5JA9A

Crystal structure of the higb2 toxin in complex with nb6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYAMRWYRQAPGEEREFVAFISSVGGSTNYADSVKGRFTISRDNGKNTLYLQMNSLKPEDTAVYFCVARLSLISDSWGQGTQVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin HigB-2
publication title Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Toxin
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ja9A00
4U6TA 1MCNA 4I3GA 1FE8L 3AAZA 3MO1B 4OI8A 4I0PD 5GZNC 2UUDK 3I75A 4JREB 1P69B 1P2CA 2G75B 3UYRL 3BEWA 5LG1A 3ZKMC 4AIOA 4EQ3A 5IK3A 4NKOB 1XGQB 2I5YL 2IBZY 5FCUH 5F3BA 5SX4I 3ZDXE 4D3CH 1RUPL 1IAMA 2ZCLL 2HTLC 2C5DC 5JOFA 5L88H 3EOTH 4G6ML 4Y1AB 4LVOC 5DDHB 4DK3A 4LCCA 4X5WB 5DD3L 4G6FD 5ISZD 2OJZL 1RULH 2OL3L 3GHBL 4JFZH 4EOWH 2A0LC 9CGTA 1CD8A 4XHJC 5BOPA 5TPWL 5E9DD 5CKGA 3LKNB 1TQBC 3PV6A 3I50L 1O7SA 1A4KA 5K9QI 1KXQE 1ZT1A 4QY8B 2V2XA 5BVJB 4LMQI 4N8CH 5CEZD 1EERB 1IC4H 1KJ2H 4PJFB 5HHVL 5ALCL 3QUZA 3KPRB 3VXQA 1EEZB 3BP6B 3Q3GA 1EEYB 3RJDA 3DMMC 5F1IB 1Z5LA 3U1SL 4O2CB 2FB4L 1Q1JH 3VRLF 3ZE1E 5E8PB 5KSAC 2LVEA 5E8NB 2VDPL 5MENA 4QRQB 2HH0L 1BOGA 4P59H 5DSCA 1J87A 2F15A 3S96A 5ANME 5JIIA 4HWZA 2XWBB 2ED8A 2QLVB 4AH2B 4ODSL 3FO1B 1JHTA 2P5EE 3CGTA 3QQ9C 5C0DA 4AZ8A 3KHOA 3RWIA 1N8ZB 1ZHKA 1RJCA 4BZ1H 1DVFD 3KYKL 3SDDA 1HEZA 3EJYD 3QDGA 4HIJA 4V2BA 4OCYL 3U30C 2AK1H 4WEBH 5ENWB 5A40E 5F7MC 3VXMD 2NNAA 1MQKL 2VO5A 3VFRB 1A4JA 1R3HA 4PTUB 5I30L 3SDYL 4F57L 4XMKH 4JHBA 3F7VA 3L3KB 4K9EH 5MEOB 4WY7H 3Q1SH 4YQXL 5TDPB 4FQHA 5EZLB 2R0KH 4KROC 1DLHA 4YGVA 4KTEL 4OBSA 1XIWA 1KIQB 2VITB 5IFAH 1LO2L 4GG8A 3B5GA 2OSLB 1WFNA 3O2DA 4ZXBA 2F5AH 1PG7X 3MRHA 1IGFL 1OT2A 4F8TA 5T1MB 4M43H 5ITFA 2D31A 3IDUA 4L8BB 3QUKA 3QCTH 3I2CH 1NH6A 4CADA 3L5XL 3ARSA 4MXWL 1CD1A 4Y1AD 3HB3D 1IC5H 5F72S 5T5FH 5I76A 4G42B 5ADPL 2A2QT 4W6YB 4JPIA 1T20B 2CIIB 2L7UA 3CLEL 1FP5A 3Q0HA 4F7EB 1ZVSB 2V9RA 3DARA 2F5BL 5IF0B 1QP1A 3MRGA 4HS8H 4RGNE 3RVTC 1OLLA 3MXWH 5SWZA 1C16A 4IS6A 1R6VA 5KJRH 4HUKB 5EOTA 1J88A 2BC4B 2NPLX 3MJ6A 3NACL 1IM9D 1RZ7H 5DMJB 3L9RA 3DVIA 2VLJE 3IDIA 4R4BA 3WS6A 2OI9B 3KPRD 1BVZA 3TNNA 2KH2B 2IQ9H 3WXWL 3ARDB 5CZVL 4PGZA 4JFOB 3UTTA 2O26U 3FB6B 5LWYL 1BREA 2PW2B 1PVHA 4JAMB 3VXTA 1V8HA 1EPFA 2H45A 4I5BB 4JN1L 1UA6L 4Y4FC 5JHDB 3L5WB 3SBWC 4P5KA 1I8IB 2DWDB 2W92A 3TH2T 4U1HA 5HHNB 1VPOH 2Q8AH 3BPNB 3TESA 4ODBD 2DDQH 3QHZL 3TYGL 5HHQA 4KHXL 4X5XA 5J11B 3WIHA 4U1NB 4HG4J 2AXHA 5J1TC 4PGBA 1HHKB 3GMMB 3D3VA 3BW9A 3VH8G 2HKFH 1GIGL 2BVYA 5T5NF 2EDJA 4TTGA 1EZVX 5F7UA 5F88A 2W9DH 1TIUA 2DOCA 1ES0B 3WLBB 4GAJH 1MELA 2ATPB 1IBGL 4DCQA 1WJ3A 1P6AB 4ZUUB 2JJTA 2Q7YB 2R1XB 4CVZB 4RFNC 4EQ2A 2R23B 5IB1A 4Z78A 1J5OH 4NQDA 2AEWA 1RJZB 3ULVH 4DEPC 1UWEL 4OQ1A 4P2RB 1I9JL 4NRYB 2RJMA 4JPKH 3GI8H 1JNLH 3MRQB 1CFBA 5EUKA 1GGIH 3VFGH 1DBML 3AFLA 4H26A 3BESR 4DZBA 1JK8B 1VFBA 1FO0B 3L3DA 3B3IB 4JRWA 4OLWH 5LGJA 4PLKD 5DXWA 3RHWK 4GG6F 32C2B 1NC2A 1R24B 1CDYA 2W0LA 1KB9J 3IAGC 3DV4B 1INEH 3LKQB 1FVDA 2CKNA 3QWOB 5GRJL 4M6OL 4XCFH 5KVEL 4GAYB 3JUZA 5FECB 3WD5H 2XYCA 4JN2A 4J3OC 3B2VL 3B9VA 3QFJE 1AD9B 5ELIA 3HG1E 5DD5H 4JY4A 3OB0K 3FQUB 4P23B 4X80H 4F9LA 3MRCA 4NBYB 2QEJA 4GKOA 4NJ9L 4ZS7H 2P8PB 4HKXA 5E5MA 4X7FC 1ZHLA 4Y2DB 1A6AB 4LPUA 4JRYE 4JEGB 2FYYB 2EC9U 3ARDD 2YD5A 2W9LA 4WHTB 3RWCA 3DVNB 1Z0NA 2JCCE 1LDSA 5EBMA 2HJKB 1FO0H 2AP2A 2Q1EA 3TFKD 1I8KA 5DFVC 5KN5B 2R8SL 4G6JL 4WW2F 2X89A 5C09B 4RAVB 1UB6B 3NIDE 2YUVA 5GGRA 1F6AB 2C4FT 3JXAA 5JHDD 1IZJA 2X4TA 2APWA 2OTPA 3UZEA 5CD3B 1KJ3L 4GW5A 1G9NL 4BZ2L 4HKJA 2GITA 5F9AC 5I6XB 5CJBA 2UY7A 3V0AC 3DHMA 1YNLL 1NEZA 5EORH 1VFAB 4MA7L 3D69A 4UIMA 1W72L 2AERT 4XVUC 2IPTL 4X7SH 4Z7VA 2CR3A 4WEMB 3BT2H 3PP4H 1FNEB 1WZLA 1UWXK 1T22B 3ZL4L 4PJAF 5L2KE 3S4SG 3Q2CA 1NC4A 3DXAE 1S7SB 2WUBL 1CDHA 4GBXA 1KOAA 4V1DE 1LO5A 3NCBB 5IMKB 2FEDD 2FGWL 3NFNA 5IBLC 5CBEB 1MLBB 3E6HB 4N0YH 5I2IB 3IJSB 4OGXH 4P2RD 5DLML 5FYLH 4M8QA 3ULUE 1OW0A 3D1MC 4OQTL 3ZKQD 1MIEH 2GTWB 1FL5B 3QWRA 2YOCA 5LBSH 4NGHL 3ILPA 4FQQB 4P9MH 5EU6B 4XT1C 1C5DB 4X6BB 3MV7E 3K1DA 3KXFA 1L6XA 4ZTPH 3L3JA 4LCYB 1L9NA 1Q38A 5GIRB 3RNKB 1X9QA 4WU7B 2NY4C 3REWA 3X12A 2UYLB 3D5OF 1AQKL 1R3KA 1S9VA 1RI8A 4NRZA 1LEKA 2E7BA 2J5LB 3DX7B 1P84J 2BK8A 4TSAH 1MREH 2R0WL 4IJ3C 1FG2A 3WLWC 2JB5L 1LHZA 4KFZC 2Y06H 1J0HA 5FGSA 3VGGA 4NQSA 3WEXB 4Y19E 1PQZB 4JPVH 4P23D 2Y4SA 4D9RD 3VWJA 4N0CC 1DLFL 1ZWIA 2H1PL 2XA8H 2LE9A 4NN7B 1YN6A 2ENSA 1TCMA 3WFBL 3ESVF 4YHLL 5HGBB 5C2UB 4Y2DD 4N5EC 4LPVA 3QNYA 1X5YA 4OFYD 2IQAB 2Y5TB 4FNLH 3QHFL 1OCWL 3RZCC 5HSFA 4JHAL 1UH2A 4BFIA 3U36A 5ID1A 5D1ZA 4P0DA 1V3KA 1Z0MA 5C09D 1QBLL 2BHYA 2ICEA 4TRPH 1L7TL 1ZK9A 2IWGA 4U1LB 4WHYG 4AEIH 4ZPTB 1NFIB 1HDMA 4JKKA 2VE6A 4ONFH 2H9GA 3CFIC 2WUCL 2XY1A 5FYLD 4ODVL 4HXAH 5AZEH 2YC1A 4UQ2B 2E27H 3SQOH 1PEWA 1RZIB 3TBYA 5DJXA 3KPOB 4E41A 4EI5C 4OB5H 5HYQB 4G9FB 4PJCE 5C8JA 1LEIA 2EZ0D 3BP7A 1SYVA 2AW2A 5I1IL 3MRBA 4IDLA 3QEQE 2K7PA 2KBGA 4XP6L 3DO7B 4IDJL 3BXNA 4F33B 1UJ3C 1G9NC 3RRQA 2XZQH 1IFHL 2AK4E 2QSCL 4MA3B 3V6FA 2P46B 5DK2B 4BELD 5DI8A 1WEJH 2HKHH 1U8LB 4IRZH 1XR8A 3AB0C 1JVKA 3V6OC 