5JA8B

Crystal structure of the higb2 toxin in complex with nb2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
b'QVQLQESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSCISSSGGTTNYADSVKGRFTVSRDNAKNTVYLQMNSLKPEDTAVYYCVADFACPLIREYDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin HigB-2
publication title Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Toxin
total genus 31
structure length 121
sequence length 121
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ja8B00
5BRZA 5A3ID 3NGBB 3WHXA 1ZS8A 3VGEA 1XGTB 3B2VL 2GK0A 2FLRT 4HHAA 2FNBA 3O3EB 3RX7A 5GS0D 5ICZA 1E27A 3LN5B 4DFHA 4Q0XH 4QTHB 1KUMA 1DUYA 5DT1H 1ZMYA 1RK0B 4X7SH 4YFLI 5D2LA 1F3JA 4O2FA 4PJDE 1Z6JT 3TIEB 4ZUWB 1N3NA 3V7AG 1LO0H 2C3GA 1MWAH 4EUPH 3C2AL 1A7NH 3EOTL 5LVEA 2ITCA 4HUXA 5DUBA 3NZ8A 3WUWG 3D0VB 4XVTL 4M7LH 4HQQL 3HNVH 5SWSD 2HT3D 5DRWB 4HLZH 4DZ8A 1X7QA 4GW1B 2IANB 1HIML 1SJVA 2DDQL 4KGJA 1BVLA 3L3HB 2A9ML 2KUTA 4KVNH 3VI3F 2OXHA 1WZ1L 1JYVA 3BT2H 4LRIA 3GO1H 3VXRB 2IMMA 1P4LB 3PP3H 3ZDZF 5AWNH 5JW5B 3TWCL 1Y6NR 4HZLB 2ADFH 3JWDL 1U8KA 1G9ML 3O4LA 1YQVL 3P4NB 1YJDL 3NIGE 3V0WL 1JIBA 3MLTA 5F89A 5E5MB 3Q6FA 1ES0A 2VDKH 1MQKL 3TZVC 3O9WA 1K9TA 1LO2H 2P8LA 1AJ7H 1U8LA 1KLUB 2RBLA 4FFWD 4GAFB 3MRJA 5AYUH 5BW7C 1NCNA 5JMRA 4ZUVB 3SE3A 5JXEA 3G5YB 4BA8A 3EJZC 1MCWW 3KR3L 4UT6H 1K4DA 3FFDA 2UWEF 2QTEA 3RGVA 1X5ZA 3AROA 3GSXB 4HFUL 1KCRH 5E70A 3T1FA 3ZT7A 3V5DB 4C56E 2I60L 5DJZA 2FIRT 5IKCB 3LPFA 2YZ1A 1WCQA 3WD5L 5E2VL 3QCUH 1RY7B 2Y72A 5GRWA 25C8H 4JPIB 5ICYB 5HHOE 3P77A 4NZJA 1OPGL 2BHYA 2BZDA 4NZUH 1NAKL 1VKXA 1R5IA 4P3DB 4LQ1A 3HG1B 2PTUA 2R1YA 1BZ7A 3W9EA 3EKCA 4YDLB 4GLRI 3RI5F 3OKEB 3O3BA 3ARGD 4AEIL 1Q9KA 2CKBB 1IM9D 5KSBF 4F3FB 2AV1B 3MJ9H 5HDQH 5DDHA 2FSEA 5EZJB 4P5TD 4LSUL 5A2LH 1NGYB 1SEQH 4ZXBA 1IM3B 5C0JB 3FN9A 1DDHB 2P49B 4EI5A 1E4WL 3TNNB 1HWHB 2M26A 3PP4L 1IBGL 1JNLL 4B5EA 5FGSA 4D8PB 2CPCA 3IDIA 4XAWH 1GYAA 3WO3B 2HJKA 2VZ3A 2C7UA 5J12B 2BX5A 5ERWA 4NC1C 5ESVA 1JZ3A 2VZSA 1DBBH 4HIIB 2Y36L 3VXUD 5F3BB 2J88L 1KCLA 3HCVA 1CF8H 1H9VA 2GCYA 5C6TH 3QDGE 2R56L 2Q6WA 4OGAC 4YE4H 3QIUB 3T65A 2EDFA 5DQ9A 1ZVYA 2VQTA 2JJSC 2VDQH 1NEZG 1FVDA 5DMKB 1FAKT 3ZKNC 1IAMA 3VFWA 3VXSA 2CO7B 2OXGA 2ZP0T 1JV5A 1KTDA 2P7TA 3PGCA 4QRRE 3MJ8A 4H25A 2MJWA 3SGDH 4DGYL 1E4KC 3RWDB 2OJZL 4KJPD 1I85A 3RX8A 1CIUA 4PLJC 2XPGB 4R0LC 4Y5XA 4GO6B 4P9HC 3BRDA 5IP4A 5DD1L 2FR4A 1GGCL 1GOFA 3TC9A 1XGQA 2DM7A 5EBLA 4KV5E 3FQUB 1A5FH 1XEDA 2NYYC 2C4FU 3CJJA 3MRCB 2ZNWA 4GAYB 4P57A 2JTDA 3HNSL 4HV8A 4LSSH 3I9GL 1P69B 1YA5A 3GSOA 4TNVK 5E9DB 4K3EH 5IEHB 3AFLA 5T5NF 3PGDA 1J05B 3UTTA 5JW4M 4M5ZL 4X8XA 5LAXA 4JO1L 2DYPA 5I1GH 3W39A 2WUCL 2XA3A 2OR9L 3HB3C 2PXYB 4PRPE 4BYHA 3BEVB 1MY5A 1ZT7A 1CFQB 4PB9H 1DLHA 4TTDD 3SKUD 4EBQH 4H1LB 5F8RC 3E6HB 2NW2B 1MCSA 3V6ZB 3T2PA 3TT1H 5D1ZA 4XWGL 4ZDHB 4K3JH 5ITBH 3RY4A 5DEFA 3WNLA 2FX9L 4PJ8D 2XFXA 2LVEA 5L2JA 3WIFB 3VW3L 3LN9A 4HKZB 4M4RA 3T0EE 2CRMA 3GSQB 3RVTC 3IXTB 3FO0L 5DO2D 4YZFF 1UA6L 3EDFA 3UYOD 4I48A 2X2YA 5JORA 4U1KA 4ZFZA 4G8IB 5DVLA 3RWFB 3SDXE 2ORBL 4ZD3L 3O6FD 4JHZA 4QTHA 1R6VA 4X6FB 4ELMB 3GHBL 3IKCA 5DQJB 9CGTA 1RK0A 4KKLD 3TIEA 3FQXB 3KYOB 3I6LE 3A6BH 3JVGA 3IFOA 4HJGA 5I9QB 5D7JD 1CICB 2GQHA 1QBML 4FFYL 5CEXB 3K1KC 4GG6E 4RMVA 4Z7NE 4KJYA 4G6FD 3D0VA 1ZLWK 3N9GL 4OM0L 1EO7A 4YXLL 1NC4D 5DRWA 4ODSL 1HHIB 2VXUH 4ENEC 1AR2A 1UM6L 2Z8WC 5ADOH 5FEBA 3IAGC 4TVPL 3U48A 4LVHB 2X4NB 5I1CL 4R4ND 3VXRA 2J12B 3JWOH 3G6DH 5JW5A 4MB4A 4HZLA 1A6WL 3IDNB 1J8HE 1G0YR 2HKFH 3MLUH 3OKDB 4CUCA 3FO2B 4X4YA 4L8DB 3SGEH 1PSKH 1TIUA 2A38A 5IFHL 2GI7A 4BQ6A 3OB0K 1S8DA 4U1MA 3L3OA 1HDMA 2Y6SD 1NPUA 4WI2A 1FNFA 2BNQD 35C8H 4NQDD 1FNEB 1KBGL 1XFPA 3R06A 3BP7B 1UKQA 3QUMH 1KLUA 3ESVF 4TSCH 4CVUA 2DI9A 1VESA 5D5MF 1DBJH 1J1PL 4YO0B 2K1MA 2D0HA 2VDOH 5C09B 4YHIA 1T0NB 3RAJL 1N4XL 2AJXL 1P84J 1G7LB 1OAQL 3MRGB 2FJHB 3V5DA 2W9EH 1NKRA 1ZHBA 5IW3A 5IKCA 4HW6A 1K6QL 4OZIB 4MWFA 1XCTB 4FMKA 4LKCB 3IDJB 1U0QA 3LKQB 4JG0L 4N0FB 4Y16D 4PJGA 4E42B 1IGCL 5KVGL 4L8CB 3GHEH 4JQXA 4KUZL 5DQDL 5CBEB 3MA9L 4JPIA 4U3HA 3SDAC 1F4YL 3FOLB 4O00A 1VACB 1I3GH 3VD9A 4IS6B 5AZ2H 3H0TB 3U9UB 1ZHKB 3DMMC 4YXHL 4Q9BA 4TVPE 4OLVL 1EGJH 1NUFA 1ONQB 3VGDA 1AKJB 3V5KB 1AR1D 5C2BL 1A7QL 2NY5L 5FCUL 3X12B 2CKBA 1DE4B 1B4JL 3FZUC 4S0SD 1CD0A 1KB9K 2AW2A 3FO9B 5EZJA 2KL6A 2JELL 4K9EH 1LO5B 3TBWB 4JZJA 1NGYA 1IM3A 1GGTA 3CUPA 3TNNA 2I24N 5E8PB 1WFTA 4HUVB 3B5GA 3IS1X 2J1KA 4MDJA 5FF6B 1JGVH 4FHBD 1W0VB 1DJSA 2A6JA 3EUUA 2ZUWA 3VXNA 3QIWC 5HVFB 3D69B 4N1HB 4NQXA 3T4AB 4HIIA 3RL2B 5J56B 3GMRB 4DK6A 3FMGH 2PTVA 1LNUA 4U1HB 4Z7WE 4C83B 4G9FD 1RI8A 2Y23A 3DRTB 3MLVL 3UCRA 4UMGA 1MHPH 2R2BA 3RJDA 2EEDA 3RWDA 4G8GA 5KAQF 3WFCL 3QDJE 5HHME 4XRCA 1FL6B 2XPGA 3BE1H 4J6RL 1MFDH 3CMOH 3DURB 1JTOA 3IJSB 1IJ9A 4MQXC 4MQTB 5BRZE 3GMQB 4M8QB 4XP5H 3MRCA 3ILQD 4EOWL 4WJ5B 5I1LB 5IEHA 4P59H 1B9ZA 2KBGA 1XZ0B 3QNYA 5D2LE 4X98B 4X99B 1JVKA 2HT4C 4L9LA 3GBML 4HH9B 1G1CA 2PXYA 1SY6H 1EXUB 3BEVA 4TULL 1KGCD 4CJ0A 2IEPA 1D6VH 1SVZA 3MRNB 4NUGL 3WN5C 2A9NH 3CLFL 4H1LA 3V4PH 3EYQD 2NW2A 