5JCJD

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjD00
1SBYA 5B4VA 2EW8A 3GQVA 4CMCA 3OBBA 3PHJA 1LSOA 2AEJA 4OKNA 3VTFA 1NR1A 3IUSA 4AJKA 3QLJA 4C4OA 3UOGA 1K0UA 2NVUB 2Z5LA 4OXNA 4WEOA 4EBFA 2FPGA 2CFCA 5A3JA 4J2HA 4H3VA 4WLNA 4TRMA 1OAAA 2Q2QA 4RF2A 2PGLA 1NP3A 2Q4EA 5IDYA 3QVOA 3MTGA 3N74A 4HX5A 1QKIA 3GVCA 4BNIA 1VL6A 4IINA 4CMEC 1WDKA 4GWGA 3RASA 3V1YA 1B8VA 3I52A 4FDAA 1QLJA 1H2BA 2NVUA 2WYUA 3JQ9A 4PLVA 4Y9DA 2R00A 4QO8A 3STHA 4CR6A 2GF2A 2CDCA 3OJFA 4X54A 3G3EA 3GDFA 1N7GA 6LDHA 5FF9A 3EZYA 1T1SA 4KUEA 4BQRA 2EERA 1AGNA 1HDCA 3TZCA 4FS3A 1YBVA 2NWQA 2B83A 3ETGA 1XSEA 4DGSA 3ETEA 3RBXA 4A7PA 4NBUA 3PEFA 4TZTA 1LSSA 3C7CB 3Q3CA 4IDFA 5MDHA 3IKTA 2YUTA 2OP0A 4XEHA 3ORFA 4PG8A 2Q4BA 1H6BA 3ZN2A 3ZWNA 1SOWA 2OBYA 4QX6A 1YL5A 4Z0HO 4DC0A 1RYEA 1C1DB 2D0IA 4NDNE 4H15A 1E3WB 3U09A 4GBJA 3PHHA 2WE8A 2DBVO 3UKOA 3D4NA 3R3JA 3KETA 1E7YA 4Z3DA 2QG4A 3UN1A 4CM8B 2XF8A 1I2CA 1BG6A 1F17A 3DBRB 1KIFA 1MA0A 1O0SA 4B3HA 3KXDA 4RVSA 1J4AA 3WNQA 2F00A 1LDGA 5TT1A 1W4ZA 1C1DA 3F3SA 4H7PA 2QYTA 1E7RA 5T8KC 3ZU3A 4I5GA 3TRIA 4WLFA 4EDFA 4KZPA 4W4TA 2ZB8A 4L8VA 3S2FA 5DCWA 4MO2A 1DIGA 2EP5A 4NMHA 5L4SA 3WGHA 1MXHA 4C7JA 3BIOA 1K6JA 4JQCA 1E0DA 1KC1A 2Y99A 4FBGA 1LLCA 5U9CA 1HDYA 3VVBA 3PHGA 1KVUA 2W2LA 5AXDA 2O23A 3CH6A 5KKAA 1YQGA 1UR5A 4JIGA 1J0XO 2E37A 4NR0A 4BV8A 3JQAD 2DBZA 4OMUA 4BO0A 2HRZA 5IAAA 3VPXA 3PYXA 2EXXA 2Q46A 1EUCA 4O6VA 4BGEA 1GUYA 3JQDA 5C7LO 3VPHA 1B7GO 1E7MA 3PJEA 4ZGWA 1SB8A 5AOVA 5BSEA 3PQFA 5GZ3A 5COBA 2ILTA 1NQ5A 1W8DA 4W7IA 3VPGA 3VPFA 4E5PA 4TRNA 2HLPA 2OP1A 4M1QA 1ORRA 2I3AA 1T25A 1I0ZA 4L4XA 2Y1CA 1XDWA 1PTJA 5K6AA 2ZCVA 4HWKA 3Q2KA 4KQWA 4L4RA 4Q9NA 4J91A 2BFAA 4A10A 1HZZA 3AU9A 1PWXA 1H93A 2I67A 3QSGA 4XR9A 1U3TA 1CJCA 