5JA9A

Crystal structure of the higb2 toxin in complex with nb6
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSNYAMRWYRQAPGEEREFVAFISSVGGSTNYADSVKGRFTISRDNGKNTLYLQMNSLKPEDTAVYFCVARLSLISDSWGQGTQVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Toxin HigB-2
publication title Ribosome-dependent Vibrio cholerae mRNAse HigB2 is regulated by a beta-strand sliding mechanism.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ja9A00
1YUHA 2JCCF 2CIIB 4UBDC 2JCCE 4LGSB 1XCQB 4H25A 3GMLA 1B2WH 3QEGH 4FQJH 4C4KT 1T1YA 1A9BB 4TNVK 2BSRA 4GMSL 3HR5A 4F9PC 1OP9A 4MNQA 5C0DB 1XH3B 4G6ML 5GZOD 1FFQA 4JJHA 3B5TA 5D7LD 1N59A 1TTUA 3LHPH 2XXMB 12E8H 2ZCHH 5D7SL 2XICA 3E8UL 2WUCH 2LVEA 3C5SA 1A1OB 4XNUL 1O0VA 3WKNA 3CLEH 5JHDE 5J12B 4XB8A 3ZTNL 1FGNL 4LLYA 4KK6C 3QYCA 4H20H 3C60B 2JJVA 4N68A 4HV8B 2HVJB 5EORL 5IJKC 1AE6H 3DX9B 1S9VB 4L3CB 4NT6B 3IKCB 5DR5L 1BFTA 4D0BB 2BXYA 5HYJA 3IU4L 1CFQA 1T5WA 3B9VA 3N50A 4O2EB 1C12A 4YC2C 2AXGB 4NUJA 3S35L 2F58H 3I50H 3FB6A 1CZ8L 3IXAB 2NY4B 5BZWA 1ODAA 4DGYL 1A3RH 5I19H 1OPGH 1HYRC 2O5YL 2R0KH 4JFZH 4OLVL 5CD3A 4OLWH 4X7TB 2XPGB 2AKRB 3VCLB 1C5BH 2Q3ZA 4JPVL 1NBVL 2R2BA 3BXNA 1N0XL 3U4EB 1GGCH 1ZGLM 5IHUL 2OL3B 3HG1D 3ARED 3MBEB 2AW2A 3MX0A 5KOVC 2RBLA 3ULSA 3T2OA 3JWDC 1P84K 2GCYA 3TYGL 5E5MB 3IRZA 5EZIL 3MUHL 3D25B 4OCXH 1A0QL 3FKUS 3VD7A 3D18A 5HDLA 4ERSH 4LLDA 4H1LA 2GK0B 4U6HB 4F9LA 1YECL 5GHWH 4HKJB 4FQIH 2D31B 2AABL 4X80H 1KB5H 1OARL 5T1KA 5SWZB 4DKDC 3HMXL 1R5WB 3QIBC 2DYPB 5CILL 3WE6B 2CR3A 4WEUD 1QRNB 3CXHK 3TT3H 1GGUA 1PG7X 3B83A 5FUZH 4KMLB 2WP3T 3MNZA 3P4NA 4LHUG 2BSSA 1OP3K 4PRPB 3T0ED 1SYSA 5K93A 1WIUA 1RJYA 4YHOH 2YPVL 4S1RL 5IFJB 3MRFB 3VI4F 4P2RE 2P44B 2W0PA 3VI4E 3MRNB 2BNRB 5C07E 3RGVD 3NH7H 2GFBB 4KRPD 4W4NA 4C56A 1CXKA 5FYJD 1DBJH 1R3IH 3HNVL 1X5YA 3LVEA 4WI5A 1BOGA 1R3JB 3UXFA 4M93C 2QQKH 3BT2H 1LP9A 3P4OA 1J5OH 5GGUB 3TA3A 3JWOL 5GGRA 4JRYE 1TIUA 3CH1B 5I66B 5B3NA 4KKBC 3OKYA 1QLFA 1UWEH 3LRHA 3GJEB 3O8XA 5GRUH 4KK9D 3GBML 3FQRA 2AK1H 1G9MC 1A9BA 1EV2E 4XP1L 5CP7A 3CAFA 1MSPA 5C0DA 4NM8H 1I75A 1MPAL 1XH3A 5I9QB 4CJ0A 4Q2ZB 4IDJH 4IMKA 2AV1A 4KDVA 5E5UB 4JJ5A 2OI9C 4XVJL 5CZVL 4C55A 4FQHB 1YC7A 3VXMA 3I6GB 3GGWA 3ILPB 4IRJD 1XR8B 3C5JA 5EU7E 5JQ6H 4QY8A 1OTTC 1I7TB 3TO4A 1P7QA 3DX7A 1HHHB 3MRPA 1FNEA 3MJ6A 4F7MB 2FX7H 2XTJC 5EU7C 3HMXA 5FM5M 1FVCB 5D2NB 2BNQD 4ZOEA 2WWKO 1I4FB 3R1GH 3DX9A 3MV8D 4L3CA 4NT6A 3DVGB 3RVXC 4H88H 3WLBA 4QKXB 1RIUL 1MLBA 1EVUA 4O2EA 1U58A 2AXGA 4S2SB 1SJVA 2XI9A 3UC0L 5ITFA 3PGFH 4KMTL 4X6DA 1XF4A 1KPUA 1RULL 4O58L 2MSPA 2XPGA 3U0WL 2AKRA 3VCLA 4XHQA 4KROC 5CJQH 1GGIH 1WT5A 4NP4L 1GPOH 1WWBX 3RX8A 2P5WE 1FRGH 1UYWH 2ZKHH 5FYLE 5JO5B 1A6UH 3KPSE 4LQ1A 4NQDA 3SDYH 1OGAA 5KSBB 5E5MA 3O0RL 3D25A 5GS2D 1FL6B 1WICA 1JPSH 4CMHC 4PLNC 5HHMD 1S7VB 5EIQA 2ESVA 2GK0A 4U6HA 2G9HB 4C4KO 4GKOA 4PGZA 4YUEL 3RHWF 2R0WH 4HKJA 2Q87A 4ONHB 4XCNA 1JUFA 2ZUYA 1A3LL 2VO5A 3D39E 1AFVH 5E6IB 3QRGL 5I1IL 1RIHL 2A73B 1E6OL 1KEMH 3SDAB 2V5SA 4KV5F 4LARH 5E08L 4KV5E 2DYPA 2F53B 1XGYL 3DGGB 4I0PD 5TF1H 3CMOL 1A6TB 1X5IA 4IIQC 4P5MA 3WDIA 1WZMA 3NCJH 3MMEA 1AD9A 1Q9WA 4PJAB 2X7LB 5D93B 3KPRB 3MJGX 4LGRB 3MRFA 4GRWH 3AREC 2OP4L 5D6CB 5I75C 1ZT4A 2GFBA 5DQJB 4XP4L 2YBRA 3CXDH 4PP1D 1AO7D 2BY2A 5DTFB 1MUJB 2NY0B 3MRLB 1CL7I 2WV3A 3W2DL 1FPTL 1SJHB 4Q7DA 1IQWL 4WHYG 2QQNL 3LQAC 2WINB 5D1XD 4G6KH 3BZEB 5EU5B 2VQTA 2X9XA 1XF3B 2DRUA 3OHXA 4M1GL 3H9SD 1JNNL 5EU6E 4P9HC 4UT9L 3HI6L 2KZ1B 4G7VH 5DMIL 1DN2A 1OM3L 4UT6H 2ZJSH 3OQ3B 4FP8L 3UBXG 4EI6A 5ACLA 3U4BL 2ENYA 3HC3H 4F7TA 4KTEL 4LCUB 5IVZA 3T65B 4UV4L 4C58B 3T0EC 2YPLA 5DJ6A 2H2SC 2YC1B 2M8XA 4MJ2A 1J05A 1Z6JT 1VGKB 1RSFA 3GHBL 3ILPA 2VR9A 1A7PL 5KAQF 3JXAA 1HDMB 1Q0YL 3IXTA 1QRKA 1T4KB 3AVEA 2ATKB 3VXSB 2Z31D 3RGVC 2EDWA 1F6LL 1NCDL 1U6AL 3N85L 1CDIA 4KRPC 4XAKE 1BJ1J 5FO7B 4UAOC 3VGFA 4F7MA 3BP7B 4TTGA 1RZGB 3HMWH 1KCVH 1FNSH 3W39B 3QWQB 1EJOL 1T66D 4G43A 4P4RB 4HPOL 3TNNB 3CMGA 1ZKAA 3VFRA 3VGGA 4P9MH 2VSDA 3KLSA 1YEHL 2NY1B 4OZIB 3DVGA 2I60H 1OLLA 2WP3O 3TVMC 4HUUB 1S3KH 5I1DA 5DZLA 1A6PA 5TFSL 15C8L 4XC3L 3GSOB 4WGWB 5DJ2A 3BWAB 5FHAH 2VXTH 2J8OA 4NQEA 3U0PB 3CSPA 1DANU 3PGCA 3U82B 3QFDB 1NGQH 5TH2B 3KXFE 2BVQB 3VWJD 2WBJA 2NXZB 4JRXB 2BMKA 4GO6B 2XNAB 3G9AB 3CVIL 2GAZA 4OF0A 4PD4K 1CGVA 3PG2A 2AEIT 4P2CG 3DRQA 4KVCH 2J88H 1CFNA 1RUPH 4PJIA 5ACMA 5JO5A 5L6YH 2M2DA 4NKDB 1SVZA 1N6UA 4OCSL 2F8VA 3LSOB 4IRJC 3L9RA 1QOKA 4UV7H 4JQIL 2PCPA 2NR6D 2Z93A 4JO3L 2P8PA 4I3GA 2J5LC 4PRHD 4YWGL 1EFXD 1RI8A 3WEXB 5DFWH 4ONHA 4LCIH 3TBSA 4Y2DD 1AR1D 4XBPA 1LEKB 1Q9KB 3RWEB 5HVHC 4ZS7L 2A73A 5IVXF 1LEGA 2HG5B 3SDAA 4QWWC 4BSVA 4C54A 5IVXE 3IRPX 2DI8A 2GUOA 5DC4B 4R7DB 3VWKD 2BC4B 4PJGF 3DGGA 4M7LT 2GSGB 3MLVH 4YDLB 1JPTL 1F3RB 1T2QL 1XMWA 3WFEL 2R4SH 4WI2A 4XC1H 4G9FB 3NCYS 5C09A 5I8KL 1I8LC 2O61A 4OV5A 1D6EB 2ZSWB 3LN4A 5IJKA 4E41A 2IPUG 3QG6B 2AI0L 1T0NA 5DQJA 5I1LA 1OAKL 2NXYD 3ARZA 5DTFA 3MRLA 5A3ID 1WWWX 5K9QI 3BPOB 4PJBB 1FH5L 4GLRH 5GRJH 4WU7B 1QFWI 4OF3A 1IAIM 3FQNB 1W0WA 5EPMB 5GXBB 3P3YA 1XF3A 2DD8H 5CFHA 3NABL 1CFVH 