3V6ZA 4Z95L 5MEPA 5IJKA 4HIHB 1N6VA 4CVXB 3PABB 2P8MB 2AK4B 4AH2B 2OR8A 3R0MA 4PJAF 2FECI 4Q74A 2DL2A 1ROWA 3WIFA 3BIBX 3N50A 3VMOA 3N1QC 2CGRL 3HC4H 3GSQA 4UNVA 1Q9LA 3D1MC 1KEMH 5CLTA 5BV7C 2WZPD 5CHNB 3LV3A 4G8IA 1Q72L 5T1LD 4F15C 3ZKQD 1H8OA 3RWFA 3BW9B 3S34H 3O4LE 1IGFL 4N1CA 4KKCC 3BN9C 4X6FA 5I66A 5FFLA 4ELMA 5DQJA 1G0DA 4PS4L 3RUGB 3NBNA 5D7KD 1KN2H 5DVMA 3FQXA 5GRJL 2EECA 3DYPA 3U9PH 4Z7OE 4WFFD 1IEHA 2NXYB 4IOFC 5HTSA 1HHIA 3LEVH 1KYOK 3GRWA 5BZWB 5HY9B 4MLSA 2DQIL 4L3ED 5CGTA 1T4KB 4LNRA 4S11A 4OZ4A 3KAAA 4DN4H 5E56A 5C0RL 3HZMB 5JIHA 3OGOE 5JO5A 4PJ5B 1HE7A 4Z76B 3HA0A 3PDGA 5JW3H 1NGXB 5LKNA 1U8NB 3VWJB 3IDNA 2YPLE 3GSNL 4LK4A 5C0ND 4F58H 2VC2H 2DTML 3OKDA 4QHNB 5CEZL 1OD9A 3FO2A 4XCFL 4L8DA 2X9WA 2MQ3A 4ZPVB 5DZOA 4ZOCA 1EEYB 4BFEA 5CD3B 1UADC 5EU5B 3NPSB 5MP6H 2Q8BH 3FQWB 1JGUH 1ZV5A 5C0AD 3CC5B 3QFJD 1WBYA 3QAZC 4WFHD 4R2GD 1BFVH 3QG7H 1FNEA 4JO4H 4YXKH 1XR9B 3OKLB 4M62H 3MXVL 1INDH 1WAAF 1B2WL 3TJEH 4F2MB 1MJUL 3DBXA 3MLSL 4YO0A 4D2NA 4YQXH 3L7EB 3P9MB 5C09A 3RWJB 3RL1B 3LHPH 2ESVA 3QQ9C 3QEQD 4LAJH 5K33A 3PWNA 1T0NA 4NNPL 1J0ZA 2R8SL 3VE0B 2IBZY 2YD8A 1G7LA 4AG4H 4YC2C 3W0WE 4HIEA 3QPXH 4HG4J 2CQVA 2K7PA 4OCLC 4D0CA 3A0OA 4JFQA 4OZIA 5EU4A 2XWTB 4LKCA 4N0FA 4IMKA 3FB8B 1UFUA 4E42A 4L8CA 4F7EB 3AMLA 3QUYA 1SM3H 1E6OH 2V17L 5CBEA 3SDDC 2VLRD 4Y19E 3O8XD 1JHLL 4G7VH 2HFGL 1VACA 4OZFH 4HUUB 1FSKB 3NH7L 4IS6A 3VXPB 3H0TA 3U9UA 3TCLB 5CJXA 2AJVH 4KXZH 3MOBH 1KPUA 4KMTH 5DD5L 1NL0L 2MHAB 1ONQA 1AKJA 1LP9E 3V5KA 2R29L 1OD7A 3X12A 1CXIA 5C3TA 1CDBA 1ZAGA 5EZOL 3BSZH 3SDCD 2C26A 2NXZD 5CEZE 4XP4H 3LEYH 3BQUB 3SO5A 3DSFH 4JFXB 5A2IH 5CGYD 3LQAH 4WGVB 5AAWA 4P23B 5F1NB 1JHKH 1DBML 1YN7B 4FQLL 3EYUL 5FF6A 4V2BA 3NZHL 4QHKI 1FGVL 5I71C 3BD5A 3D69A 5MHSD 1FNSL 1DQML 1IC7L 4ZS6D 3GMRA 3MLXH 3AREC 1BJ1J 4N0RA 1EFQA 4X7SL 2X4OB 1YY8A 4X4XA 3H3PL 4M03A 3MRFB 4HCRH 3ARSA 4LOUC 5C92A 1LO0L 3KLAA 3C6LC 1FFOA 1FRGH 5IFJB 3U36A 3R0NA 1F42A 1V8HA 4PJEF 3CX5J 5L7XH 5EDXA 3W9DA 3DV6B 1GXEA 4MJIB 2CK2A 5IBTL 1KOAA 1MJ8L 4WTZG 4ESKA 5FK9B 4CVZA 3TCXA 4U05A 3BUYA 3DURA 4HC1L 5HXMA 5ANMB 4KVNL 3DGGB 5CZXC 1D9KD 3BT2L 1D5MA 4IRJC 4M8QA 2DLIA 1CG9B 3KS0H 4K7PH 4O51B 5HGHA 2WQ8A 4WJ5A 1I1AB 5I1LA 5IQ9B 2PN5A 3RU8H 4BQ8A 3E8UL 4MCYB 3UTSE 4X5WB 4D9RE 1XZ0A 1Z9OA 3T09A 4NFBA 4PGZA 5EBGA 1EXUA 3MZGB 2W60B 3BRGC 3OG4B 2AJUL 3B5TA 3LKOA 1S7UB 2LTQB 3SJVB 2FATH 1I8KB 4KROB 1EZVY 1NUDA 3VFVB 1EEQA 2N1KA 3ULSA 5KS9E 1A4KB 1GVIA 4NKOB 3VFNB 4CVXA 2NQCA 2P8MA 3MBED 5CD5D 4AH2A 5C07B 5DJ6A 4Z7VB 5MERB 4YPJA 4I0CC 1FIGL 3O4OC 4PJBB 4UT6L 4LGRB 1J88A 4XXCA 2VLLB 3HMWL 2HWZL 3TEUA 1P7QD 3PGFH 5SX4I 2VNCA 4OI9A 2BJMH 4EXPX 3ES6A 2NLJB 3KXFD 4PREB 4RAVB 4O58L 5F9WC 1DEEB 3BW9A 3EO9H 4YBQC 3OKNB 3QZWG 4GAJH 1GZQA 2ZSWB 1XAUA 3BKCL 4YK4B 1Z2KA 3I84A 3HE7D 4TUOB 1BOYA 1FO0L 2I07A 3FOMA 4Q9CA 3IF1B 1CZ8H 1FVCB 4NQTA 1AD0B 5HI4C 1RUKH 3ARTA 2NY0D 2B2XL 4BUHA 1XIWD 2R0ZH 5T3XH 2HG5B 5IF0B 3V0AC 3VI4E 1KIPB 2FECL 2WP3T 1WFOA 3TBTB 3MCLL 1T1XB 4LCYA 3ZMRA 3QNZB 3HZMA 3ZKSD 5GS3A 5TE7L 4PJ5A 1QTYT 1NGXA 3L95B 1U8NA 3VU2A 4PJGE 3VWJA 4FOMA 2IALA 4XAWL 4QXGL 3OPZH 5J11B 1NCWH 4M5YL 4ZPVA 4RWYL 3QIBC 1EEYA 2WBJA 4JPVH 4YHLL 3DHJA 1W0YT 4TNWF 1DBBL 3VJ6B 5EU5A 2PW1A 1XGRA 4OB5L 3FQWA 2VABA 4MAYD 3PXJA 2E9BA 2D7TH 3CC5A 4I5BA 4OCXH 4HS3A 4L8BB 1U36A 5DA0B 2X1PA 5D1XD 5DRZA 4PB0H 4OTXH 3KPMB 3OKLA 4XWOD 2NX5D 4QWWC 6CGTA 3RIAF 2JB6A 3QSKB 3JV5A 3L7EA 3RWJA 3RL1A 4NO0D 1BWMA 4KK9C 4AIZA 4MB5A 1CVRA 5DHYB 4EI6B 1IC4L 3SEPA 4AK1A 4XNYL 2ZUSA 3VE0A 4G6KL 1P1ZA 2QQNH 4JRYE 4AIOA 2FO4B 3CXDH 4MLIA 1DL7H 4NO2B 3HMXL 1UWEL 2EDDA 5C1MB 2AXJA 2FJGA 3VXTB 1QNZH 4LSSL 4K3EL 5DA4A 4NWUH 1UGNA 5FGCB 4W6WB 5DFTA 5E6IB 4QCIA 3VXPA 4XP9H 3TCLA 4DUVA 1O0VA 4ONGH 1MRDH 2MHAA 1R3IL 3C8KB 1AIFA 4KRPB 5L2KB 4O2EB 4BZYA 4PRIB 3QHZL 3TZVB 2GJZA 4G8GE 2G60H 3TT1L 1M7DA 5I73C 2B7DT 2EE9A 3X11B 4LP5A 6FABL 3MJ7B 5IB2A 1QRND 5D7SL 1AQKL 4JFXA 4HIXH 1OSPH 3MV7B 2HFEB 4P23A 5F1NA 4PP1D 1YN7A 5HI5C 2HJLB 5ELIA 3EJJX 3O81A 3UTZB 2RIKA 3IDUA 3WLWC 1RQ5A 4EJ1C 3TO4A 5FDWB 4M43H 4BUGA 4FZ8H 2JIXB 1T89A 4HBCH 3LPGA 3OX8B 4P2QA 1CD1A 3CDFA 1SJHB 3UXFA 3HI1A 5ABDE 4JFDB 5I30L 2R4SH 4NO3A 1YEFL 4G9DB 2FIKA 4MNQA 4WV1C 1M1SA 1U8OA 1JPST 4MJIA 5TPWL 1LE9B 4OI8A 5FK9A 1J0IA 4V1DA 4GH7B 4NT6B 3FQNB 1RK1B 1FG9C 5ANMA 1MRFH 2BRRH 2YPKB 4PJDF 2BHUA 3TIDA 4P3CH 3DVIA 3MRKB 1CG9A 1YY9D 3RDTD 4O51A 3MUJA 1M6OA 4PGCB 5IQ9A 1I1AA 5DTFB 1RZ8A 5H8DA 3VXQA 4HUWB 5F9OH 4G3YH 3O6ML 5BVPH 4M9OA 5GS2H 5L88H 1VPOH 1GL4B 5DJDB 4EN3B 2IH1B 1S7UA 3SJVA 3QDAA 2ARJB 1I8KA 1FFNA 4NZTH 3D0LA 1FNGA 4GQ9L 4GW4B 4OCYH 3U1SH 3RWHB 5C9JB 4NKOA 3HKFA 4TSCL 1UACL 3EOBB 3DO7B 4NKMB 1N6QH 4OV5A 3CDYA 1DBJL 2BHZA 3P0YL 4Z7VA 2VDOL 4Z7UB 3TN0D 3HAEB 3NIGF 3T0WA 3ARUA 2D7NA 4K7PX 5ILTH 1U91B 5H35A 2VLLA 1XF4B 3AGVA 4XPBL 4N9OB 4LPUA 3LKSB 2NLJA 4HLJA 4AMKH 3T3MF 2H2SD 5BMFL 1DEEA 2YC1B 3BJ91 5F7UA 2EDWA 3S36H 3SCMB 3OKNA 3KPOA 2AEIT 4HXAH 1OB1A 4FFVC 4PJHF 1WFUA 3DSNA 4WHDA 3L3KA 3DX9B 3ARQA 5GHWL 3TA3C 3IF1A 1NLBH 2ZJSL 3DRQB 1FVCA 1AD0A 3QA3B 