2Y07L 4NJAL 4LBEA 3MGOA 3U9UA 3VW3H 3C8HA 4PRBB 1T03L 5DEZA 3RUGA 4PJEB 5TE4H 3RVXD 1L0XA 3VDAA 1F4YH 5F7LB 3VXSB 1PX4A 1W8NA 2CDEA 3IB4A 4ONHB 5E2UH 3IGAA 1I1YA 5EU6D 5FGCB 5D72H 3MCLL 2VSCA 5T1LB 3ZKNC 2J8UF 1CR9H 4HH9B 5GGVL 4XP9L 4KU1A 3RAJH 3V5KA 4I0PA 3PDOB 4F9PC 2NXYD 4K71B 3KHQA 1OAUL 4N1CA 3GKWH 5C0FB 1IT9H 5FYJU 5IIEA 5CINL 5E00A 1T4KB 4CL7A 3V8CA 4ZTOH 4ODHH 1ED3A 4R8WL 3I6KA 3SKJH 1EAJA 3EYVA 3UTZB 3MJ7B 4ODWB 3OKDB 1BX2B 3HC0B 1CXHA 4LLUA 3V7MA 1AXSB 3LN9A 1NCAH 4PD4J 5ISZA 4BSJA 2JJSA 2PYFA 3BQUB 3U0TB 4MQXC 5HI5D 5GJTH 5CWSA 4DGIH 4JO1H 4F2MA 1Y0LA 4DKDC 5E9DA 4ZNCD 2DS4A 3T3ME 3DGGB 1QSEB 4GUPA 2GSGA 1I7UB 3DUUB 2YPKA 5J7CC 4OZGF 3DNKA 4YDVA 1IM3B 3LN5A 3IDXL 4ALAL 3P0VL 2EYSB 2VLLA 1A0QL 4KQ3H 3RA7H 3SO3B 3BRFA 1IKFL 5DD6A 3LIZL 4XP1H 4GG6B 3BO8B 2X70B 4M61B 3MOAH 4Y4HC 3BH8B 3WNPA 2A6JB 2R2HB 2I9TB 2XXMB 1HNFA 1QFWH 4HJGB 4GMTH 1G6RB 4EDWH 4MA8H 3I85A 4OGAC 4B41A 5I73C 1I8LA 1MWAA 1QR1A 1ZOXA 2ZCHL 5HPMB 1JZ4A 1Q9WA 4JGUA 4G9FD 1BF8A 5CBAB 2VXQH 5JXEC 5IB3B 5IEKB 3MLVH 4AEHH 1RUAL 2NY3B 3S35H 2QQNH 5BJTB 1WICA 4M5YH 2PUQT 2ZKHH 4ONOA 3P9LB 4FABL 1Y18A 1VKXB 1KN4L 5F6IC 1DVFA 1K4DA 1M05B 4QTHA 5FYKH 2GSIA 4ZNEE 1KB5H 1U91B 2V5RA 4ZOBA 1BAFH 3VXMA 1GRWA 4O2EA 4NDMB 4X4MA 1EBPA 1I7RA 4HIXH 4S1QL 5FKPB 1G6RH 1XAUA 4J3TA 5F7DB 1ZT7A 1G9MH 1EK3A 2HJLA 4ZAKB 1D5ZA 5I8KL 2E7LA 4XPBL 3EO0A 3NZHL 3IXTB 3TV3H 5T1LD 1C08A 1JI2A 3TCLB 4F3FA 1DQJB 3WHE0 3L5HA 1MRCH 2EE3A 2F8VA 4GXUM 4UIKL 5JDSB 2DTSA 3MO1A 2C1PB 2LU3A 1CVRA 1ZGLM 4DFHA 4KXZH 1OF2B 4NKIH 4PPTA 5EOQL 3OHXB 2G75A 2QTEA 4NKOA 1XGQA 4NC1E 3MLYL 1L0QA 1MFCL 4K94H 5DQDL 1CLZL 1AJ7H 1OD7A 2X5PA 4PRIB 1OAKH 4HUMB 5C9JB 1QSZA 4L5FH 1JZ7A 4OKVB 1QPPA 1GSMA 1CT8B 4Y1AA 2Y5EA 5DDHA 3LB6D 4QHKJ 4X5WA 4I4WB 3R1GL 4M7LL 4DTGH 1QQDB 4R26H 5E4EB 3BQUD 4OCNC 1QHPA 4P5TB 3I3EA 4LASL 1AY1L 2YKLH 3LKNA 5IHZB 1QSED 5GRZA 1KCVH 3U7WH 3WFHB 1NAKH 2KUTA 1YJDC 3WFCH 4QY8A 4X6FB 2EXWC 3FO2B 5BVJA 4CRPA 2HMID 4MVBC 3RBGA 5FIEA 3SY0B 3QIBD 4PJFA 3V4PH 2XTJE 3KPRA 1EEZA 3BP6A 1EEYA 1NMBL 2DLHA 5F1IA 4O2CA 1SY6H 2ZJSH 1FNHA 5E8PA 5E8NA 1MFNA 1QFWI 2H2SC 3LOWA 3H8NA 3RQ3A 4QRQA 3SKUD 2A6IB 4XVSL 3AS1A 1GZPB 4ZS6D 2R9HC 4BFEA 1G0DA 2XWBA 2UVEA 4AH2A 2NY3D 3FO1A 4O9HL 1MSPA 3OPZH 4BSWB 5TGBB 1Y6MR 4UT6H 1N8ZA 2IC2A 2KQMA 1MUJB 4RISL 5IB5B 1WWWX 4KY1L 5GZOD 4H1LG 2QJDA 3S5LB 4XNQB 2ED9A 5DUBB 5ENWA 5KSBF 3FN3A 2PCPB 2OZ4H 3VFRA 4PTUA 2FDBP 2GEEA 3K2MC 3L3KA 5MEOA 3ABZA 1PEZA 5TDPA 4Z5RB 5EZLA 4X7TB 3HI5L 1IEAB 4ZAKD 2ZCKH 5HYSG 4JE4B 3MLUH 1KIQA 2VITA 4WFFE 2F54B 3ARFC 1MCOL 2OSLA 4Y5YB 3BAEL 12E8L 1T1XB 3TT1H 5IV2B 3QNXB 4S0SD 4WI8A 5J8OA 5IJKA 1KULA 1U36A 5T1MA 1H5BC 3EZJB 1S3KL 1R5VB 4KXZI 4L8BA 3C87A 1INDH 5I16B 5E5RB 5F70A 5IFHL 4L4TB 4PRID 3I3BA 4CW1B 2DJ4A 3JWDH 1LP9A 5E8DL 1UZ8B 4FQJH 2V17H 1BFSA 1MEXL 5TQ0H 4G42A 4Y8AA 1A3LH 1T20A 1UWGH 2CR6A 3ZDYE 1FSKB 4UILL 3OKLB 2WQ8A 1ITBB 4F7EA 1ZVSA 5IF0A 4P5TD 3GMQB 3KJ6L 4CKVX 3K2UL 3G6DL 1G7LB 2A1WH 2BC4A 1YY8B 3VWKC 4F7PB 2M1KA 3QAZB 3MFFB 2J8UB 2QADC 4LGPB 1MJUH 4YDIL 2ERJC 1S7UB 5AEAA 3LAFA 3ARDA 4I48B 3QDMB 4JFOA 2AV1B 3FAXA 2KPNA 4OF0A 1FZMB 3CVHB 3FB6A 2OCFD 1MCWW 3H7BA 2VISB 3OJDB 2PW2A 5IQ9B 4JAMA 5AYUH 3GSUB 5LGHL 4NZJA 1RU9L 4I5BA 4AT6B 2WLZA 5JHDA 3QRGL 3L5WA 3LRGA 5DO2C 5C92A 2YZ8A 1I8IA 2DWDA 3RIFK 2VDLH 2VLRE 1MCJA 5DVLA 2VZVA 3GJFB 4G80B 5HHNA 4KUCF 1RURL 1C1EL 1WFUA 4YNYB 3RHWF 5K93A 4LCWE 3BN9C 4U1NA 3UTSE 4J12A 2DQIH 1HHKA 3GMMA 4ORGB 4JZOB 5EU4B 3V4UH 4LGSB 1HINH 2PO6C 3CVHH 3HZKB 1T66C 1ES0A 3WLBA 2NY7H 2ATPA 2F54D 4PRPE 4YUEL 2Q7YA 4ZUUA 2R1XA 3PF2A 3UTPD 2R23A 2YS4A 4JFZL 5MERB 4LEOA 5HHME 1RJZA 3DJ9A 4WIQA 2VL5A 2B2XL 4P2RA 4NRYA 2MNUA 4HK3N 3I9GL 3GJFH 1DQQB 3NN8B 4UZGA 5F9OH 1KNOB 1MVUB 4E0RB 3MACH 3MRQA 4KMTH 1ETZB 4N8CL 3WO4C 1IC4L 1JK8A 1FO0A 1KJ2L 4I1NB 3TP4A 3B3IA 4PIRF 5D7LE 32C2A 4MXVF 1R24A 3CAFA 5DEFB 1Q1JL 3DV4A 3LKQA 3BWAB 1UVQB 3DI2B 4UMGA 4UOJA 3QWOA 4GAYA 4P59L 5FECA 1AD9A 1HE7A 5JPMB 5I1HH 1RFDH 4P23A 4R7NB 4FQLL 1I3VA 4YO0B 1P5UA 2D7NA 2P8PA 1HZHH 3EDJA 4Y2DA 1A6AA 3BKYL 2FYYA 2EICA 4GQ9H 5MHSE 4BZ1L 5F7NC 4OFYA 3QDMD 4WHTA 4PGCB 4OZIE 3DVNA 3G5YB 4WEBL 2HJKA 4NN5C 3RY5A 5KN5A 4UINH 3MLXH 5LXGH 3GFUA 4F37K 4XMKL 3F65A 4PLOB 4RAVA 4K9EL 3RVWC 3NIFE 3Q1SL 1UB6A 4PJBF 1NAMH 2VDOH 1F6AA 5J6HB 5C6PB 3MFGB 5CD3A 4BQCA 4LHUG 3SCMA 5L6YH 4K7FB 2F5AL 2EDHA 1XGRB 4FQCH 3GM8A 1VFAA 4OLEA 4M43L 2AXFB 4HQQL 1F3RB 2XN9E 1FIGH 1FNEA 1T22A 2OTUB 3QCTL 1H15B 2K9UA 1DR9A 1YUHB 3IDJB 2PYEE 4Q6IB 3RKPA 4YDKH 2R0LL 3QCUH 5CGYC 3O6LH 5IVXF 5T5FL 1S7SA 3UC0L 4ZG1A 3FB5B 2XWJB 1FLRH 1WLHA 5JXAH 5IMKA 3IDYC 4YFDB 1MLBA 3E6HA 3ECBB 2OYPA 5FHAH 3MXWL 5I2IA 3IJSA 4KJQD 1EHNA 4OZHE 5J13C 3GBNL 4R4ND 5I1EH 4LVHB 1L7IH 4H20L 5KSUB 1MVFA 4R7DB 1LDPH 4KAQL 1S7WB 4TSCL 4WI7A 2GTWA 2O5ZH 1FL5A 1RZ7L 2GKIA 1EGJA 5DTFB 1X44A 4PR5B 5EU6A 1C5DA 4X6BA 5EIVA 2YPVL 4QRRB 4LCYA 1KTKE 3W0WE 1E6JL 3RNKA 5GIRA 1LE5B 3RDTC 4BJLA 4LARL 4MDJB 4WU7A 1FGVL 4C56E 3O81A 2UYLA 3GRWH 4FG6C 3DX7A 4MNHB 4JFDB 1L6ZA 1KCLA 1QBMH 2HN7B 4QO1A 