8ZA 4X9IA 3LPGA 5I1JL 3NPSB 4BSVB 1CICB 5E8OB 5KBNC 3FMGL 1LILA 3MJ7A 4RCAA 5JPNA 3UTPE 2FR4B 1ERNA 4RAHA 4L4TB 3DV6B 2MCPH 5DHVH 5C92A 4XX1E 4JFOB 5KJRL 1BWMA 3JTSA 4BFEA 2I9TA 3KPRD 4JKLA 4BH8A 1KIQB 3P0YL 1IQWH 2FEDD 2QHLA 2X4UA 4MNQD 3JV6B 4Q6IA 4Y5YA 5ENWB 3WD5L 4PIRF 2FGZA 4OBSA 1JMZA 5HYSB 5EIIB 4HWZB 5I17B 1JV5B 1G1YA 1UZ8A 2E7HA 3QDME 4FOMA 3DV4A 2PW1A 1VA9A 2E5EA 4MQ7B 3I75A 3OJ2C 5IVZA 5JDJA 1JRHI 1S8DA 4OCWH 4KKAC 1MJ7H 5FFLA 1HH6A 4JFQA 3X12A 1INDL 4LNVA 2X09A 3AAZB 2DBLH 3I84A 3C6LD 5TGBB 4LEOB 3QUMB 2R56L 1QP1A 3DSNA 1CFTB 3EJYC 3GMNB 3O3AB 3FRUB 2G2RB 4PGZA 2XQBH 3HAEA 3SY0A 3LKPB 4F7TA 5AWNH 2YPVL 4WHCA 5DJZB 5DK2B 5E8PA 3JUZA 4KRPC 1J9CT 4EDWH 1WTLA 3UROR 1QEWB 1BGXL 1T4KB 4KK5C 4EN3D 3FJTA 1AP2B 1QKZL 2KH2B 3SHSA 5IB3A 3WNOA 5L7XH 4NM4H 3BJLA 3VD3A 4JN2B 4OF5A 4LEXH 3OXSB 4I2XA 2C7UA 1Q9OB 1WVZA 1OGAA 3GIVA 2DQCL 5IMLA 1HE7A 3UC0L 5FO8B 4RMVA 4JGJA 5BS0A 4UT9L 1H3PL 2ATPB 3BEWB 4X7EC 2F54E 5JNYB 3GMLA 3OX8A 3ZHLA 3EO1B 1AXTL 4LVHB 3CFEB 4G8FB 2NYYD 5B39B 2G5BA 2GJ6A 1ORSA 2X42A 4ODUA 3DUUA 2X4SB 4O4YL 1F5WA 4X7TB 1LEKB 3VFUA 3PWPB 1Q1JL 3TVMD 4G42B 1CD1A 4JN1H 4LSTH 1CDGA 3WEXB 3DARA 3NCFB 5DEGA 3QPXH 1ULVA 2HLFC 1I7UA 1FFOA 3T3MF 5IR1A 3B5TA 2FJFB 4HCRL 3Q6GL 2NZIA 4NKMA 5H8DA 5DFTA 2F19L 1I9IL 4LQFL 4JQVC 5DJ2A 3WSQL 4KJWC 3ZT6A 2IANB 5MHSD 4I77L 4S1QL 2PO6A 3OG4B 4RMSA 5C0FA 5F1SA 3B9EA 2HFGH 4I0PD 4A6YH 2Z0BA 1IGTB 1JWMB 1LD9A 1OAQH 4ZYKB 4XNXL 4PGDB 2Y36H 3D48R 3S6CA 4FXKA 4BZ2H 4X5WB 2NW2B 2I5YH 3W39A 4GAGH 5DD0H 4HH9B 4MQXD 3RUGA 4HIEA 4QOKE 3GSQA 4XBGA 4JHAL 1MREH 3WUWA 2DN7A 4AQOA 1FVCB 2XG5A 4XMKH 3P9MA 4N8PA 4Z8FH 3GHBH 1OWWA 1VACA 5IJVA 4JQXA 3CSBA 4OZFB 2WWMC 4XNQA 1AQDB 1FIEA 1VERA 4X6FB 4KMTH 3LEVH 5C0JB 5FA4A 5GGTA 3GSRA 1JGEB 1OT1A 1UYWL 1IAOA 1GPOL 4YHKH 1CU4H 1V7MH 2WWKT 3C08L 5DT1L 2DOCA 2OLDA 1QRND 3RX5A 3HZKA 3RWIA 1WFOA 1GGBH 3UJTL 1NBQA 1HIMH 1WCBB 5DDHA 1F6LL 2ZUQC 3HHRB 4R0LC 1UWEH 5BVJA 2RB8A 4FQCH 1J8HB 2H3NA 4QY8B 1I85A 5I66B 1EJOL 2E3VA 4G9FD 2DLGA 2AJ3A 5HHXH 3KPRA 4LARH 3GSVB 5ICXB 3V6ZA 3G5ZA 4M9PA 4MNQA 5EBWB 5MEOA 4QWWC 2JJSC 4PJ9D 4M62H 4S2SA 2NNAA 2ZSVB 1BOGB 1CXHA 1RMFH 1MCEA 3C9NA 4LCYA 2IFFH 3PGDB 4LLQB 3IFPB 5J89A 3OR7A 4X5LA 3D2UB 1YMMB 1VSCA 5SWZB 3HI5L 1I1RA 3X14B 3SKNA 1QFUL 1ZHKA 3C6LA 4Y89A 3EO0A 5C0BB 4KVNL 4PJ7A 5D6DA 1GHFH 3QO1B 5DJCA 3MLTB 5HD8C 1A9EA 4JRXB 4MDIB 4R3SB 2OR9L 3KYMA 4IS6A 2PYFA 3JV5A 5HHVL 1WZMA 2A74B 5LBSL 1K9TA 1MJJA 5IFAL 4N9OB 1B4JH 2WBJB 4P3WA 3DGGB 4YDIL 4Z7VA 3LS5L 3SOBL 4EN3A 2XZQL 4OV5B 3AREB 5SWQA 5IQ9B 2FD6L 2VLMD 1K6QL 3QH3A 3IDNA 5E2WH 5D71L 5JW4Q 2ZSWB 3GSNH 2H1PL 3RX8A 3IAPA 5BS0E 1G7IA 3DX7A 5F88B 4C4KT 3JWOL 4YHMH 5IKCA 1YYML 5J06A 3QPQD 1NBYB 2FH8A 3GJFH 4QT5A 3HI1A 2NXZC 1CD0A 5FGSA 1HCFX 3CH8A 2YKLH 1FORH 4YFLI 2QQLH 1YY9D 4UT7H 3A6OA 4OGAC 3N1FC 5EFIA 4HWEL 2R39A 1QBBA 5FM5M 3UBXI 1LP9B 5FM5O 4AL8H 5IM7A 4GW5B 3TVMA 4AEEA 3VGGA 4PJIA 4WW1A 1MFBH 1RIHL 1MHHB 1MH5B 1IC1A 4OZIB 1CLZL 1C5BH 3FZUD 1HQRB 3T1FB 3W0WB 1JPFB 4BH7B 2EDJA 1MHEB 1W72L 5I8KH 3Q6FB 5F7EH 5F6HJ 2X1QA 1EFXB 4S0SD 1YUHB 4NZTL 4YIQB 1I1FA 2VDMH 2F9BT 1VEOA 2FB4H 2GY7B 2HWZL 5JOPD 3FFCA 4OKVA 4TRPH 3O6FC 1AGBB 1DDHA 4QNPF 3KPNA 3WFBL 1UM5L 4I0PA 1OQOA 1KJVB 4EI5B 3A67L 5I76A 2CMRH 3EZ8A 1SBBA 4N1HB 2GJZA 1J0JA 4HPOL 4TNVF 4OZHE 5C07E 4YGVB 4Y16D 4XNUL 2IGFH 5HXMA 4LLMB 1KXTB 5ESVA 3ZTJH 4UUJB 4DVRH 3L7EA 2CGRL 1T20B 4NKOB 2OXHA 4POZD 5L2JA 4LKXB 1VB9A 4CMHC 1NMCC 4F37K 1XCQB 3TO2A 2BVQA 5E5RB 4Z7UE 5F9DC 3FFDB 2X4PA 3HAEG 5I1KL 1CFVH 1YN7B 2Z31D 2BOCA 3ZTNH 2OBGA 3QFJD 3VRJA 1QRNA 1ZANH 2QQKH 4F8QA 3VWKB 3DBXB 4GMSH 1GZQB 3NCYP 2QEJA 1F4WL 3CSYB 3C2AH 1XCTB 2CLZB 4MAYD 5DUBB 2EIZA 2NQCA 4BFIB 1JPTL 2ITDB 4M00A 4U6YB 4DOHE 2R9HD 2AXGB 2E9JA 3C87A 4G9FA 5ILTH 4CADB 2M1KA 4XPGH 1I9EA 3D3VD 3T4YA 1U8IA 4PRHE 4YHPA 4JQIL 4PJ9A 5JW3L 3DECA 2X9WA 3BUYB 2UZXB 4JFPB 5HI5C 4XCYB 3RWDA 1A3RH 1NC4D 5DMGC 1KENL 4ELKA 2IALB 4JB9L 4WI5A 3X11A 1OGTA 5DS8B 4KKCD 1A22B 3V7MA 4HXAL 3VRIA 4K71B 4PJDE 5KVMC 2AJZB 4KFZC 1SJEA 4ZFZA 4PJ7E 1DBAH 3O8XD 2HFEB 1ZLVK 1JNHB 4B7IA 1FGNH 4LSDA 1KCUL 5IV2A 4J7RA 2H32A 4YWGL 4HKBA 3NCJL 3RL1B 3QQ9C 2GTWA 4PLJD 1KCKA 4PJCF 1MPAH 4P2QB 3BPLC 1MAKA 1RUQL 1DJSA 1TNMA 2HKHH 4QYOB 2IADB 4F7MA 4WW2C 4HC1H 1FE8L 4LF3B 2F5BH 3TA3C 2X1PA 1I9RH 2J8UA 3BD3A 2B4CL 3CFBB 3DUSA 2R8SH 2ZUQB 3HC3L 2VXUH 2R2EA 4S1SL 3REWA 2DLFL 1S9VB 3RVXC 3UTQB 3FQWA 1JRHH 3BPOC 3L5JA 1AFVL 2EC9U 3HS0B 4CBPA 2C9AA 4NC1E 3G5YB 4XVUD 3RBSA 3V5DB 4H8WH 1URLA 4UU9A 1CCZA 4PLOB 1MHPL 4YHZH 3WUWG 1KLGB 4MA3A 2ZUYA 3VA6A 5T1LD 