3G6JE 4MMXC 4F9LC 1EGJL 4U1JB 2I9TA 1ZHLB 4LU5L 5IB3B 1L9NA 4Z7QF 1NH6A 1KIPA 2R1XB 4U6HA 3P4LA 2DQGL 4I2XA 4DAGL 2ENYA 3TBTA 4ACPA 4MCZB 4K9EL 4MDIB 5DJ2B 2VH5L 4LCUB 1QLEL 2DJSA 3OR7A 3C5ZC 5IK3A 2PTTB 1BHGA 4MA7H 1BEYH 4HDIB 5EN2A 3ZLQC 4O5LH 4CKVX 1MFCL 1MNUH 2BY0A 1QSFE 3Q0HA 5KZCD 2WLZA 3FB5A 2QSTA 3T0DA 1CR9L 3LS4H 3VJ6A 4HUMB 3V7MA 1I3UA 3QPQC 5EIVA 1RZJL 3CFIC 1FNLA 3LDBC 3WKMH 3GK8H 4L8BA 3LB6C 1PG7X 3MRLA 3MRHB 2NZ9C 1AO7B 3KPMA 4ZO6A 4KI5E 1A6UH 2VQUA 3D25A 3P9WB 2QKIB 1R24B 4OBRA 4PJ9D 5L0QB 1QFWH 5DHYA 3RBGA 3U46B 4HPYH 1R3KA 2BXYA 1NGWB 2YN3A 3BE1L 1C12A 4LCCC 1A1MB 2P45B 3L3JB 2E7MA 2ZOLB 3PG2A 4ODHH 3VD3A 4JFFB 1AY1H 1A4JA 3VXTA 1U93B 4N8PA 1P5UA 4Y7MA 2F5BL 5TDPB 3PWJA 4CADB 4YHPB 4RGNE 1QO3B 2M8XA 3KYNB 3F6IA 4U1IB 4P4RB 1F11A 2HRLA 1AXSB 4KQ3L 2OLDA 4QF1B 4PY7B 2A9NL 3C8KA 2FO1A 4ZYKB 5L2KA 4E41B 4O2EA 4M1GH 4KV5F 3L5IA 3TZVA 5C0CB 4J1UB 1F4XL 5EC2A 3IXAB 4NQCD 5IMLB 3HRPA 3NAAH 3KYKL 5EO9A 4ELKB 5T1KB 3MJ7A 1T5WB 3HHRB 5C0BD 4S10A 5BW7A 2C1OB 3MLYH 5INCB 3RVWC 4PJIE 4NO5B 1F5WA 3AY4C 4H5SB 4YGAB 1FDLH 1KEML 5ECJE 4GBXB 4JM2C 2X4TB 4HJ0D 4XH2A 2G75B 2NY4D 3MC0A 4MJ6A 1B3JA 3S34L 5E2UH 3VGAB 1DVFD 5C7XH 1HCFX 4KHTH 4PRHB 2CKBH 1TZHB 2EZ0C 1FYTE 5T3XD 3KG5A 1BD2B 2YKLL 2VIRB 1JN6B 3EJYD 4R3SB 3KPPB 1ZLSH 1QBLL 2JIXA 1KB5B 3SDAB 3TJHC 1RFDL 5F6IC 5CCKH 3U9PL 5HYSG 3S37L 3FONB 1JMXA 4QEGA 4G9DA 4ISVB 3E1F1 3IGAB 4NUJA 1SVCP 2NX5E 3LEVL 1L0YA 4AENA 4GKSB 4MD5B 1ZGLB 3QG6B 4NT6A 3KPRB 3FQNA 5EB9A 4P2RD 3VFGL 5KANI 1VA9A 3GSRB 5C86A 4IOIB 1J0HA 3CGTA 4PP2A 4TPRL 1N59B 1UVQB 1S5HB 1L7TH 3S4SA 3B2UC 3SGJC 4XZUB 4GG6F 4Z7NF 1LD9B 1O7SA 1W72B 4XHJC 2VC2L 2FYYA 3FAXA 3J8F7 2UY6A 2BDNL 3SBWC 3F62A 5DJDA 2EE6A 1B0WA 1HSBA 2V2WB 3NIFE 2IH1A 4JY6A 3GEWB 3CK0L 1PQZB 3HC3H 3ARVA 2ARJA 2MQCA 1LVEA 2H2PC 3E3QC 4XPTL 1DTUA 2IQAB 4N5ED 1ACYH 4N0UB 3VMPA 5KSBB 4OM1H 4GW4A 4JO4L 3RWHA 5C9JA 1RHHA 1JNJA 2VAAB 4GXUN 4M62L 4M6OL 1INDL 3DO7A 3O9WD 2PO6B 1F4AA 1U9KA 5E4EB 2J2ZA 1RZIB 1Q1JL 4Z7UA 4WUKH 5EBWB 3KPLB 5EU7C 3A6CL 4KTDH 2WP3O 5FYKD 1E4KA 3O3DB 4JO2L 5GGVL 3LY6A 3TBYA 3ZDYF 3LKSA 3DI2B 2NY6D 1VADB 1GGIL 4H1LH 1J8KA 3RGVD 3B83A 5I74B 3QXDB 1SM3L 3VH8B 1E6OL 3ARBB 4JVPA 1T20A 4XX1E 4XNQA 2KZ1B 3QQ3B 4EQ2A 4PJ7B 2J6EA 3VWKC 2VKXA 3FFCE 3DX9A 4PGEB 3EDKA 3DRQA 4GRLC 2AJVL 15C8L 3MOBL 3CXHJ 1TVDA 2WANA 4KMTL 1IMHC 4U1JA 1SEBB 1ZHLA 1HYRC 5IB3A 5DD3H 2LABA 4BFBD 1T0MA 1LK3L 3H9ZA 4XPAH 3CLEL 4O9HH 1LK2B 3NFSH 2EC9T 3UYRH 1IGJB 1ZA6A 3IETA 2XKNB 2Y5EA 4MDIA 5A2KH 1D5BB 4OD1H 3IDGA 2ZKHH 5D93B 5ACZB 2MCG1 1AGEB 3E2HC 5GGSB 1NC2D 2JJVA 1OAUH 4X4MA 4AEFA 1JHKL 3GJFK 4YBLC 3RKDC 3ULUE 4NQVA 3EO1B 4EI5D 4OZHB 4NKIH 4F15B 2QEJA 1GIGH 3ZTNL 1NLDH 3TVMC 3MRBB 3VD5A 5C08A 2DQHH 3ARRA 3FTGB 1S5IL 4R97C 3I2CH 4D0BA 5IG7B 5B8CC 1ZTXH 4XI5D 1R24A 3B9KC 4DVRH 2NY1C 3B9DA 2GJ6B 3CVHA 3G9AB 3UO1L 3G5VB 5ALCH 5F9AC 2F54A 3U46A 3X14A 5FA3B 4YHMH 2WQRA 1KNOA 5GS2D 3CSGA 3L3JA 4Z7WF 3JWDC 4CW1A 3C5JB 3HPLB 4JFFA 4AY0A 3WFBL 1G9MC 4GOSA 5BS0A 1CTOA 3DI3B 1U3HC 3HI6L 3VFTB 1YJDC 1A7OH 1LILA 2DQTL 3BX7C 1YMHA 4OKVB 1S3KH 4KC3B 4CADA 4YHPA 5C2UB 4UOW0 4MA8L 4WDIB 4K71B 4NGHH 5FXCH 1QO3A 3KYNA 1BAFH 3DHMA 4P4RA 2LV4A 4P2QE 5F6HI 1PEZA 4HKJB 3UTTD 1J18A 3DJ9A 3H9SE 4PY7A 2DYPD 3MUY1 1A9EB 4ZYKA 1ZA3B 1I9JH 3WXVH 1I7RB 2ATKB 4F8TA 4MNQE 5T5FL 2X9XA 4UBDD 1DZBA 3DUUB 2YUZA 5CILH 4V1DE 5EO1B 5T3ZH 4IDJL 2MFNA 4JY5H 2D7QA 5T1KA 4XHQA 1T5WA 2YUWA 5D2LF 5D1ZD 1EA9C 2C4FT 3U7YH 3PIQB 4NQEE 4I9WE 3FRPA 3PQYA 4JKMA 1F4WH 4YNYB 1EEZB 2ZPKH 4GBXA 2CDGA 1FE8H 2J7LA 2G75A 2XXMB 3D3VD 2CLRB 4XX1G 1NCDH 4P5KB 1TZHA 4GAGL 5IJVB 4GAJL 1JZ8A 3JWNC 2VIRA 2CMRH 4L29B 5D71H 2CKNA 3T2NH 4JKPH 2P5EE 4M1DL 3SDAA 5E08L 1NBVH 4DKFH 1TTUA 5DFVC 5ALBH 5MENA 3FONA 2CRZA 4LCWE 5EOQL 3DMMA 4ISVA 3D2UB 2WLYA 1R0AL 1CFNB 1PG7L 2EYRB 1MOEA 2R0WH 4GKSA 4QRPE 5J3HD 1JPSL 1ZGLA 5J57B 1S7RB 3P11H 3KPRA 4NM8H 3T0BA 1DFBL 4OAWA 3GSRA 2IAND 1NUNB 1N59A 1D7FA 1X44A 1S5HA 4Z7OF 4ERSL 3T0EC 1VCAA 1W72A 3Q1SL 4HWUA 3OPZL 3VXRD 4YGVB 1CDCA 1NCWL 1RIHL 1S7VB 1XF3B 5DJ8B 3P4MB 1Y0LA 2AQ3A 4JN1H 4F7CA 3R8QA 5I71B 3QIWA 2V2WA 1HXMA 5J6GB 2F53B 4KZEH 2HT2C 4QY8A 2CLZB 5HYQB 1LQSR 2D7TL 5M94B 1EFXB 1EMTH 4LRNL 4N0UA 5KSBA 3MOQA 4PB0L 4ETQB 3F7PC 5DLMH 2D7MA 1N64L 4I2XE 4QRQB 3CFDB 4HX1B 3V95A 3ULVL 1CFBA 4NQCE 3VMNA 2NR6C 5F93C 4AL8L 4JFYB 2V5TA 3BGMB 4XAKE 5IGXH 2OL3L 2VN4A 3O3DA 3ARPA 2QQNL 4FA8A 2ZG3A 3MV9A 2WMPA 1QPPA 3CXDL 5CJOH 4MX7B 4MXWH 1F3DH 4I18C 1MFBH 4NRYB 5JZ7D 3BDXA 3QXDA 5J6HB 2V9QA 3OG6B 4ZFFB 3VH8A 3PWPB 1TVBB 1KEGH 1RD6A 4GSDL 2DLFL 4WUUB 1GGYA 5AZEH 5KVMC 5FYKL 4PJ7A 1WIPA 1FZJA 1CDHA 1TETH 3SGKC 3SOBL 4XP9L 3ZL4H 4N90D 2WUBL 1SEBA 2YS4A 2BSED 3MRIA 1GSMA 4XXDB 4NJAL 3WN5A 4S1DD 3HG1D 5FB8B 2ZCLH 2BVOB 3V2AR 5LCVL 3BO8B 3MYJB 2MCPH 4WW2C 3LQZB 1LK2A 4GRWB 1I3VA 3CX2A 4MGXA 1QSEA 3QUZB 4RA3A 2V2TA 5GGSY 1D5BA 2N4IA 3X3FH 3CSYB 4FXGA 3SKOB 1AGEA 1GRWA 2DQDH 5GISH 2BK8A 3O4OB 1UZ8B 2P47B 1MIMH 2ICES 3LMJL 4OZHA 5T33H 3U83A 1I1RA 2DQEH 1ZLUK 1CU4L 2AJ3B 1J5OH 4JZNB 4QGTA 4KDVA 3QUXB 