3D0VB 1I3GH 1DBJH 2JTDA 3HTLX 3HE6B 1IKNA 3WEXA 1PQZA 1NGWB 4Y0GA 1B9ZA 1GPOL 2EDDA 1EV2E 1B0WA 3IKKA 1NFDB 1ZLUK 5HGBA 4EKXA 1AH1A 3P0YH 4N90E 3TNMB 4MCYB 2Q8AL 2IQAA 2DDQL 2Y5TA 4OCWH 5MI0C 2EDKA 1RZJH 2EDFA 1VESA 5KS9B 3CFCL 2RBLA 4KK6C 4Z9KB 1NGXB 1LWRA 1VSCA 3BE1H 4PJIF 2VIRB 4CN4A 5FYJH 4U1LA 3VXNB 1WIOA 2BVEA 4ZPTA 1NFIA 4L4VB 3MBEC 4DKFH 2YA2A 2BZDA 4Z7OE 3C8DA 1M6OB 2W9DL 3R06B 4LL9A 3O0RH 4GAJL 5IESH 4K23H 1VB9A 3EO9H 2G2RB 4UQ2A 1J5OL 2VN4A 1RZIA 2XKUA 4DQOH 1FHGA 3KPOA 3ULVL 3CX5K 3RWGB 5HYQA 4G9FA 4N1HB 3HPLB 3BIAX 1G1CA 1S9KC 4JPKL 1P4BH 1I9IH 3GI8L 2NXZC 5FUOH 1JNLL 4OD3H 3DO7A 2DI8A 4F33A 3C5ZB 1AR2A 3NCJH 4R0LB 3VRJB 4MA3A 1IEBB 1RIVH 3TN0C 5DK2A 5D6DC 3KDMB 2ARJQ 1EEQA 1U8LA 2ZWLT 2BRRL 5CUSH 4DJMA 1OGAE 5ANMB 4WHYH 1W2KT 1P6FA 5F6HI 5C0EB 1NUDA 4X99B 5MENE 4LSUH 4PRBA 2OM5A 1BWMA 2IPUK 4H0GA 3SOBL 3PGCB 4PJEA 2QSQA 3LV3B 3BPOC 1U8KB 2DQHL 4XPAL 5DWUH 4P3WA 3WD5L 1X5ZA 4XNXL 3VXSA 2WINB 4ONHA 5D8JH 5T1KB 1U6AH 5DD5L 5E2JA 4FQXC 1T5WB 4H0HB 2AI0H 4X80L 5T1LA 2C3WA 5EOCJ 4QRRD 4HH9A 4Y4KC 3QDGE 1DJSA 4IM8A 3PDOA 4HGKC 2FRGP 2IEPA 3W11D 1Z3GL 5C0FA 3QFDB 1BQUA 4JFDD 5DA4A 4EDXB 1T4KA 4TULH 2EDWA 1WAAA 3OSKA 2APTA 1PZ5B 4RWHA 5H37G 4OLYH 4K8RH 4FZEL 4M6NH 2Z0BA 4OFVA 3O6FC 3MJ7A 4QNPF 5AZ2H 3UTZA 1PKQB 4ODWA 3OKDA 3HE6D 4D9LL 4U1GC 1BX2A 3HC0A 1F11B 1EUTA 4MNQB 1AXSA 5J3HC 3MMEB 4JZJC 1TJGH 3SE9H 2DLIA 4R90H 3BQUA 2BNUB 3U0TA 3FZUC 2JF1A 5EORL 2VLMD 3DGGA 1QSEA 1A6VH 1I7UA 3VI4F 3DUUA 3SEPA 3S36X 3QPQD 5HHXH 1P9MC 3L3IB 1IM3A 4X7SL 2QV2A 3BT2L 3PP4L 2EYSA 1F00I 2H26B 4M1DH 5CJ8A 4M62H 4O51B 4R2GC 3B8YA 4L4VD 4F7MB 4GG6A 2B20A 4RDQG 3BO8A 1KYOJ 4KGJA 4RGNB 2X70A 4M61A 3BH8A 1DQTA 3KYOB 2A6JA 2R2HA 4EBQH 3C6LB 2I9TA 1NMCB 2J4WH 4KI5F 4KKBC 4HJGA 4LLVB 4HXBL 1G6RA 3ZSTA 1EVUA 1CVSC 5SWZE 2I25N 5TQ2H 4N0YL 3QPXH 3SDXB 4BQBA 4OGXL 1EA9C 5C0AB 5CBAA 2O93L 5IB3A 5IEKA 2PXYB 2GY7B 2DD8L 4KVNH 1YN7B 2CPCA 4QTIH 5BJTA 5LBSL 3C5ZD 4OCSL 4MAYD 1F6LL 4GSDH 4OUOA 3P9LA 3MLPA 3QIWB 1VKXA 1Q9KB 4JKLA 3UTTE 3TF7C 1EBAA 1M05A 2P4AB 1MCPH 5HHOB 5LQBH 1U91A 3CH8A 2IANB 3KPNB 4APQC 1JRHL 1R3IH 4PJBB 4LHQB 4TSAL 4NDMA 1MREL 4D0DB 2HFFB 4PJ5B 1E6OH 2QKIB 5C07E 5FKPA 3FONB 1ZANL 5F7DA 2WWMC 5T1KD 4ZAKA 1OP9A 3IXTA 4JPVL 3GHEH 3BIKA 1U3YA 5ITBH 3TCLA 4MLSA 1DQJA 1K8IB 2CDFB 4CDHA 1DBBH 2C1PA 1SJVA 1UWXH 3BGAA 1OF2A 4FNLL 3OHXA 3SKNB 5H35B 5DR5H 2HT3D 5F7FA 1KLFA 1D5XB 3D3VE 2QR0B 2NY2C 4PRIA 4YC2B 4TRPL 1CL7H 3R0NA 3W39B 4EJ1C 5C9JA 1X3DA 2D0GA 3E2HB 4OKVA 1P4LB 4AEIL 1CT8A 1PSKH 4YXLH 4MNQD 3O9WC 4GXUN 5BXFB 4Z7NF 3CK0H 5L8LB 3FT2B 4I4WA 4U3XA 2VLKB 3A0OA 3EFFB 1QQDA 4HXAL 4NQDE 3TJEL 1VGKB 2XKNB 2E27L 1CBVH 1NLBH 4P5TA 1NSNH 2VDMH 5IHZA 4OB5L 2VDNH 4ZO7A 3WFHA 1HYSC 4NZDA 3P4OB 4X6FA 3FO2A 3T3PE 3SY0A 1BEYH 1G84A 2XZQL 4IOFC 2OZ4A 1CLYH 1BIHA 1F2XK 1Q72H 4RGND 5M95B 3C6LD 3VDBA 1RZ8B 2HKHL 4HWEH 1FNLA 4IRZL 1JCKA 4Q97A 3ZKXB 5DHYB 3VW3L 3MTRA 5D2NB 3UDWA 4U1SB 5D70H 4RIRB 4JO3H 2W91A 3B83A 2A6IA 2WP3O 5C0AD 5TE4L 2PXYD 1GZPA 5I1JH 3FAWA 1F4YL 4UB0H 4PJGB 4FXLA 2ESVB 2HTKC 5E2UL 3HPJB 3NH7H 5A2LH 3SKOB 4BSWA 2IMMA 3OKOB 2B4CH 2Z31B 4YPGB 4U1KB 1NL0L 5TGBA 3QIWD 3VI3F 4M00A 3TCXA 1T1YB 5IB5A 4RNRB 3RGVC 4PJIB 3S5LA 4M4RA 1CXKA 4XNQA 5DUBA 4UOW0 3PL6C 2PCPA 1A3QA 2IAND 4Z95H 1WUNT 4PJXF 4XPGL 1J1OH 2IPUG 4PJ5D 4DN4H 1UXWB 2DM4A 4ODHL 1QBBA 4JDZB 4Z5RA 4X7TA 1IEAA 4IIQC 2VR5A 4HPYL 2BCKB 5E03A 1QR4A 2F54A 1IGJB 1OAZH 4Y5YA 1T1XA 4HUNB 3EIFA 3U48A 4LRNL 3QNXA 1T7ZA 5IV2A 3GMNB 4OLVH 5GJTL 3FN0H 3FO0H 4DGIL 2YD8A 4G5ZH 3VG9B 4JY6B 3NOIA 3GSWB 3C2SA 1R5VA 1T21B 3GSNB 5ICXB 3PG2A 5GGSB 5I16A 1JZ2A 4L4TA 4H1LH 4CW1A 4KQ3L 3RA7L 4LU5L 1A14H 1A7OH 1GC1C 5SV4A 1LK3H 4YHYC 1T5XB 1CL7I 3STZB 4CJ0A 2Q87A 3MOAL 2VXTH 3QA3B 2VLKD 3JWNC 1QFWL 4P4KC 3TLRA 3OKLA 4GMTL 4XCNB 3RIFF 2EDQA 4MA8L 3GMQA 3RP1A 2FD6H 4K7PX 1G7LA 1YY8A 4UV7H 2VXQL 5AUMB 4F7PA 1OM3L 4GXVL 3MLVL 3MFFA 4AEHL 2J8UA 1OY3B 5FO7B 4K55A 1F5WA 5CP3H 2LU7A 1MFDH 3HC3H 4XPTL 2ZKHL 4OGYL 4BKLB 1ZAGA 1U95B 5GS0D 4J1UB 2ARWA 5KG9B 4JQXC 1S7UA 1UGNA 4X5LA 4Z0XB 3I6GB 2N7BA 4I48A 3QDMA 2AV1A 2OX5A 5FYKL 3BRDA 4UAOC 1KB5L 1FZMA 3W9EB 3FTGB 3CVHA 1BAFL 4RZCB 1MCFA 1N0XH 1I4FB 2VISA 4MJIB 3TVMC 5IQ9A 3F7QA 3GSUA 3FFDB 4PTTB 1ORQB 4HIXL 2D7TH 3WKNA 4AT6A 1G6RL 1T0NB 2ESVD 4H88L 4KJPD 2Z31D 5FF6B 4ENEC 3W2DH 1UZ6E 3KPLB 2FX8H 1EJOH 4XAKE 3GJFA 4KK8C 1IAIM 4G80A 4ZUWB 1MRCL 1QVOA 3RWHB 1RZKH 4DW2H 3L3HB 2BY3A 1UM5H 2R1WB 4YNYA 4TNVF 4H5SB 4M9OA 4LIQH 1HHHB 4P48A 1T2XA 4K94L 2NR6D 1FIEA 4ORGA 4JZOA 5EU4A 4KRMB 1OAKL 3BISA 4GQPH 5D7SH 1K3ZA 4LCCC 3HZKA 3CPLB 3TIEB 4K3GA 5J6GB 4R26L 5B3JE 2HLAB 4UNTA 5MERA 4E41E 2IFFH 2L7JA 4WI4A 3CU1A 5TF1L 1F2QA 2YKLL 2OMBA 1KCVL 3U7WL 3SE3A 1DQQA 4AYFA 3NN8A 4LSSH 5DJZB 1KNOA 4PJ9B 1MVUA 4E0RA 4YPJA 3WFCL 1E28B 4PJHF 1ETZA 1DUZB 4HG4K 1WWAX 2PKDA 3FN9A 3GBML 3V4PL 3GSOB 5E6IC 3U4EB 4RDQF 4OCRH 1OQOA 2CK0H 4G6AC 4FFVC 5DEFA 1N0LA 1SY6L 1H3VA 3BWAA 3GSQB 5D1QB 1UVQA 5M7QA 2YBRB 1X5LA 3RUGE 2CO6B 3MRNB 1FNGB 5CJQH 4XPFL 1I1FB 5JPMA 4ZOAA 5IB4B 4HSQA 2J8HA 