5E56A 2E9WA 4MWFB 2ZNWA 3O4OB 4FFYL 5CJOH 2Y72A 2MHAB 4LSVH 3VFNA 1KLFA 2UWEA 3C6SB 1KYOK 1NFDF 3LPWA 4L9DA 3WXWH 2OP4H 2HLAA 4PJIE 1YEFH 5FHBH 3L3KB 3R0NA 2Q8AL 5T5FL 3TJHD 3ZYIA 3ARQA 3L1OL 2J5LB 5E6IA 5JW4M 3MRKA 3JXAA 1ONQA 2VDOH 4LRNH 4ZFFB 3F7QA 5T33H 4M3JA 2R69H 1UCBL 5MHSE 1U8MB 5GGVY 3FFCE 4MA7H 3MRRB 4BYHA 3AS3A 2E8YA 3CDGA 3EYQC 1EBAA 1F3JB 1EDQA 5EU7C 1TNNA 5FYJU 5LAXB 4P5MB 5J8OA 4ZQKA 1A6UL 1PBYA 2XTJB 5J0BA 3ULVD 3OKDA 4EUPB 3CLEL 1RU9L 3HPJA 5JIIA 1BM3L 5CD3A 2NY1D 2P44B 1LEGA 1SJHB 4MAUL 1FZMB 1H3WM 3D0LA 4XPFL 3OKNB 5ACLA 1RULH 2VZOA 1MRDH 2CIKB 2CR3A 3EO9H 1C5CL 1E28A 1FPTH 4JY5H 3F5WB 3DETC 3IB4A 1MI5D 4V2CB 1OAXH 5EZLA 2HTLD 4LBEA 2FJGB 1U2HA 2MMXA 2Y06H 1QFWI 4HUNB 4NNPH 5FF6A 3ARXA 1S5HA 4X4XA 1ZHBB 3LRGA 4LCWD 1RIUL 4F33B 4L8CB 1DN0A 1BZ9B 1BEYL 3LEXB 2DLIA 1M71B 1YN6B 2EE3A 3SQBA 1CFQB 3ARRA 2Z31A 3W11D 4Z7QE 1KCVH 3QFJA 2FJHB 4GKSA 1IARB 2HYMA 3CSPA 3L3JB 4JM2D 3DO7A 2IPUK 2ED9A 4NZRL 4UILL 4UQ3A 1ZA3B 4KI5F 1BQLH 1IC5H 1S7WB 4MAYA 4DN4H 3QRFM 1TQBB 3EIFA 4G9FE 4GG6A 2XA3A 4PJHF 3MOBL 3SN6N 5CEXB 2NXYD 4HUVA 1F3DH 2OTPA 1NFKA 4M1DH 4NRXB 3V0VA 1F2QA 2R0WL 3T4AB 5J6HA 1DLFL 4NKDA 1MVFA 1FG9C 5C86A 4OTXL 5HHNB 1U9KA 4EOWL 3IAGC 5CP7A 1N7ML 3RAJH 25C8L 5A2LH 3T3PF 1NC4A 3H6JA 2CKBA 4OCMC 5C2BL 1U8KB 3RFZC 2C3XA 1MRCH 3NBNA 1FZOB 2O5XL 3HZVA 5IMKB 3LIZH 3QG7H 3O8XA 1ZHNA 5EOCH 4L8SA 4OCYL 4N90E 12E8H 2JB6A 3QHFH 4TVSa 5E8EA 3IU4L 4CMHB 2A6KA 1EXUA 1MFNA 4PJAB 4HUKB 4BSWA 2EKSB 4JFEB 2Q7NA 3KXFE 5HHOE 5CLWA 1IGMH 2ICWA 2OQJA 1G0XA 1GZPA 1KN2L 2PYEB 3Q2CA 2GSIA 3DX9B 3U9UB 1WT5A 4U2YA 4M7KL 1U36A 2AK4B 4OIIL 43CAA 5IT2L 4XVJL 4HDIA 3NOIA 3RVVD 1Y6NR 3EKCA 4AG4L 1INEH 5ACZB 1GAFL 4ZG1A 3V6FB 3PQYE 5I1IH 1P4IL 4D9QE 3INUL 1ZVHA 2DMCA 4IRSB 3WJJA 3UTOA 3D18B 3UTZB 2BSSB 3EOAB 3MC0A 1PYWA 4J8RB 3TCLA 4E5XA 4WU7B 3AB0C 1J1OH 5IBTL 5T1LA 4U1SB 4M3KB 4D0BB 2UWEE 4DVBA 1NUNB 1MCQA 3MCKA 4XP4L 4ZDHA 2RAMA 1XGRB 4K94L 1VFOA 5FHAH 5HGBB 4KK9D 2J7LA 2P5ED 3MLVH 4P48A 2A1WL 2NLJA 3W82A 2CDGB 1YZZA 3O2WH 5JQHC 1JF1A 4N0CD 3PWNB 1SEBA 1QLEH 4ZO9A 4DKEH 5AZ2L 4JPVL 2JE8A 3QIWD 3P3YA 5B4MD 4WTZA 4JLRB 3FT3B 1WITA 4NN6C 1H0DB 4KV5E 4KK8D 4EEEA 1E27B 1U91B 4UTBL 3OGCB 2AABL 1FO0A 1Q72L 2GCYA 4HF5H 5GSRA 1B0WA 1JZ2A 4NP4L 2FL5B 4M1GL 2GUOA 2Q7YB 4YPGB 1J0ZA 4YFLF 4O51A 3NCCB 3BXNA 5BXFA 4ONFH 2DWDB 1I3RA 3VXRB 4CVXB 1GOFA 2G75A 3DXAD 5C70A 3NZ8A 3MXVL 2LU7A 4H0IA 5E1HB 3HR6A 4UQ2A 5INCA 2CDEB 5GGVL 5BRZE 3MR9B 5HYQB 4F57L 1WBXB 3BJ91 2ZPKH 4R4NC 5HHQA 4ZXBD 3UO1L 3RWHA 3DIFB 4PGBB 2E27L 4XXCA 1Z9SA 2ZUXA 1XGYH 1MI5A 1DBKL 5DD5L 4MCYA 4PP2B 2GJJA 3T0BA 1RV6X 4LCWA 5GGTL 1QSVA 4HWUA 1D9KD 1UFUA 1A7NH 5F7MC 3RNQB 1KTLA 2EIDA 4HD9A 5IVOA 3QFJE 5HTSA 4DZ8B 4PG2A 1YEIL 5D7JC 1ORQB 2VH5L 4QHUB 2GI7A 1AO7B 3JV0A 3NCEB 4HJ0C 4DKAA 3LN9A 5LGJB 2L4OA 4NJ9H 4BELD 2EH7H 4JM2A 2V7HA 5JW5A 3QQ3B 2NY2B 2ESVD 1QA9B 4XBEH 1VFAA 1MIEL 2L0DA 5KSAD 4YZFE 2PXYC 3TCXA 1EVTC 4K7PH 4NQXA 3T0EC 4F7EB 3R06A 3RZCD 3LEYL 1DL7H 5GS2H 3LDBC 1AH1A 4BZYA 4XRCA 2GHWB 3ULSA 3RWEA 2GSGB 1D5IH 1KJ2B 3WLBB 3K2UH 5GGRY 1U8HB 1I8LC 3JWOC 2BNQA 2HN7A 3BEVA 2MJWA 2C5DC 3EHBC 3OG6B 2DMKA 5D2LB 2PW2B 3BZFB 4X6EA 4CUCA 4P0DA 5MENB 3GJFK 3PJSA 2FEEI 1JGVL 5CBEA 2EH8H 3AXLB 4AIZA 4Y2DD 2ICEB 3JSSA 2VL4A 3KYOA 4LLWB 3U6RA 5L88L 3IETA 4M8QB 3FT2B 2X7LB 4G6KL 3LKRA 5EU3B 2MCG1 1RZJH 4X5XB 3O6ML 1QVOB 2ED7A 4JE4B 1YY8B 5E4EC 1F97A 3DJ9A 3QWRD 4F9LC 3MRHA 1TZIA 3TBTB 4U1JB 3DRQA 5CJ5A 2XWJB 1FYTB 1A4KA 2W9EL 3U4EB 1CDHA 1RZGA 5ABDE 3D0VA 3NFSH 5DJXB 4UTAH 1M05B 1WAAE 4FQ1L 4HZLA 3CMOL 3HR5B 3JWDL 3SDDD 4BQ9A 4IJ3C 1HEZB 2F53D 5FXCH 1YPZB 3ARBB 3QCTH 5EC2B 1KXQE 2V2WB 4HT1H 2EEDA 5T1DH 4TSCH 1XR8B 5FYLH 4RIRA 4F9PC 2OTWB 3CNKA 2MFNA 4PR5B 4OZFH 2A6JA 3UYPA 5ALCL 3PGFH 4PJGA 4GXUM 2CD0A 4GAYA 5EA0H 1MWAL 2VUYA 1R5WA 4QHLB 4NJAH 3LQZA 1NCCL 3IKCA 1TCMA 3LSOB 5DGQA 2FX7L 3GSWB 3QIWA 4JM4H 1A6WL 3HA0A 3ZYZA 1ZGLM 1WFNA 1MUJA 1KIPA 1A7QH 4OT1H 4TN9A 4HGWB 2NY4C 3MX0A 1N64H 5FCSH 3NGBC 1QO3A 1SEQL 2EEBA 1SQ2N 3V0WL 4RBPH 3S3PA 3A6BH 1U3HD 3BWUC 4RGOL 1NAMH 1JZ7A 1SY6A 2F15A 4X6DA 4KXZI 2PTTB 4NBZB 2FGWL 1YEGH 3VW3L 4W4OA 1RHHA 1KNOB 2HG5B 4RFEB 2Y6SD 1N0XH 1DQMH 4X8XA 3FB5B 3DXAA 2NY5L 3UDWC 3BRDA 1A14L 1C5DA 4ODHH 5I71B 5C6TH 4XCCL 1K3ZA 1MJ8H 2QJDA 2D9CA 4DGIL 1HILB 1EEZA 4CDHA 5LWYH 1M7IA 5D8JL 4HWBL 4X6CA 4X7FC 5GRYA 3RI5F 1MI5E 5F97E 4ZXBA 1K3IA 4M5YH 5DMYA 4N0YL 2JCCB 4WDIB 3RVWD 1FVDB 3SBWA 5TE4L 4LCWE 4RNRA 2NY0B 3KS0J 3WL9A 3AS0A 3HFMH 2DQDH 3CLFH 4OFKA 3AB0B 3C5JA 1D9KA 4JKPH 4XWGH 5MERB 4K3DH 4M48H 1MFCL 2KDGA 3PP4H 4HK0A 