4KPHL 4P5MB 5C0EB 5A3IC 4NKDB 4CU7A 3ULVE 2YK1L 3MRBA 4G80B 3BZDA 4FZ8L 5GS0C 3FTGA 2V6HA 1T22A 4NWTH 5IBLD 3IB4A 3MO1A 1LDSA 1JK8B 1VFOA 3QIUD 4I77H 4PJAB 1T7WA 3O45B 4TOYH 2XWBB 2XNAB 4P4KB 5DJXB 3G5VA 1ITCA 1QFOA 2P42B 1AFVH 5FA3A 1CGUA 2ICEB 1AXTH 1ERNA 4LAQL 2FGWH 4R8WH 2VZTA 2FL5B 4A2MA 3L5JA 1LDPH 3C5JA 1UXSB 2BVUA 1K8DA 2NY2C 1U8PB 4GS7C 2QBWA 4ZO9A 2FCBA 3VFTA 2OZ4A 1VFBA 1WV7T 4K94H 2NY7H 2BNRA 4G8EB 5JHLH 5F9OL 2ZSVA 2VR5A 4IIQC 5E9DD 5DS8B 4X7TB 5L88L 3MLWH 1I8MB 1AD9B 3QIBB 4HKJA 2Z31B 4DN3L 1I7RA 2ATKA 2AJSL 3EGSB 2PXYD 3PDDA 1KN4L 1JWSB 2VLKB 3U1SL 5JDSB 2Q8AH 5FECB 3BISA 5EO1A 4HG4K 1UC6A 1YEIH 1BBDH 1BLNB 5CFHA 4WWKD 5GGTA 2IFFH 2D0FA 3X13B 5IHUH 1MHHB 3LKNA 3PIQA 3F65A 4FFWC 5E6ZA 4ZFGL 1A3RH 1M4KA 3CFEB 3TYFB 3KHQA 3MV01 4D94A 4YNYA 5EA0H 3WCYA 2PETA 4JFEB 3LIZH 3S5LB 5I1IH 3MXWH 3WDHA 5IR1A 5CSBA 3RY6C 5DVNA 4KK8D 5GIRB 2CLRA 3QYCA 2HAZA 3GB7B 4KMLB 5IFAH 4POZD 1ZE3C 2AAVA 2FWOA 2ITDB 3G5ZB 4G7YH 4NC1E 4OT1H 2CD0A 5EULV 3BPOC 1MREH 1W0WB 2OI9B 2IBZX 1CGYA 4NN7B 3SDDA 1I1YB 3RWIB 4ZFOL 2X6MA 1TJHL 1WEJH 2NY5C 4S2SA 4LLMB 3MTRA 1UM4L 3V8CA 4G43B 4OLWH 4JO3H 1CICD 1HEZA 2EYRA 2Q7NA 3WJLC 1Y18B 4LHUG 1E4JA 2DKMA 2E9IA 3F12B 1S7RA 2HRPH 3GDBA 1A3QA 5L8KB 4B50A 3ARGC 4OD3H 4PY8I 2EDHA 1KELH 3TNMA 1BF8A 3H9HB 4P5TC 5I1EL 2GTWB 1O7VA 5CUSH 4JQIL 4DZBB 1M7IB 4FTVA 4ODXB 5F88B 2O5ZH 3P4MA 5CINL 3VI4F 3LS4L 4TQEL 4RBPH 1ND0A 3B9EA 2F53A 4HKXB 1YYLL 3RHWF 2X4QB 1BJ8A 5C0FB 2CLZA 2FD6L 3KLSA 5HYQA 3QNXB 4LSQL 32C2A 5KANG 3AREA 4WHTA 12E8L 5ISZA 4ETQA 5BO1H 1ORSB 5BOZG 1AQDB 4PJGF 5IW6B 4QRQA 1YNLH 1A6UL 3JTTB 4FZEH 1NFDA 3C6LA 3CFDA 4FXKA 2Q7YA 1L0XA 4P49A 3ALXA 4YDKL 1JCKA 4JGUA 4XVUD 3IU4H 1G6VK 4YDVB 2EDYA 4QOKE 3QCTL 4HWEL 5C09D 4MX7A 5B38A 1OHQA 1ZLWH 4JAMB 3OAYK 4KJPC 4BFIB 4DGVH 4ZUTB 1BREA 3JBG7 5T1MB 2VL4A 4ZTOH 4J3TA 1INEH 4ZFFA 2YD3A 3PWPA 4IRJA 4Y8AA 1KJ3L 1CL7I 3FT3B 3D3VE 5BQ7B 4LEOB 5T3ZD 3NACH 4I3SH 5C08E 1YEDB 4GRMB 1B6DA 3SKJL 4S1RH 1UM5H 4JHAL 1PKQE 5KN5A 1RMFL 1JMZA 4IMLA 2MNUA 1A7RL 4XXDA 4X6BB 5CKGA 4KK6D 2F54E 4D9QD 1TQBB 3P9LB 3BO8A 3MYJA 4TTDC 3OB0H 3REWA 2AI0H 3FQRB 3QUZA 5J1SC 1OL0A 4HPOL 1R3HB 1MAML 2R0LH 4Z78A 3S4SG 3H42H 2E27H 3CSYA 4C58B 5D7IA 1WLHA 5BS0E 2R4RH 1EZVX 2B0SH 2HH0L 3ARFB 3O3UN 4PJ8C 1EO8L 1CDIA 5ADPH 5KW9L 1NUGA 5E2UL 1RURH 4LPYA 4JZNA 5DO2C 5IB4B 3ARDB 4P5MA 4YR6B 5C0EA 3SKMA 5D70L 4NKDA 4G80A 4M48H 1QVOB 2XN9B 1NAML 4GUPB 3RA7H 3O6FC 2XG4A 3V4UL 5DHVA 5HGBB 5IMKB 3BKYH 1P6AB 1JK8A 2YSSB 4KKLC 1BFTA 1DN0B 4PJAA 4WFGD 5H37G 3O45A 2XWBA 3FJTA 1JRHI 5D7JC 1DANU 4M6ML 5DJXA 1OAZL 3RNQB 5HJ3B 5TH2A 3EFDL 4PG2C 3U6RA 1D6EB 3PQYE 1DSFH 3DV4B 1QHPA 4UQ2A 1FORH 5I1DA 1W2KT 1UXSA 4KAQH 4FS0A 4OQ1A 5DYOA 4CAGA 2EH8H 1U8PA 2KPNA 5D7LD 1X4XA 5I18H 4NNYB 5L6YH 3O3AA 2E6PA 3U0WL 4R4NC 1G7IA 3U30C 2LU4A 4HEPG 5DS8A 4EDXB 1X5GA 5HD8D 5BJTA 1A22B 3QIBA 4P2OB 1PY4A 5MENE 2ID5A 3KYMA 3OJDB 1LO4H 3HC3L 1H3UA 3EYSH 5F1IA 3VGHA 5D9SA 4PTUA 1V7NL 1QA9B 3MUZ1 4MAUH 3L3IA 4OM1L 1JWSA 2B1HL 4DUXA 2DQCL 2Y6SC 3HE6C 1T83C 3DETD 4ELMF 5CJ5A 3X13A 2D31B 2HTLD 2AK4D 1Q0YH 5I15H 1NGQH 4L5FH 3TYFA 4Q6IC 2COQA 5GZOD 1XGYH 2E9WA 1WZKA 3U0TA 3TO2A 3WUWB 3ZTJG 4JFEA 3QHFL 1A6AB 4LCCB 1FFRA 2BSTB 3GB7A 3N85H 1P2CB 5FOBB 1K3IA 1Q9WB 3JV6B 1W0WA 3DUSA 1FGNH 1V7ML 3GIZL 4Y16C 4ZO7A 1AHWB 4LLMA 5HI3D 3MSPA 5ETUB 2AXGB 1HINL 2I26N 4OGZA 4F37K 1T1YB 5E2WH 1U41A 4FQCL 4JHWL 5GSVB 4U3XA 3KNBB 1BVZA 1Y18A 3N06B 1YN6A 3QB7C 2A0LD 5E94A 3F12A 4MA3B 1OW0A 3MV9E 1PY9A 1X4ZA 1AR1C 2W38A 1CI5A 3GI8L 2GITA 4HT1H 1ZANL 2PYEE 5CZVL 3H9HA 3DX7A 2IPTL 4L3AA 1HN1A 2X4PB 4DZBA 8FABB 1M7IA 4PJ5D 1J10A 3QULB 4LLAA 3UTPD 4TVSa 4HMCA 4Y1AB 3VWJD 4WCYL 1A6VH 4TSAL 1MCOH 3THML 4XGZB 4HKXA 1NEUA 3WSQH 3QDMA 3G04B 3EZ8A 1NLDL 3QNXA 3B6SB 2DQHL 2QLVB 1ACZA 2VLMD 2HLAB 4XMKH 2EIZB 3PDOB 4OZIF 2F9BT 4R26H 5IBUG 1ORSA 2P43B 4PG9A 1AQDA 2VLJB 5F6IB 1QSEE 1XF5B 2MTPA 3GMOB 4YHKH 3FRPG 4WV1A 3NTCH 3QH3A 3WO4B 4DQOH 1MI5B 2NTSP 4YDVA 3DPBA 1WISA 1N6UA 3DX6B 3MODH 1II4E 2EDBA 1GGBH 4OCSH 4JANB 2JLLA 4U6TA 4BFIA 1EV2E 1I7ZA 1IGTB 3LKRB 4XCNB 4ZUTA 4R4BA 3LZFH 1NDGB 1JNNL 5F7YC 5TQ2H 3V6OA 3QUMB 4LEOA 2OCFD 1D5ZB 3WL9B 1XT5A 3ILQC 4YHYC 1OAYH 3HAEH 4OJFH 4X6EB 5CJ8A 3BD4A 4G42B 4E0RB 1FBIL 1KJ2B 2YN5A 3CFJB 1U8HB 3RZCB 1F8TH 4P9HH 1KENH 5FKPB 5AG9A 1BQSA 5CILL 3C2SA 2A1WH 1Q94B 3OGCB 4PJDB 4AM0B 4JY5L 3VDBA 3OAZK 5F21B 3EYQC 1R3HA 3FB7A 5FDYA 4DCQB 3IFLH 2DI7A 4LDOB 3QBTB 2FHFA 2ZUUA 3BP5B 3U7YL 1VFAA 4NN5B 2J6EH 1NEZB 2ZUVA 5I8OH 3BQUD 3UBXI 3P4OB 4DKDC 5HGGS 2E6QA 3SY0B 2BNRE 4LLDA 4FABH 4G6AD 1RIVH 1IGMH 5CSZB 4P23D 5AD0A 5CP7A 1CL7L 2GJJA 4J23A 5IB4A 3ARDA 4YR6A 3BZEA 4JN2A 2BVPB 4ORGA 3MCKB 4GT7A 4JB9H 4Q9QH 5B3JF 1V3MA 5I19H 4XNUL 1QVOA 4MA1B 5IVXA 2C1PB 4JKPL 4PJIF 2W92A 5HGBA 1ZOXA 2DN7A 5ALBL 3HI5H 2YSSA 3VWKB 3TA3A 1FAIH 4YEFA 4FRWA 1S78D 3U4BL 1HZHL 3CH1B 3O2WL 4GRLB 4XBGA 4RNRB 2VO5A 4UUJA 5HJ3A 3UJTL 4RX4A 4TSBH 1QQDA 2CIKB 2K9UA 2BNUB 1OSZB 3DV4A 4M93C 4MJID 4XMPL 3GGWB 1T5XB 3ECBB 3VH8G 2K7QA 1BJMA 3DXAE 4NNYA 3IS0X 4BK4A 2UYLB 3C5ZA 