4JGBA 2B4TO 4IJKA 3U49A 1HTBA 3K9QO 5DP1A 1LQUA 2PH5A 3FWZA 4CMIB 1LSUA 2ZQYA 2DTEA 4RVGA 5G0TA 4EEZA 1R12A 3BYZA 3DMTA 1FMCA 3JD3A 3ON5A 3TF5A 5HRUA 3WBBA 3ICCA 1FDTA 4WLEA 1DFIA 1DJQA 4DMLA 2VZ8A 2AG5A 1NFRA 3L07A 4DTIA 1B0AA 1ISJA 2FPPA 4RJTA 4HADA 4NJMA 4HBGA 1W73A 1B8UA 3ST7A 4XQEA 3OEYA 5FI5A 4YT5A 3W1VA 1QSGA 2GCGA 1EK6A 4RQUA 4CMIA 4M55A 4PLZA 3U9LA 2Y67A 1IE3A 1EE2A 3KRTA 1M67A 3GH3A 1YB1A 4GX5A 3TN7A 4R5MA 2IYOA 3DOOA 1GQYA 4YAKA 3H9JA 4HNHA 2AEFA 1E92A 3GPDG 2I66A 4YT8A 4IXWA 4GPD1 4WE3A 2BH9A 3E82A 3GR6A 1LDEA 2RBEA 4YXFA 3L9WA 9LDTA 4ZQHA 3H65A 1EUDA 3WWZA 3HFGA 4MP6A 1E3SA 5FEUA 4EGFA 3L9XA 4UEKA 4QUKA 2G82A 1PR9A 2XXBA 4NHEA 3WG9A 2G76A 4YA6A 4FR5A 1N8KA 1X1EA 4YRBA 3LK7A 3RAJA 3RD5A 4ND1A 4XIYA 2J5QA 3P2OA 4NBVA 3ITKA 1P1RA 1SMKA 4ALLA 1I24A 4CMAA 2I3GA 4ND5A 1PZHA 3KBOA 3BTVA 2Q99A 1KEVA 1QORA 1YB5A 1EVIA 4PIVA 2E6UX 4LISA 4Y98A 1T4DA 1GFSA 4YAGA 4N18A 4PLTA 4RVFA 4XD2A 5H82A 5BNFA 5A04A 2BFPA 3M1AA 1I30A 3INTA 5GZ1A 2LDXA 4XR4A 4DPKA 1YDEA 2PWZA 1YL7A 5L4LA 4CV1A 3FPLA 2QHXA 1D1SA 2A92A 2Z95A 2D5CA 4RPGA 2DFVA 2ZKLA 1ZXBA 3RFTA 5L4NA 3D7LA 3KSZO 4A0SA 2Y1EA 4CM4B 1PL8A 3IIEA 2UUPA 1I2BA 4PRKA 3RUCA 4E5NA 1A9YA 5JDCA 4NBWA 4PG7A 3FNFA 5IZCC 1GZ4A 1UH5A 2AQ8A 3U5TA 1KC3A 3I1JA 1C0KA 9LDBA 4U6SA 1BSVA 1T4BA 3ZWVA 2JFHA 4F3YA 3DONA 1SNYA 3AFMA 2D1YA 3JQGB 4D44A 4CM4A 1DRWA 3PIIA 3SC6A 4NFYA 1BXZA 3DC2A 1H0KA 2HJSA 1JKIA 4BNKA 4OM8A 1Y9AA 1E7SA 2P4QA 1UXGA 4AICA 5H83A 1UP7A 3GVPA 5L45A 3NJ4A 4UUOA 1ULUA 3CXRA 2NSDA 3P7MA 4U0KA 5LCXA 3C7AA 3FD8A 4ZJUA 2GZ2A 1ISHA 3AW9A 1BDBA 3JQGA 4IS2A 2UDPA 4G65A 4FIZA 3DBLB 1PGJA 1FDWA 5HS6A 3EMKA 5L40A 4R5HA 2GERA 2OORA 5B4UA 1QLHA 1LDBA 2GZ1A 2B5VA 5A9TA 2PZMA 3AY3A 4KWHA 3S8MA 5JDIC 2A94A 3F1KA 