4KVCL 1KEML 2VUOA 2BDNL 5IWLA 3QDJE 1CE6B 3QQNA 5F89A 5KVFH 1A0QL 4RAVB 2VXVH 4NQDB 3WDJA 3GIZL 2ESVA 5GRWA 4NN6B 4L5FL 3FO2B 3ZE0E 3K3QA 4XNZC 1FLRH 1MCJA 3SE3C 4KDVA 4KPHL 4NQCD 5KSAA 5DI8B 3CMGA 1MAMH 3WFCH 3WO4B 4KMQA 3RZCA 2B4CC 1XGUA 5ITBL 1JIBA 3BQUD 3RGHA 3CX5K 2VDNH 4OFYD 4PY7A 3QEQE 5CEZD 2BNQE 2VLJE 5I2IB 4K9EH 1J1XH 2P1YA 4DZBA 4BQBA 3HMXA 1QFWH 1HWHB 2AKRB 1LP9F 3FQRB 4LLVA 4L3EB 2DQGL 4RQQA 5I19H 1JHTB 1ZLUH 1ZVSB 1U8PB 5I1EH 2OJZH 3D85D 5C0AD 5IGXL 1QBLL 1DFBL 1P4BH 4ODXB 5EU6B 4Y2DA 4K7PX 2J1KA 1IM9B 3QHTC 3FQXA 1K4CA 3OXRB 3HE7B 2UUDH 4BKLB 2D7NA 5ADOL 3O9WC 1VPOL 5CILL 4WTZG 3CH1A 1XIWB 2X5PA 3BIBX 5CINH 1I1CA 1D5BA 3QXUA 4PBVC 4ZODA 4Z76A 4JGMA 4K07A 1S78C 1CGXA 2Y25A 3O3EA 3QEGH 4LMQE 1UACL 4FFWC 2Z9TA 4HW6A 2WUCL 1DBBH 1NCTA 3S35L 5KOVC 4ZTOL 4OLZH 1N8ZB 3UJIL 1FZJA 4N0FA 1N5YH 4M93C 3FQUA 3SDDA 5DC9B 4GKZB 3CCHB 4NGHH 3NPZB 4QCIB 4Q9QH 4CAGA 2F53A 2W65A 3KYKH 3U30C 1FGVH 3VDBA 4P46B 2DKSA 5IK3A 4OB5H 4PJGE 3QUXD 1ODAA 4JDVB 1CF8L 3IDGB 4J6RH 3HI6L 4PJ8D 4RAUB 5J7CC 3IJSA 1UH2A 1I1YB 1LO4L 5GXBB 1LO0L 5K59E 4E0RA 1OF2B 4Z5RB 2HT2D 4UAOC 3TGXA 3CFDB 4QXGH 5IG7A 1JP5A 5GRJL 4PGCA 4JFFB 2X41A 3QXAB 2C3WA 1RUML 1VKXA 2LE9A 4L4VB 4B5EA 4JO1L 5H35B 3PG2A 5HYJB 1LHZA 2OI9C 4APQB 4LASL 1Z6JT 4HQQH 5K9QI 4X6DE 4JREB 1U3HA 2K9UA 3PV7A 3VXMB 5ETUA 1PQZB 4JJ5B 4GOSA 4LLYB 5T1MB 1A7PL 5FOBA 3MUGA 3UTSB 3TZVD 3L9RA 1TJHL 2SEBA 3MGTB 4PYHA 3DXAE 4NQSA 1W72B 2EE9A 1NGPL 3FO1A 4LVOC 3MUZ1 3S37H 4XAWL 1M6OB 1HINH 4XCNB 5F9JA 1B0GA 2QQNH 4CNIA 1J0YA 4GRLB 4Q6IC 3EZJB 4Y5YC 1CFBA 5T5NF 3PIQA 4XB7A 4DKFL 2IPKA 2VERN 4IJ3B 5FDWA 2HA1A 3AMKA 4PB0H 2ARJA 1XF2A 4GW4B 1EEYB 3MLZH 1UWGH 1RK0A 3STZA 1BQHA 1ZT1B 1KCRH 2YD4A 5F6IB 2XWBB 4PRBA 1A6TB 4Z7NE 2YR3A 2OJEA 4XWOC 1DE4B 3SE9H 4OGXL 1AGFB 2YPLD 3D39E 1F42A 3MJGX 4LGPB 4XPHL 2HMID 2VQ1B 3HUJB 4V1DB 3MV8B 1CI5A 3KDMA 1I7RA 3I50L 4ZUSB 2FO4A 3MLUH 1RQ5A 4Y0GA 3HC4L 4QKXB 2ESVE 2J4WL 2DL9A 4W4NA 1G7JA 4WFGD 3QYCA 1X5FA 4N1CA 1U6AL 4EI6B 1T22A 3QO0A 2AP2A 3NGBB 4HBCH 3RVUC 2R1WB 3NFNB 2VL5A 3GMRA 4NQCA 3T2OA 2I24N 2ILLA 3ULUD 4ZPVA 5E6ZA 2ADJB 2XZCL 2YD9A 2Y7QA 4W6YB 1OSPH 4P3DB 3MA7A 4PREA 3BQUA 4JDZB 1JHKH 1X5AA 4OFYA 1DANU 1CTOA 5ACMA 4ZD3H 1LDPL 3K8LA 2XOTA 4P3CL 4PJFA 4OD3L 4U31A 2CKBL 3KPPB 3Q1SL 2QTEA 3OKOB 5FYKH 1J0IA 5FKAB 4R8WL 4GXVL 3D85A 2OK0H 2KKQA 5C0AA 3I02A 5E08L 3MZTA 1QFHA 5D9SA 3LKSA 4FQPA 2IAMD 2DQUH 1MFAH 1KCSL 2FHBA 3VWJB 4JVWA 3FRPA 4I0CC 4P4KC 3C5ZC 2F58H 5B8CA 2W60A 5DR5H 4K3GA 3VXPB 4NM8H 2WBWB 4J1UA 2WQ8A 4PJ5D 4JFDB 4X8JB 5DGRA 2BRQA 3C8DA 4XC1L 2VZ3A 1YEDB 4EUPH 3MODL 1YECH 1XR9A 1BD2B 4NWUH 4MJID 5DZOA 2PO6C 5SWSD 3REVA 5EOCJ 1RIVL 3S34H 4G7VH 5C09D 1A6PA 4OJFH 5DFVC 1MIMH 5C0ND 4ODVL 5HHPB 1UEMA 5ICZB 1C08B 1OSZA 2VSDA 3E8UL 1IC4H 5BVPH 3QEUB 2LAAA 1FNEB 4PUBL 1N4XH 3QUXA 4L4JA 3QWOA 4Q97A 3QNZA 3LN4B 2YD8A 2PCPA 4KJPC 4FG6D 3VMPA 2DQEL 1DBJL 3CU1A 3G6JE 3OWEA 1TJIH 4PJ8A 3F6LA 1S9KC 3ILPB 4XI5D 3ISWA 5D7LD 4Y88A 1ES0A 4HFWB 5C8JB 3MRQB 4XP1H 5F93C 5D7IF 3BAEH 3B9KD 3OPZH 2F54B 5T3ZD 2D03L 5I1GL 2VDQH 1JPSH 4PTUA 3VD5A 2DQHH 1A9BB 1UQSB 1E6JH 2Z35B 3O9WB 2YUWA 5DMKB 1FO0L 4LCUA 3HNSL 1R0AL 1ZEAH 4ODWA 5BV7H 1PG7X 1RZKC 1YNLH 1A2YA 3TZVA 1EMTH 3I2CL 5JHLH 4A2LA 3ULVL 1NL0H 4Y1AD 3QJFA 5K9JL 2V2TB 2VDKL 5C0IA 4RWYL 1BJ1J 1GC1C 3V52H 3O4LD 5FA3A 7FABL 1JJUA 3U0TB 3S5LA 3ZHKA 4M93B 2HTKD 2YRPA 4OM0H 5BMFH 3QG6A 5EBGA 4P5TD 5ANMA 4LNRB 4OF6A 1AXIB 3HE6D 2NMSA 4HPYL 3U30B 4HK3J 5C7XL 2AQ2A 4XNMB 1CTNA 3SKOB 3CFJB 3AMLA 4J3WA 4K3EH 4RDQF 4LLDB 5D5MF 1NSNH 1RURH 3KJ4C 3O41B 4LP4A 3RA7L 2YPLA 3C6LC 3KPSD 5IW1B 3MREB 5D6DC 4ZFGH 1RUKL 1KJ3H 3VFPB 4KXZH 1FL6B 4UAOB 4DAGH 3VFGL 3TYFA 3BSZH 1OTSD 1R5VA 2MTPA 5CMAA 1U8JB 4YEEA 3MV01 4JHWL 3VXSE 5I1DA 3UTTD 4R7DA 3VFWB 1BLNA 1N5AA 4EN3C 4KY1H 3NTCL 2EDQA 1MCPL 3CVHA 3ZE1F 5ESQA 5HDLA 4ERSL 3JWDC 1BIHA 5IHUH 3GJEB 4HG4K 1A7RH 3MJ7B 5JPNB 2VN7A 1JPST 1N0LA 4HIHA 1BBJA 3HRZA 3EFDH 3HPLA 3K74B 4YE4H 4LVOB 3JTSB 1M7DA 1RZ7H 3FB8A 1BPVA 1GGUA 2I9TB 3CK0H 1IRAY 5C0AE 1HYSC 4JDTL 4BH8B 3LH2H 2X4UB 4NC1C 3TT3L 1UA6L 1K8IA 1UZ6F 4XXDA 4Q6IB 4P2RD 4Y5YB 3SCMC 2FLRT 4OUUA 5FM8A 4C59B 1YYLL 1UZ8B 2IAMA 1CXIA 2DQIH 3DV4B 2PW1B 4UINL 1JBJA 2EYRA 3SDCC 5C2UB 3I75B 4MA1C 5IVZB 3TJEL 1V3JA 1OAKL 1S8DB 2HT3C 3TVMC 2FATH 4DGYL 3MLRH 2H41A 3VXNA 4DW2H 1HH6B 5FUOH 1A6VH 3F8UB 4JFQB 3X12B 3GO1H 3W2DL 4AT6A 1FH5L 1K8DA 4PJ5A 5KS9A 2EYTA 3RWCA 2Q20A 1LK3L 4K3JH 4CKVX 4PJEF 3HAEB 3SY0B 1MQKH 3TN0D 4P2OC 3IDMA 4L29A 4F7TB 4MJIA 2XN9D 5E6YA 5SWSA 5EORL 4PRID 5E8PB 3WIFA 3IDUA 5CHNB 5C09A 4GMTL 