4PJHB 5MI0B 1IQWH 1UCTA 4LASH 1ED3A 2OYPA 5JQHC 3BDYL 5JOEA 4EDXA 1I1AD 5SWQA 3W5NA 3S3JA 1RJCA 4U1GC 3LH2H 4UDTB 5FKAB 4GKNB 3PWVB 5DR5H 3DVNB 4KRNA 4ZUUB 4WO4C 1RU9L 4HD9A 4Z9KB 5HHOB 1KXQE 4Y2DC 4KROD 2DBLL 2WWKO 1JRHL 5F7EH 1BOGB 4R2GC 4LVNB 1J1XH 1RJLB 2D31A 1C8PA 3V8OA 5FUOH 1F6AA 4JFHE 4HIJB 5IGXL 5C07D 3GI9L 4NSKB 1OTSC 2P5WA 4LQFH 3ME0A 4B7IA 4LCCA 1F3RB 4LARH 4YX2H 2BSTA 3BP6A 2XA8H 3HLAA 1P2CA 1CGVA 5KTEL 3OXRB 3T2OA 2WK2A 4X6DA 1HYSC 2AJZB 1Q9WA 4BFGA 1MPAH 4UZGA 3MRMA 2QSQA 5JXAH 1MCJA 4MNGA 1I9RH 3C5SA 2QADB 5ISZE 3ZYIA 5ETUA 1S7QB 1T1YA 1NFDE 3O8XC 1DQDH 3ARXA 4MS8D 3VXME 5GSVA 4QXUL 4AT6A 3KNBA 3BPNC 1OP5K 3K80A 1OGAA 3IAQA 3QDGB 1QZ1A 2DJUA 2D0GA 5EU6E 4ZQKB 4MA3A 4QHUB 1IE5A 3M8OL 1NCBH 1UB5B 1UYWL 3LQMA 4YHOH 1DQLL 5EIIB 3BH9B 4OFYA 5F9JA 4RRPA 1MUJA 5DRNB 3FHQA 3SDCC 1OAXL 2DQDL 1MCPL 2NXZC 3M1BA 4QRRB 5F7MC 5GISL 2VXQL 4ONFH 2I27N 2VKWA 2XZCL 3AY4A 5D7LE 8FABA 1OARL 3I3BA 3W82A 5CGYC 2J8UE 5I0DA 3S96A 4Y1AA 4JM2A 3W81A 3WLBA 5JPMB 3E6FB 4R9HA 3PHOB 4LFHD 3G04A 1MELA 3TPUB 4XCCL 1Q0XL 2AABH 2IADA 3B6SA 2HLAA 2EIZA 2P46B 4ZS6C 1NBQA 4NWTL 5D1QC 5GRZA 1B6UA 3CFBB 3ULUF 1D3CA 1C5CH 1W72H 4PRPB 1CYGA 4L4TD 1HH9A 3UAJD 3H3BC 4ORZC 2D03H 2D9QB 3LVEA 4PV9B 5D7IE 2R1WB 3DYMA 2IPKB 5L8LB 5GRYA 3RTQC 3T0XA 1B4RA 1RJZA 4EEEA 4LPTA 2UUDK 1BFSA 3BMVA 3NCJL 4JANA 4XVSH 1IGTA 3LKRA 4N8VA 1LDPL 4P46B 3MACL 4PUBL 5FAAA 3BWAA 3HZYB 4ZG1A 1J0KA 1D5IH 5FGRA 1D9KC 4MVBD 3SGJA 2A6KB 3DTXB 4PGDB 2BSRA 1QEWB 3WL9A 3T0EB 1AGDB 4FQXB 4MD0A 5I6XC 5F3HA 4TNVF 1WBXB 1TCMA 1UWXH 2NCMA 3SBWA 4X6EA 2Z35B 5E6ID 2R69H 4G42A 3CSBA 3LPWA 1KJ2A 2PYFA 4LCIL 1U8HA 3RZCA 4FQJH 5FKPA 4FFZL 2ZCHL 4KRPD 5L2KD 5LG1A 2XZQL 3OGCA 4IRSB 4PRID 1B0GB 1BBDL 1MFEH 2UZYB 4AM0A 4OLEA 1LEKB 2AEQH 2DQJL 4KI5C 5JMOC 1VGKB 5IHUL 1FPTH 4OCWH 4KTEH 1HKFA 3BP5A 4GG6B 5KJRH 3ROOB 5CD5C 1A3RL 3MBEC 2I9LB 2GSIA 3KJ4B 4N8CH 2DD8L 5DSCB 4W68A 3MV7D 4KUCF 5CSZA 1CK0H 1IEAB 4Z8FH 1N5YH 4I18B 3MLZH 2BCKA 4KFZC 2BVPA 5IFAL 3PUCA 1U3YA 2ICWB 3MCKA 4OT1L 1MREL 3WIHA 3AVEA 4JY4B 1J8HB 4LEXL 2OSLB 2C3VB 3VWKA 2JIXD 3MNZB 1RULL 4GRLA 3T0VA 3MRQA 4RNRA 4K9EC 4JFDD 4HAGA 4I4WA 2APBA 3WIIL 5BV7H 5B38G 2JCCE 5DK2B 4JM4L 4H88H 1L6XA 2IFGA 3QI9B 1XIWC 3O2DA 2D7OA 1T5XA 4NBYB 3T77A 3ECBA 1KCSL 2BVTA 4BK5A 1IGIL 3STZA 4UV4H 2UYLA 2APWA 3RVUD 5CUSL 3GJEB 2ILLA 1RZJC 4Z7VF 3BPLB 5JHDE 2HFFB 3ROLA 2GIYA 2Q86B 3DROB 4EXKA 3MGTA 4C56A 4UDTA 5FKAA 4NHUB 4OZGA 4GKNA 3DVNA 4KMQA 2GFBB 1LGVA 4UT7H 5E8OB 2EKSA 4J4PD 5DVOA 4EN3D 3F5WB 4AEHL 4LLVA 1WTGT 4OIAA 1C5DA 3FQTA 4XC1L 4I0PC 3STLB 4A6YL 3GNML 4MAYC 5HHXL 3DX8A 1HXYA 4YPGB 4OGAD 5B8CA 4M61B 3D39A 3VFRB 3VG9C 3B9KA 4EIZC 3IU4L 4XWOC 1BMGA 2EICA 4NSKA 1FH5H 3G6AA 1AH1A 4HK3N 2E5EA 5IESH 5LGHH 4U0RC 1IC5L 1NCCH 1CFVH 5BCAA 1G9NL 2YMXL 3BP4B 4PLJD 4ZTOL 5TF1H 2FDBP 3OXRA 4NQSB 2NY2B 2AJZA 3C6SA 3QDME 2ARWA 4O4YH 3SCMD 5GGTH 2VDRH 5FIEA 1T3FB 3REVA 4PJXA 4IIQB 5FO8B 1U58A 1S7QA 4JPKH 1QACA 2VWEC 3VA2C 5JR1H 4K2UH 1QD0A 2JE8A 1LMKA 2D2OA 3P0VH 1MIEH 2QHRH 3B4NA 3RRQA 4JRXE 3HB3D 4QXWA 3ZE0E 1VEOA 4Z7WB 4ZQKA 1F6FB 4QHUA 1HHHB 2F5AH 4GMSH 1GZPA 5KBNC 1UWGH 2R0LL 3IDXH 5IMOB 5JNYB 5GPRA 4S0TD 2Y7QB 5DRNA 4HS8H 5HYJA 1ZSDB 3W5MA 3S88H 3SE9H 1QP1A 3KWWB 4Q58C 4LSPH 3QDJB 5HHMB 1IAIM 3BIKA 2NY3B 4OLYL 1RURL 4X5XB 5JPMA 3IFPA 3CH8A 3E6FA 1NDMB 2WV3A 3PHOA 3WHXB 5BRZB 1SBSH 3SE8H 2O61B 2NNAB 2KKQA 1T66D 2IQ9H 5LXGH 2HKHL 1T2QH 1H15A 5EO0B 2AK1L 1DUYB 4XT1C 3SQOH 2DLEA 3WXWL 2EXYC 4TYUA 5D2LB 4N1EA 1F3JB 1N3NB 1PYWA 2VXSH 5E1AA 1AO7D 4RISL 4PRPA 5IOPB 1YNTA 2H41A 2ITCB 3EFFB 4PV9A 4O2CB 3NZ8B 3BEWA 4Y5YC 2IPKA 5I16B 3KPQB 5F44A 1RUPH 1YEJL 4XNZC 5C07E 4POUB 1X7QB 2H3NA 2FH6A 4L1DA 1BVLB 2XTLA 3HZYA 1WQVT 2OMBA 5L6YL 5HVHC 3ELAT 1EDQA 3IRZA 4JFFD 3OKKB 2A6KA 3DTXA 5J9PA 5TGBB 1AGDA 3T0EA 4PRDA 1YY9C 3RDTC 2FZ3A 2ED9A 1WBXA 4YIQB 5DMYA 2Z35A 4NHCH 1U8KB 3O4LB 3SDXA 2V9TA 5C0GB 5MEOA 2Y06L 3MLTB 5F89B 2I5YL 5TFSL 3Q6FB 3M07A 1QKZH 5IT2L 3MBXH 4X83A 4E41D 4MXQD 3ETBF 5C0CD 1VGKA 4HZAA 2P8LB 4CMMA 3MRPB 4NN6C 4Y0GA 3MRJB 5T1KD 2I9LA 4L5FL 2X42A 4OCMC 2XZAH 5J13C 2VXTL 4Q2ZA 3IKKA 4UTAH 4X80L 3TN0C 4R6UA 1K4DB 3FFDB 4I18A 5TJWK 4GBXD 1Z0MA 4U33A 5CWSA 1P4BL 2ICWA 3HFML 4NP4H 3HPJB 4G5ZL 2H2SC 3IJYB 1B88A 4GRWH 4PGBA 3VFOB 1MCBA 4JHBA 4PRHD 2BVEA 4JY4A 1BD2D 1J8HA 2YPLB 5GQBA 3U79A 3MNZA 3UBXG 3S8WA 4YUEL 3SDAD 5A2JH 1BECA 4MQ7A 1R5IB 1IGYA 3QQNA 3OR6B 1I3RB 3A67H 4PBVC 3W9EB 4S1QH 1ZXQA 1OVZA 4UAOB 1CE1H 1YECL 4L4TE 3F6LA 3O3BB 3QI9A 4H20H 4F9PC 3MYZA 4IDLA 4WW2A 5LWYL 1Q9KB 1FZKB 1DBAH 3KPRD 4WHCA 5DDHB 2FSEB 1MRCH 2XY1A 5DHVH 4X6DE 2CR6A 4ZXBB 2IGFL 2JJTC 4LIQH 4ODTH 4RA0C 4KQ4H 2HFFA 1TZGL 1IZKA 3OAUH 3W0WB 1IAKA 3FKUS 4PTTB 1EAPB 1OCWL 2C7UB 2GFBA 5E8OA 3QISA 5ESVB 3F5WA 3HCVB 1NMAH 2EXWD 1NGPL 2GCYB 1XF2B 1OGAE 3QZWB 1HCVA 4Y19B 2ZUQC 3MFFB 3T65B 2AS5M 1H5BC 2E6JA 4WY7L 1FVDB 1UCBH 3VFRA 2VR9A 3ESUF 2PO6D 2W9DL 1RZFL 2CH8A 3VXSB 4QHKJ 1KTDB 1LP9B 1IFHL 4W70A 1JPTH 4PJ9C 4M7KL 1OM3H 1BGXH 2VDMH 4QRTB 4HWZA 4K8RL 2AQ2A 3WJJC 3P30L 1NC4B 5SWSA 2CRYA 3RVVD 