5TDNB 1B9ZA 4XRCA 1C1EL 5DJYA 1G7HB 1KJVA 1IGMH 2FEEL 1A7BA 1G9ML 3L3OA 5DLMH 4I0PC 1A14L 1TVBB 3G6JF 5IR1B 3UEZA 3G6JE 4LCUA 5ECJE 5ITBL 1YEEL 5IBLD 1HOCA 4WHYH 5E4IA 3T4AA 1MCFA 3UO1L 4PJ7B 3I75A 1PYWB 1HDMA 5ETUA 2ATKA 3VXSA 1G9NH 3ROLA 4MQSB 5I74C 3S34L 1DVFD 4OSUL 4HKXB 3EYSL 3MNVA 2NTSP 5IF0A 4WW2B 5ALCH 3F5WB 5FO7A 4PP1C 1RZGA 3RZCB 1BM3H 4JM2D 4EDWL 2RFXB 3V9FA 5TPWH 1JNHB 2UZIH 1IL1B 1J1OL 4QHLA 5IIEA 4HQQL 4YIQA 2A74B 4DCQA 3T0VA 1N5AB 4Y4HD 5LQBL 4UOJA 3MLZH 2OS7A 4F3FB 3LKOA 5FCUL 1MAML 3C09C 1QSEA 2EKJA 3QFDA 4M7ZC 3MOAL 3F7RA 1EHNA 3PHQA 1FYHB 3UPCA 4JRXA 4ODSH 3VJ6B 4GOSA 5H94B 5GSVA 3U2SB 2C3WA 2XNAA 3F58H 1UA6L 4DUXA 2AQ3A 3D0LB 4PGCB 2UVFA 4NO0B 4QYOB 3G5VA 4MAUH 5HYQB 1Q9OB 1AY1H 5CZXC 2EDEA 3TFKD 1FZOA 3LSOA 3C8DA 5C7XH 1CDCA 3FO9B 3VGAC 2Z31C 4GKSB 4PLKD 3VRIA 3SDDC 3CDCA 5HGAA 2NY7L 5CEZH 3DXAB 1EEYA 4BKLB 2HKFH 1ZHBA 3WEXA 5J9PA 4JVUA 5KTEL 4YHYC 3M1BB 1LEKA 1UQSB 4X99B 5FK9A 4MHHI 1P4LB 3FO1B 1U8NB 2IQAA 3OKKB 1AD0A 1SM3L 4OD2A 2IBZY 4HBCL 3PL6B 4R7DA 2OTPA 4BFBD 3IS0X 2OXGA 4UQ2A 3DROB 3PWVB 4LSTH 2R2EB 2DQJH 5DJCA 3VWJC 2H41A 1DQML 4BQ8A 5C0EB 3B4NA 3TNMB 4XNXH 1EAPA 1CN4A 2BY3A 1S7RA 4G9FA 3CPLA 3SHSA 4R26L 2DB8A 5CZKA 2FJHA 2X4RA 3T8XA 3EFDL 2F19H 1T7YA 4D9QD 4TOYH 5E1AB 1FNGA 4XX1E 2CDFB 2CRIA 4NQXB 4JVWA 1ZA6B 1YY9C 5M94B 1FE8H 1FFNB 4NNPH 5KSAB 4WU7A 1Y18A 5E2VL 5LBSL 5ALBH 3FQNA 4R8WL 5EPMA 2ZP0T 4XXCA 4XAWL 4NN5C 1MFEL 4Y2DC 4NZDA 5AYUL 3LQAL 2D7PA 3K2UH 3S5LG 5MEOA 1B0GB 2BOBA 2HJFB 2P49B 5TDNA 3EOTH 4PV8B 4LPVA 4P9HL 5D7LA 4X6FB 4Y19E 3VWKC 1D9KB 3MTRA 1MCNA 4PY8I 5INCA 1MJ7L 2VTFA 5SWSB 1UG9A 4LFHG 5IR1A 4BFIB 3L7EA 2B1AL 1BFVL 2OR9L 4GG8B 1MAKA 1YNTA 4MA1B 5BRZE 3IFOB 1F8TL 2GY5A 4M43H 4GMSH 4PJ7A 2DJSA 3CFJB 4EUPA 4NOFA 4KI5D 4LSSL 3BPNC 5HYJE 1KEGH 4Q9QL 4WW2A 5JW3L 5B3JF 3S7GA 1DQTA 3ZYOA 2NXYC 5MP6L 4HHAA 1I3GH 4HEPG 2RFXA 5B3JE 5A3IC 4R0LC 4JRWA 4U6YA 3S88H 4KQ3L 3VFUA 4WV1C 1PX3A 1FGNH 3Q5TA 2ZCLH 5EC2B 1NAKH 1K8DA 4KZEH 1UXSA 2B4CH 2LU3A 4YO0A 1G7MA 4OQ1A 3UTTD 1EPFA 3MSPA 1A5FH 1CICD 1SY6H 2NY2C 4BQ9A 4HG4K 3CX5K 3HG1A 3MRHB 3QPQD 1Z9MA 2X9YA 2YZ8A 5ICZA 2J3SA 1EZVX 5EOQL 1JHKL 5IBLC 2JB6A 4FQLL 4MAYC 3MODL 1Z2KA 2HP4A 3AY4C 4YHZH 1KB9K 4JM2F 3H7BA 1RZIA 2J8UF 1KENH 5DFVD 1NDGB 1NBVH 2EIEA 4K7PL 1RURL 5FM8A 1DVFC 3MOBH 3W5NA 1FNAA 2HRLA 3SO3C 3DXAA 2PYED 2AEQL 3MACL 1XIWB 4L1HA 4JFEB 4HGMA 4JM2C 2PW1A 3GSQB 5EZIH 4NZUL 1A0QH 3M1BA 5D5MA 1OD7A 1UQSA 2GHWB 2HLFD 1O7VA 4DZ8B 5EIVA 3V79C 2QHRL 5C9KA 1RU9H 3PL6A 4GKNA 3QHZH 1CTNA 4WEBH 3C8KB 4R96A 3VFWB 3SO5A 2ICWJ 1KGCD 3WXVH 3L5XH 3S37X 1OARH 5L2KB 3BPLC 1QFUL 1MCPL 1G7IB 1WBYA 3RGVA 1JZ3A 3TNMA 3OJMB 2HTKD 4C56E 1I7ZB 25C8H 5DS8B 2HFFB 1PZUB 3RTQB 5E2TH 2VLRB 1AHWA 1MCHA 5IQ9A 1C08B 1FZJB 3MV9B 1TCRB 3ZO0A 4WWID 1LP9E 1RMFH 4J7RA 4WVRA 4XTRD 2NY5L 2FATL 3GO1H 3M17A 3TFKC 1EHLH 1J9CT 5LAXB 2EC8A 3E2HB 4JHAL 4XVTH 2DMKA 2R23B 4PLKC 4AIOA 4HLZG 4CJ1A 2B0SL 3U1SL 4QHMB 4RMSA 1OAXL 3LEXA 4H5SA 4LRNL 1JF6A 1M71B 1BLNA 3Q3GB 4Y0GA 1C5CL 5KVMC 2KL6A 1G0YR 3MFFB 4D3CL 3MR9B 4G8EB 1B0GA 1HXMB 4NWUL 3I3EA 3PV7A 3DHJA 4JDVB 2DBLL 2MFNA 1FQ9C 5GS3A 2R8SH 3ARBD 2LAAA 1IEBB 2QSCL 2C7UB 1AIFB 1JYNA 1J11A 1JF1A 1FLTX 1YQ2A 3NCYP 4IRZH 4IRJA 5DJXB 3QP3A 2ID5A 4MB5A 5FKPB 3VXNA 5J12C 1S8DB 1ADQH 2F54D 2K1MA 2M26A 1VFAA 3QCVL 1AGBA 2AJZB 3E3QC 1HKLL 1H3WM 3RAJH 3MV8A 2G2RB 4WEMB 4XVJH 2VC2H 3FRUB 5CZVH 5IB2B 3C60C 3DBXA 3QJFA 5EU3B 3T3PF 4M03A 3T3PE 4LLVB 2J4WH 4ZFOB 4AMKL 5KG9B 3MCKB 3EJZD 1RPQA 2P48B 5EC2A 3L95A 2Y6SD 1DEEB 4RRPA 4Y16D 5D1QB 4ZUSA 4QRPB 2VDRL 3L6FA 1RIUH 2AV7A 3IAQA 1OGAE 2A9NH 2FO4B 5TDPB 1MF2L 4DVRH 1P4BH 4WHCA 3MBEC 1PSKL 2HVKA 2PETA 2XFXA 4BH7A 1CU4L 1KNOA 4HWZA 1WJ3A 5ADPL 4O58H 3GI8L 4PY7B 1UWGL 2ED7A 1QR1B 1BHGA 3BP6B 3V7MA 1NDGA 1QQDB 4OCRL 4HF5L 3MRGB 4N90E 5SWZE 4Z5RB 5DZNA 3B9KD 5JA8B 2ICWI 1UB5B 2HWZL 3O0RH 1QRNE 3CFBA 3I84A 1ND0B 3SE9H 3IDIB 4I0PA 1A6AB 1H0DB 1A7RL 5DD6A 4PRPE 3DOSA 1N64L 3NCMA 5F1OB 3SGDI 4NZTL 1EH9A 3C8KA 5K9KA 5E7BA 2VIRB 3VFOB 1CICC 2BNRE 4ZYKB 5I1IH 1RIHH 1MWAH 1T7WA 3K81A 1CDUA 1WFOA 3QPQC 1NCBL 5E08H 4AL8L 5J6GB 3KR3H 5I16B 4V1DB 1I9RL 1XGYH 2FWOA 2MCPL 3QEHA 1LE9B 1AO7A 2X42A 4TN9A 3CMOH 5FYKE 5LAXA 2GKIA 1BVKB 4C57C 5BV7C 1U3HB 5D1XA 1BD2B 5LGHL 1P2CA 4JE4B 4U33A 4UTAH 5F9JB 1A7QH 2C1OB 1WZKA 3ARXA 4PUBL 3H9SA 3OJ2C 2JIXB 3BDYH 4JY4B 5B4MD 4XP4H 3RI5F 4UMGA 1QFHA 2FH8A 3MR9A 3TBYB 1FC1A 3TCLB 2HLFC 2EDHA 1IEAA 1BBJA 1NC4D 2R2CA 1KLUB 4RMRA 1IQWH 1JGUL 3RL2A 3VD9A 1S5IL 1IEBA 5DVMA 3L7FB 3IDJB 2C7UA 5GGTH 4BFEA 5I9QC 2DICA 4P4KB 4HLZH 4I9WE 4M1GH 3FQXB 1JGDA 3QCUH 5BZDB 2HTKC 1XT5A 5I73B 4AZ8A 2H3NB 5FKPA 3V5DB 4AG4L 2F5BH 5ICXA 3PWJB 4NBXB 2YSSB 4E5XB 2AJZA 3W82A 3U4BH 4XTRC 3MJ9H 4UB0L 1MFBH 2XWBA 5D2NC 2I9LB 2O5XL 5JR1L 3HRPA 4QRQA 3MRQB 2OZ4H 2BVPA 5HBBA 3GIZH 4L8DA 4LLVA 3NACH 1UT9A 5KG9A 2R2HB 4HCRH 3MCKA 1ES0A 4U3CA 3EGSA 3N85H 2Y7QB 3VWJA 3AMKA 5E8OB 1FG2B 4Z77B 2ZSVA 5H37G 4A6YH 3GNML 1T80A 1I7RA 1EJOH 4XMPL 2YEZA 5F88B 4DOHB 2V2XB 4QRPA 2HKHL 4L8SB 2WLYA 3LKRB 3ARBC 4BZ2L 5KSBF 