5JBBE

Crystal structure of factor ixa variant v16i k98t y177t i213v in complex with egr-chloromethylketone
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
CNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Releasing the brakes in coagulation Factor IXa by co-operative maturation of the substrate-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Coagulation factor IX
total genus 11
structure length 51
sequence length 51
ec nomenclature ec 3.4.21.22: Coagulation factor IXa.
pdb deposition date 2016-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 5jbbE00
1I0UA 3H5CB 5JBCE 1IP0A 4NA9L 4Y7AB 1C5MF 2RA0L 4ZAEB 4BTIA 4NG9L 1ATBA 3KQBL 1YUFA 1LQDA 2Y7ZB 4BTUA 1Z6CA 3TH3L 2OYUP 3DEMA 3KQDL 1LPGA 2XC4L 1IQKL 1P9JA 1SZBA 1IQML 1DX5I 2J4IB 1FAKL 2B7DL 4NGAL 1F0RB 1NFWB 3ELAL 4JYUL 1Q4GA 3LTFB 1F7MA 1IVOC 2VWMK 2WG3C 4PH9A 2WPIE 1K36A 2XBWL 1HREA 3SOQA 2W86A 5JB9E 1COUA 5IKQA 1TLEA 2YGPA 2H9EL 1APQA 1LPZA 4BXWA 1FAXL 4RS0A 2WFTA 2VH6B 1YGCL 2MGPA 3Q3KB 4ZH8B 2VVVL 2Y81B 5F1AA 1EMOA 3OLTA 3QCWA 5FDQA 3CFWA 5CISA 1IGXA 2J34B 2MHPA 1PXXA 1QFKL 1K37A 2Q1JB 5CKNA 1M1XB 3ASIA 1G2LB 4X8SL 1ZAQA 5E8DA 4ZHAB 1HRFA 2P3UA 2TGFA 2WFXB 2BZ6L 1YUKB 2BMGA 2J38B 1ATAA 2VVUL 4Y79B 1JL9A 5F19A 3BPSE 2K2TA 5L2YL 2CJIB 1IQFL 3SOBB 2Y5FL 1CCVA 4X8VL 2P16L 1KLIL 1MOXC 4D0FA 1B9WA 4M10A 2BOHA 1LMJA 1XDTR 3V65B 1YO8A 1NFUB 2YGOA 1AUTL 4LORA 1CX2A 2Y5GL 3BT1A 2K2SB 2FD6A 4G1MB 1HCGB 1L5GB 2OYEP 3NTBA 1CQEA 1A3PA 2G00L 4Z6AL 3QMOA 1G1QA 3HS7A 1UZJA 2WPME 1ADXA 1PGEA 4MMXB 1CVUA 2BQ7A 2JKHL 1FFMA 3N8WA 4Y6DB 3LC5B 1G1SA 1TPGA 4JZFL 2UWPB 2WYGB 3LAQA 3CENL 2DDUA 1EPHA 1WU1B 6COXA 1KIGL 1IQLL 4JYVL 3LN0A 3V64C 2XC5L 1DIYA 1XKBA 1EPJA 1HT5A 4MMYB 3FFGL 3KK6A 1GK5A 1P0SL 2PR3B 1ATEA 5JB8E 4XLWA 1MQ6L 1EPIA 3F6UL 3KCGL 2P94L 4BXSA 1PRHA 1PTHA 2Y80B 4JZDL 2P93L 3BT2A 3ZYIB 1HAEA 4BTTA 5JVYA 3FBYA 1OB1C 2W2OE 5L30L 1FJSL 1N1IA 1F0SB 4Y71B 4D0EA 3GISX 3NJPC 1IGZA 1IOXA 4D90A 1EGFA 1N7DA 3N8WB 3EGFA 1HJ7A 2VWNL 1JV2B 3KL6B 4BDXA 2W3IB 2XBXL 1J9CL 3MQEA 1IQIL 3GCWE 1Z6EL 3N8XA 3POYA 5K0HB 2J2UB 2BOKL 2WPLE 1WHFA 3N8YB 3F1SB 3Q7DA 1HZ8A 3U7UG 2BO2A 5CKQA 5IKVA 2ADXA 2VH0B 1DQBA 4RUTA 4A7IA 4YT7L 2MGRA 1FF7A 4X8UL 2EI8B 2FLGA 2BQ6A 4M11A 4XBMA 4BDWA 1EQHA 1LPKA 1YUGA 2FLBL 1EAIC 2PHBB 4CUEA 1EBVA 1MQ5L 3IJEB 5IKRA 4O02B 3TBDA 2XC0L 1DDXA 1G1RA 1NFXB 2WPHE 2F9BL 4RRWA 1URKA 1WHEA 1F7EA 1KLOA 4Y76B 2AYLA 2W26B 4CSYA 3SW2A 3RR3A 4CUDA 4YT6L 1XFEA 1IQHL 3R05A 4LMFA 2I9BA 3OLUA 1IQEL 1CEJA 4X8TL 1NFYB 1JBUL 2KV4A 2P28B 1EQGA 2Y38A 2WG4B 2J95B 3IITB 2VWLL 2NPRA 3HO5A 1UZQA 1HT8A 2P3TA 3TZIA 1U67A 5JBBE 1W7XL 3M37L 4OTJA 4ZXXL 5IKTA 2J94B 1PFXL 3SOVA 2I9AA 2EI7B 1NPEB 2VVCK 3GCXE 5EGMB 2VWOL 4RRZA 3TK5B 4YZUB 1V3XB 4MMZB 5JW1A 2BQWA 4E1GA 3KQEL 2XBVL 4O1ZA 1IQNL 2D1JB 1L3YA 3C9AC 1XKAL 1BF9A 1G2MB 3TGFA 5KIRA 1HX2A 1IQGL 1IOEL 2PUQL 1G1TA 2P26A 1FE2A 1EZQB 1IJQA 4XL1A 3HS6A 5L2ZL 1EPGA 3KRKA 4RRXA 2W2QE 3M36L 