3LZFL 4Y5XB 3BP4A 4TRPL 2XTJE 4O02L 2FR4B 2KDGA 4N0CD 4N68A 1XGQB 4FNLL 5DC0A 1UZ6E 4P9ML 5JA8B 4P57B 3ARBD 3GSOB 3B9AA 4NDMA 2RAMA 4IIQA 1DQQB 3BH8A 4HJJL 5LAXB 5EOCJ 3BZ4A 2BVYA 1HWGB 5HGAB 5K9JH 1IL1A 1KJMB 3K8LA 1A1NA 2VDLH 1T03L 4Z7WA 4UILH 3Q6GL 3U7AA 3BWUC 2X41A 3HE6B 1CLOL 2Y7QA 1HNFA 2G9HB 2SEBA 3MLRL 4U1NB 2Q3AA 1Z3GH 2JB5H 5DEFB 3V52L 4RZCA 1MCWM 1ZSDA 3TP4A 1BM3H 2XFXB 4UTBL 5L2JB 3GMNA 4Q6IB 3O6KL 4FABL 5DUML 1IGML 4BH8B 2X1XR 1MEXH 1NMCC 1G7JB 1S9VA 1IAOB 4TN9A 3RY6A 4I48B 1NDMA 7FABL 5FYLH 5JORB 1ZVHA 4U1KB 4ZFZB 3I50H 3QEGH 2NNAA 4JB9L 2O61A 1RHFA 4HJ0C 2NY4C 1DVFC 4K3GA 3MV8D 5EO0A 3UTSB 3E3QE 3BN9D 4B41A 3K8MA 3IKCB 3EJYC 5FHAH 5TE4H 3UPAA 4JR9H 4ZOEA 1MVFA 2VXVH 3IFOB 5E99L 1N26A 4HJGB 1IQDB 5IOPA 3MOAH 2ZZUT 4UNUA 5GJSL 3EFFA 3BAEH 4O2CA 4TSBL 4KJYB 3ZDXE 2P24A 3EOAA 4LLWA 3WJLA 1JFQL 1JF6A 2GJ6D 3EDDA 3MCG1 5EU7E 2ICCA 5I16A 3KPQA 2H1PL 4WFED 5KS9B 3QRGH 4IOFD 1KCUL 2GAZB 4MJ5A 3ARGA 1A3LH 2Y07H 3WFEL 5FYJL 4Z0XA 1MJ7L 1HHJB 5JUEL 3IFNH 3OKKA 4K3DH 5HDOA 4P5TA 2MPAL 5TGBA 1QLFA 2FBOJ 1ZLVK 2O5XL 1XMWA 4Z77A 4YIQA 5I1HH 4X4YB 3KLHD 2YXFA 2FX8H 1XCQB 3RNKB 4XVJL 1F3DJ 5I0ZA 5C0GA 3ULVC 4IRZH 4WEBL 5C0IB 3EBAA 1JWUB 5IIEB 1WF5A 4JJHA 4KHXL 1S8DB 2CLVA 2GSGB 4U1MB 3L3OB 2RB8A 1HDMB 3AXLB 1C5BL 1OAKL 1FL3A 4N5EC 2J4WH 4LVOC 4RRPG 2OP4H 1J1XL 3R06B 3DWTA 3MRPA 5FUOL 1HOCB 1I7UA 5I8CA 3O9WC 3JXAA 3SKNA 4YHIB 2FB4H 4LQFL 3RKPA 3GMMB 4WTZA 1DQJB 1M7XA 2DRUA 1GC1H 2FHCA 2PR4L 3WNNA 4HWBL 1ADQA 1A1OA 1ZHBB 5KSAD 2O26U 3GSVA 3HPJA 2NY6C 4OZGE 3RPIA 3IJYA 1J0JA 1YEKH 3RGVC 4MWFB 3VFOA 5D6DC 4DUWA 1ZT4B 5DMIL 4PJGB 2V7HA 2YPLA 4M00A 1S9XB 4DW2H 3OR6A 4Q97A 1I3RA 4GXVH 1CTNA 3D39E 5FYJE 4JREB 3BKML 1CFTB 1MCFA 3D2UD 4OGXH 5E4IA 4BSJA 4N8VG 2W9LA 4YHOL 1CWVA 5I2IA 5CBAA 1IKFL 1FZKA 1KB5L 4APQC 3C9NB 1HQ4A 1WWWX 1IAIH 1YEHL 4RFOL 1LE5B 5EWIH 4LSTL 5JW4R 4JZJB 4U6VL 3D9AH 3CUPB 3MGAA 1H3PL 4PJ8A 4JRYB 2R2CA 5GZNC 1MCLA 4MDJB 3W0WA 4PTTA 4PJXE 1EAPA 2VJXA 3EDJA 2A6JB 3OZ9L 4EI5C 3VXNB 1HILB 2AABL 1EK3A 2DWDB 1G1YA 4NQXB 1RUML 2O93L 4OKDA 2FX7L 2F53D 1XF2A 2R0KL 1T6WA 3QZWA 1EFXD 4Y19A 1LNUB 1JGLL 3KPSE 3O6FA 1OQOA 3MFFA 5IHLB 1C5CL 4GMTH 1PGRB 3IAPA 4PJ7F 4D9LL 4M7LT 5KVFH 2R2BB 5D7JA 1AGBA 4C4KO 2DWEB 1X5AA 1LP9A 4XI5C 5HYJE 4UT9L 3VI3E 4UB0L 2IG2H 4KKAD 4HGWA 3JTSB 1KULA 4G8GB 2A6DA 4QRTA 1NC4A 4XRCB 3GSNA 3CFCH 1EHLL 1A7PL 2DB8A 2OS7A 5DWUL 3MJ6A 4G6JH 2X4UB 4H8WH 3PWPD 2EKJA 5SWZE 3SPVA 1N0XH 1TPXB 3O11A 2NTFA 4L8SC 4R7DB 2JK5A 4WUUD 1DQQA 2ZOKB 3QNYB 3UP1A 1BD2E 2R69L 4OZHF 5SX5H 4L9LB 2Y25A 5HGAA 1KJMA 4WO4B 5E8DH 3HNTL 5HHVL 1R3LB 5LBSH 2DLHA 5GS1C 2EC8A 4PR5B 1MFEL 4LSRH 4Y2DB 5MEPB 4UBDC 3HE6A 3X3GH 1T83A 2BNQA 4OCWL 3L5XH 2G9HA 3C08L 2UWEE 4NQDA 4U1NA 4E5XB 3P40A 4U7SA 5IB1A 5KJRL 1JPFA 3QUZD 5GJTH 1N7ML 1W8OA 1TQCB 4N9GA 5D8JL 4Q6IA 1QLRA 5D1ZC 3QEUA 4BH8A 1CK0L 1G7JA 4UINL 4Z8FL 2XQBH 3MLZL 1Q9LB 1IAOA 2BFVL 3UDWC 3LV3B 2A6IA 1AE6H 4YHZH 4Y4FB 4FQHB 4Z6AT 1VEPA 3UPRA 5LQBH 3QUXD 4OQTL 5DZNA 3NGBC 5F9DC 2DBJA 3UTSA 1ZHNB 4X6CE 3TYGL 5I66B 4AYFA 4Y16A 2QQLH 4YWGL 4MYWB 4OSUH 5F7FA 3SDYH 1CT8A 3SHSA 1T21B 1IQDA 4M6NH 2IBGA 1FLRH 3D18A 1GHFL 3FN3A 5GS0L 1L4IA 3BPNB 4P4KD 4OF7A 1RZ7H 5KS9A 3MRDB 2GAZA 5J3HC 3FB6A 1WUNT 1IT9H 4LNRB 4OZ4B 1E4XH 1HHJA 4HK0A 1LEGB 4M4PA 5JO5B 1MVUA 4JFZH 1MCCA 2RCSL 4PIRF 1P7KB 4M3JA 4G6MH 1YYML 1YMME 1FL5B 3NVQA 2QSCL 1GPOH 1XCQA 3S98A 4UT7L 3RNKA 4EUPA 2X4RA 1DANT 5D2NE 5C0IA 1JWUA 2Z31D 3W2DH 5IIEA 1ZLUH 3GM8A 2GSGA 4FQQA 2CK0L 2M2DA 3AXLA 4Y4HD 4JDTH 2X10A 1WBYB 5D1QB 4FQ2H 1KTRL 3HTLX 1TJIH 2VLKD 4QLRA 1HOCA 4XTRC 1TFHA 4HC1A 5DZLA 1L7IH 1MF2H 1JZ4A 1T7YA 5HYSB 3DBXB 2RGSA 5IESL 2ESVB 4NBXB 3PWNB 2FEEI 1NSNL 3RTQB 4S1SH 3ZYOA 3GMMA 1DQJA 1KJ2H 4ZS7H 3T08A 5A43C 1RVFL 4OIIH 1F4HA 5FA4B 2WIIA 4PYHA 5TF1L 1YEGL 4HIEB 4JFED 4EDWL 2AEPL 3ILPA 3K2UH 4D0CB 1G84A 4JFQB 5EU4B 4ZUSA 5JZ7C 1ZT4A 4OLUH 3QUYB 4XPGH 2XKSA 4KDTC 1QSFB 3ZT5A 3IDYB 1KC5L 2VE6B 2WBWB 2BY1A 2O5YH 2W1NA 4DTGL 3MV8E 2YEZA 1S9XA 4ALAH 4CN6A 3BGFB 3SQBA 2OK0H 1HQRB 2QHRL 2XWJB 1Q9OA 1KPUB 3BZFB 3OF6D 1CFTA 3EO0A 3NFPB 4AJ0A 3VG0H 4S1DC 3C09B 5FYLD 4YDLC 1N2RA 5SWSE 4WI6A 3C9NA 3NFNB 3BJLA 1LE5A 2VTFA 4YZFE 2RQ8A 1JZ7A 5HDBF 3BUTA 4YEEA 1NFDF 3K1DA 2X1OA 4KJWD 4JRYA 2VSCA 3AS0A 1T7VA 3JUYA 3M45A 1PLGH 4MMZC 1KACB 1SBSL 2DM2A 1HILA 2DWDA 1FO0A 1QSZA 4WNQB 5LXGL 4HXBL 3O2DH 1T2QL 2VDNH 1R3JB 1HHGA 1Z9LA 5IWLC 2QQKL 5J12C 3U7WH 5I8KH 3SQOL 3INUL 4RGNB 1YY8B 4X4XB 3B2VH 4Y4KB 1KB9J 2VXSL 4OI7A 2UVFA 3KLAB 3IVKB 4YAQA 4RAUB 1FFOB 2VZUA 3QIUC 3U36B 3IDMA 3HZKB 2DWEA 3W9DB 5DJYA 1QHOA 4JG1L 2UZIL 3JTSA 1I9IH 1BF2A 3GIVA 3TT3H 1ZEAL 1EAJA 3C2AH 5B4MC 5GRUL 4CVZB 3I75B 3W11D 2FBJH 3BUYB 2VQ1A 4HQQH 1TZIA 4WGWB 4GRWF 1JTPA 1G6RL 1A64A 4PJIB 1CLYL 1D5MB 2X4UA 3GM0A 1J11A 2X4SB 5HGHB 1HIMH 5J89A 5D7IF 2DDQH 4R7DA 3D85B 2ZOKA 2A9MH 4NHCL 4LF3B 4HKBA 1WZ1H 1H3XA 5J4MA 2B4CH 3UZQA 1KFAL 5B22A 4WO4A 1FYTB 4M7JL 3TWCH 4Y5VB 1FN4B 4WTWA 1R3LA 4ZAKB 3LKOB 1NMBL 3O2VH 3JWDH 5D5ME 4PR5A 5TDNB 2BRQA 2B5IB 4I0PB 3QRFM 2PXYC 1DR9A 4Y2DA 