4KJQD 3O81A 1GGTA 1YJDC 3M8OH 5TFSH 1JZ6A 15C8H 1T04A 3DI3B 4OFKA 4XC3H 1DBAL 2IALB 3P77A 2XWTB 4LVNB 4YHPB 5HHXL 5IROC 1I8KB 5KW9L 4JAMB 3KPLB 4Q97A 1RHHA 2PN5A 3HE6B 4PRHA 1K2DB 1QQDA 3E6HB 4U2YA 4QHNB 3MRGA 4Y2DA 2ZUQC 4NCDA 1DQDL 5T5FL 4MXQD 4ETQA 1MCOL 3CFKA 1R3KB 1FV1B 3VWKA 3JWDH 4D8PB 2HH0L 1ND0A 1WZ1L 3EJZC 1A6AA 1XZ0A 5EZJB 3RWDB 4PJAF 4JO3H 1X6NA 1JI2A 4BSWB 4LPXA 4XHJD 3RY4A 4RAHA 2H2PC 2Y6SC 5F7DB 3KPRE 1IGTB 4QT5A 4Y16C 3U0TB 4YWGH 1JGEB 3T2PA 3WL9B 5C09E 4PJCB 4JO1L 3VFOA 1Q94A 1DN0A 1IC5L 3CU7A 1ZS8A 3X11A 4Z7VA 4ZYKA 5K59F 4JO4H 5K59E 4Y4FB 5MHSD 5T1DL 4ZPTA 3CK0L 4HWNA 2H32H 5J6GA 5IW1B 4Z7UA 1ZTXL 4NJAL 3OKDA 3U48A 4I77H 3BAEL 2HTLD 3NIGF 4LDEB 4OKDA 5EWIH 1QSFB 5L9DH 3NIGE 4DW2L 2A38A 4WV1A 3S96B 3FB7A 3MOQA 1G6RL 3FFDB 1BD2A 3WS6C 5C0AD 1LQSR 1AJ7L 4XPBL 32C2B 4XBGB 2IWGA 4YEEA 2NYYD 3FMGH 2BDNL 3OPZH 1FO0B 3Q5YA 1OAKH 3HTLX 2WUBL 4NBZB 3MRJB 1OAQL 1ZLWH 3BP5B 4X4ME 4CL7A 2EDLA 3I6LD 3VXSE 2ATPA 4XNZC 3MPCA 3FQXA 2XKSA 3QNXA 3QDGB 5BZDA 1DVFA 5DYOB 3VXRD 4WHTA 3ZDZF 2VAJA 3TV3L 1A1NB 4CVZA 4BZ1H 4OZIF 4LAQH 3PWJA 2X44D 2YSSA 4JZOA 4E5XA 1HYSC 4OZIE 4TUJB 5EBLA 5KAQG 5FF6A 3C2AL 3WFZA 5IV2A 2GTZB 4QHKI 4WENB 3INUH 4X98A 3F6IA 3TBTB 4Y4HA 4RMVA 5JPNB 3DUHA 4JN2B 3MRQA 3MLTB 1IKFL 2NY1C 4M48L 2RB8A 1U8PB 5MEPA 3CZFA 3EYVA 4LK4A 4LPCA 4EOWL 2R2HA 4MA3B 1KTRL 5DJAB 2Y7QA 1N6VA 4JRXE 5B4MC 5JORA 4NHCL 4MJID 1OQOA 4EDWH 4LPWA 5B8CC 1TZGH 3ROOA 5KS9B 1CLYL 2V2XA 5C0JB 1MQKH 2X70B 1J1OH 4BJLA 1DTUA 3LKRA 3H3KA 5J13C 5LQBH 4UT7H 5FUCE 5FCUH 5AYQA 2IPUK 1KBGH 3AS0A 3KJ4B 1G6RA 2A1WL 3SDXA 1KTLB 1YMMB 5IEHA 5HGBB 5CJXA 3QEQD 5FB8B 3PUCA 4X6CA 3KPLA 3GM0A 1MLCB 3AB0C 5H37H 4O9HH 1UA6H 1U8LB 3I2CL 5I17A 2V9TA 1WAAA 1HI6A 3BH8B 4M7LL 4P57B 1QO3B 4PJ5D 3NCCB 4FXGA 4ZPVB 3QPXH 5ADOL 1NFDA 3GI9L 5GS1C 5I1AB 2WZPD 4Y4KD 5T3ZD 3QQ3B 4OBRA 5GRXG 3RNQB 2D03L 5F9AC 4K23H 1AQKL 3RIFF 4YHMH 4YDJA 1JGEA 4FHBD 3TF7C 4G9FE 3ULUF 1DBMH 5SWSD 4PJCA 1S7QA 3CNKA 1KACB 3BVNA 3ULUE 4DKEH 4HK0A 3B6SB 4KJQC 4EN3D 1LEIB 1SM3H 3WFBH 4PR5B 2CKNA 4PJBF 1GZPB 3T0BA 1DDHA 1BREA 4PJBE 3UJJL 1T2XA 1QSFA 1RFDH 1JMZA 3DETD 1DQMH 4RQQB 2YA0A 4ZNCD 5SV4A 2HN7B 2X89D 1TFHA 2ICWB 2H6PB 4OF5A 5E2UH 4CVXA 4NKIL 3ORJA 3BPOC 1ZLSH 4R26H 2BK8A 3OJDA 2VQ1A 5BV7L 3I6KB 4XBGA 2V2WB 2XXCB 3HE7B 4MXQC 1NFIA 4J4PA 2GJZB 2C1PB 1FYTD 3SDCD 4ZDHB 1R5VB 2DLIA 2IPTH 3MNWB 3TYFB 5KSUB 5ENWB 1GGBH 4P2QB 1NCTA 2XIDA 3DARA 2CK2A 2F15A 4NZRL 4XHJC 4OFDA 1OTSD 5F1NA 4PJ7E 4I0KA 5J06A 3QXUA 5CEXA 1MFEH 3PHOB 4ODXA 4DTGL 4I2XA 1A64A 3LQAH 4XXDA 3OZ9L 1HIML 4R9HA 5FOBB 2X1PA 2EIZA 4C83B 3QDGA 2GJ6D 1J88A 3EYOA 2ITDB 4J1UB 2VXSL 5BCAA 2W07A 2Y36H 1MJ7H 3LRGA 2UYLB 4QRRD 2HTLC 4P46D 3WS3A 3ZE0F 3QZWA 1YN6B 5GRVK 1BFVH 2OR9H 4RIRA 2GTZA 4QRUA 5GSRA 3LPWA 5ISZD 3K1DA 4ISVA 3TBTA 1HEZB 3FT4B 1F8TH 2MJWA 3MLTA 3FTGB 4LOUC 5F3BB 1I1YB 3D1MC 1KJ2H 3VFPA 2QQLL 3UTTA 4LCWB 3OX8B 2E6QA 3A67L 1CICA 1CD1A 1V7MH 2FR4B 5CS7A 2QL1A 5DC0A 5FYJH 2E7BA 5MP6H 3UTSB 4ZODA 1KN4L 5EH1A 1RHFA 1NLDH 1DEDA 1MQ8A 5C0JA 2XA8L 3KLAB 1BFOB 4JFDD 5EO1A 3SGKA 1SJEB 2FB4H 5JQHC 3FQWB 4ODTL 2YMXL 4ZFFB 4GW1B 5TE6H 3L1OH 1QKZL 3ZE1F 3UDWC 1HCVA 2GJJA 1KTLA 5I2IB 3ZE1E 5HGBA 5JHLL 1YNKH 1TITA 3HCVB 3IJYB 3DXAE 4S1QH 5D6DC 5FB8A 5JXEA 3BKYH 2CLRB 5I8CA 2PYEA 4HFWA 1CBVH 4WY7L 1X4ZA 4HX1B 3C9NB 2BFVL 3MREA 4XMKL 4LHQB 2EH8H 3CDFA 4I3RH 3MA7B 3BW9B 4ZPVA 5I6XB 4M7KL 4ACPA 3CX2A 43C9A 4HIJA 1YYLL 1MAJA 2MPAL 5HGHB 1IAIL 2C4FU 3RNQA 4PJ8D 3V7AE 4K7PH 1RURH 1I85A 4PV9B 2P43B 4ZNEE 1NL0L 3BO8B 3P30L 5EO0B 3WUZA 1EFQA 2C4XA 1DQLL 4U6XB 5H8DA 1QR4A 1INDH 3HZKB 4NGHH 5FUOL 1IC7L 3CZJA 5CIPB 1DANT 2CR6A 4G7YL 3UZVB 1I1AB 2CUHA 5DVKA 1FN4B 1YEIH 4HDIA 3O45B 3WXWL 1LEIA 3VGEA 1VKXA 3RQ3A 1NCWL 4QTIH 3MCLL 2D4DA 3BZFB 3QBTB 2HN7A 4L4JA 4L3ED 3TN0B 5HYSG 4XX1G 5AZEL 4GG6A 3MYJA 2D7QA 3REVA 4WO4D 3ZKMD 4KZDL 5DUBA 5KSAC 4TSBH 4G6JH 1YEFL 1TJGL 4XPGH 6FABH 5DVNA 5C9JB 3HE7A 3IB4A 3SE4C 3SJVD 4L8BB 2C1PA 4Y4KC 1S7WA 3ZYZA 2VE6A 5CD5D 5C6WH 4MNHA 5GISL 2QKIB 5ENWA 1BGXL 5A2JH 1QEWA 4UTBH 5GS2H 2BRRH 5A43C 2B0SH 3S36L 1AXSB 5HHQB 3VXUB 1D9KC 1UM4H 1WIPA 3RWGB 2VNCA 1C5CH 4HKZA 4TSCH 4YBHA 5DJ0B 1U91B 5HPMB 1P69B 2F54A 4G6FB 4NWUH 4PJDA 3FHAA 1E27B 1FNHA 1KYOJ 4XWGH 4LIQL 4EN3C 2DBLH 5I1JH 1M6OA 2A6IB 2ITDA 4J1UA 3RA7H 4I18B 1JF5A 1CE1H 4K9EC 3WSQH 1E6JL 3O11A 1F6FB 1T3FA 2PXYD 4Y5VC 1JBJA 1NEZB 2AXHA 4BK4A 3O2DL 2EYRA 1MHHB 4K3EL 4Z0BL 5H2BB 1A21A 1HEZA 2Z4QB 4AT6A 2X4QB 3FT2B 2YD8A 3L3KB 3ELAT 1I1YA 2DIBA 2WBWB 4Y16A 4PJHB 3MROA 4M5ZL 4KQ4L 3SQOL 1TJHL 5I8OH 4Q6YA 4PYGA 3MRCA 1YDPB 2YUWA 2FR4A 3OAZH 1INQA 3B5HA 3SDCC 4ZUVB 3FHQA 3UTSA 3PXJA 4U6VL 3FZUD 3Q6GH 3AS3A 3SE8H 3SGEH 4BM7A 1A22B 1D3CA 1BFOA 5IP4A 4KHXL 4Z0XA 4LKXA 5IBTL 1J87A 5FGBC 2ZOLB 1R3LA 2DQGH 3WS6A 2D2OA 3IJYA 1F2QA 4HUWA 3BIAX 3I9GL 4AENB 2CLRA 4JFEE 3OB8A 3LKPB 3MRRB 3B9KA 1JV5B 4FZEH 4KUCF 3HRZB 2NY6D 2IJ0C 1XIWC 4NQSB 4IS6B 5EULV 1RUQH 1Z3GL 1UWGH 1JNJA 3NGBC 2R4RL 4XBEL 2EC9U 4Y5YC 1KOAA 2VZ1A 1Z0MA 5L2KE 1T0MA 4H0GA 3CGTA 3MZTA 3ARSA 4HF5H 4N5UA 