2B7DT 4R7NA 4YO0A 2EO9A 4F7CB 5CJOL 4W4OA 1NMAL 1A1MB 3SDDC 3AM8C 5FM5O 1ROWA 4PGCA 1Q0YL 3H9HB 4P2YA 3G5YA 3QQNA 1TFHA 1CCZA 1T0MB 2BXYA 4GRWE 4KMLB 3ULSB 4MJID 1KB9K 3ILQD 1KGCD 4CUCA 3HAEB 1UEYA 1V7NH 3V0VB 5IGXH 5ABDE 4MQ7B 5J6HA 43CAB 5DD0H 4FFWC 4X4XB 4ERSH 5D1XD 3SGJA 1M4KA 3AREB 4K7FA 1IARB 4NP4H 4EEEA 3TT1L 1A21A 2CRZA 1JGLH 5E9DE 2Z92A 1P4IH 1XGRA 3P11H 2AXFA 5F8RC 1INDL 4HUUB 3TT3H 2Y72A 2OTUA 4DK6A 2R39A 1H15A 5CEZE 3SDAC 3IDJA 4Q6IA 4JFPB 2CUHA 4F7TB 2VYRE 1ZLVK 3HA0A 3M8OL 4FQJL 2V17L 5TQ0L 1TZGH 4NT6B 3FB5A 2XWJA 1F6FB 2C4FU 5IP4A 3QEQD 4JM2F 4LSQH 1JPTL 4RFEB 4X9FA 3HAEH 4GOSA 3ECBA 1ZA6B 2JE8A 4WI5A 3F7RA 1U8JB 4PV8B 3SQBA 5KSUA 4WW2C 4R7DA 4PJ9D 1S7WA 1KCRH 5DTFA 1HILB 4PR5A 1MJUL 5I71C 1PJ9A 1A7QL 4QRRA 5IFJB 5CMAB 3TZVB 3MYJB 5E6YA 2IBBA 5ACLA 1LE5A 1BQSA 4MDJA 2SEBA 2X10A 1T1ZB 1C5CH 1CU4L 3VXME 2FZ3B 3CXHJ 4M02A 1IGYB 5D1QD 5CIPH 5FO8B 1HQ4B 4MNHA 4JFDA 3WSQH 2J3SA 4I13B 5SX5K 4PJDF 4X4ME 3EOBB 3UYPA 2A38A 3V52H 2HN7A 5FGBC 2NY0B 3D0VA 5AYUL 4FHBD 1X5HA 3FRUB 3HE6A 3HMXA 2DTMH 1NGWA 4Q7DA 3P30H 2BOCB 1NFDA 3UBXG 4XP5L 1MFEH 5GRYA 3TNMA 4MCYA 4HWBA 1OB1B 2X9XA 5KS9A 2GK0B 3NFSH 2DQUH 4M48H 1DEDA 4RA3A 1F3DJ 1NGXA 3O3EB 1G7HB 2VIRA 3LRSB 1OTUC 4BH7B 1P84K 2ICWB 5A16B 3DRQB 3VXNA 4OD2B 4L4VA 3TBTB 1HINL 4J4PD 3CVHL 3B9KC 2EKJA 1M6OA 4LVOB 2VTFA 3DRTB 3R06A 1CGSH 2P8LB 3BP4B 2G2RA 4ZMAT 1I7TB 1RZFH 4LPCA 3ROLB 3UYOD 1J0YA 5D2LF 3RWGA 1OD9A 3HPLA 4XMLH 1TQBB 3CFJB 3VGHA 1ITCA 5F9OL 1RY7B 4KMTL 1A3RH 7FABH 3C5ZA 4NHCH 1F58H 2GT9B 4PJFE 4R0LA 3VRJA 1CD9B 3STBA 4K2UL 3KPRE 1IEBA 3SN6N 3KDMA 2HRLA 1FN4B 1JYNA 2GIYA 5EZOH 5ANMA 2ADJB 1YPZF 2ID5A 4NBXB 1N3NB 4X99A 5C0EA 3H6JA 5IOPB 3C9NB 5KSAB 5I8CB 2W9EH 3PGCA 4OM1H 3LV3A 4WO4C 1U8KA 1I85C 1A6WH 4RAUB 1URLA 4GW1B 5JW5B 2WINA 1YEHH 3QZWB 5T1KA 1RFDL 1T5WA 1GAFL 3CU7A 4YBLC 2NYYC 2J12B 3DUHA 4KGLA 1ACYH 4P3CL 3TZVD 1OOAA 2YHGA 2NY5H 3GM0A 3GZKA 3QFDA 3U30B 4QRSB 1KC5H 4EDXA 1F4XH 1RMFH 3MLXL 1D5IH 3LHPL 2NY0D 1PZ5A 4XBGB 5EUOF 4PG9B 1OWWA 2OR7A 3WFEH 3IFLH 1IQWH 1PKQA 1NAML 3OZ9L 2AJUH 4TUKL 4I77L 1F11A 4KROB 4MX7B 3G9AB 4MNQA 5EN2B 4CMMB 4ZD3H 5IQ7L 4IRSC 3MMEA 1RJYB 1ORSB 5B21A 3T1FB 5L6YL 4WI3A 2BNUA 4PUBH 2JJUA 1K9TA 3WJLA 4J3XA 5J0BA 3SDCC 3KPSB 3ZKMD 3L3IA 1YYMH 5FM8A 4XP4H 1WWBX 2H26A 4J3SA 1LP9E 4TUJB 5I18L 4O51A 4YDKL 1FFQA 4F7MA 3EYQD 2HTLD 3O6LL 3KYOA 2J8OA 3C6LA 2QQKH 4LHJB 5H37H 4LLVA 2UY6A 5JXAL 3FMGL 3T0XA 4NPYB 1IGCH 5HDQH 5AYQA 4HX1B 2APXA 4PD4K 4CVUA 1UCBL 2A0LD 4XHJD 3SDXA 4OT1L 5C0AA 3OJVC 5C7XH 4NO3B 1OW0C 2PXYA 2E5EA 1L7IL 3LY6A 3UJJH 4HK3J 3FOLB 1YN7A 4QRUB 4PYHA 4X9BA 1CFVL 3GMOB 3ZTNL 4WHDA 4HUVB 5HDBF 3MSPA 3AU1B 2VUOA 4DGYL 3QIWA 2OL3B 1IGMH 1Q9KA 5D5ME 5HHOA 3UP1A 3BDYH 3GRWL 1KCSH 3T1WA 2BY1A 1G7IB 5KSAD 3FRPA 2IANA 3KPNA 4PJBA 1QBML 2WP3T 3GK8L 4D0DA 2HFFA 4PJ5A 2QKIA 2X1OA 4FS0A 3KJ4C 3FONA 5JHDE 1DBJL 3ULVE 2Z8VC 3UYRH 4Y4FB 5LKNA 3O4LB 4PS4H 5BMFL 3OJ2C 1K8IA 3QQ9D 2CDFA 2ZG2A 4JVWA 5DK3A 5JW3H 3CXDL 2W0KA 3P0YL 3EYFB 4M93C 4G6MH 3WIIH 4OCWL 1J1XH 1RZJL 4YR6B 5IMLB 4JQVC 3SKNA 5H35A 3U82B 2B8OT 2OJZH 1KUMA 4Z18A 1D5XA 4GKNB 2QR0A 4XZUB 1UB5B 4U3CA 3W39A 3CSGA 3I02B 1B6DA 5FYJL 4AK1A 2UV3A 5TPWH 1P4LA 5HHMB 4NNYB 3OAYK 2K7QA 1A5FL 4DKFL 4KROD 4AENB 2A6DB 5BXFA 4QYOB 1JUFB 4UTAH 3FT2A 2VLKA 4DFIA 3KG5A 3O0RL 5IESL 4G6KL 3EFFA 1OWRM 3EO9L 1VGKA 2XKNA 2J1KA 4RFNB 4P2RE 2LFGA 4DQOL 1NLDH 3FO9B 5DA0B 2JB6B 3H9YA 3RVUC 3BYYA 4DEPB 1A6UH 1UT9A 3KPSD 4ZFOL 4PP1C 3P4OA 1P4BL 4HJ0C 5T3XH 5D7LB 3U1SH 1I9IL 4X7EC 1BJMA 1JZ5A 4Z7UE 5FUOL 4OD3L 3KAAA 5BCAA 1U3ZA 1G7MB 2LTQC 2EDBA 4JZNB 3SKMB 3QDJB 4WEUD 3T2NL 1KTLB 2HRPL 1RZ8A 3N06B 1U8PB 4ODSH 5CUSL 5A3IC 1VGEH 1BZ7B 5TE7L 2FLBT 5DHYA 2V9TA 3O2VL 5D2NA 4U1SA 1T83C 4MD4B 4N68A 4MCZB 4RIRA 3RVTD 3CFDB 2R4SL 5DWUL 3DECA 3K80A 4PJGA 4OCYH 1WFTA 2CLRB 2ESVA 5D8JL 1U6AL 1MQKH 2G5RA 4D9RE 1IC1A 3HPJA 3SKOA 3OKOA 2AI0L 5I30H 4YPGA 4U1KA 2VERN 5DMIL 4GRLC 5DVOA 4BK5A 4F57H 4YQXH 1T1YA 3NA9H 4RNRA 1A64A 4PJIA 3N50A 5I0DA 1BF2A 1F8TH 2DQDL 1X6LA 3HR6A 1MCSA 3AVEA 4TULL 3EYUH 4HMEA 1UXWA 3WBDA 4K8RL 4M6NL 4JDZA 1BVKB 5AZ2L 5J9PB 2IAMA 4QEGA 2BCKA 3MLWH 2FL5B 5FYLE 4Y4FD 4RMUA 3O4LD 4EN3C 1IGJA 5IT2L 3MV01 3NPSC 1DCLA 1QFUH 1SYSB 3GMNA 4MXWH 4U7MA 5CP3A 5D7KD 4JY6A 5ADPH 3GSWA 3V6ZB 1FFPB 1A6VL 1S78C 1T21A 3GSNA 4IMKA 4JVPA 5ICXA 5GGSA 1M71B 3E6FB 5HHXL 3WUZA 1W0VA 4HULB 3TPKA 5JIPA 4JGMA 1KCKA 3VFVB 4OSUH 5HHMD 4I8DA 3VRLE 4PG2C 2R4RH 1T5XA 3STZA 4EUPB 1YPZB 1C5BL 3IDGB 4EBQL 2F9BT 3QA3A 4OZHB 2NY6B 2J4WL 2MJWA 4J2XA 4K3EH 1QA9B 1RZJC 4DAGH 3LEYL 2ZUTA 2APBA 4XCNA 2P7TB 4NFCA 1I8LC 2V2WB 1NDGB 5TQ2L 2R15A 3QPXL 2VJXA 2EXYC 2J6EL 5AUMA 3WXWH 1N2RB 5D7LD 1JHLL 2B5IC 2BERA 5HD8D 2ZUQB 3EHBC 5EU6E 5FO7A 4C56B 4KVNL 3HZYB 2CUMA 1NGZB 4JDTH 3VD3A 2W1NA 1EFXB 1KG0B 4KKNA 1A1OB 1I1AC 4BKLA 1U95A 3QDJD 4J1UA 4N8PA 2NW2B 4P4RB 5KG9A 4HBCL 1BBDL 3P4LA 2GJJA 4Z0XA 3I6GA 4JN1H 1KENL 1MCPL 1T7YA 5E5UB 2Z8WC 1SVZA 2NY4B 5LQBL 3W9EA 3FTGA 4RZCA 4M6AA 5IEHB 1BPVA 3MLSH 1I4FA 4MJIA 3TO4C 4EUPH 3FFDA 4IJ3B 