5C0AA 3A6OA 3ULSB 1YQVH 3QFJA 4WWID 3V0WH 5EORH 3AAZA 4E5XA 4EIGB 3L1OH 1S7WA 2PUQT 3HMXA 1MQKH 3D48R 3HS0B 5EU3B 4WWKC 5IJKC 5DJ6B 2NX5B 3UJJL 2XYCA 5T5NG 1XGPA 4U0RB 5ITFA 1XH3A 2AGJL 3RWCA 2X1QA 3ARFD 5F7WC 1A14H 2VUOA 3ES6B 1VENA 4FQIL 4Y4FA 5C0DA 4FQHA 4KK8C 1HK6A 3ARDD 2C9AA 4PD4K 1ZHNA 4POZC 1RJYA 1ULVA 1GZQB 3VXUE 1T7XA 3L9RA 2XN9D 4PV8B 3CVIL 1T21A 3WD5H 2VLRA 5E2VH 3FOMB 1BQLL 2I07B 2ZG1A 2DI8A 4K07A 5EZIH 3O8XA 1CD8A 1KG0A 3DVGA 4R4FL 4UOJA 5I9QC 3K4DA 1OPGH 1CICC 3PL6B 3ALPA 1NAKH 3MRDA 4KWUA 3SGDI 1DBAL 5BOPA 2HVKB 5C6WH 3T4YB 4LCYB 5KVDL 5K9QI 1LEGA 5GSRA 4AEIH 3FL7A 4ODTL 1LO3L 4KQ4L 3KHOA 1WITA 4LVHC 1P7KA 2IALB 1FJ1A 3BVNB 1FL5A 4GJTB 1F00I 3GMPB 4R90L 3DLQR 2WBJB 3O0RL 1A6PA 1NANI 4P2OD 2F8XC 3PP4H 1IBGH 2PW1B 1XGRB 1KYOJ 1JNLH 5I1JH 2EDJA 2VABB 1X5FA 2HA1A 4I5BB 1UH2A 4HS3B 5D1QA 3QPQD 5TE6L 5DRZB 3FFCB 3WHE0 3OL2A 2Y36H 1BFOB 1MJJB 2J88H 5B39A 2VRAA 5E00A 3WDJA 3G6JA 3FO1A 2R56H 5HYSA 2JB6B 1OP9A 2HP4A 3SO3B 1JPTL 1OM3L 4AIZB 1SJXA 4K23L 3RTQA 4XVUC 3UPCA 1YEEL 1CCZA 4QRSB 1P1ZB 1UJTA 4LMQI 1E0OB 5FA4A 4Y89A 3MNVB 5IUSA 1H8NA 3BKJH 4RFNB 3MUHL 1BBJB 3BN3B 1D9KA 2FJGB 3K4ZA 1QSFA 2VE6A 1CDYA 5DD1H 5JQ6L 1GGCH 4E9LA 4IMKC 4QCIB 2CRIA 1RUAH 1F90H 1RZKL 1HQRA 2XWJA 1YNKH 3HNSH 3I9GH 3WYRA 2ZCKH 3BZFA 2VDLL 4OIBA 3HRZA 3Q5OA 4P2CG 1AIFB 4UILL 3NFPA 3VFPA 3QWRA 4M5ZH 4L1HA 1KCVL 2GJZB 2WUCH 2OR9H 1M7DB 4XC3L 4KVCL 4RQQA 3NFNA 2JB5L 2AXFA 2FEEL 2OR7A 3PHSA 5IB2B 1P9MC 3U4EA 3EHBC 4FQ1L 5F6HJ 1MEXL 4XWGH 4QHLA 4JPWH 3ZE0F 3OKMA 1QFUL 2I25N 2YXMA 2EEBA 4NJ9L 3I50L 4ZSOE 3HUJE 4Y1AD 2WINB 3D5OF 4WNQA 4X7EC 3KXFA 3VW3H 3GZKA 3SGEI 3TO4B 4Q0XL 5IB5B 1R3JA 3U0PA 1FCGA 1EGJA 3FO0H 1UA6H 5DT1L 4Q9RH 5FHAL 1MH5A 4JR9L 4PJCA 1CE6A 4Y4KA 3VRIA 3LD8C 5HVWA 3QQ4A 2VXVL 3FAWA 4P2QB 2VLJD 1MWAL 3QEHA 3IVKA 1CD1B 4ZD3H 1A7NL 1FC2D 2BNQE 4RAUA 3HI1B 3QFDA 4ZOAA 2D9CA 3H9SB 2H8PB 2CDEB 4NO3B 4NQDE 2J8OA 2EE2A 2ERJB 2FIKB 3GHBH 3HZKA 4M7LL 4MNQB 1VGEH 1CGWA 2ZWLT 3HNVL 1U8OB 3RZWA 1T2XA 3BMWA 1MI5D 4NFCA 4V1DB 1XIWA 1QBMH 4FFYH 3S7GA 3UX9B 4ONHA 3I75A 3CZFB 3N9GH 4OM0H 4PJIA 3TIDB 4ODSH 4K3DL 3GO1L 2W65A 4NQEB 5FO7A 3TGXA 5TF0A 4NC0B 5AWNL 2X4SA 1UM6H 3EYFB 1M6OB 4TVPH 1RZ8B 3D85A 2ADFL 3VXQB 4LF3A 2BSSB 2ADIB 4XHJD 4NNXA 4J3OC 3QJHB 5CJBA 5HD8C 1FYTA 3H6JA 4Y5VA 1FN4A 4ZAKA 2VDKL 2LAGB 1FFNB 5TDNA 4I0PA 2BC4A 2P5EB 3D0LB 1FNGB 3B3IB 3RZCD 3TFKD 2W0LA 5F72S 1LO2L 5IFHH 3IJHB 1AJ7L 5IVXF 4V2CB 5F96H 5AYUL 4LCWB 3HS0A 5EU3A 1ZGLP 3DETC 4OV5B 3ZKXB 2NX5A 3ZT6A 2HTLC 3WS6C 4QRPB 1KBGH 5H35B 4NO0A 5GZOC 1PFCA 1G7QB 3C60B 1KCRL 1CXLA 2VN7A 1G7HB 5KSVA 1J1PH 3QP3A 3UTQA 4F7MB 5KSUB 3MMEB 1YEKL 4EVNA 1O5DT 3QCUL 1J0YA 2AJXH 3KPOB 3AB0C 25C8L 2EDQA 1OB1B 5BVJA 4PV8A 3L3KB 4NZUL 4JG0H 2YA2A 4G9FE 1IGCH 3VWKD 3J7HA 4KUZH 5DQDH 2N7BA 4GQPH 3MA9H 4GRLD 2I9TB 4OGXL 3BPCB 3PL6A 1F2QA 3GMLB 1WC7A 4U6HB 2A0LC 2M1KA 4I2XB 3S3PA 2G5BB 3MJ9L 4OLVH 4GG8A 5HDQL 2HVKA 1HI6A 1IC1A 3T4YA 2B1AH 1SEQL 3OAZH 3OR7B 3L5WA 5C2BH 1A7QH 5FCUH 5IK3B 4W4OA 5GXBB 4OCRH 4HMEA 1B4JH 5EN2B 1T1WB 4XMLH 1NMCB 2F15A 3BVNA 3I3EA 2JELH 2NMSA 3BHBB 4JKLA 5E7FA 3GMPA 3FB5B 4PRBA 3VWJC 3C8HA 3EZJB 1CF8L 5C6TL 2PCPB 4L3CA 3L6FA 3IRPX 1OTTC 4PJEE 3D6GA 4X6DF 1KGCE 4YE4L 3GSWB 3MRLB 3FFCA 4TUKH 3NPSC 5HHOD 2VDQL 4BKLA 2NZIA 1BFOA 1MJJA 5F7KC 1L6ZA 1G7MB 5ID1A 2AXHA 1J9CT 5KVFL 3PHQA 1WT5A 3D25B 3QXTA 1URLA 3CDGA 4K94C 3F7YB 1UH4A 4Y5YA 1KSRA 1R3KB 3G08B 4QRSA 4GLRH 3MLVH 1PDKA 4LHUB 1C12B 5DF0A 1MCNA 3MNVA 4XBEH 2A73B 2BMKB 1A5FL 1BBJA 1A4JB 5FV2A 1RAMA 1VFMA 4J6RH 1N0XL 1Z5LB 2DM3A 4ONOA 3PWJB 3ET9F 4PPTA 1BQHG 1LWRA 4KRMB 5I1GL 3QO0B 2QADD 1F11B 2D3VA 5D7KE 4EOWH 4JM2F 3F7VA 3G5XA 1BX2A 5LBSL 4PB9L 4EBQL 2H9GA 1MHCA 1FSKC 3L3DA 4ODUA 5GGVY 1ADQH 4WFFE 3QDGD 1U8IA 2OL3B 2GUOB 3GBMH 5EC2B 3ZE2F 3L5XL 1PZ5B 4K3JL 5ITBL 3TV3H 4NUGH 5EO9B 3CLFH 3ZHDA 5F7DA 4L3EE 1ZVSB 4JFPB 2IAMC 4Z95H 1A47A 1TXKA 4QRRD 3BQUC 1T04A 3TN0A 2GT9A 4EUPG 5C9KA 4G6AC 1N8ZB 4XH2B 1AE6L 4MJ6B 2IPUK 2WINA 5IB5A 2HTKD 2CGRH 1U42A 1EH9A 4HLZG 2AKRB 1Q72H 3A6BL 1WSST 5C0AE 4M6NL 2CSPA 3QFJE 1UQSA 2DMCA 4WFHE 1OF2B 2H8PA 3H9SA 2CDEA 4JFOB 4PS4H 1S78C 4PRPD 1WCBB 4NUJB 4J7RA 2VXUL 3LN4A 5GRXG 5GRJH 1I7TA 4AENB 4RWHA 1DP0A 4F9PA 1OP5H 3QO1B 5ADOL 3QEQE 3CZFA 4APQB 1P6FA 3NABH 4P46D 2FEDD 4NQEA 4PP2B 3UROR 3DIFB 5DGQA 3EYFA 3G6DL 3JWOL 3RQ3A 3S4SB 2JJTA 2NW3B 4F33A 3TLRA 3ZDXF 5ENWB 3VGBA 2FYYB 2HKFL 3MLUL 4LDEB 4MJ2A 3T0ED 4FQXD 2BSSA 2ADIA 1PSKL 4NPYA 5A1AA 2E8ZA 3QJHA 1I8IA 1ETZA 3QHTC 1HSBB 2VLRE 2R23B 3BYYA 4JY6B 3GSNH 4JZOA 4KXZI 5CEZH 4XCFH 35C8L 2P5EA 2BP3A 3B3IA 4PY8J 2F8VA 4OF3A 4LMQE 4RMUA 3MUGA 3RIFK 3IJHA 2LTQC 1H5BA 3QUML 3RWEA 1RHHB 1U2HA 3KPNA 4IRSD 4KROC 1G9NC 1MF2L 1YPZA 3FRUB 3I6LD 4LCWA 1JJUA 2EDRA 1PEWA 4M6AA 3WNPA 2G2RB 3CIQA 4QRPA 4BELD 2MSPA 2NR6D 2QR0A 4PJ9A 5E8EB 1G7QA 4ZS7L 1KJ2L 3C60A 3MXVH 1B2WH 3LSOA 3WJJA 2V9RA 1G7HA 1MJUH 3TBYB 5LGJB 2W9EL 3MLSH 4R0LB 4F7MA 1OWRM 5KSUA 5JLZA 1L0QA 3MMEA 1WZLA 2X5PA 4NNPH 2R8SH 3GHEL 4LGPB 2W0FA 5MHSE 1ITBB 3FHAA 5GGRB 1T20B 4BSVA 4XNQB 4KY1H 1I3GL 