1EX0A 4H0HB 5FYJU 1X44A 2VLRE 2KBGA 4E42A 3DX6A 5J6HA 3Q6FA 2VLMD 3L3GB 4OGZA 3O2DA 1MHEB 3IDGA 3IU3B 3RTQC 1QYGH 1J0IA 4LHJB 1U8OA 4WFFD 4LLQB 5IMOB 5F7WC 5AD0A 4LLUB 5HVWA 1B0RB 4RAVB 1MJ8L 5MERB 5K9OA 2EYTA 3U36B 2VXVL 1IGCH 4OZFA 1T21A 1RZFH 4YJZL 3BKCH 3E2HC 3HB3C 2AQ2A 5LGKA 2EE2A 4OM0L 1BAFH 3D2UD 4GXUN 3DPBA 1B0WA 2H1PL 5F7FA 4WUUD 5DRZB 5FECA 2VDNL 3PQYD 1HQRB 1NC4A 5CHNB 3RUGF 2Y06H 2Q8AH 2QKIA 4KU1A 1J8HD 4PJ8C 1CGTA 3RBGA 1CFTA 3WFCL 4DKFL 4XH2A 5T1MA 3HZYB 1A2YB 2GTWB 2JKXA 5JDSB 3RWGA 1U8KB 2DKMA 1U91A 3PWPD 4FOMA 5HPMA 4LPTA 1E4KC 1JGLL 4WIQA 3R06B 5CGYD 1E27A 3BN9D 3WUWA 1QLRA 3VFTA 3MLSH 4X8JA 3QUZD 4RSVA 1DBBH 2FYYB 4OLUL 4PG9B 1S5IH 5I15L 3S4SA 3HAEG 2UWEF 3LMJL 5GS1A 2GY7B 5J11B 5JLZB 3TCXA 1T7ZA 4YHIB 3DTXA 1UM5L 3LEYL 3B5GA 2PR4H 4M6NH 1PZ5B 4OF6A 4YFDB 4WO4C 4NM4L 3ZKMC 2DF3A 3CDGA 3DIFB 4JDTH 1UEYA 5HVFB 4PJEA 4GMTH 4MDIA 2CJUH 2IC2A 4QRPE 2LU7A 4LNRA 3TWCL 3P9LA 1AP2A 4AM0B 5C0CD 4N0CC 5CD5C 5JR1H 4WCYH 3QUML 3GSUA 2BSTB 4JFQA 1XF2A 3N1PC 3T4YB 2PO6B 4LQFH 4GRMB 4F7PB 1FLRL 3BGFB 2EE9A 3JV5A 4YHLL 3GSVA 1G0DA 2CRYA 4PRHE 1ZLWK 4I3SH 4JQVA 1V3KA 2VXUL 2IF7A 1KCRL 2ZOLA 3OR6A 4L9LC 4HMDA 4NFBA 3FONA 2EIDA 3MLXL 5HDBF 4KGJA 5F6IC 3HLAA 1GXEA 4UOW1 1JV5A 4OLEA 2JK5B 2P5ED 1E4XL 3QUYB 1DBAH 1X5ZA 5JW4R 1C8PA 1YC8A 4JFFB 4YK4B 5KW9H 3WBDA 5IB5A 3O4LB 1RZ8B 2VDPL 2HFTA 3PP4H 4AEFA 3GDBA 4DUVA 1FVEB 3VFVA 3WMSA 4U49A 3C6LB 1DQDH 4NFDA 4AQ1B 1DLFL 1BZ9A 4IOIA 3T0DA 43CAB 4PJ9B 3PWUB 4V1DE 4YQXH 5IM7A 1IGFL 2DOCA 3CLFL 4WI9A 1QBLH 1U8HA 4CADB 2HH0H 4HS6A 1Q72L 3L3GA 1WZ1H 4L4VB 5FOJA 3LCYA 1GOFA 2ZUWA 4M00A 5I30L 3WV0A 3IU3A 3V4PL 4Q6IC 4Y89A 2I5YL 1BD2E 2ICEA 5IMOA 4LLUA 3UTOA 3KWWA 1B0RA 4RAVA 3VDAA 3KJ6L 3VA6A 5C3LD 5C0AA 4N0YL 3U36A 4HIIB 3SY0B 4DK3A 5IFAH 4Z7WB 1LO4H 5L8KB 5C0GB 1PX4A 3RL1A 5T1DH 4AYFA 3CK0H 4P23B 4YEFA 5D8JH 1ZTXH 4O51A 4NJAH 5HDQH 5A40E 2ORBH 3GIVB 5MENB 2DQCH 3QUMA 2NY6C 3UJTH 5C0RL 4NHUA 3BAEH 3D85D 1EMTL 3U9UB 3LD8C 5CHNA 3TPUB 3FRPG 4KKNA 4YE4H 2XY1A 5T3ZL 3OL2A 1N4XL 3QXDB 1U9KA 1NUGA 3PV6B 5I1KL 1AJ7H 2GTWA 1ZHKB 1S9YB 4YDVB 4XP6L 3UDWA 2BDNH 3N1GC 3VXRA 5AEAA 1CLCA 5D7KD 3F65A 4WU5B 4PRNB 5EIIB 4HGWA 4YAQB 3BRGC 3KDMB 5CUSL 5I73C 5C2UB 2IBZX 4XCEB 4DWHA 5L88H 2FYYA 4NJ9H 1SYVA 4MMXC 5IEKA 5D7JD 2OTUA 1IGIL 2BVOB 4K9EL 4OCYL 5JLZA 2A6JB 1JN6B 1NGWB 3F7PC 2UZYB 3O3BB 1XGTA 4U1IB 4U6TA 3RHWK 3MV7D 3RJQB 4HUVB 4HULB 1PZ5A 2FCBA 3QDMB 4MZ3A 1TPXB 1ZEAH 4M62L 1SEBA 3TV3H 1IE5A 2HA1A 1EO8H 2R69L 4DOHE 4IBLT 3QO0B 4X4YA 2HFGL 4FQQB 2HT4D 1R3HB 4O4YH 3KLHD 4IRSB 5BO1H 3W0WB 1KTKE 2B5IC 4R4ND 3HAEH 3LIZL 2BSTA 2V5TA 1R5IB 4L8SC 1K5NB 2PO6A 4X4XB 5F7EH 4GRMA 1WK0A 2V17H 2VR4A 3BSZL 4NPYB 3QEQA 4UNVA 3STLA 4HUNB 4MJ6B 4PB0L 1VHPA 1B4JH 4XNYL 5CGYC 4LVNC 3QUXB 1WAAE 1R6VA 4BYHA 2FHBA 3QUZC 2YRPA 3RWHB 4YFEA 2IBGA 1AQDB 1AGDB 3QXTA 3SE4A 1P6FA 3ZHDA 1F6AA 3NTCL 4G9DB 1GC1L 1J10A 2CDEB 2OL3H 5TQ2H 2F74B 1NMBH 1WFUA 2VXQL 4YGVB 1EEQA 1RZ8A 4NRYA 4PJCE 5IG7B 1XGPB 5DD0H 4I4WA 4Q0XL 4HSQA 3L3IB 1ONQA 3I2CH 4TPRH 3RWJB 2X4PA 5IT2L 2AS5M 3RWFB 1XGUA 4IM8A 3TZVA 4NO2B 4V2BA 1JYXA 3RWIA 1OCWL 4ZAKB 3P0YL 2AK4D 5IVNA 4EN3A 4GKZA 1KIRA 1UZ8B 2QBWA 2BCKB 4IOFC 5EUKB 5KANI 3EBAA 4ZO8A 3LV3B 2B8OT 1QSFE 4TTDC 3W9EA 4QNPE 4LP4A 2DQUL 5C2BL 4QXGH 3C6SB 1IC4H 1NCAL 4ELKB 3QIWD 1UH3A 4FFWD 5D1ZB 3O6ML 4NNXA 1HNGA 3BEVB 1E28A 3VH8B 5B38B 4JLRB 3UZQA 1NC2D 1KCSH 4P23A 5DSCB 5DEFB 1FYTA 1NPUA 3OKOB 3GIVA 1CYGA 1EGJH 4PJFA 2XQYG 3FQTB 1FFRA 4JFHD 4RBPH 3TT1L 5JHDB 2IADB 4LSPL 2XN9D 1RD6A 3U9UA 5DZOA 1HXYB 5DUML 5B39A 4L4TB 1YEJL 4NKIH 4R97C 2VUOA 1UCTA 2E7HA 4QOKB 2EKSB 5CMAA 1PGRB 4GAJL 3EOYG 3THML 5BV7H 1ZT7A 4YDVA 4HIHB 3QDGE 1S9YA 5EOCJ 3NN8B 1W72B 4KI5E 4HAGA 3CFCL 4TRPH 1EEZB 2GJ6A 3O4OB 4N9GA 5FYKH 4YPGB 4NO5A 1VFOA 3CSBA 3FFCD 3HUJB 2F9BT 4J8RA 4X0KB 4P46A 4EZMA 1LNUA 2J6EL 4NZRH 2HJLB 4N8VG 4FZ8H 1U93A 1HH9A 5ISZA 4L29A 5AAWA 2YS4A 2Q7YB 4DTGH 4H26B 4OIAA 3OZ9H 3PNWA 3O3BA 3OG4B 2R1WB 2IFGA 4XCFL 4U1IA 3KPNA 3QG7H 4HUXA 4CRPA 3NMEA 4UILL 3DV4B 3FN3A 4ZUWB 2Z92B 5KS9F 5CINH 3GSNL 3P9WB 5KS9E 4ODVL 4GRLB 5F1IB 3QO0A 4Z7QE 3AAZB 4O02H 5INDA 3MGAA 4QXUH 2W60A 3QHFH 3O2WH 1X5HA 4JFDA 4J3TA 2X40A 4UZGA 4MCZB 3Q1SL 4ZUUB 1JI1A 1MVFA 1TZIA 2DQTL 2V7HA 4NSKB 3X12B 3OF6A 1GSMA 1YMME 1ORQB 3VW3H 1CR9L 4F58L 3CVHB 3ES6B 2DN7A 2PYEE 1Q38A 3SKUD 1AXTH 2X4TB 3VGBA 3L5HA 1ZHLB 2OR7A 3QUXA 2DI9A 1K3IA 2ZOKB 5J1AA 3WO3B 2XA8H 4ZXBD 3RWHA 1OF2B 3WDJA 3MRDB 2IH3B 1FZMB 1J8KA 1QKZH 2HAZA 1KGCE 3REWB 1YJDH 5KVDH 1V3JA 4LEOB 4PJ8A 1B2WL 3QEGL 4FQJL 4G5ZL 3L3JB 4MVBD 5E94A 4YGVA 1I9IL 2EEDA 4P2YA 4BQBA 4POZC 5L2JB 1J0ZA 4XMKH 5MEQA 2HT4C 3RWJA 3LHPL 3V8OA 1SMAA 1E4KA 3KLHC 1X5KA 12E8L 1J12A 3MGOB 5ACZB 4A2MA 2J6EA 4M7KH 4ZAKA 2VITB 3BKMH 1D5BB 4ZO6A 4LDOB 2MPAH 5TE7H 3OAZK 2Q1EA 1IAIH 3O9WB 2DKSA 3GUTB 1NGXB 1KB5B 3V0AC 1JTOA 5CEZD 1CFSB 1NL0H 1A7OH 4GLRI 4WW1A 2P7TB 3LS4H 3C6SA 4GG6E 4DGIH 1C16B 4H20L 4L3EA 4CDGC 1AE6L 3GSNA 4U1MB 4WO4A 3VH8A 1INEL 1J86A 5HHOD 4RFOH 3KLDA 4YX2H 1RQ5A 2EICA 4WTZA 2V5MA 4R7NB 3SJVA 5DEFA 