3MOAL 4G43A 2GIYA 5GISL 5E7FA 5IB3B 2IPTH 3LZFH 5F1NA 2EZ0D 2NY5C 1SVZA 5EBMA 5CBAA 4E9LA 4MQXC 4I2XB 3IS1X 2C7UB 4JO3L 1OGAB 1BQHG 3GIVB 3IDJA 5IMLB 3VD9A 2R1YA 3TYGH 2AJSH 1NCNA 5BS0B 1F45A 1WGOA 3QDAA 4LSRL 5CIPH 5D7LA 3U0WL 4JO2H 2ZUTA 4X7SL 1RVFL 3VG0H 3GMLB 3OX8B 3RI5K 5DEZA 3B9KA 1FNFA 5DD1L 2G5BB 2GJ6B 4NKIH 2XTLA 4ODUB 3DUUB 2R1XA 1GGCH 3W5MA 4OCRL 5BJTA 1MEXL 3QUYD 4DQOH 4KZDL 2B20A 1CD1B 5DHYB 5A3IC 5GGQH 3EYVA 4NO0D 5I1JH 5J12B 1SY6L 1V05A 3SKMA 4JN2A 2DLEA 1FFOB 5IR1B 4NKMB 4Y1AA 4H0GA 5CGYD 3ZE2E 4PJHE 2DTML 1RUAL 4FTVE 5F7YC 5DJ2B 3O4LA 2PO6B 5ALBL 3P0YH 3RDTC 4NOFA 4XH2A 1KELL 5ANME 4PJ9C 3MJ9A 3WD5H 4S10A 3BZEA 1MJUH 1LD9B 1OHQA 2LFGA 5GJSL 2VAAA 4G8FA 3HE6A 5B39A 4FXKB 1EV2E 4M8VA 4BQ6A 3QIBD 3SGJC 3W39B 4MB3A 4Y5VC 3PWPA 4M03A 3RUGB 1S5IL 4HIEB 1BF2A 3RHWF 3FRPG 3GSQB 4XBGB 1ZTXL 1ZLUK 2BNUA 3KPSA 3WUWB 3S96B 3P9MB 5H94A 2AVGA 1ADQA 2X4OA 1VACB 4R96A 5IJVB 4G6ML 4M7LL 1EK3A 4E41D 5IVNA 2LAGB 3QCUL 4XNQB 3HG1D 2VZ1A 2UUDK 5FA4B 2YPVH 4ZS7L 2DICA 5BW7A 3GSRB 4U1GB 1IAOB 3O3DA 3UTTA 2V17L 4OAWA 3BOVA 3EYFA 4WI8A 3RY6C 2V9RA 3L3DA 3S3JA 1QKZH 3HZKB 3RWIB 2R15A 1R3HA 5DDHB 2XIDA 4HSQA 4C56D 5BVJB 4U33A 2V6HA 5H37H 3MLSH 2H3NB 3HMXL 2CUIA 3RTQC 5HGDA 4TTDD 2QKIA 2V2XA 3QPQC 4HJJH 3BT2L 2Y4SA 2AJ3B 5GSVA 4DOHB 3KPRB 3BHBA 5FGCB 4H1LH 3V6ZB 3G5ZB 4MNQB 1JWSA 4U2ZA 4P2RA 1IC7L 2OMBA 3VGBA 1I1AD 2H2PD 4S2SB 1AXTH 2DLTA 2NNAB 4FMKA 2ZZUT 3LHPL 4Z95L 1G6RL 2CH8A 3C9NB 4LCYB 5JHDD 3ZKNC 2E9IA 4M5ZH 4O4YH 5ID0B 4OF3A 1V3LA 2CUHA 3NZHL 3OR7B 1Q1JH 3GZKA 5DA4A 1T7YA 5INDA 4ZUUA 3SKNB 4PJ5E 5E6IC 5JW4N 3KJ4B 1ZHKB 3C6LB 2AEQL 2DI9A 3EO0B 4RX4D 4H20L 1X4XA 2YOCA 1Z5LA 3ZKMD 4PJ7B 3R1GH 4IDLA 3RZWA 3G6AA 5DJCB 4XVTL 1Y0LA 4K7FA 4HCRH 1A9EB 1IBGL 2G60L 3Q6GH 4MJIE 5IB5A 2F19H 1U93A 4LQFH 4EXPX 3KYMB 3QNYA 4IS6B 5SWSE 3TN0A 1CGTA 3WSQH 4JZNA 5HVGB 4I77H 2XN9A 4KROD 4OGYH 4R2GD 4S1QH 1E4JA 4IOFD 1P4LA 4S0TD 3DO3A 4AK1A 1KN4H 1MJJB 2FBJH 4PRIA 4I5BA 1F4XL 3ARDD 4Z7VB 1OT2A 4EN3B 2JCCF 3S5LG 2IQAA 5EN2A 4XNXH 4H88L 2E7BA 1WV7T 3TO4C 4IRJD 5SWQB 3NIDF 4L1HA 5KSBF 4ZOBA 3QH3B 3VFMA 1IGIL 3IDNB 5EOQL 5D7KD 4WO4C 3WLWC 5SWZA 1CGYA 3J8F7 1G7IB 1QSFD 1YEHL 3DX7B 4HS8L 4JHAH 5IKCB 4NQED 5L2KD 5C0BA 4DUVA 1XGQA 4QT5B 3UJJL 4F8TA 1IVLA 3HI1B 4OLYL 3MLTA 2A9NL 4I3RL 4R4FH 5F21B 4L8BA 1BVLA 4JRXA 1YQVL 2IBGA 3S7GA 1ETZA 1UYWH 5EFIB 1ED3A 2DD8H 3PWLA 2BFVL 4KJQC 4XP5L 4OQTA 3QUYA 1CFNA 5IM7B 4QTHA 5CZKA 3TVMB 4WUUD 3E3QE 2EDOA 4PJIB 4WW1B 1BJ8A 1S3KL 4NO0A 4UB0L 1MOEA 4C55A 1EIBA 4URTB 3EUUA 3NA4A 2BP3A 1D5ZA 3RIAK 5FK9A 3LD8C 5K9OA 2CUMA 4WEUD 3O4LE 1I1FB 2YN5A 2FWOA 3FFCB 4R9HA 3VG9C 4OKVB 1NQBA 1DDHB 3KPNB 4I0PB 5E5UB 5E2TL 4KHXL 3WS6A 5ISZD 1P9MA 5I76B 3PWPE 2AERT 3QIBA 1VENA 4OF0A 4X9GA 2WSKA 4ISVA 3ARGD 3T1WA 1IT9H 3HI5H 1QFUH 3FOMA 1NH6A 4YDJA 4HIXL 5B3JF 5ESVB 2HVJA 2LV4A 1X5LA 4KVNH 5EC1A 4OSUH 3BIAX 5L2JB 1CXLA 3TNMA 2IANE 4E41A 3Q6FA 3HG1A 1JZ8A 2OR9H 3QI9C 1L9NA 4X4ZA 1IL1A 3TO2B 2BVQB 3UTTE 2X9XA 3PL6D 5HHVH 3UPCA 2AW2A 3DSFL 4EBQL 2X4PB 5E9DD 5LBSH 1UH4A 3MUJA 4JRYA 4WHDA 2MKLC 1UT9A 5IJKA 4Z6AT 2BOCB 4YDIH 4JKKA 4EI5A 3VRJB 3SOBH 1QRNB 1Q0YL 4U6HA 2DDQH 4OKDA 1YEEL 5LJYH 2FD6H 1K6QH 4C56A 1W0YT 2IFGA 3MNWA 3V4UL 1DQTA 4RMTA 2BRRL 2H1PH 5CEZL 2N4IA 3QRGL 1LO3L 3C2SA 1YYMH 3M8OL 1F8TL 3P77A 3QR2A 4G9FB 4UIKL 3WJJC 3MA9H 3T4YB 5J11B 1U8IB 1MCFA 2DIBA 1KPRA 2QLVB 4YHPB 5F3HA 3MFGB 1Q8MA 2R23A 4PJ9B 1XCQA 1I1AA 5F71A 5D1QD 3RWDB 3BRFA 4UNUA 3LQAL 2DWEA 5I9QC 2Y5TA 4ELKB 4HWEH 5JHDA 3MJ8A 3X11B 1OGTB 1VGEH 3HRPA 4U1HB 3VRIB 5A2IH 3TJHC 2WUBL 2RQ8A 1SJEB 2EO9A 3VU2A 3B3IA 3PF2A 3MZGB 4ZFZB 1J8HE 4RX4A 1NGWA 5HGAA 1D5MA 1GXEA 2EDNA 4FZ8L 2F8OA 3ZDZF 3MLYL 4JY6A 4LRIA 5IV2B 1OOAA 2H32B 2HWZH 3RGVD 4ODTL 4HKBB 4WVRA 1NPUA 2VLRD 5DHVA 2GTWB 4CVZA 1DQQA 3LS4L 2ZG1A 2EIBA 4OLEA 3ARDA 4XCEB 4ELMA 4F7MB 2DYPD 4IRJA 2J8UB 5SWZE 4NPYA 4HPOH 4FQ2L 3ZT7A 4OLXH 2R2EB 5EUKA 5B39G 5C0BE 4XNUH 3BE1L 3FQWB 1QSFA 3L3IA 4NQEA 5L2KA 4CDGC 2CGRH 4JRXE 1BOYA 3S88H 1AJ7L 4UU9B 1G7PA 4MA3B 1J1PH 3C09C 3LPFA 5T3XH 3DVIA 4JG0L 3VFNB 1HXMA 5I1KH 1H5BA 2UWEB 1KCLA 2A83A 35C8L 3V6BR 4AIXA 3W11C 1G0DA 5HY9A 4HGKC 1I3VA 1JUFA 4QRPD 1IGJA 4WUUA 4NQVA 4ZAKD 3WNLA 4JM2C 5E6IB 4UV4L 2WAHA 1F4WH 2G5RA 4Y4KD 1ONQB 1MCBA 4N1EA 1NMAL 2EDKA 1T2XA 4HEME 1PDKA 2ZWLT 2VZUA 3Q48A 4TPRL 3WJLA 4JQIH 4O5LL 4ZQKB 4O2FA 4R97C 3OKDB 5ISZA 4HIIA 3HPJB 5CD3B 1LEGB 1LP9E 1ACYL 4EKXA 1UM6L 3DMMD 1AQKL 3D0LB 4ODBD 4HXAH 4JFXA 3GHEL 5C9JA 3ARGA 4IMKA 4PS4L 3VFTA 4Y16B 4OZIE 1FZKA 2VDLL 32C2A 5SV4A 3W0WE 4M7JL 1E28B 4E41E 3VCLA 1T1WA 2BERA 