1E6OL 4PTTA 2P48B 4D0CB 1ORQA 4HKBB 1T0NA 3TYGH 2H8PB 1KIPB 3OTTA 3ARYA 2APFA 5F3BB 5FF6A 5ITBL 3KPLA 3S97C 2J7LA 5DC0A 5DQ9B 5ESVB 4ZUWA 4JO2L 1J05B 3RWHA 2R56L 1P1ZB 3L3HA 1DBBL 4JREC 2P47B 2IG2L 1GIGH 2A6KB 2R1WA 2VWEE 4H5SA 3OGOE 4NC2B 5ID0B 5DR5L 1HHHA 3RNQB 1IBGH 3QHTC 4L9LC 3RZCB 5DMKB 5DFVD 3CDYA 5E1AB 2JCCF 5FAAA 4O00A 4YXLL 3CPLA 4LFHD 3MUGB 1ZS8B 1CGYA 3TIEA 3NGBC 3NIDF 3QDHA 5J6GA 2HLAA 4RRPG 4OFKA 5IVNA 3NCFB 4BFBD 1CBVL 1J0ZA 1NLBL 1NSNL 2VDNL 4K8RC 4EI5B 3U0WL 5DJZA 4HCRH 4PJ9A 4XVUD 2NY1C 1E28A 1OGAB 1T89C 3IJYB 3K46A 5I66B 2VSDA 2YA0A 1DUZA 5GRJH 4M6OH 2Z93B 1BEYL 5KVEH 1UJ3B 1CLYL 1Q72L 3GSOA 5I8EB 3U4EA 3S96B 3THMH 2NY6D 3B2VH 2YXMA 1B88A 2C26A 3BZEB 3AB0B 3GSQA 5D1QA 2FX9L 3VFNB 2YBRA 1W72B 4NJ9H 5IBLD 4PJEE 3ELAT 5BW7C 3MRNA 4U6HB 1FNGA 3VXSE 1F3JB 1PW3A 3JTSB 4YDJB 1S5IH 4XPHL 5I1JL 3RY6A 1I1FA 4C56D 4I18C 5IB4A 5F1OB 3IAPA 3M1BB 1EFXD 3NH7L 2AJZB 2MTPA 1W0YT 4G6JH 5DEGB 5IROA 4DUVA 3ULUF 2GK2A 1A1MA 2DQJL 1FCCA 2DMKA 3ARZA 4YZFF 5I1KH 4NN6C 3H9HA 5AWNH 4XBEH 2NY4D 1EZVY 2YRZA 3GSXB 3E3QE 4F80A 1T0MA 4ESKA 4BZ2H 1WAAE 2CIKB 4Y16C 3ULSA 4YK4C 4Z95L 1CICC 1J1OL 4DN4L 3WLWD 4CBPA 2BHZA 4KK9C 3EKCA 3S3SA 3DTXB 3HAEA 1AE6H 5T3ZH 2VXVH 4BQ8A 4J4PA 3V0VA 1AHWC 1W72H 4MQ7A 4N0FB 1IGIH 4UNUA 4Q9BA 5D7JC 43CAA 2IPTH 4X4XA 2AEQL 1KXTB 4N0CD 1UACH 3AREA 5F7HA 3ARRA 2R2BB 5E2TH 1GHFL 1XFPA 4N5ED 1EH9A 3RI5K 4OLVL 3S88L 1QSEE 3FN0L 2VZUA 3FO0L 4G5ZL 4Y5VC 4ZUSB 2WUBH 3FB7B 1S8DB 4JG0H 3JBG7 2GCYB 3RZCD 2FGWH 3MODH 5FYKE 4HUUA 5SWSB 4GG6E 4JFPA 4F7TA 2X09A 1RUQL 2DAVA 4NT6A 2EDTA 1LGVA 1QFOA 3DVFA 4OQTH 4Y4HB 3VU2A 3O3BB 4N8VG 1JGDB 2OMNA 2FJFB 4RFEA 4PRAB 5EH1A 4U1JB 1ZA6A 2ZOKB 2F19L 5I73B 5JUEH 1GZQB 4XVJH 2FD6L 4FMKA 3PDDA 4M8VA 4EI5D 1U8JA 4PV8A 4UV7L 4LGRB 3VG0H 4FFYH 4TUOB 1AQKH 1OGAD 4U2YA 1HILA 5MEND 1MFDL 4PJCF 2JB5H 3PWJB 4KDTC 5IFJA 5CMAA 3TZVA 3MYJA 3LEVH 4XH2B 1YY9C 2G9HB 5C07B 4XC1L 1T1ZA 1VEPA 5F6IB 2FZ3A 5J56B 4W70A 1IGYA 4CU7A 5D93C 1J18A 1DLFH 1HQ4A 2H1PH 3CJJA 4WTWA 5FO8A 5HGHB 3BRGC 1N0XL 4YHLH 3EOBA 3PABB 3O3DB 4W6WB 1SJEB 2Q76B 2MPAH 2D7TL 3FRUA 3QHFH 2CD0A 2HFEB 4XNYL 2DBJA 4JHAH 3HE7C 2XRAH 2BOCA 4JLRB 2FX8L 1EJOL 3ZKND 2DM7A 1J12A 4C83B 3CMOH 3CFEB 3DYOA 3BPNC 4NKMB 4G8EB 4DW2L 3UZVB 2HWZH 3S35X 1UM5L 1EO8L 1OB1A 3WUWG 2GK0A 2WUCH 1IAKB 3GMPB 4KUZL 3V5HB 5DF0A 4F15C 4LIQL 4TVPL 4PRIE 3O3EA 1G7HA 4RA0C 4ZXBD 3LRSA 3RWFB 4BH7A 4YBQC 2ICWA 5A16A 3DRQA 2PTVA 4OD2A 3TBTA 4KKLD 5D7SL 3DX6B 3F7PC 3DRTA 5F9DC 3G5VB 3HMWL 2BSED 4IDJH 2H2PD 3V9FA 2P8LA 3BP4A 1I7TA 4Y7MA 3ROLA 1NGQL 4MQXD 2NX5B 1U3HC 2WZPD 4YXKL 2VQTA 3CFJA 4D9QD 2Y07H 3O4OC 4LSSL 4NJAH 3Q6GH 1QO3B 1J0IA 4AEFA 5SWSD 2GI7A 4NZRL 2GT9A 1T03H 2NTFB 4XI5C 3T3MF 2ITCB 2VDKH 3GSVB 1OTSC 4MD0B 5DJ6B 4Y4HD 4OCRL 1FN4A 2CK0L 5EU7E 2ADJA 3P4MB 1N3NA 3CD4A 2MKWA 3MCLH 5IOPA 3C9NA 5KSAA 5I8CA 3FQXB 5DHXB 2CK2A 4OGAD 3KLDA 5CJQL 3H9SB 3MNWB 2LV4A 4RAUA 4GW1A 3PV7A 5JW5A 5JXED 3QZWA 4POZC 3FL7A 3IU4H 3RX7A 1MCQA 2F58H 4R8WH 1QSFB 1IMHC 3UX9B 5C07D 4RAHA 1YJDH 2DL2A 3GEWB 4PGDB 3WIFB 3Q48A 4QRSA 1RV6X 3P9WB 4IBLT 4NRXB 4WFED 2UZYB 4XBGA 4PG9A 1PBYA 1D9KC 2BVUA 5CP7B 4LAJH 4PGEB 2NTSP 4HWUA 4JPWL 4E42B 4AY0A 4HIIA 1V7NL 4MX7A 5EN2A 4CMMA 3FFCB 4ERSL 3IDXH 1RJYA 1ORSA 3T1FA 3ARXA 1A0QH 3UTPE 4YAQB 1U8MB 3MXVL 3D3VD 3ARFB 4C4KT 4NP4L 3RPIB 1OP3K 5F89B 4QXWA 1BOYA 1P4IL 3B2UC 3P11L 4A6YH 2FIRT 3FQTB 3KPSA 3S3PA 1H5BB 4L4TE 3CDCA 1RUML 1CLOL 4HEME 3TT3L 4TUJA 3F7YB 3CMGA 5BZDB 2CRYA 2ZCHH 3ARVA 3HN3A 4RBPH 4XXCC 5HBBA 3DUSB 5KANG 4YHOH 4X8JB 4OLUL 2APVA 5DZNA 4NPYA 1KV3A 4ELMF 4HX1A 5MP6H 2NX5D 4B0MM 3LCYA 2R29L 1KN4H 2QHLA 2J8UE 3AS3A 4NO3A 4PP2B 3VWKB 1AGFB 1NUNB 5I1CL 1PFCA 1KCRL 3FOLA 2IPKB 4QRUA 4Y88A 4OV5B 3UBXI 3GMOA 2EXWD 4MVBD 2QADB 4HUVA 3AU1A 5DJYB 4MNGB 3RTQC 4J3UA 2OL3A 3QDME 2ERJB 4S1QH 3H2WA 1KYOK 2NXYC 3DOSA 1CGTA 1Y6NR 2EH8H 4XPBH 3NZHH 3TBSB 1G7IA 2Q3AA 2H2SD 3WSQL 1OP5H 1TMCB 3V52L 2B0SH 1NCBL 3H9SD 3FOMB 1UM6L 3IFNH 1LD9B 3MR9B 2XPGB 5CSBA 5EOQH 2R9HD 4LAQL 5K9KB 5EO1B 1HH9B 4Y4FA 3SBWA 3MLYH 2WNGA 1MFCH 5DQDH 3O4LA 3MLTB 1CLZH 3WNOA 5C3TA 1QSFD 4KI5C 1QLRB 3EYFA 3OJMB 1F90L 4Q74A 3ULUH 1PDKA 4YR6A 2IJ0C 5IMLA 3V2AR 1ZLVH 3NFSL 3R1GH 2DQUL 4M48L 2VL4A 4CJ1A 3UTOA 4LOUC 4ZO8A 3WCYA 4GKNA 4ONGH 4XZUA 1UB5A 3I02A 1M7DB 3VXUB 3NABL 4LASH 1AY1H 2ZUYA 3MRFB 4NNYA 4AENA 2A6DA 2PO6B 4QYOA 1JUFA 4UT9L 1OAQH 3FFCD 3MRBB 1LO3H 4WWKC 2CKBL 1CGSL 3ARFD 4LCUB 1J0JA 5F6HJ 1K2DB 3FO9A 2JB6A 4HFWB 2IH1B 2GFBB 1NCNA 3GIVB 1S7TB 5D7LA 1A3RL 7FABL 4NHCL 1F58L 1TXKA 1KPRB 3C09C 1G7MA 4OF8A 4R6UA 3WJJA 3WO4B 1OQXA 4JZNA 3BGMB 3QDJA 4XVSH 2ZNXA 5SX5H 3SKMA 1KTLA 1MHCB 2R0ZL 1U8PA 1KFAL 5C0JB 2YK1L 3RY4A 1BZ7A 3W5MA 4XCCL 1CXIA 2DMCA 4MD4A 4MCZA 1R0AH 3I84A 4S0TD 5KVDH 4I9WE 3CFDA 1IAIH 4OM1L 1MQ8A 2NW3B 3VWKD 3ARGC 2X42A 2CLRA 1IAOB 4TN9A 1YEHL 3MRMB 3X3FH 3GJEB 3NTCH 2QADD 3C60C 1FPTH 4JY5H 4HZAA 1ACYL 4NYLB 1CGVA 3QIUB 3MZGB 5E2WL 3DIFB 5CZXC 1NPUA 2NY5L 1MI5E 2ICCA 1KC5L 1KIRB 2ZSWB 2OBGA 1F4XL 2QQLL 1MCOH 2ZUSA 3BAEH 12E8H 4NN5B 1D5IL 4XAKD 