4AQTA 1UZKA 3HPTA 3LC3B 1NT0A 2BOUA 3HO3A 3ZYJB 2UWOB 3P5BL 1IQJL 2UWLB 2XBYL 2RNLA 5COXA 4FM5A 2BOXA 3NT1A 1KLJL 1U8CB 4ISHL 3N8YA 2KL7A 4OTYA 4ZXYL 1EMNA 3LIWB 4Z0KB 1HAFA 3N8VA 3K9XA 1UZPA 2P3FN 4Y7BB 2W3KB 5KN5C 3HS5A 1RFNB 3MDLA 1NQLB 2RHPA 4JZEL 4COXA 3KQCL 3LTGD 3PGHA 3N8ZA 4TGFA 3ZYGA 3QH0A 1DVAL 1W8BL 3TK6B 1FSBA 4CUFA 3FCSB 5JVZA 2WPJE 3ENSA 2FLRL 1CVWL 1ATDA 1NZIA 2FZZL 1APOA 3CA7A 5CKMA 4ISIL 3U73A 2VJ3A 5I46L 5JBAE 2P95L 1TOZA 4C16A 1CCFA 2WYJB 1KSNB 3LN1A 2EI6B 4Z0LA 2W2ME 4RRYA 2GD4A 2P3FL 1O5DL 3CS7L 2W2NE 2WPKE 3NTGA 2M74A 2KB9A 2Y5HL 2Y7XB 1X7AL 2W2PE 3HO4A 2Y82B
chains in the Genus database with same CATH superfamily
1I0UA 3H5CB 5JBCE 1IP0A 4NA9L 4Y7AB 1C5MF 2RA0L 4ZAEB 4BTIA 4NG9L 1ATBA 3KQBL 1YUFA 1LQDA 2Y7ZB 4BTUA 1Z6CA 3TH3L 2OYUP 3DEMA 3KQDL 2BSFA 1LPGA 2XC4L 1IQKL 1P9JA 1SZBA 1IQML 1V1IA 1DX5I 2J4IB 1FAKL 2B7DL 4NGAL 1F0RB 1NFWB 3ELAL 4JYUL 1Q4GA 3LTFB 1F7MA 2YGQA 1IVOC 2VWMK 2WG3C 4PH9A 2WPIE 1K36A 2XBWL 1HREA 3SOQA 2W86A 5JB9E 1COUA 5IKQA 1TLEA 2YGPA 2H9EL 1LMMA 1APQA 1LPZA 4BXWA 1FAXL 2WZPP 4RS0A 2WFTA 2VH6B 1YGCL 2MGPA 3Q3KB 4ZH8B 2VVVL 2Y81B 5F1AA 1EMOA 3OLTA 3QCWA 5FDQA 3CFWA 5CISA 1IGXA 2J34B 2MHPA 1PXXA 1QFKL 1K37A 2Q1JB 5CKNA 1M1XB 3ASIA 3S6XA 1G2LB 4X8SL 1ZAQA 5E8DA 4ZHAB 1HRFA 2P3UA 2TGFA 2WFXB 2BZ6L 1YUKB 2BMGA 2J38B 1ATAA 2VVUL 4GU3A 4Y79B 1JL9A 5F19A 3BPSE 2K2TA 5L2YL 2CJIB 1IQFL 3SOBB 2Y5FL 1CCVA 4X8VL 2P16L 1KLIL 1MOXC 4D0FA 1B9WA 2JJLA 2BOHA 4M10A 1LMJA 1XDTR 3V65B 1YO8A 1NFUB 2YGOA 1AUTL 4LORA 1CX2A 2Y5GL 3BT1A 2K2SB 2FD6A 4G1MB 1HCGB 1L5GB 2OYEP 3NTBA 1CQEA 1A3PA 2G00L 4Z6AL 3QMOA 1G1QA 3HS7A 1UZJA 2WPME 1ADXA 1PGEA 1QIUA 4MMXB 1CVUA 2BQ7A 2JKHL 1FFMA 3N8WA 4Y6DB 3LC5B 1G1SA 1TPGA 4JZFL 2UWPB 2WYGB 3LAQA 3CENL 2DDUA 1EPHA 1WU1B 6COXA 1KIGL 1IQLL 4JYVL 3LN0A 3V64C 2XC5L 1DIYA 1XKBA 1EPJA 1HT5A 4MMYB 3FFGL 3KK6A 1GK5A 1P0SL 2PR3B 1ATEA 5JB8E 4XLWA 1MQ6L 1EPIA 4A94C 3F6UL 3KCGL 2P94L 4BXSA 1PRHA 1PTHA 2Y80B 4JZDL 2P93L 3BT2A 3ZYIB 1HAEA 4BTTA 5JVYA 3FBYA 2HOXA 1OB1C 2W2OE 5L30L 1FJSL 1N1IA 1F0SB 4Y71B 4D0EA 3GISX 3NJPC 1IGZA 1IOXA 4D90A 1EGFA 1N7DA 3N8WB 3EGFA 1HJ7A 2VWNL 1JV2B 3KL6B 2HORA 2W3IB 2XBXL 4BDXA 1J9CL 3MQEA 1IQIL 3GCWE 1Z6EL 3N8XA 3POYA 5K0HB 2J2UB 2BOKL 2WPLE 1WHFA 3N8YB 3F1SB 3Q7DA 1HZ8A 3U7UG 2BO2A 5CKQA 5IKVA 2ADXA 2VH0B 1DQBA 1V1HA 4RUTA 4A7IA 4YT7L 2MGRA 1FF7A 4X8UL 2EI8B 2FLGA 2BQ6A 4M11A 4XBMA 4BDWA 1EQHA 1LPKA 1YUGA 2FLBL 1EAIC 2PHBB 4CUEA 1EBVA 1MQ5L 3IJEB 5IKRA 4O02B 3TBDA 2XC0L 1DDXA 1G1RA 1NFXB 2WPHE 2F9BL 4RRWA 1URKA 1WHEA 1F7EA 1KLOA 4Y76B 2AYLA 2W26B 4CSYA 3SW2A 3RR3A 4CUDA 4YT6L 1XFEA 1IQHL 3R05A 4LMFA 2I9BA 3OLUA 2H9EC 1IQEL 1CEJA 4X8TL 1NFYB 1JBUL 2KV4A 2P28B 1EQGA 2Y38A 2KNIA 2WG4B 2J95B 3IITB 2VWLL 2NPRA 3HO5A 1UZQA 1HT8A 2P3TA 3TZIA 1U67A 5JBBE 1W7XL 3M37L 4OTJA 4ZXXL 5IKTA 2J94B 1PFXL 3SOVA 2I9AA 2EI7B 1NPEB 2VVCK 3GCXE 5EGMB 4GU4A 2VWOL 4RRZA 3TK5B 4YZUB 1V3XB 4MMZB 5JW1A 2BQWA 4E1GA 2XBVL 