1JNJA 4PLNC 5EZLB 5FEBA 4LBEB 3SO5A 3F58L 1S5HB 4X4XB 1B3JA 1UKSA 4JRYE 1DN0B 3PL6A 4YWGH 3NCJH 2DKUA 1MF2L 4XZUA 1FAIH 2Z31B 3KYNA 5BCAA 3QFJB 3FKUS 4UT6L 4GKSB 5FAAA 4KTEL 4C56E 1FE8H 3CVHL 4JO4H 1NCDL 3ULUL 4QXTA 3DO7B 4GBXD 4A6YA 2B4CH 5D1ZC 4UQ3B 4K8RD 1OAZH 4MAYB 4S1SH 5DRNA 4GG6B 3LD8B 5SX5H 1AFVH 3GM8A 4HUVB 1TZHA 3WN5A 5CCKL 2LU4A 3V0VB 3EAKA 5J6HB 3D3VB 2PUQT 4NKDB 3VG9B 1PAMA 1YNKL 5JOFA 1VFBB 1MHPH 3IDXL 2CLVA 3OSKA 4F33A 1IMHC 5D1QA 5JHDE 4FFYH 1PKOA 1T1YA 3LKOA 1NC4B 2IQ9H 1A47A 2CKBB 2FHCA 5DURD 4Y4FD 5I8EA 3E1F1 1U8OA 1IAIL 2V5YA 2Q8AH 5T5FH 3HZVB 4PLKC 4Q7DA 3FL7A 3L1OH 3LQMA 1QFWM 4S1RL 3O8XB 4G7YH 1ZHNB 3TV3H 3UAJD 3BN9C 4JG1L 4L8SB 1RZIA 2JB6B 5E8EB 1C12A 1S7TA 1CR9H 4J2XA 2A6KB 5I74C 1EXUB 2QSCL 3KNBA 4BSWB 1UENA 4N5EC 3KLHD 5GZND 3RGVA 3ZHDA 2VLRA 2ICWB 1NKRA 2OQJB 1GZPB 4YHOL 1A6UH 4PBWD 2VIRA 1WIUA 4MVBD 2ZCLL 4W4OC 2GSIB 3CLEH 1QPXA 1RU9H 4HKJA 1T7XA 4F80A 4MAUH 2DYPA 43CAB 5D7KE 3HNVL 4HDIB 5TPWL 1XEDA 4NQEE 5KAQF 2XG4A 5I1CH 2H45A 4PRAA 1C5CH 2X4QA 3QUML 4HV8A 1XFPA 3P11H 3SBWC 4LIQE 5CZXC 3BKJH 4F2MA 1PYWB 3TCLB 4E5XB 5T1LB 1RIUH 5C9KA 4DVBB 4ENED 3MCKB 4ZDHB 5JQ6L 5F6HI 4P2QE 3NACL 5I9QB 1MELA 3UPRA 2BHUA 2NLJB 4KI1A 1CD8A 3F62A 5L6YL 1JF1B 4WUUE 1SEBB 5DVNA 4GAJL 2YUXA 4QRPA 3NN8A 4N8CH 4HS3A 1R24A 1C16A 4ZAKA 1FNSL 1FL5A 3SDAC 4NZRH 4UILH 1FFRA 1KOAA 4Y4KA 5KANG 1JGLL 4JCLA 4AH2A 3C5SA 3SJVD 1X4ZA 4R7NA 3I6GA 1FO0B 3IDYB 3MOBH 2GCYB 3ARSA 1MCSA 3I9GL 5GSRB 5DZNA 4AEFA 5CJXA 2R0WH 2GUOB 4JFYA 3GSNA 1J87A 1DLFH 1AD0A 4Q2ZA 3V4PL 3BMWA 4O51B 4EOWH 4ETYA 4H26A 3BXNB 5BXFB 3QHZH 3GJFA 4KQ3L 1I3RB 5HVHB 25C8H 2NY1B 2G75B 2Z4QA 3NZ8B 5C2BH 2F74B 2JJTC 5FDYA 3DMMA 4UQ2B 5INCB 1KTKE 3MBXL 4KKLC 3KJ6L 2Q6WA 3L95A 5E1AA 2BX5A 4Y2DC 5HHQB 1H8SA 4X80L 3RWHB 5JZ7C 1BWWA 5F9AC 3VGAC 1QSED 3MLWH 4OCYH 1MI5B 2LQRA 1F11A 1JWUB 3KLAA 3IU4H 1DQJA 3SDYH 3HAEH 2VKXA 4MCYB 5HJ3A 1WC7A 1Z3GL 1E4WL 4LCWB 3NCMA 2FBOJ 5C08D 1I8KA 2XTJE 1KTLB 4Z7WB 2D7TL 2YPKA 2YMXL 1F02I 1KN2H 3MXWL 3VXRA 5DRXA 1HHGA 4YQXL 1INQA 3AY4A 3WS3A 4IOIA 2NR6D 3NIGE 4OIIH 4JM2B 4GBXA 2V7HB 2VQUA 5JW5B 4XVJH 3VFVA 4MA8L 4AG4H 1VESA 1GAFH 1VFAB 1HKLH 5C0CD 4AEHL 3VXUD 3HTLX 3INUH 3MACL 2NXYB 4NQXB 1EO8L 3CXHK 3R06B 2QSQA 3VI4E 2PETA 1BQSA 1NAKH 4XRCB 3ULSB 3VXQA 1M7XA 1P5VA 5IBTH 3ET9F 1UCTA 1EX0A 1T89A 1IAMA 4HIJA 4XP4H 3GB7A 2HN7B 3BEVB 4DZ8A 2C4XA 2A1WH 3LV3A 4TOYL 4Y4FA 3ALPA 4X6EB 4FMFA 5AZ2H 2IPUG 5BZWA 1PZUB 1BECA 3PJSB 4XBPA 4AIZB 5CBEB 4P59L 2DBJA 2FNBA 4IHOA 1FIGL 3KYOB 3IETB 5GGUA 4HMCA 3LKRB 4JZJA 4UTBH 2ADGA 2P5WD 3EYSH 5DUML 3V5HA 1Q72H 1BMGA 2VLRE 3BISA 1P84J 3OAYH 3MRHB 2I60L 1TZIB 4KI5D 3PP3H 1GOGA 1BREA 1L0XA 1ZA6A 1FNAA 3DRQB 5DQ9A 3WLBA 4D0CA 1A4KB 2Y6SC 1MY5A 4MHHI 5JMRA 1RZGB 3D0VB 3V0AC 5IW6A 4HZLB 4KH2A 2HP4A 3V4VH 3ZZ1A 4OZHF 5GGVH 5D2LA 2PW2A 5F9WC 1E4KA 3ILQD 4F57H 2K3TA 3V2AR 4LVNB 1DTUA 3QUKA 4OZ4A 1KF9B 2FX8L 2E27H 3GBML 2E7LA 3RVWC 5KVDL 4PJAE 1DBKH 3C60C 4RIRB 3SKJH 5DD5H 5JIKA 2AJVL 2A6JB 5FKPA 1D5XA 3NH7L 2N7BA 5L8KB 4Z7UF 5GGTH 2VOTA 4PJGB 2PYEE 4GAYB 3GNML 1TPXB 3EOYG 2XY1A 1R5WB 5MI0B 2VH5H 4WNQA 3LQZB 5IESL 2AK4E 3NAAL 3IKCB 2VXSL 5KVGL 1P7KA 3QIWB 4TNWF 1MUJB 1KIPB 3LKQA 1RZKH 2A77L 2A2QT 3HR5A 5D1XD 5E2JA 1CLOL 1QO3B 4HC1A 1PY4A 5K93A 3SJVA 1MIEH 1G9ML 4D3CL 1GC1H 1ZLWH 5DUPL 4IM8A 4DEPC 2OTWA 3EOTL 4X6DB 1ZMYA 1E6OL 5IHBA 1G1CA 5EOTA 1IQDA 5AZEL 2O5YL 1RHHB 4FP8L 4GQ9L 3SO3C 1QOKA 3QSKB 5JLZA 3DXAB 1A6ZA 1M4KA 1P6FA 4KGLA 1MCWM 1C5DB 4RGMB 4F15B 4PJDF 1RJLA 1EEZB 1AHWA 1RUPL 1M7IB 4X6CB 1JGVH 1N26A 4PJ7F 4ZXBB 5L88H 1QHPA 2PR4H 5GIRA 2D7MA 5HGHA 1QSEA 2JB5L 5IBLD 1NFDA 4PRPD 5D93C 4XT1C 1B2WL 2VZTA 4RNRB 3GI8L 1AGDA 1UJ3A 5I1AA 3FB7A 2ICCA 3W81A 3BKYL 5B8CC 3MLXH 3C5JB 1D9KB 5C08A 2OM5A 1TCRA 1A7BA 2EO1A 3PDOA 1BJMA 4HK0B 3VXRE 2RHEA 5IB2A 1G7LA 3BWAA 3RNKA 2W9EH 2D4FA 3G04A 2NX5D 2A6IA 5F89B 4FQ1H 2ICES 2ESVB 3CMOH 5DD3L 5F7DA 5F7HA 4QF1A 3UPAA 5C0CA 3TM6A 4YAQA 2EDDA 3VXUA 4ZOEA 2P8PA 5KSAB 5DRZA 4YK4C 3RZCB 2YK1L 5CGMA 2OTUA 1XGUB 4NDMA 5J13C 2P42B 4MXVF 2DJUA 5DJ6A 4PY7B 5ALCH 3AM8A 4DZBB 1QLRA 4LLVB 1MWAH 1AO7E 4RQQB 3PABA 2HT2C 3CDYA 4PJIF 1NGYA 4OLUH 2YZ1A 4P49A 3QIUD 1MHCA 5E00A 1HH9A 1A6WH 3W9DA 3WFDL 4CL7A 4Y2DB 3FQXB 1SYVA 4NQDA 3TC9A 1K4CB 4P23C 4NT6A 1SEQH 3RY5A 2FYYA 3CH1B 2P5WA 3LY6A 3V0WH 4DN3L 4EQ2A 1FBIL 1D5BB 2IEPA 4Z76B 1CWVA 4PJXA 4RGOH 2YN3A 1D6EA 3TZVC 3O3EB 2FGWH 2APVA 3VW3H 2A0LD 5DJAA 2X4RA 4YDLC 4FZEH 1Q94A 5F1KC 5GS2D 3FQRA 5D2LE 1CDIA 1JNNL 1FZJB 2DKMA 5EULV 1A14H 4N0FB 5TDPA 1WWAX 3FQUB 3SDDB 4XCCH 1T6WA 5FO9B 1V3KA 2F53B 