3PGDB 1BPVA 2MMXA 3I50L 3FQTA 5C08B 3OV6A 3KGRA 4P2OD 5L8LB 3MCLH 1A3RL 2IADA 5I19L 1OPGL 3EZJB 2R0KL 3FT3B 4JFZL 2LAGB 5CP3A 3MV01 4OLWL 1HXYA 4M5YH 4XCYB 5D2LF 3BH9B 1C5BL 1OOAA 5AZEH 5ID1B 1A47A 4LVHC 5CWSB 2F54E 4KZDH 4QXTB 1VESA 1IAOB 2GITB 4NN6B 3RPIB 5GRYA 4L9LA 2DWDB 4AH2A 1TJIL 4G8GD 3K0WA 4J6RL 4JGJA 4JPIA 1OQXA 4H0IA 3FJTA 3VG9B 1BGXH 3ARRA 3ARDB 3UBXI 2CH8A 4X0KA 1L6XA 3S36H 3VRJB 4ERSL 2PXYA 2ICES 1LWRA 1F4AA 1WWAX 3QI9D 5DA4A 2GT9B 3WN5B 5DHVB 5HTSA 5GHWL 3NFPA 4FFWC 2EZ0D 1XCTB 5JXAH 4FQIL 3Q48A 4LCWE 2R1WA 4NO3A 4I48A 4OUOA 1TETL 1N3NB 1F3JA 3F12B 4KJPD 2R1YA 3CSYB 4EXPX 4ZUWA 1F13A 3BUYA 3UTSE 5IGXL 1S7SA 1K4CA 3A6OA 4GRLA 2PW2B 2DJ4A 5FUZL 3K4AA 3LOWA 3BP4A 1CDBA 3QNYB 5IOPA 1S9XA 2VMFA 2XZQH 2UZXB 3V4UH 1M7IA 1RJZA 4YHOL 5F96L 4CMMA 1L7IH 4M1DL 4NSKA 3T1FB 1KPRB 1BF8A 1PKQB 4M3KB 4XMLL 2R15A 4M5ZH 3V5KA 2W9LA 2DI7A 5FYKU 3NH7L 5CLTA 3ES6A 3MO1B 3ZZ1A 1R3IL 4Z78A 2VDMH 2BHYA 1ZHLA 1P5VA 4F37F 2ZOKA 1J5OL 5D7IA 1NBZA 4PRDA 4WI3A 3MRDA 4F15B 4EI5D 1F4WH 3V6OC 5JOFB 4KHXH 1T7XA 5E2JA 1BBDH 1UWEL 3DUSB 1KG0A 2AEPL 1P7HL 2BSED 5I8EA 3WNKA 2AVGA 3I9GH 4RGND 3VGHA 4OI7A 5A16B 4JB9H 2NW2B 5D96C 5GJSL 1HSBA 4IDJL 3WJJA 1NBYB 3V7AG 3RDTB 2E5EA 3VD5A 2Q7NA 4HH9B 1BZQK 2JJUA 4NQVB 1OAZL 3I02B 3QB7C 1BF2A 4MXVF 3G5YA 3I85A 5JQ6L 1I1AC 2R4RH 4MXVE 1JK8A 4RX4D 5ILTH 3MRIB 2LFGA 1CFSA 1OSPL 3EYFB 4APQD 1VFUA 4HIXH 5ESAA 2ZG3A 1UJ3B 4U3HA 5DD3L 1NCCH 3QR2A 1OGTA 3O6FD 3R1GL 3D2UA 1M05A 3IETB 4QRSB 4H88L 1XGQB 3BESR 1WF5A 5BS0D 3JZ7A 4R7NA 1KCKA 5DI8B 5HPOA 4O2FB 3BQUB 4HS8H 4NQCB 3IGAB 4LLMB 4WHDA 3DMMB 3JTSB 3ULUH 1J8HA 3PGFL 3SKNB 1K6QL 1GZQB 4JZJB 3X3FL 2EE6A 3VXUE 1IKNA 4XCYA 2VXVH 3S3SA 3RU8H 4LKCB 2VZVA 4U1JA 3QEUA 2HT3C 1GGIL 2YWZA 3IDNA 4KFZC 3DVIA 1T1WA 1GPOL 5FEBA 1FRGL 3PWPA 5CGTA 4UUJA 2GIYA 2VAAA 1UYWL 1IAOA 3HKFA 1KTDB 3HS0A 3RPIA 3HFMH 1A6UL 3OG6B 4EDXB 2AP2A 4LHUB 1WCBB 5T3XE 3IDMB 3SDYL 1M7XA 3UCRA 3TPKA 4NYLB 4PS4L 1NBQA 4I18C 4UNUA 5C0BB 2O5ZH 4PJHF 1XCTA 1JWMB 2FX9H 1H9VA 3EO1B 4HC1H 1AFVL 2YD5A 3TIEA 1KEML 4LARL 4PTTB 4MQ7B 3CSYA 2X2YA 3NAAH 3VFSA 1F58L 3BYYA 5TF1L 3VXPA 4JFYB 3BHBA 2CLVB 4P2OC 1CLZH 4KKCD 5FA3A 4ODHH 4NN7B 1I8IA 3NCJL 3LN5B 3MFGB 3MJ7A 1WSST 3QJHB 1CGSH 3PABA 5ESVA 3ALXA 1U41A 5L0QB 1PKQA 2EYSB 3RVTC 4W68A 5A2FA 3SKJH 3TWCH 3GB7A 3MLWL 5I0DA 5FFLA 2IAMD 1XR9B 3CXDL 3PP3H 4LFHD 3MJ8A 1NCNA 4MNGB 2JB5L 3KPOA 2CKBB 5IB4A 2P5EA 3QI9C 4LSRH 4G80A 1FLRH 1WISA 4R2GB 5JIIA 2EZ0C 4YHLH 1W0YT 4NDMB 1F4XL 4WFHD 4OZ4B 4KJPC 3LQZB 4G7VL 2DMCA 3D3VB 4Y2OA 3V6FB 5F7HA 1L0YA 1SHMA 4UT6L 5A16A 2ZJSL 5ELIA 5H35A 3BDBA 1WVZA 2HYMA 1LO5B 2EEBA 1PQZA 4OJFH 4N0RA 1H5BB 5IB1A 3HC3L 5EUOA 3CSGA 5FDWA 5CSBA 5D72L 1HHGB 4U7MA 3I02A 3ZKQD 3FOMB 1P7KA 3EYUH 4UDTA 5MI0B 3V5HA 1A4JB 2E27H 4K7PY 2I24N 3MLUH 4P5TD 5DRNB 2QADD 3EYFA 3BMWA 2LABA 4NRZA 3GBLA 1UJ3A 1KCVL 1FNSL 2EXYD 4LF3B 3FQUA 3KS0J 5BXFB 1VFBB 4OUUA 1IGFH 4XNQB 4HKBB 2VWEE 4P9ML 3EIFA 1FVDB 3LY6A 1FGVL 3MQIA 3QFJD 1XGQA 2FRGP 4W6XB 1TVHA 2PF6A 4X9GA 5ESQA 5I30H 3D85A 4OF7A 1WCQA 2NY3D 1S3KL 2NX5D 2FJGA 5HY9B 3BQUA 2I5YH 4LBEB 4NQCA 1MHCA 5FHAL 2VXTL 5IMLB 1T2JA 1A1MB 3IF1A 5DFTA 3SKNA 4PGDB 4NKMA 3KJ6H 2OMBA 2W0FA 1ZOXA 1QA9B 4RGNC 1HSAB 4LKCA 3UTQA 1K8IB 1UKTA 3MUGB 3BZDA 5SX5H 3DVNB 2CUMA 4OV6F 2ILLA 2C4FT 3QQ4B 4KVCL 1RUPL 4S1DD 1BX2A 1EIBA 1A9EA 4W4OC 3IDMA 5BQ7B 1A4KA 3GM8A 4LLWB 4UV7L 5D7JA 1I9EA 2X4OA 2ADIB 1YEGH 3QDAA 1CI5A 3QDJB 4APQC 5FO8B 5I1KH 5EU4B 4GJTB 5HHPB 2VN4A 4M61B 5HHNA 3EO1A 3O6FC 3K8LA 1UXWB 1RVFL 2ADJA 4D9RD 5J56B 4M4RA 4B7LA 2AXJA 4WTZG 4MQ7A 5CEYB 5IQ7L 1I9JH 5HHVH 2YPKA 3QNZB 4K9EH 2CDGB 4XCCH 3MLVL 1TDQA 3MCG1 2EDOA 2JJTA 3LN5A 2YD4A 4RBPK 2R4SL 3MLYL 4TVSa 4XC1L 4EVNB 4JDZB 4M62H 4ODWB 1LK2B 1JWUA 4G8IA 3UBXB 1U8JB 3EO9H 2EH7H 5GGVH 3L3HB 2DQIH 5I18L 5IMMB 3LIZH 2EE3A 1EHXA 4X6EB 3VRLE 4JFFE 1Z0NA 4KRLB 3IDXH 4F7EA 5EOTA 5E7FA 1JZ2A 5GJTH 3O4LE 3IFLH 4PB0H 3QIUB 2DD8L 1OW0C 3SKOB 4XNYH 4YLQT 1CFVL 2PKDA 2N4IA 2EDKA 2IANB 3GSRB 1OB1B 3RI5K 1OT1A 5D71H 3QAZB 1W0VB 5DLML 2DLEA 1S5HB 4OAWB 1YUHB 4WWKB 4OFVA 2AK4A 3C8HA 4KKCC 5LXGH 2R56H 1PLGH 4H25B 3QA3A 1X4YA 2YWYA 3OKMA 1B88A 3KNBA 1T1YB 1HHKB 2VXQH 2BSRB 4X8XA 3O3EA 4QHUA 4MNQB 1G9NL 3QIWA 4Z7WF 4Z7WE 1N59B 3ULVF 2IAMC 2RGSA 5ALCL 3ULVE 2AGJH 2BVTA 1KXTB 1NC2A 7CGTA 1BM3L 3C5SB 2EDNA 1F11A 4MS8D 4XNQA 5TPWL 4MD5A 1HHJA 5E2WH 2EDYA 4WUKL 1BQHA 4P99A 1LE5A 2XN9A 3MLZL 1BIHA 3UYOD 5TQ0L 2A9ML 2ED9A 3B2UC 5IMLA 3TBWA 1A1MA 3SCMB 5BMFH 3ARGD 3ZE2F 2XZCH 4DVBA 1MFNA 3ZE2E 4ODSL 1CFQB 1T5WB 3G6DH 3F58L 3QIBD 3D69A 3X14A 4NUJB 4EQ2A 3HPJB 3RGHA 5CJBA 3FFCA 1ZSDA 4U31A 5BZWB 4MAUL 1RJLA 4LSPH 1AY1L 4YBLB 5CD3B 5JOPE 4YR6A 5BQ7A 1IRAY 1YEJH 2R2BB 3BXNB 2K9UA 4P5TC 4H8WC 1UACH 3NBNA 1IC1A 2H26A 4L8CA 5JW4N 5CEZL 2QSQA 3O6LL 3S3PA 3QDME 2HKFL 3ULSB 2GCYB 4GH7B 4M02A 4P2RD 3EYQC 3BI9X 5C07D 1YYMH 4H1LB 1TPXC 2NY3C 3DRTA 4JFDE 2FGWL 4IHOA 3EO0A 3U9PL 3QNZA 4AIXA 4LSTL 2DQJL 1N26A 1V3MA 5T1KB 5DXWA 2C26A 2DLTA 4JRYD 5SV3A 4QRTB 4EVNA 1UFUA 4JDZA 4PBVC 2WSKA 5DD1H 2WWKT 1BEYL 