3KQEL 4O1ZA 1IQNL 2D1JB 1L3YA 3C9AC 1XKAL 1BF9A 1G2MB 3TGFA 2BT8A 5KIRA 1HX2A 1IQGL 1IOEL 2PUQL 1G1TA 2P26A 1FE2A 1EZQB 1IJQA 4XL1A 3HS6A 5L2ZL 1EPGA 3KRKA 4RRXA 2W2QE 3M36L 1LK9A 4AQTA 1UZKA 3HPTA 3LC3B 1NT0A 2BOUA 3HO3A 3ZYJB 2UWOB 3P5BL 1IQJL 2VRSA 2UWLB 2XBYL 2RNLA 5COXA 4FM5A 2BOXA 3NT1A 1KLJL 1U8CB 3N8YA 4ISHL 2KL7A 4OTYA 4ZXYL 1EMNA 3LIWB 4Z0KB 1HAFA 3N8VA 3K9XA 1UZPA 2P3FN 4Y7BB 2W3KB 5KN5C 3HS5A 1RFNB 3MDLA 1NQLB 2RHPA 4JZEL 4COXA 3KQCL 3LTGD 3PGHA 3N8ZA 4TGFA 3ZYGA 3QH0A 1DVAL 1W8BL 3TK6B 1FSBA 4CUFA 3FCSB 5JVZA 2WPJE 3ENSA 2FLRL 1CVWL 1ATDA 1NZIA 2FZZL 1APOA 3CA7A 5CKMA 4ISIL 3U73A 2VJ3A 5I46L 5JBAE 2P95L 1TOZA 4C16A 1CCFA 2WYJB 1KSNB 3LN1A 2EI6B 4Z0LA 2W2ME 4RRYA 2GD4A 2P3FL 2BT7A 1O5DL 3CS7L 2W2NE 2WPKE 3NTGA 2M74A 2KB9A 2Y5HL 2Y7XB 1KKEA 1X7AL 2W2PE 3HO4A 2Y82B
chains in the Genus database with same CATH topology
1I0UA 3H5CB 5JBCE 1IP0A 4NA9L 4Y7AB 1C5MF 2RA0L 4ZAEB 4BTIA 4NG9L 1ATBA 3KQBL 1YUFA 1LQDA 2Y7ZB 4BTUA 1Z6CA 3TH3L 2OYUP 3DEMA 3KQDL 1LPGA 2XC4L 1IQKL 1P9JA 1SZBA 1IQML 1DX5I 2J4IB 1FAKL 2B7DL 4NGAL 1F0RB 1NFWB 3ELAL 4JYUL 1Q4GA 3LTFB 1F7MA 2YGQA 1IVOC 2VWMK 2WG3C 4PH9A 2WPIE 1K36A 2XBWL 1HREA 3SOQA 2W86A 5JB9E 1COUA 5IKQA 1TLEA 2YGPA 2H9EL 1LMMA 1APQA 1LPZA 4BXWA 1FAXL 2WZPP 4RS0A 2WFTA 2VH6B 1YGCL 2MGPA 3Q3KB 4ZH8B 2VVVL 2Y81B 5F1AA 1EMOA 3OLTA 3QCWA 5FDQA 3CFWA 5CISA 1IGXA 2J34B 2MHPA 1PXXA 1QFKL 1K37A 2Q1JB 5CKNA 1M1XB 3ASIA 3S6XA 1G2LB 4X8SL 1ZAQA 5E8DA 4ZHAB 1HRFA 2P3UA 2TGFA 2WFXB 2BZ6L 1YUKB 2BMGA 2J38B 1ATAA 2VVUL 4Y79B 1JL9A 5F19A 3BPSE 2K2TA 5L2YL 2CJIB 1IQFL 3SOBB 2Y5FL 1CCVA 4X8VL 2P16L 1KLIL 1MOXC 4D0FA 1B9WA 4M10A 2BOHA 1LMJA 1XDTR 3V65B 1YO8A 1NFUB 2YGOA 1AUTL 4LORA 1CX2A 2Y5GL 3BT1A 2K2SB 2FD6A 4G1MB 1HCGB 1L5GB 2OYEP 3NTBA 1CQEA 1A3PA 2G00L 4Z6AL 3QMOA 1G1QA 3HS7A 1UZJA 2WPME 1ADXA 1PGEA 4MMXB 1CVUA 2BQ7A 2JKHL 1FFMA 3N8WA 4Y6DB 3LC5B 1G1SA 1TPGA 4JZFL 2UWPB 2WYGB 3LAQA 3CENL 2DDUA 1EPHA 1WU1B 6COXA 1KIGL 1IQLL 4JYVL 3LN0A 3V64C 2XC5L 1DIYA 1XKBA 1EPJA 1HT5A 4MMYB 3FFGL 3KK6A 1GK5A 1P0SL 2PR3B 1ATEA 5JB8E 4XLWA 1MQ6L 1EPIA 4A94C 3F6UL 3KCGL 2P94L 4BXSA 1PRHA 1PTHA 2Y80B 4JZDL 2P93L 3BT2A 3ZYIB 1HAEA 4BTTA 5JVYA 3FBYA 1OB1C 2W2OE 5L30L 1FJSL 1N1IA 1F0SB 4Y71B 4D0EA 3GISX 3NJPC 1IGZA 1IOXA 4D90A 1EGFA 1N7DA 3N8WB 3EGFA 1HJ7A 2VWNL 1JV2B 3KL6B 4BDXA 2W3IB 2XBXL 1J9CL 3MQEA 1IQIL 3GCWE 1Z6EL 3N8XA 3POYA 5K0HB 2J2UB 2BOKL 2WPLE 1WHFA 3N8YB 3F1SB 3Q7DA 1HZ8A 3U7UG 2BO2A 5CKQA 5IKVA 2ADXA 2VH0B 1DQBA 4RUTA 4A7IA 4YT7L 2MGRA 1FF7A 4X8UL 2EI8B 2FLGA 2BQ6A 4M11A 4XBMA 4BDWA 1EQHA 1LPKA 1YUGA 2FLBL 1EAIC 2PHBB 4CUEA 1EBVA 1MQ5L 3IJEB 5IKRA 4O02B 3TBDA 2XC0L 1DDXA 1G1RA 1NFXB 2WPHE 2F9BL 4RRWA 1URKA 1WHEA 1F7EA 1KLOA 4Y76B 2AYLA 2W26B 4CSYA 3SW2A 3RR3A 4CUDA 4YT6L 1XFEA 1IQHL 3R05A 4LMFA 2I9BA 3OLUA 2H9EC 1IQEL 1CEJA 4X8TL 1NFYB 1JBUL 2KV4A 2P28B 1EQGA 2Y38A 2KNIA 2WG4B 2J95B 3IITB 2VWLL 2NPRA 3HO5A 1UZQA 1HT8A 2P3TA 3TZIA 1U67A 5JBBE 1W7XL 