4TVPE 2W65B 1R3LA 4HWBH 4LSQH 1TETH 4ZUTA 1MQ8A 4GS7C 1A7OH 4J3TA 5CJBA 1MJ7L 5IK3B 4A2MA 3V79C 5JMOC 5GHWH 3QAZB 4LIQL 4PYGA 2D31A 5ID1A 3MBEC 3KPQA 3BP5A 4QRTA 4U49A 1MFCH 2HMIC 1FYTE 1UM4H 3IJSB 1KEMH 4E0RB 4Z7QF 3PHQA 4U1KA 5IG7B 5BQ7A 4ALAL 1A0QH 1NANI 4PGCB 1FDLH 2YXMA 3GIZH 1YPZE 1F90L 3CCHA 1VKXB 4L5FH 3GRWH 2D0HA 2AS5M 1S7XA 4KPHH 3S4SA 5L7XL 1EFQA 1U3HB 4LEXL 1CGUA 5ETUB 4UBDD 5FOBB 3OQ3B 3MUGB 4JANA 4KWUA 3P4NA 3L9RB 3V6OA 2SEBB 4NQSB 3FO1B 5FYLD 5TF1H 3ZTJG 3GK8L 5F9JB 2X05A 3EDDA 1HHKA 2DQGH 4I0KA 1B0GB 5SX5K 4CNIB 1OAYH 2AEPH 3PIQB 5F9WB 2IPKB 2F5AH 5DJ8A 5FDWB 1DFBH 2ARJB 2AV7A 2EDHA 2Q76A 2EE6A 4RGND 1XF2B 3QCVL 4Y19D 2BC4B 2VWEE 1F2XK 1MSPA 1CK0L 1RK0B 3STZB 3GSOA 1BQHB 3OJVC 4PRPA 1IKNA 2B7DT 1KFAH 5CILH 3QNXB 5HPMA 4PRBB 2Z93A 5EZOL 2OJEB 2V5SA 4WEBH 3NPSC 4JJ5A 1U92A 3B5HA 2XPGA 1OAUL 3TF7C 3KDMB 1I7RB 3S35H 2WUCH 2FZ3A 4ZTOH 2FO4B 5I8CA 3DHJA 2NX5A 1RFDH 1G7JB 4ZSOA 3FCTA 4A6YL 1CGVA 2NY6D 1J10A 4I3SL 3RY4A 4XAKD 4GRLA 2GQHA 1T22B 4YNYA 3N0PB 1OCWL 2Y36L 2I5YL 2VL5B 2JCCE 3GMRB 4NQCB 3MNVA 4GAGL 4LSSL 1LE5B 3BUTA 4ZPVB 3BDYH 3UBXA 1MCLA 2Y7QB 5A16A 3MA7B 4PREB 3BQUB 3CVIL 4PBXA 1A6TA 1IZKA 1MREL 3HZMA 4HKZA 1TZGH 1T0NA 2UWEF 3T2NH 5HVFB 4FFZL 4PJFB 1CF8H 3GMMA 3L3OA 4XCFL 4CU6A 1W0WA 2G9HA 4XI5C 4KMTL 2Q1EA 1LO0H 4L3AA 3D85B 5C0AB 3I02B 3QIUA 4NQDE 3B9KC 4YHKL 5EU4A 5GRJH 5D9SB 4NHCH 1KIRA 3LKSB 2W92A 2HFTA 2DJSA 1T66D 4KV5F 1RUMH 3QEHA 4QXUH 3L7FA 4U4BA 1JVKA 2XZAL 4JO1H 2R1WA 5AYUH 5E70A 2EIEA 4PJXE 4LASH 5B8CB 1UWEL 2W60B 4FQCL 5C6PB 1Y18A 3U4BL 4YO0A 3E3QC 4J1UB 1N6VA 2ITCA 2O5ZH 3BPCA 1T21B 3OZ9H 4L3EE 4M02A 4LARL 4U6VH 2WLYA 2DQFA 1XR9B 4XAWH 1HOCA 1P69B 3REVB 4M6MH 4M62L 2HTKC 5EU6E 3ARFD 4WWID 3H9YA 1U0QA 2B1HL 3HE6C 2JTDA 2D3VA 1OSZB 4KKAD 1SVCP 1NFIA 2AXHA 3KPOA 3QUXB 2NY3D 3QNZB 2PCPB 3MGOA 1GHFL 4OGXH 3VXPA 1T0MB 4XPHH 4PJ8B 3I50H 3V95A 1ES0B 5HI4C 2M2DA 4ONOA 5CD5D 1KTDA 3HC4H 1VFUA 2J4WH 4OIBA 5BW7C 3PNWA 4KRPD 4YBHA 4PTUB 4KK5D 4J3VA 2Q87A 2ZNXA 4KTDH 4YZFF 3RKDC 1SJXA 1K85A 4ODWB 2B39A 5ICZA 3WNKA 2QQQA 3GSNL 2XZCH 4NC0B 4ZUWA 3V6OE 1A2YB 1I3GL 3TZVB 5CJ8A 2JELL 3QJFB 3QQ4A 5C0IB 2FECL 4LAQH 4YDLB 4NO5A 4P3CH 3X13A 4OD3H 2YKLL 2QQLL 3Q1SH 5FA3B 3S5LB 3ES6A 4GXVH 3IFNH 2A73A 1OY3B 3QG6B 5E08H 5ANMB 1QPPA 4Y19A 2AJXH 5HYJE 4WFEE 1U3ZA 1KCSH 2BZDA 1KBGH 2Z35A 5SX4I 3N85L 4P4RA 4WFFD 1DSFH 4PV8A 2HLFD 3UTSE 2YPLB 1S7RA 4NO3A 2JK5A 2NX5E 3EDKA 4ORGA 2A6DA 2FB4L 4KJWD 2VR4A 4KQ4H 4ORZC 1B0RA 3AS2A 1NAMA 3MODH 1EJ6A 2EDEA 3TYFB 3B2VL 5DJDA 1R5VB 1WAAF 4FFVC 5CMAB 5C3LD 4AQ1B 4OV6F 3MRPA 4HFUL 1JGUL 2D7QA 5I1DB 3FQTA 2QADC 4R7DB 2ERJB 4K8RL 3QDGD 1RIVH 3SE8L 1BLNB 1N5AB 2CMRL 4D2NA 1U8NA 1KB9J 2OR7A 5JO5A 4ODVH 4HKXA 3PP3K 2EZ0C 3CVHB 5F8RC 2LU3A 5ESQB 3E8UH 5LGHL 1Z0NA 2IGFL 4NIKB 5D72H 3B9DA 4PUBH 3SPVA 1G7QA 4HIHB 1BBJB 3HRZB 3HPLB 3HUJE 4V1DE 4RFOL 4ONGL 2BY0A 4WI6A 2Y23A 3U82B 5HDOA 1I75A 1M7DB 5JORA 3FB8B 3PWJA 5F7FA 3BKCL 5E99L 1K8IB 1CVRA 4XXDB 1J11A 4OUUB 5IFHL 1EO7A 2D03H 1D7FA 3ZTNL 2IAMB 3PGCA 5IROC 1Q9LA 1UB6A 4UMGA 2GTZA 2OS7A 3KPTA 4KAQL 3GSXA 4LKCA 3VXNB 3TBYA 3HNSH 1R0AH 4AT6B 2OMNA 1VEPA 3GJEA 3S4SG 1K8DB 4PJ5B 5KS9B 2EYTB 5DWUH 4XGZA 3RWCB 3I2CH 1KJ2L 1QHOA 1G9MC 5K9JH 4BZ1H 5EO1A 3IDMB 4RWYH 4L29B 2ZOLA 4TNWK 3TH3T 4MJIB 4QWWD 2B2XL 1RAMA 5SWSB 7FABH 2V9TA 3GGWA 1JMXA 3WIFB 3ARFA 4OBRA 1ZLWK 1FNGA 4AMKL 3CU7A 5C09B 1ZLSL 4G43B 3H2WA 5FYKD 4HPYH 5DXWA 4JHBA 4E42A 4TVPL 5F1NB 5C7XH 5EBMB 2FSEA 4TUKL 1L4IA 5CBAB 1SBSL 3SGDH 4Y7MA 1BFSA 3IFOA 1U8QA 4JFDE 3IDJB 2ENSA 2R1YB 3VD7A 1EAPA 5HD8D 4MD4A 1FGNL 5AYQA 1PG7W 1RUKH 1BD2E 4JFZL 5D7LB 3H9ZA 5I73B 3QXDA 1XT5A 2CDFB 4JM2F 3VH8A 2ADFL 4NN5B 1WWCA 3B9KB 2FX9H 3ZDYE 4JHWH 1MPAL 3DTXA 5CHNA 5B38B 5HYFA 3P4LA 3FOLA 2R1XB 4LAJH 3ZE0F 4EI5C 2F5BL 5BJTB 1PX3A 2J2ZA 4M6NL 1I9RL 5D96B 2R8SL 1F6AA 4MDJB 3EYVB 1QLFA 4NZJA 2YRZA 4ERSH 4OFPA 1G84A 3SKMB 5FYLE 4Y1AB 3UBXG 2IC2A 1DEEA 1OWRM 2YSSA 2NXZD 3IKKA 4M6AA 1J7VR 3O4LB 2GW5A 1WIOA 4XHJC 1UA6H 4XH2B 4OLVL 5IHLB 5CJOL 2VC2L 4I8DA 3EOBA 4LSVL 4Y19E 3BZEB 1YYLH 3HZYA 3KR3H 1U95A 4YR6A 2C3HA 4FABH 2VAAB 3HE6B 3SQOL 3VMOA 5TF0A 1NANH 1VCAA 3TJEH 2XFXA 1LGVA 4CVWA 4JPWH 4DGYH 5DHYA 3P30L 4WY7L 3VWKC 2CO7B 5DC0A 2BNUB 3KPSB 4NWTL 1F3RB 4QHNA 1FH5H 5H94B 1BBDL 1OM3L 1QR1A 1KSRA 4NZDA 2X4OB 1NUGA 4R96B 2R29H 1LK3H 3OHXA 4MLIA 2EKJA 3STBA 1MRFL 4ZS6C 2AJUH 1HSBA 3O6FD 2IH3A 2Y07L 4KROC 4R2GC 2CO6B 3BKMH 4IOFC 3Q5YA 1VDGA 2B8OT 3O3DB 3BESR 3UTTB 1M1SA 3QDGA 4OAWB 3EYFB 2IBZX 4X9FA 1AD9A 4GMTH 3L3DB 3PV6A 1RULL 5J4MA 1R3HB 2Z91A 3BH8A 4K23L 3EO9L 4K71C 