3PE9A 2KL6A 3FJTA 2ORBH 1BVKA 4NUGH 3IFLL 3WFEL 5I1GH 5J9PA 2Z4QB 4R96B 2AJUL 2FL5A 3KLAA 4OF3A 1DFBH 4EIGB 5DO2D 5IFHH 2PF6A 2I24N 3BQUC 4IEFB 3H3KA 1SYSA 3JVGC 3FQWB 4LDOB 1EHLH 1MNUH 3C8KB 3V6ZA 1N6VA 1FFPA 5TE6L 1P5VA 4TNWK 1WCBB 3BN9D 5IBTH 3E6FA 4UILH 2HMIC 4JKMA 3PGFL 4M1CC 3UPCA 3VFVA 3VXUD 3QIBC 3KJ6H 3ZHDA 3UAJD 3K2UH 3IT8D 4ODXB 3MBXH 2PO6D 4EUPA 1YPZA 4JM4L 1FV1B 3IDGA 1ZLSL 3J8F7 4OZHA 3ARQA 1QA9A 5EU3B 2P7TA 4YDIH 1ADQL 5L9DL 1P7QB 5HDQL 2V2WA 1NDGA 4OKDA 1FZOB 2P5WB 5J13B 1N2RA 4C56A 3HZYA 2I26N 3AC0A 3RWEB 1NGZA 4I3SH 1EFXA 1KG0A 1XMWA 2ARJB 4QRRE 4OIBA 1A1OA 4O2EB 5FA4B 2V6HA 3K4AA 2NW2A 4P4RA 3QYCA 5LGHH 3L95B 1IGML 1K8DB 5FYJE 2AJYH 3MV8B 3UTQB 3RDTB 3QRGH 3BDYL 2WAHA 5I1DB 3LS4L 2AJSH 3TEUA 3OX8B 4L1DA 5IEHA 1YEFH 4B7LA 4RQQB 2GHWB 2BX5A 4OF5A 2FX7L 3SE8H 4IHOB 3QI9C 4PJ7B 4D0CA 1RURH 1C1EH 4HKBA 2XIDA 5F71A 5JPNB 2H8PA 1KJ2B 1IAII 1KIPA 3MA9L 1NFDE 1FQ9C 2A77L 4PS4L 5DQ9A 3BD4A 5ESVA 1U8OB 1J05A 5JW3L 4HEPG 3OKYA 1P1ZA 3QIUD 2DQGH 5KS9E 2X4UB 2A6KA 3WIIL 2VLME 1J1XL 2OR8A 3MUHL 3X3GH 5C0GB 5MI0B 3BZ4A 5ID0A 3RNQA 4YUEH 3LQAH 1QACA 5GGTL 5HGAB 2E8YA 5DMKA 3B5HA 3RZCA 3LKSB 2HFGH 4LKCB 4L4VE 1BJ8A 4OZIF 2GQHA 5E1AA 1FH5L 3RVWD 2B2XH 3I9GH 4XB8A 3MBEB 3ALXA 4ELMB 1S9WB 2ZSVB 3MUGA 4UTAL 4WTZG 1ZS8A 2NY5C 5E4EC 2X1XR 3NIFF 1UH3A 1HI6B 5AG9A 1NLDL 1CF8L 2VQ1B 4EI5A 1A6UL 3QQ4B 5C6WH 5T3XL 4BSVB 1I75A 2GTZB 1OGAA 3IJYA 5I66A 2NXZB 2FATL 2AJXH 5FHBH 2Z93A 1BBJB 1UJ3A 4Z7WB 5I8EA 2NQCA 3TN0B 3QB7C 1MCHA 1JGUH 3OAZK 3BZEA 1P7QD 2UWEF 5EC1B 4FQLH 3VFNA 1VGEL 1W72A 4RMQA 5FUCE 1V3MA 4U6HA 3BKYH 2P5WD 3BZDA 1F3JA 1SMAA 4YDJA 3JTSA 3MROB 3L5IA 3BPOB 2XWTB 3M1BA 2ZUWA 2AJZA 5GRVK 4FQXB 4DUWA 5DEGA 3H3BC 4NO0B 5DJCB 1JNHB 3NA9L 5EO0B 3MV8D 4Y4KB 4KZEH 5IMOB 4F9PA 3GSXA 5IM7B 1C12B 3STLB 1F8TL 4FG6D 2CIKA 4FMFA 1DQDL 2DIAA 4OQTA 3G6JB 2X7LA 4N5UA 4BYHA 5E8OB 3EYUL 4FQPA 1PKQE 3UO1H 4G7YL 2VAAB 4NZUH 5DJDB 4P2OC 3DTXA 1SM3L 3HHRB 4GO6B 4MNQE 2BP3A 3MLWL 4HQQH 4N0FA 4U1GB 3JWOL 4Y5YC 3OKEB 2OK0H 2R2BA 3GNMH 4JZJB 1DQMH 2R0LH 1LP9B 1QFUL 1NBZB 1MCDA 5F97E 5HGGS 4ZUSA 4B50A 2WW8A 3FB7A 3UC0H 3WV0A 1YC7A 1S8DA 1IE5A 1NEZG 4RMTA 2GCYA 1FJ1B 4KK6D 4UNVA 5C6TL 5SWSA 4KVCH 4OSUL 5KOMC 3O41B 1FGNH 4R2GB 2R4RL 3GBNH 3VXOB 3MBED 5JQHC 4CU8A 1MAML 1QNZL 2LABA 1FFOB 1Z9OA 4H20H 4N8VB 4KAQH 4Y4HA 4TSCH 3O3BA 4K3EL 1ZGLP 1JGDA 4DAGL 4U7KA 2FJFA 2D9CA 2LVCA 4PRAA 2BSSB 4L3EE 2GJ6B 3SDXE 4U1JA 5IHLB 1XR9B 2YPVH 2KDGA 2ZOKA 5C0AE 1GZQA 1E6JH 4HT1L 4PYGA 4LARH 4JRXB 3P2TA 1FGVH 4LLWB 3TWCL 1ZXQA 5JXEA 4TUOA 5D5MB 4PY8I 4NM4L 2NXZD 4ORZC 2DWEB 5CSGA 4JDTL 3H7BB 5I19L 3PWJA 3QEHB 1YEGL 3SGDH 3PGDB 3TN0D 4EZMA 5HHOE 2ZPKL 4XH2A 2D3VA 2G9HA 5C07A 3F6LA 2IANE 2WIIB 1GPOH 3MLZL 4PJBE 5HGHA 2CXGA 2HFTA 3MLSL 4PJ5E 3PABA 3O3DA 4APQB 1BM3H 3ZE0F 3SE4C 1SJEA 1RIHH 1NUGA 2Q76A 3QXDB 4X9GA 2AVGA 1I9EA 2HFEA 1R5IB 1S9XB 1EX0A 3CFCH 4TTDC 3KPMB 1CXLA 4FQXD 4O02H 4JLRA 3UBXA 1CE6B 4NO0D 5EULV 4C83A 3CFEA 4NKMA 4G8EA 4Y4KD 4JM2C 3WUWB 1FFNA 5HVHC 3BD3A 4Z7QF 4MJ6B 1IAKA 3KR3H 4ZOCA 3GMPA 3V5HA 5FOBB 3CXHK 4QWWC 5CEYB 4KK5C 5DYOB 3RWFA 4LEOB 2NY2B 2VL5B 3Q5YA 1HSBB 2VLKE 1UKTA 1YEKH 4KI1A 2GJZB 3DX6A 1JGVH 4GRMB 3ARBC 3G5VA 3O9WB 4KDWA 5J3HD 4S1DD 5IWLC 4Z7UB 2E6JA 2RFXB 5B39B 1II4E 2NX5A 3FZUD 2EIDA 5IJVB 3SE3C 3VCLB 2BRRH 1CDCA 4HCRL 1QO3A 3JWOC 1QTYT 3H3PH 2Q6WB 2NTFA 4D2NA 4R2GD 3IRZA 2ITCA 3GSVA 3SOBH 2XV6B 4XPAH 1WCQA 2DQHH 3B43A 4MD0A 5DJ6A 4QHKI 5HHPB 4IRJC 4XNXH 3GIZH 3THML 3VFUB 1CQYA 4KKBD 3IS1X 3ZSSA 1U41A 3P4MA 1KT2B 5D2NE 2GJ6D 1P53A 3FQXA 4GAGL 3MRLB 4U05A 2MOVA 5KOVC 1CQKA 1EHAA 4JRXD 4PJGE 3H9SA 3MNVB 1YEIL 5JR1H 3MNWA 1S5IL 2ESVE 1ND0B 3T0EC 2CH8A 1Z3GH 3G08B 1PG7L 1TETH 3ZO0A 4QHLB 3S3JA 4HH8A 1MFBH 1QSFA 4FZEH 4OAWB 1DDHB 4D9LH 4PJIE 2ZNWA 5I1KL 1D6VH 3QO1B 2EIZB 3SGDI 3ULVD 5AWNL 4XBEL 5F7EL 2K1MA 4PGDA 1Z2KA 1X5AA 3WIFA 3RGVB 3PL6B 1EFQA 3W81A 3SCMB 4APQD 5CEXB 3BKMH 2CLZB 1JN6B 2DIJA 1QLEH 4NRXA 3NCYP 2W60B 5CP7A 5LCVL 4PGEA 2H6PB 4E42A 3N1PC 5GS1C 1AE6L 3RU8H 5T3ZL 2VXVL 5HI4C 2WWMD 1A6PA 2AAVA 3QEUB 4IIQB 4U31A 1IGIL 3FFCA 2BHUA 1MY5A 2EECA 4X0KB 1U8MA 1UACL 4YAQA 3ARFA 3IF1B 5E2TL 1JTOA 3RPIA 4RMVA 2WWKO 5F89A 2YPLB 3BH9B 7CGTA 3WYRA 3FQTA 1DANT 1H5BA 4JG0L 3E8UL 3WFDH 4HXBH 4ZDHB 4WNQB 3MODL 4CDGC 3F5WB 1FAIL 3F7YA 3VDCA 5BZDA 2NY2D 2HLFC 5JOPE 3DUSA 1E4JA 5TH2B 4X8JA 4YHYB 4K3JH 2DD8H 3O9WD 3DROB 2P42B 4J23A 4JFQB 2X4QB 3HLAB 4LQFL 2JELL 4OCSH 4PBXA 2HAZA 3L7EB 1E4WH 3DSFL 5JUEL 4XVJL 4LVHC 4PP2A 3K8KA 3VG0L 3VWKA 4FFYL 5MEQB 1AGFA 1QD0A 2IPKA 4ZODA 4OV5A 4OTXH 4RX4A 1JRHH 5CCKH 5DJYA 1ERNA 2X44D 4MNGA 4IOFD 3VGEA 4OBRA 4Z77B 1N7ML 1F4WL 3LEVL 1ZANH 2FWOB 5E24E 3BJ91 5B38B 3OB8A 3TBSA 4QNPE 1U58B 4MJIE 5F9JB 5JOEA 4UAOB 1EEUA 1S7QB 1KGCE 4Z0BH 3O3UN 1GC1H 1ACZA 3TVMB 4C59B 4X9HA 3FOMA 3HE6C 1LD9A 3MR9A 2MPAL 1JF1B 2XPGA 3ZYOA 4TPRH 5DUMH 5TFSH 5K9KA 4FXKB 5EO1A 1HH9A 3BD5A 2XRAL 4NBZB 3MLTA 4XWOD 1YEDB 3CMOL 1QLRA 3UROR 2HWZL 3LD8C 2X1WL 1YECL 2XOTA 3WL9B 3RGVD 3QNZB 3SCMD 3KLHC 1WISA 3TJEH 2P8MB 2Y9RT 1M7DA 3VXUA 