3M37L 4OTJA 4ZXXL 5IKTA 2J94B 1PFXL 3SOVA 2I9AA 2EI7B 1NPEB 2VVCK 3GCXE 5EGMB 2VWOL 4RRZA 3TK5B 4YZUB 1V3XB 4MMZB 5JW1A 2BQWA 4E1GA 3KQEL 2XBVL 4O1ZA 1IQNL 2D1JB 1L3YA 3C9AC 1XKAL 1BF9A 1G2MB 3TGFA 5KIRA 1HX2A 1IQGL 1IOEL 2PUQL 1G1TA 2P26A 1FE2A 1EZQB 1IJQA 4XL1A 3HS6A 5L2ZL 1EPGA 3KRKA 4RRXA 2W2QE 3M36L 4AQTA 1UZKA 3HPTA 3LC3B 1NT0A 2BOUA 3HO3A 3ZYJB 2UWOB 3P5BL 1IQJL 2UWLB 2XBYL 2RNLA 5COXA 4FM5A 2BOXA 3NT1A 1KLJL 1U8CB 4ISHL 3N8YA 2KL7A 4OTYA 4ZXYL 1EMNA 3LIWB 4Z0KB 1HAFA 3N8VA 3K9XA 1UZPA 2P3FN 4Y7BB 2W3KB 5KN5C 3HS5A 1RFNB 3MDLA 1NQLB 2RHPA 4JZEL 4COXA 3KQCL 3LTGD 3PGHA 3N8ZA 4TGFA 3ZYGA 3QH0A 1DVAL 1W8BL 3TK6B 1FSBA 4CUFA 3FCSB 5JVZA 2WPJE 3ENSA 2FLRL 1CVWL 1ATDA 1NZIA 2FZZL 1APOA 3CA7A 5CKMA 4ISIL 3U73A 2VJ3A 5I46L 5JBAE 2P95L 1TOZA 4C16A 1CCFA 2WYJB 1KSNB 3LN1A 2EI6B 4Z0LA 2W2ME 4RRYA 2GD4A 2P3FL 1O5DL 3CS7L 2W2NE 2WPKE 3NTGA 2M74A 2KB9A 2Y5HL 2Y7XB 1X7AL 2W2PE 3HO4A 2Y82B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0U A;  3H5C B;  5JBC E;  1IP0 A;  4NA9 L;  4Y7A B;  1C5M F;  2RA0 L;  4ZAE B;  4BTI A;  4NG9 L;  1ATB A;  3KQB L;  1YUF A;  1LQD A;  2Y7Z B;  4BTU A;  1Z6C A;  3TH3 L;  2OYU P;  3DEM A;  3KQD L;  1LPG A;  2XC4 L;  1IQK L;  1P9J A;  1SZB A;  1IQM L;  1DX5 I;  2J4I B;  1FAK L;  2B7D L;  4NGA L;  1F0R B;  1NFW B;  3ELA L;  4JYU L;  1Q4G A;  3LTF B;  1F7M A;  1IVO C;  2VWM K;  2WG3 C;  4PH9 A;  2WPI E;  1K36 A;  2XBW L;  1HRE A;  3SOQ A;  2W86 A;  5JB9 E;  1COU A;  5IKQ A;  1TLE A;  2YGP A;  2H9E L;  1APQ A;  1LPZ A;  4BXW A;  1FAX L;  4RS0 A;  2WFT A;  2VH6 B;  1YGC L;  2MGP A;  3Q3K B;  4ZH8 B;  2VVV L;  2Y81 B;  5F1A A;  1EMO A;  3OLT A;  3QCW A;  5FDQ A;  3CFW A;  5CIS A;  1IGX A;  2J34 B;  2MHP A;  1PXX A;  1QFK L;  1K37 A;  2Q1J B;  5CKN A;  1M1X B;  3ASI A;  1G2L B;  4X8S L;  1ZAQ A;  5E8D A;  4ZHA B;  1HRF A;  2P3U A;  2TGF A;  2WFX B;  2BZ6 L;  1YUK B;  2BMG A;  2J38 B;  1ATA A;  2VVU L;  4Y79 B;  1JL9 A;  5F19 A;  3BPS E;  2K2T A;  5L2Y L;  2CJI B;  1IQF L;  3SOB B;  2Y5F L;  1CCV A;  4X8V L;  2P16 L;  1KLI L;  1MOX C;  4D0F A;  1B9W A;  4M10 A;  2BOH A;  1LMJ A;  1XDT R;  3V65 B;  1YO8 A;  1NFU B;  2YGO A;  1AUT L;  4LOR A;  1CX2 A;  2Y5G L;  3BT1 A;  2K2S B;  2FD6 A;  4G1M B;  1HCG B;  1L5G B;  2OYE P;  3NTB A;  1CQE A;  1A3P A;  2G00 L;  4Z6A L;  3QMO A;  1G1Q A;  3HS7 A;  1UZJ A;  2WPM E;  1ADX A;  1PGE A;  4MMX B;  1CVU A;  2BQ7 A;  2JKH L;  1FFM A;  3N8W A;  4Y6D B;  3LC5 B;  1G1S A;  1TPG A;  4JZF L;  2UWP B;  2WYG B;  3LAQ A;  3CEN L;  2DDU A;  1EPH A;  1WU1 B;  6COX A;  1KIG L;  1IQL L;  4JYV L;  3LN0 A;  3V64 C;  2XC5 L;  1DIY A;  1XKB A;  1EPJ A;  1HT5 A;  4MMY B;  3FFG L;  3KK6 A;  1GK5 A;  1P0S L;  2PR3 B;  1ATE A;  5JB8 E;  4XLW A;  1MQ6 L;  1EPI A;  3F6U L;  3KCG L;  2P94 L;  4BXS A;  1PRH A;  1PTH A;  2Y80 B;  4JZD L;  2P93 L;  3BT2 A;  3ZYI B;  1HAE A;  4BTT A;  5JVY A;  3FBY A;  1OB1 C;  2W2O E;  5L30 L;  1FJS L;  1N1I