4PJGF 3MCLL 3WKMH 2FLBT 1OQXA 3FHAA 4G80A 5HGDB 1RJCA 1FNHA 1Z9MA 2QKIB 2V2XB 3S96A 5GSVB 3BHBB 2X44D 4LSRH 3KHQA 5K59F 4JFED 1JWSB 3U0WH 5K33A 5J3HD 1RVFH 4P2RB 3KG5A 1NGQL 4K7PY 4NOBA 4O2EA 1T04A 4G3YH 5MP6H 4AENA 1KCVL 2BMKA 1SM3H 1ZVYA 1CL7I 4OCRH 1MEXH 4KZDH 1NEUA 1F4HA 1VGKA 4X6DF 4R0LA 4LHJB 3QA3A 4ZUUB 5INDB 5HBBA 4DN4L 5HI3C 1Z5LB 1LNUA 3G6AB 2W38A 1Y0LB 1QBAA 4K7FB 3TNNA 1K4DA 2HH0L 4XHQA 5IB5B 4M1DL 3ZKXC 1UADC 1U93B 2DTMH 1RUAH 3TN0B 3QNYB 3CDCA 5D7SL 5ADPH 3IYLW 4JZNB 1ROWA 2KBGA 2XN9B 4JVPA 2JJSA 1P4LB 2X4TB 4PRIB 1KELH 4I5BB 5FECA 2QADB 3RAJL 3FN0L 1WF5A 4WFHE 1ZGLP 3O4OC 2IQAB 5EN2B 1IM3A 4X0KA 4M43L 1MRCL 4LFHD 1DZBA 5CGTA 5BO1L 5ID0A 4EDXA 2GAZA 2LABA 3VFMB 2HFFA 5TQ2L 4Z7NF 4HAFA 1S5IH 2J5LC 1Z0MA 1ZTXH 3QHFL 3FT4A 1WBZB 1FC1A 3GBLA 1IZJA 4V2BA 4L9LB 1XGQB 2X6MA 1U42A 2Q8BH 4S1DC 4L8BB 4G6MH 2JJVA 4M7LH 1BVLB 1JFQL 1IGML 1ETZB 1RD6A 3QQ9D 4ZS7H 3WIIL 2ADIA 3I3BA 2BVTA 1IAII 1ED3B 2DM7A 2V17H 3H3PL 2XTJC 3PWLB 4PGJA 3QUYB 4U6XA 1CFNB 4QTHB 3TA3D 4U1MA 5LGKA 2ZKHH 4NO0B 2I07A 1INEL 2W07A 3F7RA 4UDUA 4I2XE 3OAZK 3RVXD 5E4IA 1OGAE 4OLWL 5I1IL 2BHYA 1D5ZB 5F7UA 1CE1H 5FK9B 5K9OB 4YFEA 3HMXH 2AXFA 4NQTA 4BFBD 3BT2H 4OCLC 3H42H 2FWOB 1J1OL 3ZMRA 5C6WH 4G6JH 1MFEL 1IC7H 2GJ6E 4KRNA 3MLVL 4R6UA 4WENB 3LHPH 4Z95H 1G6RH 3DROA 1W2KT 1UVQA 1CGSH 3QIBB 4WU5A 5EZIL 4TSAL 1AY1H 4ISVB 3RWGA 2MNUA 5D7IA 1EAJA 3FOMB 4ODSL 4HHAA 4YDJB 2HVJB 4U0RB 4B50A 2AEQH 1FV1A 4LSUL 4H20H 4NFCA 5EC1B 1TQBC 1OP9A 4XVTH 3G5XA 3TNMB 1IBGH 4E41B 3HG1B 3ZSTA 5JPMA 1IL1B 4CN6A 3O6FA 1C7SA 1D6VH 3RGVC 3U79A 3KS0H 1QZ1A 4ONFL 4H5SA 4JRYB 5F9OL 4GRWB 4KK6C 3DOSA 1CVSC 4JGUA 3KPMA 2JF1A 4H88H 4M7LT 3WXVL 4U6HB 3RUGE 1OTUC 3CGTA 4C56B 5GGSB 1IGIH 3MNWB 3QT2A 2J8HA 1Q9WA 1T83A 3G6JF 5SX4H 1I9JL 3P77B 4NCC2 2BVPA 1C1EH 2A9NH 4I3RH 4OLYH 3FQNA 1KPRB 5F3HB 1YQVH 2R23B 5JOEA 2LTQB 4G8GD 5D5MA 1I1AB 1XGTA 1A1NA 2DWEB 4L8DB 5M7QA 3GUTA 2Y5TB 3VH8G 4LL9A 2V7NA 5JHDB 3MJ8B 2GT9A 2XNAA 4LPWA 4MQSB 2DLHA 5KTEH 4NJ9L 4LLAA 4XP5H 2EH7L 5E2VH 3B3IB 4OI7A 1GGIL 1S3KH 4XBEL 4KRLB 1F58H 4Y4KC 1NGWB 5HGAB 1D5MB 2J6EL 2CRMA 3EYUL 4NYLA 3CIQA 4K7PL 4N8VA 1H9VA 4JY6B 3KPRE 4WI7A 5FGCE 3TPUA 4IRSC 2BXYA 4MNQE 1DANT 3N1QC 1O0VA 4KROB 4R2GB 2X1XR 4QGYA 5DHVB 5EIQA 4XMLH 4CVZB 1DQQB 3VE0A 5EG6C 4Y4HD 5FYKE 3ARDB 4KHXH 4ELMB 3MV7D 4QRQA 2WBKA 2A38A 1MNUH 3DYMA 4IRJB 4NPYB 4U1HA 5EUKB 1JZ6A 1YEJH 2A9MH 3NA9H 1QSFB 3UEZA 1IAKA 4HIXH 2YD2A 3L3IB 4KHTL 3MO1A 4NQEB 5L2KB 4KUCF 2C26A 1RZJL 4QRUA 1G7PB 4YDKL 3K80A 4MS8C 1OVZA 4LPVA 4NN7C 5I18H 4EBQH 3DNKA 4Z7VE 1HXMB 4OZGA 5IF0A 5EO0A 1H5BB 2A83B 5F7LB 5HY9B 4WW2A 3BH9A 3GMPA 3B8SA 1JUFB 4PJEA 4XCEA 4WI9A 1IGJB 3AY4C 4Z0XA 3TA3A 1Q0YH 4WUUB 4NQVB 3OGOE 3SGKC 4Q9RH 4GBXC 3OKLA 3U7AA 3ARUA 4K8RC 4HT1L 3VI3E 1QRKA 3F7YA 4PJFF 4LSPL 2H8PA 3U0PA 5T1DL 3FONA 3QRGH 1LO3H 1MCOL 3ZKXB 4TSCL 3VD4A 5FYLL 5IOPA 3M8OH 1F8TH 4UIKH 4HUUA 4JEGB 5HGGS 4MXVE 1EVUA 4MZ3A 2CXGA 1PGRB 4O2FB 5ISZB 4K3HA 4HIIB 1T7ZA 1T89C 5E8NA 5CIPA 4OFIA 4NUGH 2EECA 4BQCA 1ZHLB 4JFXB 5C9JB 2DM2A 4X9HA 3ARGB 3DHMA 4I18A 2DL2A 4OT1L 3VFTB 1LEIB 4HS6A 1FZKB 32C2B 1N64L 3V5KA 4J4PC 2NY2C 4HXBH 2Z8WC 5KSUA 3V9FA 3VCLB 1T1WB 2M8XA 4TYUA 1FCGA 4FZ8H 3LRSA 3A6BL 4NHUA 4JPIA 1RSFA 4GH7B 4ETQA 3KLHC 1T03L 1KULA 3PL6B 4ODTH 4WHTA 5E9DB 3BIKA 5LKNA 4XZUB 3LS4H 1N0XL 2B1AL 1Q9KA 3KYNB 2C3VA 1EGJH 3ZT5A 2CJUL 4ODHL 4L1DA 4QXTB 4A6YB 4ZTPL 3UX9B 4R4ND 2LVCA 2ICWJ 4Y16A 5DRNB 3BE1H 5HDQH 2JIXD 1ZXQA 2BSTA 1TZHB 3WN5B 2E7LC 2BSED 3CLFL 3MRIA 1AJ7H 3CXHJ 4W6XB 5JOFB 1ZT4A 4JKPL 5GJTL 4M48L 2CLVB 4G8GA 3UZQA 5D1QB 4JG0H 5D7JD 1T1YB 3LKOB 1C8PA 1U3YA 1HHJA 3JV4A 1QRNE 1FQ9C 5I8EB 1CLCA 1U8OB 5KVFL 5GS3A 5EIVA 1L7TH 4RA3A 4UV4H 2B5IC 4NRZA 5DQJA 1RZIB 5SV3A 5A1AA 1MAML 2PXYD 1C12B 1S7TB 3ARBC 1XH3A 3T0ED 9CGTA 3ZE2F 1NMAH 1KPUA 3KNBB 3B43A 3EFFB 1AE6L 2VDNL 2CLRA 3PWUB 3RGVB 4RMQA 3M45A 3D3VA 5CSZA 4TPRH 2VLRB 4K9EL 1J1XL 1VFBA 5EBLB 5KANI 4C57C 4O5LH 4Y4HA 5EB9A 2VIRB 4NZUL 4HKJB 4J3OC 3JWNC 5GS0D 3MV7A 3EHBD 4H1LA 2I9LA 3O11A 1ACYH 2DYPB 2R4SL 2AI0L 2KQMA 4JZOA 2CPCA 1JTTA 2E7CA 3MRFA 3GHEH 1AHWC 2CXKA 2X9YA 5DK0A 2MPAH 1CL7H 1Y6MR 4PRAB 2X4QB 3LB6C 4HV8B 3THMH 3D69A 3IDIA 4M1CD 3W5NA 4ZO7A 4FXGA 2ZJSH 2VWEC 5ERWB 4LHUD 4F2MB 3OKKA 1F6FB 4M6OL 5DSCA 1KG0A 1J5OL 3F58H 4OZGE 2P8LB 3CXDL 2YS4A 3QEGL 1A3LL 4ACPA 4HCRA 2DJ4A 2KZWA 1MF2H 1LO2L 3UPRB 3MRCA 4LVEA 1AGEA 3ULUF 2IWGA 2APTA 3NN8B 4QRPB 2J8UE 4UT6H 3GI9H 3BD5A 3IU3A 4HS3B 1N5YL 2VLME 1R24B 3CVHH 1C16B 1NCDH 4ZAKB 4NGHL 1TVHA 5I71C 1FL5B 1K2DA 4Y4KB 4AH2B 1FGVL 3MRBA 3MRDA 5DTFA 3C5SB 