5AZ2L 2X40A 2V17H 4YK4C 3QWOA 4OZGF 3BPCA 3VG0L 4JLRB 1FP5A 1T0MB 3GMLA 3NH7H 5MEQA 2G5BA 3QI9D 5DD5H 3IETB 1MI5E 1ZA6B 4NQCA 3NCCB 3T2QA 4ODWA 4WU5A 3VRJA 2R29H 3OJ2C 3IDGB 4MSWA 2RFXB 4QOKB 5HYIA 4X4ZA 2EDEA 5EZOH 1EVUA 1T1WA 1JGVL 4NQVB 3BHBA 2LFGA 5INDB 2DL9A 1B90A 5K9OA 3O2DL 2EDXA 2OTWA 1G7PB 1AI1H 3MR9B 5IQ7H 5J11C 4FQLH 1DBMH 4L4VD 5BZDB 3EYUH 3FMGL 2PCPA 1DVFA 1JGDA 2WWMD 1DQTA 1KTLB 1A2YB 3NZHH 1FGVH 5C08B 3GSWA 1U3JA 5EBMB 1FNSH 2JF1A 5K9QG 4F7TA 5EUOA 2GTZB 1DQMH 1IC7H 1G7MA 1PKQB 4D0BB 3NN8B 1MHPL 1U8QA 4PJXF 2D4DA 4W6XB 4AIXA 4WHYG 3CVHB 4TUJB 3H3PH 4TVPD 3UAJC 3F7YA 1R5VB 2F54B 1SHMA 1I9IL 3TT3L 3FCTB 3X14B 2DIAA 3G08A 5FUCC 1KNOB 4LHUA 1MFDL 3CMOL 3P3YA 2FBJL 2Y9RT 5EPMB 1WK0A 2EDLA 2A73A 4CW1B 2BMKA 4DOHE 5IBTH 1MJ8H 4P2RA 5BS0B 4XP5L 3KXFE 2NY2D 5HSFA 1UENA 1YMHB 1Z5LA 2L4OA 4Y8DC 4HC1H 3CSPA 2BVQB 4P59L 4MVBC 3WBDA 1LEIB 4PJCE 3QO0A 2B4CL 2DKUA 4Z18A 1SY6L 1D6VL 2DQFB 4BQ9A 3ZSSA 3E8UH 1MHEB 5E6IC 4QNPE 1CVSC 3O2VL 5ACLA 4NM4H 3V4PL 1U92A 4PGJA 2V2XB 3BGAA 2OL3A 2GUOA 5DK0B 5EORL 5E7BA 1PZ5A 4KRPC 5IBUB 2AJUH 3L1OL 3RBSA 4HEME 3T3ME 1ZVSA 4EQ3A 4JFPA 4KK5D 3WFDH 2WSKA 3PQYB 3HC4L 2RR3A 4JE4B 1A14L 2CDGB 1F2XK 1N8ZA 2XTJC 3K81A 3QDJD 5HHMD 4PJHE 2NY3D 2APXA 1KV3A 1CN4A 1FIGH 2WM0A 5BRZD 3WKNA 3HMWH 5D6DA 2HWZH 4MXVE 3SN6N 2AKRA 2Z91A 2EC9U 1KN2L 2AEWA 4O58H 1T6VN 4Z7QE 1VDGA 5B39G 3VXOB 4JRWA 5EZIL 5MENB 4XNMB 1OF2A 4JFOA 1HH6A 2X70B 2PW2B 3DMMB 3BKCH 1WCBA 3SDXF 5GRVL 1FO0H 4PJFA 4CDGC 2HVJB 3QO1A 4X6CF 2B2XH 1S7TA 4DN4L 3MLPA 4APQA 4OAWB 3GUTB 4LLUB 2ADGA 2R9HC 4UDUA 5IW1B 3DIFA 5JW3L 4RCAA 2NW3A 3OHXA 4F58L 5ENWA 1WWCA 3V0VA 3RVUC 1NC2A 1NAMB 3MCLH 4F8QA 1OOAA 1Y0LB 2BXZA 5TE7H 4F7CB 1WVZA 4P3WA 3QIWB 2R23A 2VWEE 1HXMB 5HHNA 2OTPA 2EYTB 5I1JL 2Q8BL 4QY8B 5MP6L 1JGUL 4QXGH 3O4LD 2H45A 4IJ3C 4J4PC 4M5YH 4EN3C 4RWYH 5F7NC 1JZ2A 4YHLH 1BFVL 3QG7L 1RUQH 4YXKL 4K8RC 2JJSA 3FRUA 3TJEL 4OB5H 3GBNH 3RVXD 4YQXL 1ZT1A 2G2RA 3LHPL 1SYVB 1QRNE 5E8EA 4AG4L 3MV9B 3GKZA 5JXED 5LGJA 3ALWA 3QPXL 3AM8C 3OKYA 4R0LA 1TTGA 5DJAA 3F8UB 1S9WB 3BKJL 1IC4H 2PYEB 2YBRA 4WW2F 4XNYH 5GGRY 4G6KH 3V6FB 5IROC 4U6YB 1CGSH 5GGRA 8CGTA 4HGKC 3HMXH 3SCMC 4L8SA 1UWEH 2P8PA 4G7VL 4L9DA 1FZJB 1RUAL 2YPLD 5DD0H 1T1ZB 1F90L 2P1YA 1YNKL 4WHYH 2ZCKL 1TTFA 2R2EB 1QR4A 4F37F 1FV1B 3MRIB 4JLRA 1NANH 3WN5B 5GS1A 3AS2A 2VZ1A 1QYGH 3WEXA 1I4FA 2W07A 5EOTA 3TH4T 2HLFD 3WFHB 3BSZL 2NPLX 1QSEB 1R3IH 4XP4L 3LEYL 2V2TB 3RY5A 3DSFL 4FXGB 3S36X 4WWKB 1ORQB 3LQAL 3QHZH 2RFXA 4JKWA 1K5NA 4QOKA 3ZE1E 5C8JA 4JPWL 4ZXBD 6FABH 3FT2B 4ZFOA 1KCKA 5D7SH 1AQKH 4F57H 3SE4C 4UU9A 5INDA 3UDWA 5BV7B 1AXIB 3W0WD 5CGMA 4RBPK 1G7PA 3MR9A 3PXHA 5K9KA 3GRWH 3D3VA 5BZDA 3MLXL 1X6NA 4QRUB 1KTLA 4Q9RL 2IMNA 1A2YA 1T66C 1XGTA 5EBMA 1T22B 4HCRL 3O3EA 2GTZA 3LN5A 3MO1B 4P48A 2Q87A 4YFLF 1PKQA 4Y19D 5F8QC 3H2WA 3NN8A 1FRGL 1PZUB 5DRXB 5L7XL 1QUNA 1P4IH 1VGEL 4TUJA 4BH7B 3GKWH 4ZUWA 1R5VA 2X1WL 3FCTA 1PVHA 3VXSD 3S35H 3MROB 5DC4B 5I30H 1IVLA 2GY5A 1YEFH 5L0QC 2VB5A 5EPMA 4G8FB 5DXWA 5TPWH 1K8DB 4GW1A 5CEZD 4K7PL 2IANA 3DVFA 1VFBB 2C3WA 3RU8L 2BNRB 2BVQA 3L3HA 1QRKA 1LEIA 2ZSVB 2W91A 2H26B 1HHKB 1NCAH 1P4LA 4X9FA 1Z0NA 4F80A 2DQFA 1MHEA 4NCDA 2FATL 1FZOB 1V3LA 2GEEA 3O6MH 2V2XA 1P84K 3P4NA 3QAZB 5E0QA 5DK0A 2HJFB 5E5MA 3OWEA 4FN0A 5F96L 4B53A 3Q5TA 4MXQC 5L9DH 3HE6D 3ZDYE 4U4BA 4UI2A 3WNOA 3LKNB 4BZ1H 5E6YA 2F58H 4GQ9H 3ZYJA 4N5UA 1OP3K 1UACH 3PGFL 2BJML 2XY2A 4OFPA 5EOCH 1IRAY 3P0YH 5IR1B 4ZUVA 3C87A 3G5YA 4YC2B 3EO9L 1A6TB 3O41B 3DXAB 1H8SA 4GBXC 4JQVC 2YWZA 3GSXA 2FWOB 5H2BB 4XPBH 2J3SA 3VGAC 4KDTA 2K3TA 3CZJA 1CQYA 5BMFH 3SDDB 4L4VE 3VXOA 3UTSD 4D9RD 1CZ8L 4S2SB 3ZZ1A 4WI3A 4XNMA 1RUKL 2X70A 5ICYA 1YPZE 3OJMB 1OT1A 2PW2A 3ISWA 1X5JA 4CL7A 1HEZB 2R0ZL 1RPQA 5T3XL 5GHWH 1CFSB 3LCYA 4P3DA 1QFWI 2HVJA 2ZJSH 3HG1A 5E5RB 2B20A 1G9EA 4RFEB 4M02A 1S9KC 4LU5H 3OKEA 2B1AL 5I1AB 3GUTA 3DO3A 4LLUA 5IW1A 4CU6A 4HFWB 3TNMB 5CEYB 2DQGH 3GFUA 4OCRL 4F3FA 2AV1A 4OF8A 4KJQD 4DAGH 4XMLL 4PFEA 1NAMA 4IEFB 4FTVB 3UMTA 4I8DA 2VH5H 2BOCB 5C0JA 1QLEH 4FP8H 1DDHA 4JPVL 2VMFA 5SX4H 1ND0B 1PW3A 1FG2B 2DIBA 2EYTA 1KIRB 4D8PA 1MFCH 1I75A 3LAFA 3BXNB 4OCXL 5IWLA 32C2B 3AREB 3STBA 2V5MA 1REIA 4WHTB 3IU3B 4TUKL 5ISZB 2EXWC 1CR9H 4OTXL 5F3BA 3LD8B 5LGKA 1I8LC 3T1WA 1NFDB 3C6LB 4FXKB 1RZJH 3VXMB 3I6KB 2Q7YB 3QIUA 1GJIA 4FQPA 1SYVA 5EU6B 2PO6C 5C0BE 5DMKA 5E4EC 4OZFG 5B38B 1VB9A 3VD7A 1DL7L 4XBEL 4QGYA 1WJ3A 1S9WA 3RVVC 2PYEA 3B43A 4KZDH 1WIUA 3V6FA 3DGCR 1QNZL 4IRJB 4U6YA 2HMID 4N0CC 5D7LB 5CJQH 3QXUA 4NWUL 3P73B 3ZHKA 1A8JH 2J8UB 5I74C 2N56A 4HF5H 4IM8A 5T3XE 5HPMB 3FQUA 3CPLB 3ARBC 1T1ZA 5EUOE 4GAYA 4XCEB 5D2NC 5E9DA 4TTGA 3EIFA 4ONGL 1ZLVH 5KN5B 4IMLB 1MRDL 2R2EA 1J05A 2F5BH 1FV1A 5JIIA 3L3GB 1ADQL 4UQ3B 1UJ3C 2G60L 2YD5A 4KKBD 4KQ3H 1KPRB 1CFQA 3REWB 3WFHA 3TV3L 1N0LA 4Z78B 2B8OT 1T7ZA 3E6HA 4WWKA 4HIXL 1ORQA 2VZOA 1OSPL 5D7IB 4P2RE 1F4XH 1YDPB 4ZDHA 3EOYG 2DIJA 3KYKH 3FT2A 5D93C 1LP9F 4JRYD 2VR4A 4HKZA 5F9WB 4MHHI 43CAB 3SKMB 3IXTA 1EBPA 1H3WM 4QRUA 4M43L 3PV7A 3AB0B 4HBCL 3UZVB 5DGRA 2XT1B 1Y6KR 4BQBA 2L0DA