4XVTH 3WDHA 2CRMA 3MRFA 1AGBB 1OL0A 1AQDB 2PO6A 4F8QA 4N1EA 4Z6AT 5DMYA 1U3JA 5GSRB 2WMPA 4LCUA 1T80A 1K2DA 1Q9LB 2FHBA 3HKFA 2N4IA 3IRPX 2EC8A 3OQ3B 1CGXA 4HFWA 2IH1A 2GFBA 3GIVA 2D7PA 3U2SB 3U7YH 4Q9RL 1S7TA 4PREB 5HYEA 5DK0B 2PNDA 3QULA 3WN5C 2GW5A 3Q6GL 4HS6B 1V3JA 4O58H 3MUY1 3M07A 3VGAC 5BQ7B 5I9QC 4MAYC 1KPRA 5ALBL 4Z7VF 1D6EB 2VDKL 3BGMA 1MHCA 3OKNB 3T0BA 4JO4L 5E6IB 2XG4A 4JGJA 5C0JA 3MOQA 3EOAB 2VAJA 1JZ8A 2XZCL 1NL0H 4FFZH 5F21B 5GRWA 2NW3A 3QCVH 4OLXL 2G5BB 1IAOA 4NWUH 3MRMA 3GJEA 3IU4L 4TNWF 4M3KB 4XPGH 2F58L 2AABL 3L3GB 5D96C 4WV1C 1VA9A 1JRHI 4MJ5B 4NYLA 3S36H 1TNNA 3QIUA 4HPYH 4F58L 2DKMA 3DIFA 1YJDL 4JR9L 1KIRA 2ZSWA 4OIAA 1UKQA 5F1KC 4Z7NE 3TVMD 4LRNH 1TTFA 1BD2B 4LSPL 5GJSL 5DRNB 4DOHB 2Z4QA 4R96A 2E7HA 2AGJH 3QUXC 4UV4H 4L8SC 3KYNB 4ENED 3P9MB 5JQ6H 1TQCC 2H3NB 3TYFB 2DLGA 3EDKA 5F9WC 1KB5B 4WGVB 2C4XA 4LU5H 3FQWA 3RVVD 3C8KA 1UZ6F 3H0TB 4A6YL 1KEML 3OR6B 3D9AH 4YHMH 1WCBA 2ADFH 4L1HA 3QG6A 1ZA3B 5J12C 5EU5B 3SDAB 2LQRA 4IOIB 4ODXA 1FL3B 2CO7B 3HI1B 4LPXA 1FV1A 4YHOL 1OM3H 4GXVH 1M7IB 3GB7B 1JPGB 1Z9LA 3DURB 5J06A 1YDPB 2RHEA 4YHNB 5EU3A 1P7QA 3WE6B 5HYFA 2OTWB 4XPTH 4OGYH 5MP6L 1OVZA 1RAMA 2ICWJ 1FZOA 2P5WA 4ODTL 1QBAA 3VI3E 4NZTL 4WW2B 3O2DH 3VMOA 2ZOLB 2VC2H 3RWEA 1Q94B 1R3JB 3O6ML 2ARJA 4LVEA 4P49A 5FGRA 5FA4A 5I71B 2NZ9D 1T7WA 3L95A 1GOHA 1K8DA 3VXSD 1BQHB 4PJXE 5E6ID 3MV8A 3UTQA 3OBAA 3RDTA 1CTOA 4H88H 2EH8L 5I1DA 3OX8A 4FFVD 2N7AA 3BIKB 2Z91B 1MAJA 5JZ7C 4RQQA 4IHOA 2Y6SC 4LPYA 2B0SL 3D39B 4PJ7A 1EDQA 1WF5A 3IFNL 4LDEB 5JPNA 5HPOA 1KJ2A 3UJTH 2L4OA 3RUGF 4PJAB 1Q9OB 2Z8RA 2KZ1B 1U8OA 2K3TA 3DV6B 1NFKA 1HHJB 4HW6A 2X4UA 3PWUB 1FYTB 3ULUL 5DJAB 5C0GA 3MJ9L 4LCIH 4NM8L 4JFHE 1GH7A 5HGAA 3HNTL 1DP0A 1BWWA 3LKSA 3QXTA 5ICZB 4ONGL 3A6CH 4LKCA 4X6CF 3IETB 1BD2D 4ZO9A 3UMTA 4RMWA 3EYOB 5TF1H 4K7PY 2HT4C 3MBEA 5DRXB 4ELMA 1OAQL 1S9WA 2ZSVA 3B9KB 4FFWD 1LO3L 1HYRC 4HAGA 4RRPA 1FDLH 4X83A 5FYKD 3S7GA 1NCDH 3HUJF 1HI6A 2M2DA 3CDFA 2BDNL 1G7PB 4ZOEA 4HLZG 1JP5A 1X4XA 3GBMH 2VQ1A 1ZKAA 2D4DA 3QQ4A 4BSVA 4DGVH 2XFXB 2VZ3A 2GTZA 2QBWA 1BBJA 5JIHA 4Z7WA 5GS0C 4NUJB 3MUJA 1U9KA 4WCYH 3ZDZF 3MRIB 4U6YB 4XPFH 3TN0A 1KIUA 1F4HA 4XXDB 5D6DA 5GGRY 5FK9B 5BV7H 4P57B 5EC1A 1YA5A 4MS8C 3G5XB 3QSKB 4M7JH 5CJOH 2LAGB 1NMAH 5FEBA 1R0AL 1JBJA 5KVDL 4HK0B 5C0IB 1IAIL 1WC7B 2YWYA 3MROA 3WNNA 2OP4L 4WO4B 1Q0YH 4YHIB 2XWTA 1YMHB 4H25B 3X3FL 1DSFH 3NTCL 2Z31C 4MZ2A 5BS0B 4XBPB 3CX2A 4FQXA 1FPTL 1OTTC 4JY5L 1CE1H 3T04D 4YBLB 4NO0A 5DJCA 1E0OB 1I1CA 1JNHA 4NKDB 4Z8FH 1XH3B 4MA1C 5EO0A 3PDGA 4Y4KA 2D4FA 2BY2A 5IMOA 2YD2A 5IM7A 3BVNB 4S1SH 5FKAB 1C12A 3STLA 5E2VH 1TJIL 3N85H 3INUL 2NR6C 3G6JA 4HFUL 5E8OA 3D39D 2VAAA 2KKQA 3MRDB 5DJDA 3BMVA 2ORBL 4NUGL 5I1GL 3O6FA 3PHQB 4Y5XC 2P24B 1HXMB 4FZ8H 4M7ZC 1DFBL 4K7PH 4IRSB 3OKEA 4JZJA 1ZV5A 4HPOH 4NOFA 5J1AB 3PP3K 1NBZA 2IBGA 4JHWL 1FYTD 4PJHE 3M8OH 1EHLL 1MNUL 2C1OB 3KPSE 4R97C 1CGWA 1TLKA 1FJ1A 1NCUA 3SDCB 5IBTL 1JPTH 3RWJB 1P9MA 1XF4B 1GOGA 4MQTB 1OTUD 3O41A 1UXSB 2CGRH 3O2WL 2Y7QB 3VXOA 3CC5B 3MBXL 5LGKA 1FFOA 4N8VA 3B9KD 5C0BB 2FH6A 3ULUC 5DVKA 4JQIH 1IC7L 1MF2H 2BSSA 4X9IA 1OGTB 2GJ6A 4HAFA 1XR9A 1A7QH 2E7CA 4QT5B 1JNJA 4JRXA 4LLWA 1CU4H 4G3YL 5D5MA 4LLDB 1K6QH 2DWEA 4MYWB 4I3SL 3BX7C 1C7TA 4KJWC 1AC6A 3QEHA 2QQQA 5KZCB 3S34H 3PGDA 5C0RH 2AJYL 2ZG1A 5DRWB 4PJFF 2RB8A 2WIIA 4L29B 4U1MB 3U4AA 4BUGA 2AJSL 4LSTH 1YEFL 1X4ZA 1YQVH 4APQA 4XP5H 3ILQC 1QVOB 3SE8L 1X5IA 2AXGB 1U93B 4WO4D 3QXDA 4OZGB 1C7SA 1WZKA 4DKEH 3KJ4B 1R5IA 1S9XA 1NGYB 2B1HH 2Y36L 3O4LE 5KVFL 3DETC 3KPMA 5D1XC 5BS0D 5C0NC 4FQ2H 5T3XE 3NBNA 1CE6A 2NYYD 3CH1B 5EG6C 3HFMH 3VH8B 4NWTL 5D7KE 3WUWA 2DQGL 2EDNA 4DN3L 2MHAB 4M93B 4MJ6A 4P46C 3X3GL 5DD1H 5B8CC 3LQAL 5FOBA 1SHMA 3EAKA 2HFGL 5CEYA 5DYOA 4CN6A 3KS0H 1HSBA 5FO9B 5K9JH 4FP8L 2F53B 6CGTA 2GJZA 5F93C 4GRMA 3O9WA 4L4TD 4IRSD 1MOEA 4YDLB 5GRXG 4O4YH 1WSST 2DIBA 4Z7UA 5B4MC 4XMPH 2RFXA 2L0DA 2WWKT 4YFEA 4K2UH 2MQ0A 5B39A 4XNZB 1JNNH 2EYRB 5B22A 4CN1A 1I9RH 5ACMA 1TJHH 5IJVA 3VCLA 4A2LA 5L0QC 1VEMA 3SDCD 1J9CT 1NAMB 2PTTB 5FOJA 4ZQKB 3MLRH 2Q6WA 4QCIB 5DJ2B 4QXTB 2AJXL 5FHBL 3QDJE 4NQEB 3SGKC 1U0QA 3IJHB 2LTQB 1T6WA 5HHPA 1CFNB 5C0BD 3VFUA 5HYJB 3D18B 35C8H 2UUDH 3RL1B 1JGUL 1KT2A 1GAFH 2BJMH 3EDEA 1B0GB 2EE2A 3MRLA 4P3CH 5GS3A 2ZZUT 1JYWA 3MNVA 1HIMH 1CWVA 1ND0A 1A7BA 5TDNB 3ZT6A 1KN2L 3G08A 1KLGB 3O6KH 4Q2ZB 1MI5B 4QHLA 3LHPH 4KRPC 2AXJA 3ARPA 2VXUH 4GRLB 4OAWA 3OAUH 1DDHA 3DX9B 3OZ9H 3CZFB 3QDAA 4TUKH 3VFMB 3QO1A 2EIZA 4I77H 4KZEL 4YIQB 5IQ7H 4NSKB 3RGVA 4X6CB 1FORH 3PL6A 2RQ8A 2HG5B 5CEXA 2CLZA 1JN6A 4NIKB 1MHPH 2ZP0T 4R4FH 1TZIA 5CHNB 1IQDB 2W60A 3UO1L 4NZUL 2DICA 3D25B 2EIEA 2H6PA 2Z92B 2FCBA 3ZE2F 3SO5A 3QEUA 4IIQA 2VZ1A 3HUJB 4NQCB 1S7VB 3NCYS 5GGUB 1V7MH 4X4ZA 4X0KA 4M6ML 4EN3B 5I18H 2OK0L 3IF1A 3S4SB 2H41A 3V4VL 3GNML 1DQML 5DHVB 1QOKA 3NPSB 2OXHA 2YPLA 3BH9A 3QJHB 1NEUA 3QUML 4XNUL 3S8WA 3FMGH 4ZDHA 4WNQA 4IMLB 2WBKA 3F5WA 4KVCL 1UCBH 1FGNL 1YPZE 4OT1H 2YA1A 5TH2A 4WI2A 1VCAA 2F53D 3C2AL 3TO2B 4ETYA 4S1RH 3GKZA 3DROA 3P73B 4JFQA 1CFVH 2X4QA 3HLAA 