3CC5A 4R7NB 3I6GB 5DF0A 1B6DA 5CCKH 5FM4A 1UXWA 1WICA 4JFYB 1SJVA 3GSNB 2CK0H 3I3EA 2NY0C 1AD0B 2YC1A 1YNKH 1KB5A 4Q2ZB 5I30L 3IDXH 1QR4A 3AM8C 4H26B 1PG7L 2NTSP 1VADA 3GJFB 4X98A 4P9ML 4RDQG 2Z4QB 4KJYA 2AK1L 3DVFA 2DIJA 4QXGL 3DMMB 4LCCA 1IAIH 1BJ1H 3GSUA 4MNHA 5T3XD 2Q6WB 3V8CA 3L95B 5HHMD 5E1AB 1KV3A 5E8DL 2NY4D 1HZHL 3MTRA 4XC3H 3NABH 3ARPA 3P4MA 3WIHA 4JG1H 5IIEA 1F11B 3KLAB 1DQJB 2PNDA 5JOPE 2W9DL 3SKUD 5HJ3B 1WC7B 3WO4C 4NN7B 1I8KB 4N8VG 3P0GB 2YPKB 4YBQD 2EC8A 1ZT7A 5IMMA 5AG9A 3ZL4H 3TBVA 3DGCR 2ZCLH 2APXA 5DRXB 1HHGB 1INQB 2QQNL 3WS3B 2VDPL 4IOIB 3VGFA 2F74A 3RKPA 1S7VA 3O45A 4GBXB 4PRNA 4PG9A 2VABA 2R4RL 3H9HB 3VFVB 4KKNA 1P2CA 1WK0A 4LFHG 2V9QA 3MLZL 1UWGL 3ZKQD 2JIXA 1O5DT 1OTTC 1KCRL 3QUMH 3QDMD 5JXAH 3HE7C 4MNGA 1JWUA 1HSAA 4U0QB 1XIWC 4NBYB 1NEZA 1Q0XL 3VXQB 1RK1A 1I7TA 3RJDA 3MRLA 1LMKA 4HIJB 5D7JA 3GB7B 4Z7WA 3IJYA 3IGAA 3TT1H 3LV3B 4Y4FB 5EPMA 4GAJH 5AUMA 4PJBA 1S9XA 3BMVA 5BZWB 4XBPB 3QBTB 4IHOB 1MCRA 4HBCL 3MMEA 4GG6E 5GGUB 1JGLH 1PX4A 2DI7A 1IKFL 2PXYA 4JZJB 3T0EA 2ADGB 5FUCE 3V5HB 3D3VE 3I9GH 2X4NA 1FN4A 3MRNA 4P46C 1JHKL 1E0OB 1EH9A 4ZD3L 3V4PH 5GZOD 2GK2A 5DQ9B 1ZA6B 2X2YA 4D0CB 1J12A 1P7QD 1X6NA 5EZJA 2OXGA 5FYKL 1JN6A 4HX1A 5IW6B 4ZFOA 3LN5A 2B0SL 1JF6A 4U3XA 4YHYB 3MBXH 3KJ6H 2EDWA 1CG9A 2DQUL 2VLLA 5F44A 3QUKB 4X80H 4OZ4B 5GRUH 2VDRL 4LPXA 1A1OA 5IBLC 1JYXA 3QZWA 5LQBH 1IKNC 4APQC 4LHUA 3CX2A 2H2SC 5FKPB 4AYFA 4NM8L 1D5XB 3HN3A 4JREC 4LGRB 4F9LA 1S78D 4PD4J 1L0YA 5L0QB 2YMXH 1YECL 1LK2A 3RBGA 3MXWH 2EDXA 4NWUL 4WNQB 3S36H 8CGTA 4YQXH 5C0DA 4B7LA 5ITFA 1P7KB 2XI9A 4U1LA 1EHAA 3E2HB 1RZFH 3S34L 4G7VL 3LKQB 1X5GA 4GRLC 2B5IB 2BVUA 4MA8H 2H9GA 1HCVA 6FABH 1YEKL 2WINA 3E6HA 3SJVB 1A1MA 5HPOA 4R26H 1GH7A 4JPKL 4F9PA 1EO8H 1N4XL 3V7AE 5F6IC 3LAFA 4UV7L 5EOTB 1IQDB 4QOKD 5J1AA 1X5IA 1TJIL 3GMQB 1A4JA 1NBVL 5JLZB 1A6ZB 2P5EA 4XP1L 5K9QG 4TNVK 4CN4A 3BAEL 5CFHA 1RJLB 3QJHA 2VDQL 2QV2A 4NFBA 1AHWB 4PGEA 4KZEL 4P59H 5E95B 1E6JL 4UIMA 5GIRB 5HGHB 1MLBA 1QSEB 1YJDL 1BFVL 1NFDB 3BVNA 1ZEAL 3KGRA 4DGVL 4YUEL 1AGDB 1UJ3B 5BV7L 4Z0BL 5I1AB 3FB7B 1HXYA 1YNLL 4G8IB 3U2SA 1CQKA 1BZQK 5CZVL 2XRAL 5DRWA 5C08B 1TCRB 1EMTL 3PDOB 1NL0L 3ULVE 2I60H 4OF7A 4F7CA 1ZSDA 3FTGA 2A0LC 5H37G 5IB2B 1G7LB 3BWAB 4KDWA 3RNKB 3V52L 1IGYA 3WYRA 3UDWA 3G04B 3H3KA 2A6IB 4XVSH 4Y5XA 3K0WA 4TUJA 4MD5A 4OM0L 4K2UL 5BMFL 5C71A 1U58A 5DLML 4H1LG 5F7DB 1J0HA 1OLLA 3OAUL 4QF1B 5C0CB 4HUXB 4YAQB 1FCCA 3VXUB 2P8PB 5DMIH 5DRZB 5TH2A 3QDMA 2FX8H 3VWJC 2OTUB 5KVDH 4NDMB 2NTFA 4XWOD 2FECI 2AJVH 5DJ6B 4Z7WE 3NH7H 1QUNA 3JZ7A 4ZFGL 3EDEA 4LLUA 4Y2OA 1QLRB 1RI8A 1RZJC 3GNMH 4CU8A 4PJBE 3X3GL 4MJ6A 4DAGL 2AJYL 1CZ8H 3PABB 43C9A 1NGYB 1ZKAA 5IESH 3NAAH 2VXSH 1MHCB 5E00B 1HH9B 3P40A 4I48A 3W9DB 4X99A 3HB3D 2A77H 1SYVB 4FQIL 4KY1L 5EDXA 5L9DL 4NT6B 2GFBA 4Q0XL 4WIQA 2FYYB 1G9MH 2P5WB 4MGXA 5IHUL 4PJXB 5DUPH 4ONHA 3S9DB 3EOTH 5I75B 1D6EB 1D3CA 1ZWIA 1LDSA 2WNGA 3EFDL 5D6CB 1BX2A 1E6OH 4AY0A 3BDBA 1RZ7L 2O5YH 4FP8H 1P7QA 5DJAB 2X4RB 4Z78A 3MRGA 4OD2A 4P2YA 3LH2L 3K1DA 1Q94B 3DYOA 4S11A 3V7AG 3BPNC 3K46A 2P24A 3KPLA 5TDPB 1G9NL 1T2JA 5EO9A 1CXKA 4OZIF 5F1OB 1RUPH 2DQIL 5D4QA 3E0GA 2NY7L 1R3LB 1HQ4A 4ZUTB 3H0TA 4GKNB 3JTTA 3VFOA 2FATL 2JB5H 3MLRL 4P4KD 3C5ZD 2WK2A 2VTFA 1B2WH 5FUOL 2XY2A 4YGAB 2D2OA 3U7YL 1DLHA 1X5HA 2D31B 5ID1B 5TE6H 4I4WA 3KPQB 1QFOA 3BP5B 4QRTB 3QWRA 3O2VL 3UYRH 1MQKL 1AKJD 5FV1L 5F72S 3PHQB 5EUOA 4U1KB 3GM0A 1OP3H 3QULA 5BQ7B 4JR9L 1IEBA 3DI2B 4PP1D 3TH2T 3HNTL 5DD3H 5FO9A 5DFVD 5F1IA 3UP1A 1H3TA 1L9MA 2IPTL 3LZFL 1XGPA 4ZO8A 3STLA 1RHFA 4BUGA 5IHZA 4P9HL 1S7XB 3S4SB 3QDHA 3BI9X 2YK1H 3G5VA 1E4XL 4KJPD 5C07D 4JANB 3P4NB 1WZLA 3CFKA 3S36X 4RMWA 3TYGL 1FFPA 4EXKA 1H3VA 1IFHL 1OARH 4QOKA 2D7PA 2P5EE 4WWKD 3P0VH 4XPAH 3MYZA 1NEZG 1HHKB 1MVUA 4F58L 5F96H 1CXFA 4YXLL 2E7MA 3SE4C 5DJ8B 3I6KA 4NKIL 3WFDH 2UV3A 2AV7B 3ZDXE 2Q76B 1T3FA 4GSDH 3KHOA 4QO1A 3AU1A 3GSOB 4PRPB 2JJWA 3BGFC 2WIIA 2VKWA 1T1XA 2Q86A 4I13B 5CP3A 2VZVA 2Z93B 5HPMB 4DN3H 1FBIH 1X5JA 4C83A 1OPGH 1KUMA 4XPTL 4LQ1A 4BA8A 2J88H 1U92B 2XPGB 2QHRL 4ELMF 1PW3A 3IXTA 4W70A 5DQDL 4DUXA 3P9WB 2FZ3B 1T7VA 4YHLL 5I8CB 3O6KL 4PPTA 1YC7A 5TQ0H 2NX5B 2H6PA 3DUHA 3BX7C 1HNGA 1PZ5A 4ZSOB 5IFJA 1JNNH 3FCTB 4K9EC 5HDBF 4PRHD 4X6CE 1MJUL 3ARFC 2HAZA 4CRPA 4YNYB 1WEJH 3QXWA 3VA2C 3MNVB 3WHXA 2BC4A 5IVXA 2ARWA 1PSKL 3EJJX 2APBA 3PHOA 3UBXB 4WHYH 5A16B 3QNXA 1X9QA 1FLTX 2DM3A 3HZMB 2NY3C 4LIQH 4HKZB 3QZWG 1T0NB 2W59A 2ZUUA 4O58L 1HYRC 4LHUG 3X3FL 1CDBA 3GMMB 4XNYL 3L3OB 2E6QA 1W0WB 2G9HB 2VLKD 4RWHA 3ABZA 4EVNA 1G7HA 1IILE 5IB1A 5CD5C 3QIUB 5EU4B 2VXTL