A;  1F0S B;  4Y71 B;  4D0E A;  3GIS X;  3NJP C;  1IGZ A;  1IOX A;  4D90 A;  1EGF A;  1N7D A;  3N8W B;  3EGF A;  1HJ7 A;  2VWN L;  1JV2 B;  3KL6 B;  4BDX A;  2W3I B;  2XBX L;  1J9C L;  3MQE A;  1IQI L;  3GCW E;  1Z6E L;  3N8X A;  3POY A;  5K0H B;  2J2U B;  2BOK L;  2WPL E;  1WHF A;  3N8Y B;  3F1S B;  3Q7D A;  1HZ8 A;  3U7U G;  2BO2 A;  5CKQ A;  5IKV A;  2ADX A;  2VH0 B;  1DQB A;  4RUT A;  4A7I A;  4YT7 L;  2MGR A;  1FF7 A;  4X8U L;  2EI8 B;  2FLG A;  2BQ6 A;  4M11 A;  4XBM A;  4BDW A;  1EQH A;  1LPK A;  1YUG A;  2FLB L;  1EAI C;  2PHB B;  4CUE A;  1EBV A;  1MQ5 L;  3IJE B;  5IKR A;  4O02 B;  3TBD A;  2XC0 L;  1DDX A;  1G1R A;  1NFX B;  2WPH E;  2F9B L;  4RRW A;  1URK A;  1WHE A;  1F7E A;  1KLO A;  4Y76 B;  2AYL A;  2W26 B;  4CSY A;  3SW2 A;  3RR3 A;  4CUD A;  4YT6 L;  1XFE A;  1IQH L;  3R05 A;  4LMF A;  2I9B A;  3OLU A;  1IQE L;  1CEJ A;  4X8T L;  1NFY B;  1JBU L;  2KV4 A;  2P28 B;  1EQG A;  2Y38 A;  2WG4 B;  2J95 B;  3IIT B;  2VWL L;  2NPR A;  3HO5 A;  1UZQ A;  1HT8 A;  2P3T A;  3TZI A;  1U67 A;  5JBB E;  1W7X L;  3M37 L;  4OTJ A;  4ZXX L;  5IKT A;  2J94 B;  1PFX L;  3SOV A;  2I9A A;  2EI7 B;  1NPE B;  2VVC K;  3GCX E;  5EGM B;  2VWO L;  4RRZ A;  3TK5 B;  4YZU B;  1V3X B;  4MMZ B;  5JW1 A;  2BQW A;  4E1G A;  3KQE L;  2XBV L;  4O1Z A;  1IQN L;  2D1J B;  1L3Y A;  3C9A C;  1XKA L;  1BF9 A;  1G2M B;  3TGF A;  5KIR A;  1HX2 A;  1IQG L;  1IOE L;  2PUQ L;  1G1T A;  2P26 A;  1FE2 A;  1EZQ B;  1IJQ A;  4XL1 A;  3HS6 A;  5L2Z L;  1EPG A;  3KRK A;  4RRX A;  2W2Q E;  3M36 L;  4AQT A;  1UZK A;  3HPT A;  3LC3 B;  1NT0 A;  2BOU A;  3HO3 A;  3ZYJ B;  2UWO B;  3P5B L;  1IQJ L;  2UWL B;  2XBY L;  2RNL A;  5COX A;  4FM5 A;  2BOX A;  3NT1 A;  1KLJ L;  1U8C B;  4ISH L;  3N8Y A;  2KL7 A;  4OTY A;  4ZXY L;  1EMN A;  3LIW B;  4Z0K B;  1HAF A;  3N8V A;  3K9X A;  1UZP A;  2P3F N;  4Y7B B;  2W3K B;  5KN5 C;  3HS5 A;  1RFN B;  3MDL A;  1NQL B;  2RHP A;  4JZE L;  4COX A;  3KQC L;  3LTG D;  3PGH A;  3N8Z A;  4TGF A;  3ZYG A;  3QH0 A;  1DVA L;  1W8B L;  3TK6 B;  1FSB A;  4CUF A;  3FCS B;  5JVZ A;  2WPJ E;  3ENS A;  2FLR L;  1CVW L;  1ATD A;  1NZI A;  2FZZ L;  1APO A;  3CA7 A;  5CKM A;  4ISI L;  3U73 A;  2VJ3 A;  5I46 L;  5JBA E;  2P95 L;  1TOZ A;  4C16 A;  1CCF A;  2WYJ B;  1KSN B;  3LN1 A;  2EI6 B;  4Z0L A;  2W2M E;  4RRY A;  2GD4 A;  2P3F L;  1O5D L;  3CS7 L;  2W2N E;  2WPK E;  3NTG A;  2M74 A;  2KB9 A;  2Y5H L;  2Y7X B;  1X7A L;  2W2P E;  3HO4 A;  2Y82 B; 
#chains in the Genus database with same CATH topology