3GSNH 1KULA 2F19L 4HXAH 4TOYL 3MNZB 3P4NB 2BSSB 4ZXBA 2A6DA 1SYSB 5KVFL 1RJYB 3ZHLA 5IMMA 4X9IA 3MRKA 1FE8L 1QPXA 3BMVA 3STZA 1BJ1H 4OLXH 5ALBL 3T77A 2XQYK 3IJHB 2R0LH 5EZLA 3FOLB 4C56B 3QIUA 3K2UL 2XTJD 4ONFL 1BOGB 4PJXA 2IANA 1OB1A 4TNWF 3P4OB 4JREB 5F9WB 1VADB 3BRDA 1MI5D 4FFVC 4AEHH 3GHEH 5JNYA 1QLFB 3CFDA 2C3GA 1T1XB 4G5ZH 3O8XB 1FP5A 3FQRB 1HHKA 3ARFD 1F3DJ 3WO4C 4OB5H 5CP7B 4M43L 3KYNA 3QXAB 1I9IH 4MQXC 3P0GB 4KROD 2AV1B 1QP1A 1KEGL 3IDYC 4M6OH 5HHOA 3U6RB 3MC0A 3WD5H 4JJ5B 3BJ91 5DURB 2CGRH 5BVJA 2R1XB 5D1ZC 1UENA 5HYEA 3VXMB 4NFCA 3GGWB 1I3GL 1XF5B 2OBGA 2P5WD 3C5JB 4QY8B 4ALAL 3S88L 3AC0A 1CK0H 3TO4B 4LVEA 5FYLD 2VL4A 1P7QB 5J0BA 1WUNT 3DX7B 5E6YA 2ZCLL 3KPSD 1NAKL 4KZEL 3MRPB 1BVZA 4L4TE 2B4CL 1RUML 1FNEB 3P40A 3EUUA 4QOKE 1NDMA 4LPYA 1XAUA 4U1NA 2KQMA 1A5FL 1SY6L 3SCMA 1INEH 3WLBB 4RISH 1KN2L 3IT8D 1AKJD 2Z9TA 3ARWA 4JANA 1MLBB 3SOBH 4HH8A 3CH8A 4CN1A 3HUJF 5DD5H 4DZBA 1U58B 2FEEI 2GEEA 3HPJA 3HUJE 2EEAA 4J3SA 1JHLL 5EA0L 3D39D 5ITFB 1MCEA 5DQDL 4X6DB 1XF4B 1KPUB 2CMRH 2KQNA 1OTUC 4YHZL 3BDXA 3WJLC 1JZ4A 2W92A 4OZHA 4Y7MA 3QI9A 3F7QA 1RUKL 4HW6A 1KENL 4U7SA 3GKWH 4YXHH 3MOBL 1G7QA 1F00I 3P9MB 1PEWA 4NQDB 2OX5A 1OGAB 1TJIH 4MS8C 4J6RH 4GSDL 4MB3A 3ZL4H 2AEWA 2ITCA 5I71B 4OCNC 1U92A 2ESVB 3JUZA 1RU9L 4FNLL 3ZKXB 4S0SD 3QHZL 5IJVA 3KHOA 4WEBL 4XCNB 1JUFB 3WXVL 4OD1L 1AI1H 3L5XL 3OGOE 3ARGC 3RIFK 4FQXD 1FFOB 2IG2H 1TETH 4KI1A 3NZ8A 4CN6A 3EOAA 3ULVD 4ZSOA 4QRTA 25C8L 4M9PA 5GRVL 1AGCA 5E2TL 5GS0C 2D7OA 1CXFA 5IGXH 3W11D 3B9EA 5EU6D 4TQEH 1RMFL 4P5MB 3K8MA 2BJMH 3GO1L 4UI2A 3MMEB 4GS7B 4XGZA 1AD9B 1EHLL 1Q9WB 1FSKC 2H2SD 4YXKH 5F96H 4XVTL 4EI5A 3FB8A 4M1DH 2HMID 5DJZA 4IOSD 4HFUH 4XMLH 3V4VH 1SY6A 1X4XA 1EXUA 3PHSA 1ZT4B 5DRXA 3IJHA 2XACC 4RFEA 5HYIA 2YOCA 5DVLA 3FOLA 2YBRB 1DQQB 3VE0B 3J7HA 5DGQA 5IBUB 2E7CA 4YHNA 5C1MB 2R8SL 1HZHL 3PWLA 4XAKD 1F5WA 3TVMD 4B5EA 3LPGA 3ZT5A 3BRFA 4HK3N 1VADA 2HJKA 1NJ9A 4Q58C 4GQ9H 4W4OA 1DL7H 2IPKA 3H9YA 3OHXB 4IRZL 4LL9A 4OI9A 2CPCA 4RX4A 5EDXA 1NUNB 1T1XA 2DM3A 1CDJA 2AEPH 2J1KA 2OMNA 2N7AA 3JTTA 3N9GH 4RMWA 3QXAA 1VCAA 1VPOH 2DBJA 1ADQL 3T3ME 3FO2A 3O9WC 3LDBB 2G75A 5GJSH 4OKVB 4EI6B 3O6FA 4F7TB 1EUUA 1NUFA 3EFFA 3KXFD 3RAJL 5IVZB 3U6RA 1OL0A 1BZ7A 2VC2L 2YPLB 1IAMA 5DJ6B 3DUUA 2R1XA 1I7UA 1OAZH 1J05B 3BPCB 1TZHA 4FTVD 1XF5A 5C08E 4F2MA 3IXTB 5I1HH 2J4WL 3PP3K 4ONOA 1HQ4A 3JV6A 1OSPH 2CK0H 4D2NA 4ZS6D 1ORSA 4XNMA 2FBJH 1TENA 3F62A 4G43B 4P3DA 5DD3H 3VFRB 3UTZB 4JQXC 3MRMA 4LSQL 4JGUA 1N7ML 5F1KC 4IJ3C 1TTGA 4QWWD 4FMKA 3S35X 2A9NL 4M6ML 5I1DB 4DVRL 1P4BL 1T03L 2YHGA 5DJ2B 5I1CL 5KZCB 4NN6C 1QBML 1FZKA 4Z18A 4NQEB 3PGCB 1FCCA 1K6QH 2CIKA 1MH5A 3X3FH 1YNLH 5C0FA 2WBJB 3ARFC 3ARQA 2FX8L 3GSXB 2XKNA 3IAGC 1FO0H 4KTYA 2NTFA 3VFMB 2BMKB 2B20A 1IBGH 4WI7A 1H8OA 5I1GH 2GW5A 1F2XK 4Z76B 2GAZB 2AJXL 5JA9A 3DRQB 3X3GH 3P9MA 4H8WL 1D5MA 1CFNB 4PJIB 1LDPH 1ZA3A 5T33L 1CQKA 3L9RB 1X6LA 3SE9L 2OQJA 2PCPB 3SKMA 3SQBA 1JRHL 2NCMA 4GBXD 4PS4H 1NH6A 2Z93B 1BQHG 4Y5XA 2P8PB 5DJDB 3P11L 2UY7A 3TH3T 4XPAH 2BZDA 3ESUF 4RMTA 3HZMB 1ADQA 1RK1B 2VLJD 3TBSB 3S5LA 1PKQE 4XBPB 5E00B 5JMRA 4HZAA 1FFOA 1MWAL 3G6AA 1LEGB 4BSVB 2ZUVA 3KPMA 1ZMYA 4KXZH 2GUOB 3KR3L 3QQNA 2IAMA 1F58H 5SX5K 5FV2A 1RK0A 1YEDA 3DECA 4LSVH 3TBVA 1R24A 4GAYA 3V8CA 4F7CA 1MRFH 3MUJA 1NAML 5C09B 4UTAL 2O61B 1A7QL 4OV5B 3LN4B 1MY7A 4F15C 4E41B 1J0HA 1KLGA 3MLWH 4OFIA 3BDYL 1MFAL 1FL3A 1T0NB 1DQQA 3VE0A 5I1LB 3VXOA 4URTB 1P9MC 1YPZA 2JB5H 3RY5A 1RIVH 4YC2B 3WFHA 2X4SB 3ET9F 1GOHA 1W0WB 2C9AA 3DYPA 2CSPA 3F7VB 5GGTL 2MNUA 1F4XH 3ZYJA 2X09A 3RDTC 4YNYA 4K3JH 1JZ7A 2DDQL 3G08A 4Y1AD 3ZDXF 3P0VH 4FQXC 3ZDXE 4XRCB 5E03A 3QCUL 2AJVH 4P5TA 3SBWC 5DJYB 1KJVB 4B53A 1LD9A 2F5BL 3L3OB 1U3YA 1FG9C 3W11C 4MSWA 1NKRA 3LH2L 2A83B 4OKVA 3MJ9L 5FO9B 4MWFB 4RGOL 3QFJA 1MFBL 5F3HA 1S78D 3V6ZA 4DK6A 1BFSA 1HOCB 5D72H 4KVNL 3BPCA 5CZXD 3T4AB 3U7WL 3SN6N 2HMIC 4NQCE 2OZ4L 2NX5A 4GRWE 3I75B 4HLJA 3GIZL 3X13B 3NACL 5ETUB 4LVOB 3Q2CA 4HCRL 3ROLB 1LVEA 2XWJA 3SDDD 1MWAA 2XOTA 3MNVB 4DN4L 5IF0B 4CGTA 5JW5A 4A6YL 2H32B 1NLBL 1LO3L 3GJFA 5D4QA 1L7TL 3BUTA 3QCTH 3UTZA 1N0LA 4FFZH 2OSLB 4GQPH 4IDLA 4M1CD 4QHLB 1FGVH 5IIEB 4YIQB 2CLZB 2NLJA 4DCQB 1GL4B 1D5ZA 3LKOB 1P1ZA 1ZHNA 3M8OL 4KUZH 1QSEB 2PTUA 5DRWA 4HZLA 2F8OA 5CBAA 5C0ND 4O5LH 5C0BE 3GSXA 3PHQB 2LQRA 2E6PA 3SGDH 5EZOH 3VFMA 1OD9A 4PGJA 3CCHA 3JV4B 1HE7A 5GSVB 2WWMD 4MA8H 2Q76A 3CUPA 4QTHB 4Z76A 1NEZG 2QHLA 3G5VB 1XFPA 4M93B 2VLKD 4OZGB 3ZMRA 4F57H 3RNKA 1FZOB 3JWDL 5GGTA 2D9CA 1YY9D 1IM9D 5DMJB 1X5AA 3SPVA 3VRIB 1FIGH 5HGAB 2A0LC 5DJDA 4ZS6C 2D9QB 1EEYB 1ZHBB 4NWTH 2K7PA 5J9PB 3HZMA 2B2XL 1RK1A 4DEPC 1RVFH 2IH1B 2VN7A 4F9PA 5E00A 4HUMB 4JO4L 3TESA 2JCCA 5FK9B 3MJ9A 2ZNXA 1H15A 2EDQA 2IQAB 1MRDH 1AD0B 4OD2B 4LCYB 2Q86A 1AR2A 5IQ7H 1GCFA 3KYMA 4QGYA 5L0QC 4UQ2B 4Z95L 4MNGE 2OZ4A 4CVUA 4ZOBA 4I77L 5EWIL 3HC4H 4BUHA 5T1LD 5DJCB 4JO2H 4HCRA 4FN0A 5L9DL 2H9GB 5EN2A 3S98A 3CC5A 3KHQA 4Y19D 3NFSH 1SEQL 3MLYH 1EAPB 2WQ8A 4A6YA 4AEIL 1S7RB 3CPLB 4ZO9A 2FJHB 2RCSL 2VR5A 4RAUA 2X4RB 2ARJQ 3B9DA 3FMGL 4PTUA 4D9LH 3T8XB 