1M2WA 4BNHA 1X13A 3NX4A 1LBEA 3TOXA 1P1HA 4S1VA 2Y68A 2CVQA 2HQ1A 5A9SA 1YGYA 1B14A 5F5NA 2Y0CA 3C3XA 4RO0A 4DUPA 2CF5A 3DBLA 3OH8A 4RPHA 2QRJA 2D5AA 2UUOA 2AQHA 1FXSA 3PYMA 4GL4A 3ZU2A 1N92A 4D0RA 3ASUA 4QT0A 1DC6A 1Q7GA 1V3UA 4JJFA 4OHUA 4RF5A 1ISMA 4BKRA 4Y6RA 5BNTA 1X14A 3PRJA 4FN4A 4WPGA 2J3JA 1SPXA 4FCCA 1Z6ZA 4JNKA 1LDNA 4J16A 4R9SA 3ZWAA 2CD9A 5CAEA 2PGDA 4BNMA 3SJUA 3Q9NA 1IZ0A 1Z7BA 2O4UX 4CUZA 5ITVA 4AJ4A 3KVOA 4GVLA 1VJ0A 2B0JA 3QHAA 4FFOA 4PLWA 3I4FA 4CUKA 3QWAA 5KOIA 3UH1A 1XU7A 2AMFA 2VUTA 4OXYA 4M8SA 3ZW9A 1KEUA 2Q1SA 1K2WA 4K6CA 5LC1A 3ENNA 4YJHB 4FQ8A 5L7TA 3HUDA 4RORA 3C7DB 3ZGYA 1DPGA 3V2UA 4J90A 1EQ2A 4GGPA 1GV0A 3C1OA 4J9UE 5DBGA 3LT4A 2PD6A 2Y1FA 1X0VA 3P19A 3I6QA 1RWBA 1DHTA 1CDOA 3IDSA 4E12A 1XEAA 5TS3A 3E48A 3LVFO 1ONPA 4YJHA 3ZHZA 2X0JA 1QYCA 1N1EA 2EP7A 3FR7A 1GYPA 1HDOA 2HAEA 3ANNA 1U8FO 3RUEA 1R0SA 2EJVA 1F14A 3NGXA 4CV0A 3BHIA 1PZFA 2HK8A 1LEHA 4E2ZA 2VRCD 3GHHA 4LSMA 4WGGA 5JCXA 3BAZA 3MCVA 3GGPA 3ULKA 4B79A 1GZ3A 1RPNA 1WXDA 4QTZA 1R4MB 4EJ6A 4J4TA 1E1LA 4WNCA 3L0DA 3TNLA 1KEWA 2DVMA 4YR9A 1U1IA 4B7XA 1C1XB 1D7OA 1RM4A 4R01A 3WR5A 4CJXA 1NVMB 2JHGA 2H63A 4DIOA 1NVGA 3RIHA 5DULA 3TL2A 4IDBA 4BO4A 5G4KA 3JSAA 4LCEA 1PJLA 1H5QA 5JC8A 2AHRA 2Q1WA 5AXCA 1R4MA 1B8PA 4GLLA 3GUCA 4MP3A 3PK0A 2X58A 4MVJF 2VUUA 4NBTA 2YW9A 5HA5A 3BMNB 3PXXA 1C1XA 1T2AA 3FWNA 1V9LA 3JYNA 1M76A 2YDXA 3F46A 3E9NA 2EWMA 4Z9FA 2GNAA 4YJFB 1N2SA 1XELA 3H9GA 1LC3A 3RSHA 3O26A 3GT0A 1TEHA 1ARZA 1IPEA 3E5MA 2BMAA 3EUWA 4A03A 5TQVA 3WLEA 3BMNA 3ZDFA 4XB2A 3VZPA 5ICSA 4WASA 5HBRA 2H9IA 2HMWA 4TQGA 5CPFA 1ZCJA 1ENOA 2JD2A 1QYVA 4MPDA 1BXGB 2VYVA 4ZD6A 1GADO 5IN4A 3B70A 4YJFA 4CM1A 4OOEA 4UREA 1UAYA 3RBZA 5B4TA 3H8VA 4IGEA 4CLRB 4CV2A 2C5EA 1MFPA 4W6ZA 