 1I0U A;  3H5C B;  5JBC E;  1IP0 A;  4NA9 L;  4Y7A B;  1C5M F;  2RA0 L;  4ZAE B;  4BTI A;  4NG9 L;  1ATB A;  3KQB L;  1YUF A;  1LQD A;  2Y7Z B;  4BTU A;  1Z6C A;  3TH3 L;  2OYU P;  3DEM A;  3KQD L;  2BSF A;  1LPG A;  2XC4 L;  1IQK L;  1P9J A;  1SZB A;  1IQM L;  1V1I A;  1DX5 I;  2J4I B;  1FAK L;  2B7D L;  4NGA L;  1F0R B;  1NFW B;  3ELA L;  4JYU L;  1Q4G A;  3LTF B;  1F7M A;  2YGQ A;  1IVO C;  2VWM K;  2WG3 C;  4PH9 A;  2WPI E;  1K36 A;  2XBW L;  1HRE A;  3SOQ A;  2W86 A;  5JB9 E;  1COU A;  5IKQ A;  1TLE A;  2YGP A;  2H9E L;  1LMM A;  1APQ A;  1LPZ A;  4BXW A;  1FAX L;  2WZP P;  4RS0 A;  2WFT A;  2VH6 B;  1YGC L;  2MGP A;  3Q3K B;  4ZH8 B;  2VVV L;  2Y81 B;  5F1A A;  1EMO A;  3OLT A;  3QCW A;  5FDQ A;  3CFW A;  5CIS A;  1IGX A;  2J34 B;  2MHP A;  1PXX A;  1QFK L;  1K37 A;  2Q1J B;  5CKN A;  1M1X B;  3ASI A;  3S6X A;  1G2L B;  4X8S L;  1ZAQ A;  5E8D A;  4ZHA B;  1HRF A;  2P3U A;  2TGF A;  2WFX B;  2BZ6 L;  1YUK B;  2BMG A;  2J38 B;  1ATA A;  2VVU L;  4GU3 A;  4Y79 B;  1JL9 A;  5F19 A;  3BPS E;  2K2T A;  5L2Y L;  2CJI B;  1IQF L;  3SOB B;  2Y5F L;  1CCV A;  4X8V L;  2P16 L;  1KLI L;  1MOX C;  4D0F A;  1B9W A;  2JJL A;  2BOH A;  4M10 A;  1LMJ A;  1XDT R;  3V65 B;  1YO8 A;  1NFU B;  2YGO A;  1AUT L;  4LOR A;  1CX2 A;  2Y5G L;  3BT1 A;  2K2S B;  2FD6 A;  4G1M B;  1HCG B;  1L5G B;  2OYE P;  3NTB A;  1CQE A;  1A3P A;  2G00 L;  4Z6A L;  3QMO A;  1G1Q A;  3HS7 A;  1UZJ A;  2WPM E;  1ADX A;  1PGE A;  1QIU A;  4MMX B;  1CVU A;  2BQ7 A;  2JKH L;  1FFM A;  3N8W A;  4Y6D B;  3LC5 B;  1G1S A;  1TPG A;  4JZF L;  2UWP B;  2WYG B;  3LAQ A;  3CEN L;  2DDU A;  1EPH A;  1WU1 B;  6COX A;  1KIG L;  1IQL L;  4JYV L;  3LN0 A;  3V64 C;  2XC5 L;  1DIY A;  1XKB A;  1EPJ A;  1HT5 A;  4MMY B;  3FFG L;  3KK6 A;  1GK5 A;  1P0S L;  2PR3 B;  1ATE A;  5JB8 E;  4XLW A;  1MQ6 L;  1EPI A;  4A94 C;  3F6U L;  3KCG L;  2P94 L;  4BXS A;  1PRH A;  1PTH A;  2Y80 B;  4JZD L;  2P93 L;  3BT2 A;  3ZYI B;  1HAE A;  4BTT A;  5JVY A;  3FBY A;  2HOX A;  1OB1 C;  2W2O E;  5L30 L;  1FJS L;  1N1I A;  1F0S B;  4Y71 B;  4D0E A;  3GIS X;  3NJP C;  1IGZ A;  1IOX A;  4D90 A;  1EGF A;  1N7D A;  3N8W B;  3EGF A;  1HJ7 A;  2VWN L;  1JV2 B;  3KL6 B;  2HOR A;  2W3I B;  2XBX L;  4BDX A;  1J9C L;  3MQE A;  1IQI L;  3GCW E;  1Z6E L;  3N8X A;  3POY A;  5K0H B;  2J2U B;  2BOK L;  2WPL E;  1WHF A;  3N8Y B;  3F1S B;  3Q7D A;  1HZ8 A;  3U7U G;  2BO2 A;  5CKQ A;  5IKV A;  2ADX A;  2VH0 B;  1DQB A;  1V1H A;  4RUT A;  4A7I A;  4YT7 L;  2MGR A;  1FF7 A;  4X8U L;  2EI8 B;  2FLG A;  2BQ6 A;  4M11 A;  4XBM A;  4BDW A;  1EQH A;  1LPK A;  1YUG A;  2FLB L;  1EAI C;  2PHB B;  4CUE A;  1EBV A;  1MQ5 L;  3IJE B;  5IKR A;  4O02 B;  3TBD A;  2XC0 L;  1DDX A;  1G1R A;  1NFX B;  2WPH E;  2F9B L;  4RRW A;  1URK A;  1WHE A;  1F7E A;  1KLO A;  4Y76 B;  2AYL A;  2W26 B;  4CSY A;  3SW2 A;  3RR3 A;  4CUD A;  4YT6 L;  1XFE A;  1IQH L;  3R05 A;  4LMF A;  2I9B A;  3OLU A;  2H9E C;  1IQE L;  1CEJ A;  4X8T L;  1NFY B;  1JBU L;  2KV4 A;  2P28 B;  1EQG A;  2Y38 A;  2KNI A;  2WG4 B;  2J95 B;  3IIT B;  2VWL L;  2NPR A;  3HO5 A;  1UZQ A;  1HT8 A;  2P3T A;  3TZI A;  1U67 A;  5JBB E;  1W7X L;  3M37 L;  4OTJ A;  4ZXX L;  5IKT A;  2J94 B;  1PFX L;  3SOV A;  2I9A A;  2EI7 B;  1NPE B;  2VVC K;  3GCX E;  5EGM B;  4GU4 A;  2VWO L;  4RRZ A;  3TK5 B;  4YZU B;  1V3X B;  