5BRZD 3GKZA 3OPZL 3AM8C 3D3VE 1FNGB 5HJ3A 2IQ9H 5DK2A 4ZQKB 2VZUA 5I18H 2OTWA 4QF1B 3PIQA 4GBXC 1Q0XL 5HYJD 2X4SA 1Y18B 5DHYA 3U30B 5EBWB 4HS3B 3F7VA 5EBGA 2E9IA 3EDJA 3ABZA 2EDXA 4D0CA 4PREA 4I0CC 5MEOB 2BOBB 3HNTH 5E9DD 3N1QC 3TJHC 1NMCC 4V2CB 3VXTA 4KJYB 4PRID 2NY2D 5D7LB 4ZD3H 1ZWIA 4HWUA 4BZ1L 4LAQL 3PF2A 5INCB 5J89A 1YZZA 5EC1B 2W9EH 1IJ9A 2A83A 3L7EB 5FO9A 4MWFA 1YNTB 4RZCB 4CMHB 2XN9E 4XWOD 3INUL 3UAJC 4MAYD 1F02I 1MJJA 5HI3C 3X13A 4P49A 4F33A 4EUPB 4PY8J 1IT9H 2A6KB 3ARGA 2H32A 2PNDA 4DFHA 4Z6AT 1FNFA 4HHAB 1TZGL 3QIBA 2OSLA 5E4EC 4U6YB 1MQKL 4W81A 2CLZA 4WUKH 4KDTC 3VFUB 1MFDH 1QHOA 4E9LA 4UT7L 1K8DB 1G1YA 1UXSB 5TQ0H 4YO0B 1KBGL 2A9MH 3WIHH 1G7MB 3QDJE 1B3JA 2P8MA 5ANMB 5DEGA 3HG1B 3AREB 1NGZA 3JV4A 4O9HL 5ICZB 1HILA 4QTHA 1N8ZA 4P2RA 4TUOA 4PRBA 1JYWA 4OT1H 5KN5A 1S78C 3QPXL 2DWEA 1F90L 2JB6B 2D7TH 5C07A 5IHZA 4OZGA 1RZJC 3FN0L 3H7BB 1RZIB 4R4BA 2P4AB 4JY6A 2XV6B 4K23L 3C5ZD 1N2RB 2DTMH 3CDYA 3TA3D 3O6LH 4YHML 4CAGA 4WDIB 1DBML 2PW1B 4JRYA 4DAGL 4LCCC 2IH1A 5FM5O 1OT2A 2FSEA 4M1CC 5D5MB 4DKEL 3D6GA 5C0IA 4JG1L 1O7SA 4LCYA 3WFBL 2JTDA 4GKNB 1U36A 2FGWH 4I5BA 5K33A 3U9PH 3H0TA 3T0EB 1KCLA 4R96B 2OJEA 4EJ1C 5C0NC 1RFDL 5CCKH 2H9GA 1WBYB 5E2UL 3RGVB 2WWMC 3WYRA 1ZLSL 4PJXE 4UAOB 1AHWB 5IQ9B 1BEYH 4Y8AA 2IANE 1CQYA 1JPGB 1X5GA 3IFNH 3M17B 4F8QA 1HHIA 3O41A 4LEXH 3C60D 5A2KH 5KVFH 4ZQKA 1LHZA 2VZSA 3BZ4A 2IPTL 4FQPA 5FIEA 4QF1A 1GGBL 3V6BR 4RA3A 2W91A 1MI5A 4NNYB 4NIKB 3LEXB 4H5SB 4OLZL 1Q8MA 1BLNB 4QEGA 5EBWA 2FO1A 4HS3A 3ARFA 4MNQE 3QXVA 4X5WB 5CLWA 2NY4D 4CN4A 3D0VA 3DWTA 4ONFH 1IGJB 2VABA 4KJYA 1UC6A 4DUWA 4HWBL 2EDFA 3UJIH 5DJ8B 5K9JH 2Y36L 5EC1A 3DSNA 1JF1B 2BP3A 2GSIA 4IRJB 4KRNA 2P5WA 2WIIA 3MBED 4AJ0A 4RZCA 1BVLA 4ZUTA 4TVPE 3BD5A 4PGBA 3KPSA 4LMQI 4TUKL 3VXNB 1HNFA 3LRSA 3QUKB 2Y5TA 3NIDE 4OTXL 1VFAB 1KJ2L 5JPMA 1AGBB 2BNQB 3P2TA 2A6KA 3MV8B 3L5WB 2Q8BH 1V7ML 1FFPB 1AKJA 1J0YA 1UH2A 1C5DA 4OGXL 3DBXB 3QJFB 5FYJL 4OIIH 1CD8A 1NLDL 4QO1A 4ALAH 4N90D 5SWZD 4B0MM 3D39A 2DIJA 3WKMH 1RZ7H 2FB4L 1KT2A 2DYPD 4GW5A 4FA8A 3L95B 4IIQA 2RIKA 1RUMH 4J12A 4WJ5A 1QRND 5E70A 3L1OL 5TE6L 1AC6A 1F45A 7FABH 5F7MC 4NKQB 3NPSC 4AIZA 1HH6B 4PJGB 4ZUSB 1YNKL 5ANMA 3L6FB 4S1QL 4PRPD 1KN2H 3BKYL 5IB3B 3AREA 2AV7B 1WIOA 2WANA 1CBVL 5E8EA 1JPFA 1VGEH 2BNRD 2EH8L 4B7IA 1G9EA 1JHLH 4MJ4A 5EA0H 4I3RL 2HVKB 5DQDH 1NANH 4XWOC 1P9MA 2YKLH 4WWKA 4HJGA 5HHMB 2XFXB 4BH7B 1KNOB 4HWZB 1IAKA 1RUKH 2BOCA 4AQOA 1WFNA 5KJRL 1N2RA 4X6BA 5FYKD 1UWXH 4ODUA 4WDIA 4FABH 1INDL 1IMHC 1JFQH 5AZ2H 5F8QC 4HWBA 4NGHL 3OXSB 5DMKA 2VKWA 1EDQA 2DQFB 3CFBB 4GSDH 4GXVH 3KPPA 4I0PB 1YEIL 5EU6A 2VQUA 1PVHA 5DD6B 5IESH 4E0RB 3TJEH 4FNLH 4Y8DC 2Q6WB 3T0EA 1L9NA 4QTIL 2BX5A 5K9KB 5KSVA 1M7DA 4OD1H 4JZNA 2L7UA 1KJ2A 1MIEH 2JJSC 4KGLA 1CFBA 5I74B 2G5BA 3NIFE 5BJTA 1MVUA 4U1LA 1EO7A 4P59H 2FWOB 4TSBL 4G6JL 3QEHB 4I9WD 1LP9F 4XPGL 3WHXA 6FABL 1AO7B 3WNNA 1DUZA 1JPGA 4YDKH 2NQCA 2NNAA 3EJJX 4MA7H 4U1GC 4XP9H 3TVMA 1SJXA 1CGWA 5D1XB 4UTBL 1P2CB 2BRRL 3C5ZC 3OB0H 3PDDA 4NNYA 3TA3C 3QH3A 2VDLH 3H9SB 4EIGB 1UM4L 4YHKH 1LO2H 3P73A 1FC2D 5GPRA 3OTTA 4M7ZB 5J57B 4TSCL 4X5WA 3BX7C 3PE9A 1IGJA 4XWGL 3O8XC 1DE4A 1IEAB 1BBJB 1IM3B 1I3RB 1AGEA 1K9TA 5I1JL 3OXRA 4JY5L 3RA7L 1B4RA 1HZHH 1CE1L 4N0FA 3RL2B 3VXME 1IGYA 3WSQL 5DJ8A 2MOVA 4S11A 4RNRA 4FTVA 5B38G 1P53A 4QXWA 1JGDB 2Z31B 1OSZA 5I1EH 4PLJD 1U8MA 3NZHH 3QUKA 5ICXB 3V95A 3TO4C 2W65B 2BNQA 5I8OL 3L5WA 4IMLA 2J8HA 3D9AL 2XWBB 1FFPA 4IEFB 4QRQB 4GAGH 5T5NF 2FH6A 2BVPB 3Q6GL 3LZFH 2V9RA 4X6DF 5E6ID 2APTA 4UQ3A 3IS1X 4L8DB 3SE8L 4X6DE 3SDAD 2YD3A 3GK8H 1ES0B 3EGSB 3VWJB 2OLDA 2F53D 1J18A 2H2PD 2VERN 5IVXA 2ZSVB 2NY4C 1I7RB 2FJFA 2YEZB 1HH6A 2DQGL 4PJGA 1Q1JH 5DO2C 4LSQH 1I8LA 3GMPA 1N7MH 5IB3A 2W59A 3KPRD 1WT5C 4NQDE 4U3XA 4M6MH 4X4ZA 3AM8A 4OGAC 1T03H 2VUYA 2AQ1A 4G42A 1T04B 4FZEL 3RVWD 3VA2C 5I1CH 1QBMH 1DFBL 3B2VH 3P77B 2ESVE 3LQMA 4GBXA 3W9DB 4TYUA 3JWOC 2VYRE 1RHHB 2FX8H 5IKCA 1RUQL 4P5KA 4K7PX 1DP0A 1RZJL 4PRHB 1EFXB 2NY0D 4YGAB 5I71C 2PTTA 4R4FH 2I9TA 2VLJA 1U8IA 2AJXH 4Y2DB 2Y07H 4H8WH 4ETQB 3CFKB 1TCMA 5T33H 3EDDA 3T1WA 3OXSA 2DQFA 3VWKB 1FORL 5C70A 1JRHH 1XZ0B 2Z35A 3KPTA 1KUMA 2DL9A 3RP1A 4E0RA 1QYGL 4W70A 3P11H 1AGFA 4QT5B 1ZGLB 2Q6WA 1ETZA 1L0XA 4PP2B 4JEGB 1KSRA 1Q94B 1DN0B 2ARJA 2BNUA 1ZS8B 1OY3B 2LE9A 4WFHE 4Z7VB 3X11B 3E6FA 5ABDE 1ACYH 1FAKT 1IGCL 2E8YA 1RZFL 3BKCL 4CDHA 2VDQH 4ZPTB 1F4YH 3BPNB 1BAFL 4Z7UB 3GJFH 3OKDB 3VXSD 4NOBA 1YPZE 1HYSD 2NXYB 1NQBA 3BGMA 1XF1A 1M1SA 1J1XH 3G04A 4JN1H 1G7LA 2AXFA 2Y06L 4WV1B 2Q8AL 3SEPA 3FB7B 1P4IH 5FV1L 1NAMH 1CS6A 2NY1D 4QLRA 1IAII 3GSWA 4Y1AA 5J4MA 2J2ZA 3DI2B 4B41A 3MZGB 1UZ6F 1MFAH 2C3VB 4RGMB 5SWQA 1UZ6E 1VDGA 4M8QA 3DYMA 4N8CH 1IM3A 1I3RA 3MLSL 2YPLE 2NXZD 4JRXD 1DBBL 4BH8B 2PYFA 3DURA 4RA0C 4CNIA 1P84J 1FIEA 5IUSA 1NGYA 4QCIA 1UB6B 3RVUD 2ATPB 2DDQH 2UUDH 4FFYH 3QNXB 4HAFA 2Z31A 3EJYC 2PR4L 4M6NL 3SDDA 1DVFB 3WIFA 2VSCA 4WHTB 4JDTL 3SO3B 4CVZB 2FIKA 4GMTL 4MDJB 2W65A 4JZOB 2CJUL 2I07A 4JM2B 1BQUA 3LH2H 5EBLB 5FF6B 5IV2B 4NCC2 3B3IA 4RGOH 1ACZA 4FQ1H 4X98B 2FD6H 