3ZTNH 1B3JA 5AG8A 3LQAC 3L7EA 2EIBA 1HKLH 3HRZB 4E5XB 3Q5TA 4DGYH 4P9HH 4PJ8C 4OZFG 4HKZB 5KSBB 3MV11 2X41A 3RVUD 3PIQB 2SEBB 5MEQA 1CYGA 3Q5OA 4X4YB 4E9LA 4N9OB 2B5IB 5DHVH 3MCKB 3T0DA 1CGUA 4NQED 2Z9TA 3GK8H 2BNQB 1I1AB 4I9WD 4Z77A 3GJFK 4NO5B 3C5JB 4MXQC 1KJVB 2VXSH 5HYJD 2F74B 4JQXA 4JB9L 2FWOA 3LN4B 1N59B 5B38A 5A3ID 1U58A 3MUZ1 5F9JA 5BMFH 1CXFA 4ZFOB 5C08B 4Q9QH 1KPVB 1S7QA 3RIAK 2R69H 3CXDH 1A1NB 3BKJL 3LH2L 4OD1L 4UQ3B 4DUXA 3UPRB 1BM3L 3TO4B 3TVMA 1RIHL 1NCWH 2P44B 2A9NL 1JF1A 4JFFB 4FXKA 3TJHD 2X05A 1JZ6A 1MI5D 1D5BB 4O02L 4WFHE 4MLIA 4NC1C 3OR7B 4GRLD 1YEDA 5E0QA 2QSTA 1CFSB 4QKXB 1AXTH 5E1HB 4LSRH 1A5FH 4QOKB 3QRFM 5I74C 3BI9X 3WL9A 3QNZA 4YE4H 3KR3L 3LDBC 2FEEI 4HLJA 4G6KH 5KW9H 1XF5B 5FXCH 1O0VA 4L9LB 5KSVB 1BJ1H 2P8MA 1JYXA 3CUPB 3EYQC 3OL2A 3P0GB 1AGBA 4MDIB 1AQDA 4NQCD 2OLDA 1YEKL 1JYVA 5EPMB 2E6QA 4OZ4B 1CIDA 1JGVL 2X4RB 3S9DB 5D7IF 5GSRA 4EN3D 3ALWA 1JE6A 3NGBB 3RKDD 1Q9LA 4HUXB 4POYA 4OCMC 2DI7A 3T2NH 1MY7A 4DWHA 2HRPH 4AG4L 3C08L 2XTJC 4HGMA 3U2SA 5HDBE 3LEXB 4PREA 4X98B 2MCPH 5DK0A 1TVHB 1IM9B 3VA6A 1S78D 4MJ2A 4HS6A 5TE7H 3H3PL 5BQ7A 2NY1B 3O2VH 2BFVH 3T77B 1RK0B 5IW1B 1D6EA 2JJVA 5AAMA 5GQBA 1A7NH 2R4SH 5FYKU 4LRIC 1JL8A 3OXSB 4M1GL 3OKNA 4JJHA 3GIZL 3CSBA 4G8IB 5E6IA 5T3ZE 3V6OE 3S37X 1BFOB 1BVLB 3EOAA 5DMIH 2MQCA 4YH6A 1U2HA 4XX1E 4HZLB 2EXYD 1PGRB 3CFKB 5JR1L 5FYJD 2G5BA 1H8SA 1O7VA 1D5MB 2VNCA 2DQDH 3EHBD 4I18B 1TETL 2BNQD 3T4YB 3L3GA 1I1AD 1MFBL 4U33A 1HH6B 4MJ5A 2XKSA 5TJWK 1B4RA 1D6VL 3EZ8A 3U83A 3AM8A 2CSPA 1G7QB 4NN6B 3BJLA 4G8GE 3ZKSD 1KEGH 1M7XA 5CJ5A 3S5LG 4WUKH 1WV7T 5C08D 4HF5L 5IT2H 3BKML 1SBSL 4Y16B 4YK4B 3TO4D 1QLEL 4L4JA 1AIFB 1BD2A 1CICB 1MRFL 3VFTB 3VFWB 1NJ9B 4G7VH 5DRNA 1KF9B 4JFFD 3RU8L 4GKZB 4QXUH 2DQCH 2FJHB 4QHNB 5BOZG 3N9GH 1AHWB 2HT2C 3KYNA 1EO7A 1XCQB 5D7JB 3P9MA 4XC3L 2H3NA 3TYFA 3VMNA 1A7PH 5IR1B 1KB5A 4OM0H 4KQ4H 4AEEA 4QOKD 1YNKH 1C5BH 1F3DH 3K4ZA 3H0TA 4Y5VB 4D9QE 3OR6A 5DVMA 5DMGD 3WFDL 5SWSE 3LEYH 1OSPL 1G7JB 4X6EB 4LLQB 1ZA3A 3QUYC 3OB0H 5EU5A 3SDAA 4BUHA 4HD9A 4IOIA 4L3EB 1FL3A 4OF7A 3HI1A 1WWCA 2J6EH 1B2WH 2FGZA 4DVRH 3NFPB 1M7IA 4K3JL 3GB7A 1JHLH 1JPGA 3DURA 3R8BB 1YDPA 4YHNA 4HDIB 1Z6JT 3WE6A 2OTWA 3AGVA 5CGTA 1E4WL 4HBCH 1BBDH 3D87B 2GUOB 4K8RD 1KENH 3G04B 3VD4A 3F12B 4WW2A 1MAKA 2ZOLA 3KGRA 4OTXL 5I1LB 2HVKB 1Q94A 2NY1D 5LVEA 1VDGA 1R3JA 5CCKL 4R3SB 3A67H 4N0UB 5GPRA 1LO4H 5C2BH 1BQHA 1AGCB 5BRZB 4KUCD 5BO1H 2EEBA 2Z91A 3GDBA 2JKXA 4LQ1A 1WT5C 5D93B 4WFEE 4JO2H 4Z0BL 1XF1A 2R56H 1GC1L 3O8XB 2EKSB 3D39A 4X7DC 2IG2H 4LEXL 4FTVB 5FGBA 1WBYB 4TPRL 5DUML 5TFSL 3EYSH 1AP2B 4PJEF 4PJAA 4UDUB 3UJIH 1AR1D 1Q9OA 3DI3B 3S98A 3HE7B 4RWYH 5IVXB 1SY6A 1JPSH 3DV6A 1HHJA 2VUYA 4AMKL 1RK1B 3PWUA 1FYTA 5F7YC 1FNFA 5DJAA 1V3LA 3NPZB 2DQFB 2ZUUA 4JDVB 4GAFB 3NCCB 5CD5C 4F15B 4Y16D 5ICZA 2VDQH 3CVIH 3IETA 1CICD 4NNPH 4PB0H 3EYOA 5GSVB 4KK9D 4XVTL 5EBWB 1XGYL 1WAAF 3ARTA 4WTZA 5DRXA 2H32B 1YNTB 3U0WH 3B9KA 1KELL 5D7JD 4CAGA 2P1YA 1JWSB 4U6XB 4LP4A 2O5YH 2E6PA 2MMXA 2NX5E 3AMKA 5C71A 4KV5F 1G7PA 1DZBA 3S37L 5HGDB 4UBDC 4U7SA 3RWDB 1U3HB 3U7YL 5KTEL 1AGEB 3FT4B 5HD8C 4WFGD 2XFXA 2FX9H 3O4OB 2YUZA 4O58L 1FCGA 4L3ED 5DT1L 3WJJC 2X1QA 4NUJA 4LDLB 1CD0A 5CJXC 3MRIA 3TA3C 4U6YA 4XPHH 1J8HB 4PRHB 4XXDA 2EYTB 2X4SB 5FK9A 3GMLB 2D03H 2AEPL 4P57A 4JFEB 2VDRH 3G5XA 4FFZL 4QHMB 3VRIB 6FABL 5JMRA 3H9SE 4HK0A 2DQJH 2H32H 5C0IA 1JV5B 4H1LB 1WC7A 3QCVL 1J8KA 4WO4A 5HHOD 1H3GA 4YHIA 1I85A 1YMHA 4H25A 4NWUL 4HLZH 5JO5B 1V05A 5BS0A 1K3IA 4XBPA 1QSFE 3IDNB 1MIMH 4I2XB 1W8OA 1E4KC 1MHEB 4NKDA 1XH3A 1LILA 3S36L 4GS7B 4ZYKB 2IAMB 5BRZD 5HYSB 1YY9D 3UPAA 3QXVA 2DLEA 5EIIB 3BVNA 5FKAA 1YEEH 2AEQH 3HI6L 3T4AB 3O8XD 1GHFH 3HZVB 3MRDA 1SEBB 2XZAH 4FTVD 4I0KA 5D6CB 2CMRH 2JK5B 3S88H 1D9KB 5D7IB 3PHQA 2AGJL 5K59F 1MCBA 3FFCE 2P24A 1U8NA 1HXMA 4NNXB 4UV4L 1ZTXL 3HE7D 3JV5A 4QRTB 4IRSA 5JQ6L 1W0VB 3O3AB 1QRNE 4HMCA 2WBJC 1AC0A 1RUQH 5J1AA 4NCDA 4U49A 1VEOA 2C1OA 3BKCL 1GCFA 3D9AL 4YHML 4M4PA 3SDCA 2ADFL 3ZMRA 3RWJA 3VXRE 5JNYB 1AO7B 4AL8H 1XF4A 1UXSA 4YBQD 2F19H 1CLCA 1ZHBB 2Y7QA 3CC5A 2NY6C 4U0RC 1HWHB 2M26A 3G6AB 5A2IH 5C0BA 4YBHA 2V5TA 2MQ3A 1UG9A 5CILH 5FUZH 1UM4L 1OGTA 3HC4L 4NQTA 5J1SC 4X6DF 5F1SA 4AQ1B 3VGDA 2DQEL 4KPHH 5DJ8B 4QT5A 1U3HD 5T1DH 4XC1H 4ZFGH 4GT7A 2ZUQC 4LLDA 3O2DL 4YZFE 4C58B 2VC2L 3MRKB 4MNGE 1A6ZB 1FL6B 4BZYA 4XI5D 1J8HD 1OTSD 3RTQB 1F13A 4PRHD 5IMMB 5EBLB 5DRWA 2NXYB 4XNYH 4U1MA 4L29A 4JFED 5HI3D 4ZSOB 3MOBH 4UDTB 2AXGA 1U93A 1MPAH 1EO8H 4OZGA 4CMHC 4KC3B 1EUUA 4KUZH 1NGYA 5EOCL 4L3AA 3UJTL 4POZD 4TVPH 3CH1A 5CS7A 3VH8A 1JGEB 1VACB 4PB9H 1HHIB 4MB3A 2IAMD 1RD6A 3LS5H 1P7HL 4KZDH 3QJFB 1EGJH 1NUFA 2MHAA 1KLUB 4TQEL 4LCIL 4JQVA 3HMWH 3KNBB 4P5MB 5DVNA 4B7IA 2YN3A 2C3VB 3D48R 1H9VA 4WUUE 3VXUE 3A6CL 1CK0H 1G0XA 3HNVH 1NGQH 1JWMB 1D9KD 5ADOL 5FO9A 4YXKH 1N5AB 4MQSB 2F53A 4OCXL 4LPTA 3EJZC 1FNAA 4OV6F 2DN7A 1OT1A 1ULVA 2DM2A 4NFDA 1KSRA 1FDLL 4NZRH 4TSBH 2V5SA 4WWKB 1A8JH 1NCDL 1WBZB 4TVSa 4F37F 5JOPD 5IHBA 3QUZC 2EYRA 1B90A 2VKXA 3B2UD 1YMMB 3NVQA 4LKXB 2AJVH 1JWUB 4DGVL 1NAMA