4MMZ B;  5JW1 A;  2BQW A;  4E1G A;  2XBV L;  3KQE L;  4O1Z A;  1IQN L;  2D1J B;  1L3Y A;  3C9A C;  1XKA L;  1BF9 A;  1G2M B;  3TGF A;  2BT8 A;  5KIR A;  1HX2 A;  1IQG L;  1IOE L;  2PUQ L;  1G1T A;  2P26 A;  1FE2 A;  1EZQ B;  1IJQ A;  4XL1 A;  3HS6 A;  5L2Z L;  1EPG A;  3KRK A;  4RRX A;  2W2Q E;  3M36 L;  1LK9 A;  4AQT A;  1UZK A;  3HPT A;  3LC3 B;  1NT0 A;  2BOU A;  3HO3 A;  3ZYJ B;  2UWO B;  3P5B L;  1IQJ L;  2VRS A;  2UWL B;  2XBY L;  2RNL A;  5COX A;  4FM5 A;  2BOX A;  3NT1 A;  1KLJ L;  1U8C B;  3N8Y A;  4ISH L;  2KL7 A;  4OTY A;  4ZXY L;  1EMN A;  3LIW B;  4Z0K B;  1HAF A;  3N8V A;  3K9X A;  1UZP A;  2P3F N;  4Y7B B;  2W3K B;  5KN5 C;  3HS5 A;  1RFN B;  3MDL A;  1NQL B;  2RHP A;  4JZE L;  4COX A;  3KQC L;  3LTG D;  3PGH A;  3N8Z A;  4TGF A;  3ZYG A;  3QH0 A;  1DVA L;  1W8B L;  3TK6 B;  1FSB A;  4CUF A;  3FCS B;  5JVZ A;  2WPJ E;  3ENS A;  2FLR L;  1CVW L;  1ATD A;  1NZI A;  2FZZ L;  1APO A;  3CA7 A;  5CKM A;  4ISI L;  3U73 A;  2VJ3 A;  5I46 L;  5JBA E;  2P95 L;  1TOZ A;  4C16 A;  1CCF A;  2WYJ B;  1KSN B;  3LN1 A;  2EI6 B;  4Z0L A;  2W2M E;  4RRY A;  2GD4 A;  2P3F L;  2BT7 A;  1O5D L;  3CS7 L;  2W2N E;  2WPK E;  3NTG A;  2M74 A;  2KB9 A;  2Y5H L;  2Y7X B;  1KKE A;  1X7A L;  2W2P E;  3HO4 A;  2Y82 B; 
#chains in the Genus database with same CATH homology
 1I0U A;  3H5C B;  5JBC E;  1IP0 A;  4NA9 L;  4Y7A B;  1C5M F;  2RA0 L;  4ZAE B;  4BTI A;  4NG9 L;  1ATB A;  3KQB L;  1YUF A;  1LQD A;  2Y7Z B;  4BTU A;  1Z6C A;  3TH3 L;  2OYU P;  3DEM A;  3KQD L;  1LPG A;  2XC4 L;  1IQK L;  1P9J A;  1SZB A;  1IQM L;  1DX5 I;  2J4I B;  1FAK L;  2B7D L;  4NGA L;  1F0R B;  1NFW B;  3ELA L;  4JYU L;  1Q4G A;  3LTF B;  1F7M A;  2YGQ A;  1IVO C;  2VWM K;  2WG3 C;  4PH9 A;  2WPI E;  1K36 A;  2XBW L;  1HRE A;  3SOQ A;  2W86 A;  5JB9 E;  1COU A;  5IKQ A;  1TLE A;  2YGP A;  2H9E L;  1LMM A;  1APQ A;  1LPZ A;  4BXW A;  1FAX L;  2WZP P;  4RS0 A;  2WFT A;  2VH6 B;  1YGC L;  2MGP A;  3Q3K B;  4ZH8 B;  2VVV L;  2Y81 B;  5F1A A;  1EMO A;  3OLT A;  3QCW A;  5FDQ A;  3CFW A;  5CIS A;  1IGX A;  2J34 B;  2MHP A;  1PXX A;  1QFK L;  1K37 A;  2Q1J B;  5CKN A;  1M1X B;  3ASI A;  3S6X A;  1G2L B;  4X8S L;  1ZAQ A;  5E8D A;  4ZHA B;  1HRF A;  2P3U A;  2TGF A;  2WFX B;  2BZ6 L;  1YUK B;  2BMG A;  2J38 B;  1ATA A;  2VVU L;  4Y79 B;  1JL9 A;  5F19 A;  3BPS E;  2K2T A;  5L2Y L;  2CJI B;  1IQF L;  3SOB B;  2Y5F L;  1CCV A;  4X8V L;  2P16 L;  1KLI L;  1MOX C;  4D0F A;  1B9W A;  4M10 A;  2BOH A;  1LMJ A;  1XDT R;  3V65 B;  1YO8 A;  1NFU B;  2YGO A;  1AUT L;  4LOR A;  1CX2 A;  2Y5G L;  3BT1 A;  2K2S B;  2FD6 A;  4G1M B;  1HCG B;  1L5G B;  2OYE P;  3NTB A;  1CQE A;  1A3P A;  2G00 L;  4Z6A L;  3QMO A;  1G1Q A;  3HS7 A;  1UZJ A;  2WPM E;  1ADX A;  1PGE A;  4MMX B;  1CVU A;  2BQ7 A;  2JKH L;  1FFM A;  3N8W A;  4Y6D B;  3LC5 B;  1G1S A;  1TPG A;  4JZF L;  2UWP B;  2WYG B;  3LAQ A;  3CEN L;  2DDU A;  1EPH A;  1WU1 B;  6COX