4WCYL 4KVNH 4Y4HB 3UTPE 3U7WH 2XTLA 1TMCB 5MEPB 3CXHJ 3CZFB 3EYVB 4NQEE 5FM4A 4LQFL 2B1HH 1KJMA 3QO1B 4DN4H 5BOZG 5JORB 3BPLB 4KMQA 2KKQA 1NLBH 1LO3H 3HI5L 3JVGC 4I3SL 4QHKJ 5L7XH 5HI4D 1L7TH 2LU4A 2A77H 4PJIF 3ROOB 5A2LH 3MGTA 4PJIE 1JVKA 3QQ9D 4ORGB 4G9FD 2VLKA 4WNQA 3BD3A 3VGDA 1H3TA 4F37K 4NC1E 3ULUD 1G6RB 3SDXB 1IM9A 5IEHB 5FA4B 3W9DA 4NQUA 1W72H 4X6CB 4PLJC 1QFWM 5E95B 2VLLA 2HT2C 5HYSA 3PP4L 1NSNL 1EFXA 1I3VA 2DQEH 3AMLA 5I17B 1HI6B 4FXGB 4K8RD 5GQBA 1NFDB 1TXKA 4YQXL 4KK5D 1QBLL 5EO9A 5E6IC 3L3DA 4OI8A 3BKJH 3QULA 3SDAC 4NBYB 5T1LA 4P3CL 4HMEA 4X9BA 3LEVH 4YDJB 4Y19A 2VISA 1ZGLA 1S7QB 1HWGB 2B2XH 3IAPA 4PP2A 3ZT7A 3BVNB 2P42B 1I8MA 3OKEA 3ESVF 3GEWB 4HK0B 5IFAL 4UINH 4E41E 5D93C 1LO4L 1CD0A 1KLFA 1G7JB 2Q20A 5BRZA 2DTSA 2YD1A 1MCWM 1WBXA 5D8JL 4N1EA 5HDQL 2ADFL 1ZAGA 4W6WB 2ORBL 2DQCL 3HAEB 3RVWC 4Z95H 1DDHB 3UJTL 1DUYB 3C08L 2W9DH 5CBEA 5GS0H 1QLEH 4JM4H 2UY6A 4R0LA 1MNUH 3CVHH 4YE4L 3RZCD 4JR9H 4PLOB 1CF8H 1SEQH 4FXLA 4CVXB 4YPJA 4AEIH 2NY0C 2D7NA 3WDHA 1QFOA 3U7YH 3LKNA 4LOUD 3OJDB 2VQ1B 4OCWH 4ENED 2RCSH 2DQHH 5F93C 5E9DA 3VFNA 1NFIB 4PRIA 3K4ZA 2C3VA 5DMYA 3DJ9A 2C3XA 1T20A 5HGDB 2QR0B 3DSFH 1MIML 1ULVA 3EZ8A 1Q0XH 1ZK9A 4X7SH 4BH8A 4NJ9L 1HINH 5L88L 3LS5L 5F1NB 3G5ZA 2BVUA 1S7UB 2F5AH 3UMTA 1OWWA 4MAYA 5D9SA 4O2CA 5CEXB 3AY4A 3HI1A 4NO0D 4ODXB 4I2XB 1GGYA 1UB6A 4XXDB 1N6QL 4MD0A 3CFIC 2EIZB 2YXFA 5E8DH 3HPLA 3IVKA 4MZ2A 1G0XA 1VERA 3LKSA 4S10A 3EYOB 3O3UN 1ZEAL 2ZNWA 4YBQC 4LVOC 1EO8L 3IFPA 4MDJA 3DO7A 4JM2A 1MREH 2R39A 3WS3B 2J8UA 3QZWB 4O4YL 1JWSA 3K46A 4RIRB 3DXAD 1CCZA 4QRUB 5GSRB 1PD6A 1DLHA 5BO1L 4WFEE 4ISVB 4JPKH 1CTOA 1CE6A 1QSEE 5KANG 4FQCH 3JSSA 3SE3C 4J3XA 1IILE 5C71A 3VFPB 5F7EL 1H3GA 3UTTB 2V17L 3VDBA 1A7NL 1CICB 3QO1A 3PL6D 2JJSA 1CD1B 4K7FA 4BQ6A 1B4JL 5E5RB 1WV7T 4JHBA 4OZGF 3VG0H 2NXZC 5DQ9B 3J8F7 4OZGE 1L9MA 5EO1B 3NFNB 4OFYD 2Y23A 4ORGA 2EO1A 4OQTH 3MRBB 1N5YH 3RVUC 2OL3L 5TQ2L 5BV7B 5FA4A 1U95A 5IMKB 1NMBL 5DWUH 3C5ZA 1H3PL 1DQJA 3ZLQC 1KFAH 2E9JA 5FUCC 4GT7A 5I8CB 2PYEB 4HFWB 4R90L 5DD0L 2CIIA 3MREB 1QBAA 4TPRL 5KSAD 4KH2A 1XCQA 1GJIA 1F90H 1K4DB 1V7NH 43C9B 5DHVH 5A1AA 4HIJB 3FN0H 3ZTJG 3PDGA 1TQCB 4QXGL 5FYLH 5TDOB 1IC4L 1D9KD 5HI4C 3U46B 4YDLC 4DAGH 1A1OA 2XTJE 1D6VH 1CIUA 5C6PB 2Y4SA 4JG1H 1C7SA 1G7JA 3QQ9C 1KCSL 4HDIB 2R29H 1VKXB 3MYZA 3ULUC 1EGJL 3C60A 3HAEA 3NCEB 3RKDD 2YK1L 4HV8A 1DUYA 2HVJA 3OSKA 1MI5E 1S9VA 1E4XI 1ITCA 3IKCA 5BVPH 4D0BA 3ALPA 3ZKSD 2WIMA 1T89C 2OJZH 2AJ3B 5LVEA 4S1SL 4GG6B 4AK1A 3MYJB 3REVB 1GAFH 5DUBB 1YQVH 3IXAA 4OM1H 3S3JA 4K8RC 3U30C 2EXWD 5F72S 2V5RA 2X1XR 4XXCC 5D7LE 1I1FB 1ZANL 2H8PB 4TRPL 3VFGH 3TH4T 1KIQB 4KK5C 5FYKL 4X7TA 1GIGL 1S7WB 2W0KA 2GK2A 3ARBB 3MBXH 2VE6B 4MNHB 5HGDA 1UWXK 1VFMA 2CXGA 2QR0A 5GZOC 1QEWB 3U4EA 4PD4J 3RY6C 3IYLW 2OL3A 4KDWA 3MBEA 2VRAA 4FZ8L 4OLZH 4N8PA 4PJ7F 5DA0B 5I0ZA 1S7UA 4HKZB 5DC9B 3BIKB 3D87B 2F54B 4PJDB 2DQDL 2GQHA 4WI4A 1U3ZA 3HZVB 4WW2F 4K94C 3QG7L 2COQA 3KYKH 1M6OB 2ZUQB 1FBIH 4HWBH 5CINL 3O11B 3FAXA 3BN3B 1T3FB 2D31A 3VD4A 4WW2C 1SBSH 2EYRB 3PJSB 4O02L 2HRPH 3RZCC 4QXUL 5SWZA 3QHFL 1XIWD 4JFED 1RY7B 3O2WL 3CD4A 1NMAL 4JPWH 1F97A 1R5WA 4TUKH 4AT6B 3WE6A 1E4WH 1YEKH 4ENEC 1QRNA 4Y16B 4OTXH 3MROB 3VW3L 2D0GA 4KUCD 5ANME 3MRCB 3OJVC 3HG1E 4ODBD 3OB0K 4PRPA 3U4AA 4EEEA 1INQB 4OGXH 1L0QA 1AXTL 5IFJA 3ECBB 1EGJA 4CW1B 5L2KD 2IFFL 3MRNA 2BNRA 5JZ7D 5DQ9A 1OWRM 1IARB 3BFOA 2VDKH 1MCKA 3NFNA 1GYAA 4JCMA 4P3WA 3RTQD 4Z0XB 3MRBA 2VLRD 4UDUB 4LKXB 1R3JA 3MV9D 1YJDL 4OGYH 5KVDL 1R3LB 3ZYIA 5HSFA 4XVSL 5IMKA 2SEBB 6CGTA 3U83A 4XPHH 4HUWB 1ZVSB 5GGUA 1IFHH 3HB3D 5JUEL 1NEUA 5D5MF 2DM2A 4Z7OF 3B9KB 3CH1A 1DBKH 2MHAB 3AXLB 5D5ME 4Z7OE 2VZOA 5I66A 3QWRD 4XP5L 4HXBL 3GJEA 1K4DA 2WAHA 3MV11 3FRPA 3BKML 3T0EE 5TE7L 1MHPL 5KJRH 1SVCP 4Q2ZA 1T0MB 3AGVA 1A7OL 1EBPA 2APXA 3PL6C 3LS4L 4XNZB 5TDOA 3OWEA 4MJ5B 2XRAL 4DGIL 3GMNB 4FQHA 1RZKH 5JIPA 3I6GA 3U46A 5FYJE 4K71B 3NCBB 5EBMB 4E42B 1XR8A 1HN1A 2XYCA 3DX6B 5J6HB 3Q6FB 4M7JH 4RFOL 4TSAH 4POYA 4J3WA 1I7TA 4YX2L 1MCQA 3IDGB 1HHHA 4N8VB 4HMCA 2VH5H 1U8OB 1AHWC 1FVCA 5D2NA 3ZTJH 3RX5A 5AD0B 4C59B 3LKQB 4LU5H 1I4FA 2G60H 1T0PB 1MCBA 5KBNC 5K9OB 2EYTB 4M5YL 3EDFA 4OZFB 1T21B 1NGPH 2YUVA 5FHBL 2XKUA 2AJ3A 4L5FH 4S2SA 2ZPKL 5FAAA 5F7LB 2OXHA 2CKBH 3JVGA 4JG0H 1ZVYA 1IZJA 1D5IH 4KK9C 1I1FA 5B8CB 5FECB 5LCVH 2H8PA 1NC4B 1KIQA 1PJ9A 2XQBL 2P45B 3ARBA 4N0CD 5D1QD 2CRZA 2XZAH 5J13B 4FTVE 1CFTB 5GRZA 3OKLB 4XH2B 4QRPD 5T1MB 2D4FA 35C8H 1BWMA 4N0UB 1KC5H 5IROA 2FLBT 5KSBA 3BIKA 5JXAL 1IEHA 1FL6A 3AB0B 2BNQE 2DM7A 4MA1C 3HZVA 2KZWA 1S7VA 3MV8E 1QLRB 4JCLA 4N1CA 3VFTB 1A6ZB 3WUWB 2RAMA 4X8JB 4YH6A 2G9HA 2JELH 4JY5H 4DN3H 3RKDC 3S4SB 5DK0B 5GS1B 3OAYH 3DTXB 3GJFK 5E6IA 3PJSA 2XZQL 3V4UL 1L7IL 2F53A 3CDGB 4PJEB 2EXWC 4MDIB 4PJGE 3T2NH 1GHFH 3UYRH 4LNRB 1A6TA 5GIRB 3P9LB 1AP2B 3D9AH 4JHZA 4PJAA 2X7LA 2YZ1A 3KPRA 3Q0HA 2VDML 1BQLL 3ECBA 3GSUB 4JFQB 3BWUC 4CW1A 1XF2B 4EIZC 4K2UH 2NY5C 2OK0L 5D6CA 2NZIA 5HHME 2E9BA 3UROR 1HWHB 1F4WL 4V1DD 3GSVB 4Z9KB 4UDUA 1A6WL 3MA9H 3H8NA 3BJLA 2VLJE 1BBDL 1MUJA 3OR6B 4HJ0D