A;  1KIG L;  1IQL L;  4JYV L;  3LN0 A;  3V64 C;  2XC5 L;  1DIY A;  1XKB A;  1EPJ A;  1HT5 A;  4MMY B;  3FFG L;  3KK6 A;  1GK5 A;  1P0S L;  2PR3 B;  1ATE A;  5JB8 E;  4XLW A;  1MQ6 L;  1EPI A;  4A94 C;  3F6U L;  3KCG L;  2P94 L;  4BXS A;  1PRH A;  1PTH A;  2Y80 B;  4JZD L;  2P93 L;  3BT2 A;  3ZYI B;  1HAE A;  4BTT A;  5JVY A;  3FBY A;  1OB1 C;  2W2O E;  5L30 L;  1FJS L;  1N1I A;  1F0S B;  4Y71 B;  4D0E A;  3GIS X;  3NJP C;  1IGZ A;  1IOX A;  4D90 A;  1EGF A;  1N7D A;  3N8W B;  3EGF A;  1HJ7 A;  2VWN L;  1JV2 B;  3KL6 B;  4BDX A;  2W3I B;  2XBX L;  1J9C L;  3MQE A;  1IQI L;  3GCW E;  1Z6E L;  3N8X A;  3POY A;  5K0H B;  2J2U B;  2BOK L;  2WPL E;  1WHF A;  3N8Y B;  3F1S B;  3Q7D A;  1HZ8 A;  3U7U G;  2BO2 A;  5CKQ A;  5IKV A;  2ADX A;  2VH0 B;  1DQB A;  4RUT A;  4A7I A;  4YT7 L;  2MGR A;  1FF7 A;  4X8U L;  2EI8 B;  2FLG A;  2BQ6 A;  4M11 A;  4XBM A;  4BDW A;  1EQH A;  1LPK A;  1YUG A;  2FLB L;  1EAI C;  2PHB B;  4CUE A;  1EBV A;  1MQ5 L;  3IJE B;  5IKR A;  4O02 B;  3TBD A;  2XC0 L;  1DDX A;  1G1R A;  1NFX B;  2WPH E;  2F9B L;  4RRW A;  1URK A;  1WHE A;  1F7E A;  1KLO A;  4Y76 B;  2AYL A;  2W26 B;  4CSY A;  3SW2 A;  3RR3 A;  4CUD A;  4YT6 L;  1XFE A;  1IQH L;  3R05 A;  4LMF A;  2I9B A;  3OLU A;  2H9E C;  1IQE L;  1CEJ A;  4X8T L;  1NFY B;  1JBU L;  2KV4 A;  2P28 B;  1EQG A;  2Y38 A;  2KNI A;  2WG4 B;  2J95 B;  3IIT B;  2VWL L;  2NPR A;  3HO5 A;  1UZQ A;  1HT8 A;  2P3T A;  3TZI A;  1U67 A;  5JBB E;  1W7X L;  3M37 L;  4OTJ A;  4ZXX L;  5IKT A;  2J94 B;  1PFX L;  3SOV A;  2I9A A;  2EI7 B;  1NPE B;  2VVC K;  3GCX E;  5EGM B;  2VWO L;  4RRZ A;  3TK5 B;  4YZU B;  1V3X B;  4MMZ B;  5JW1 A;  2BQW A;  4E1G A;  3KQE L;  2XBV L;  4O1Z A;  1IQN L;  2D1J B;  1L3Y A;  3C9A C;  1XKA L;  1BF9 A;  1G2M B;  3TGF A;  5KIR A;  1HX2 A;  1IQG L;  1IOE L;  2PUQ L;  1G1T A;  2P26 A;  1FE2 A;  1EZQ B;  1IJQ A;  4XL1 A;  3HS6 A;  5L2Z L;  1EPG A;  3KRK A;  4RRX A;  2W2Q E;  3M36 L;  4AQT A;  1UZK A;  3HPT A;  3LC3 B;  1NT0 A;  2BOU A;  3HO3 A;  3ZYJ B;  2UWO B;  3P5B L;  1IQJ L;  2UWL B;  2XBY L;  2RNL A;  5COX A;  4FM5 A;  2BOX A;  3NT1 A;  1KLJ L;  1U8C B;  4ISH L;  3N8Y A;  2KL7 A;  4OTY A;  4ZXY L;  1EMN A;  3LIW B;  4Z0K B;  1HAF A;  3N8V A;  3K9X A;  1UZP A;  2P3F N;  4Y7B B;  2W3K B;  5KN5 C;  3HS5 A;  1RFN B;  3MDL A;  1NQL B;  2RHP A;  4JZE L;  4COX A;  3KQC L;  3LTG D;  3PGH A;  3N8Z A;  4TGF A;  3ZYG A;  3QH0 A;  1DVA L;  1W8B L;  3TK6 B;  1FSB A;  4CUF A;  3FCS B;  5JVZ A;  2WPJ E;  3ENS A;  2FLR L;  1CVW L;  1ATD A;  1NZI A;  2FZZ L;  1APO A;  3CA7 A;  5CKM A;  4ISI L;  3U73 A;  2VJ3 A;  5I46 L;  5JBA E;  2P95 L;  1TOZ A;  4C16 A;  1CCF A;  2WYJ B;  1KSN B;  3LN1 A;  2EI6 B;  4Z0L A;  2W2M E;  4RRY A;  2GD4 A;  2P3F L;  1O5D L;  3CS7 L;  2W2N E;  2WPK E;  3NTG A;  2M74 A;  2KB9 A;  2Y5H L;  2Y7X B;  1X7A L;  2W2P E;  3HO4 A;  2Y82 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...