2POQX 2I5PO 5CHEA 1E1NA 1F12A 3I9MA 5ADHA 4JX8A 4Q3EA 4JCOA 4ZRMA 2QW8A 4R3NA 1VE9A 5F1KA 2J6IA 3HG7A 2C54A 3CMMA 3DBVO 3UICA 3GVXA 3PZBA 5JC1A 1ZK0A 3HB5X 1N1GA 1ZEJA 4IDEA 4EUFA 5C37A 4Q3BA 4OGWA 1N7HA 2CF6A 2VHWA 4DA9A 4ESOA 2CUKA 2EKPA 1NNUA 5ES3A 3DHYA 1I36A 1LXCA 5DN9A 5GZ6A 5DF1A 3QP9A 5JY1A 3SXPA 1LA2A 4RDIA 4MKXA 4OIMA 3KUXA 4IPTA 1G1AA 3DZFA 2Q2VA 4B8WA 7MDHA 1UZNA 3OA2A 1GD1O 2P9GA 1VPDA 1GAEO 3BA1A 3KEOA 3PDUA 3W8EA 2Q45A 3WYBA 4JXKA 1XLTA 2YHUA 1C0PA 2JFGA 3PGJA 2NVBA 4Y8VA 3OM9A 4NJOA 2X5JO 5EIOA 2VYND 1PJ3A 1T2EA 4ZICA 4E5KA 2IZ1A 4LCJA 2DPHA 3KO8A 2ZTLA 3WGYA 2PZJA 4YTEA 3UCXA 5I8WA 5KWEA 4JK3A 3TQHA 4EITA 2BI7A 2WSBA 3ZWBA 3GNSA 4AVYA 4YJGA 1X15A 4CMHA 2PK3A 3KZVA 5GMOA 4CLXA 2FSSA 4CLEA 4PRLA 4XB1A 4BL5A 2NU7A 3FRJA 1LC0A 4MDHA 1WZEA 2O7SA 4RF4A 4TSKA 3WGIA 1WMAA 4WOKA 1UAGA 1LNQA 2CDAA 4BNTA 4G2NA 4RVHA 4YACA 4B3JA 4CM7A 2O3JA 1AE1A 2PD3A 3WFIA 4ALMA 4BKQA 2BGKA 1CF2O 1W6UA 3WYCA 2GN8A 1JW9B 2Z1MA 4CM5A 1XIVA 1J6UA 2ZB4A 1E6WA 1PS8A 1YQXA 4PLPA 4PG4A 4BNVA 4U0JA 4IY1A 4E30A 3KTDA 2EGGA 2Q50A 4OO3A 1ZO8A 4J1NA 3NDIA 3SBOA 3PFFA 2O3RA 5FYDA 3VPSA 4EW6A 4F6CA 3GMSA 3VTZA 2GR9A 4RZIA 3TJRA 3HHPA 1YH3A 1YJQA 2GLXA 2IEBA 3PWSA 1R4NB 3AOEA 1DIAA 2FRDA 4I9NA 4D3DA 1Y5RA 1VI2A 1KEPA 1T2DA 3S1LA 5FWNA 2NLOA 1IULA 1ZVMA 1MFZA 3LDHA 3PFWO 4DL9A 2YQ4A 4I08A 1GUFA 1NPTO 4WOJA 5JYDA 1ZIDA 4XRGA 2I65A 1HDRA 3ZV3A 2P4HX 4KQXA 2RIRA 1XKQA 4EZBA 1AXGA 2B37A 1R4NA 3IQDB 1HDGO 2O2YA 2YDYA 3WYEA 5JMWA 1A71A 4PZCA 2FWMX 2X5OA 2JD0A 1LDYA 3NT4A 4IS3A 5I7FA 2X4GA 1LTHR 2IODA 1KBZA 2CDBA 2RH8A 1CRWG 3ETDA 3GNQA 3Q9UA 3DB2A 3FPCA 3G0OA 4XDZA 3MJ4A 2ZTVA 4KTTE 1BVRA 4XYLA 2NADA 1LLQA 3LQFA 3QW2A 2QRLA 3K96A 2HK7A 1BMDA 4GSLA 1AN9A 3HDYA 3ZHYA 1NPYA 5ICMA 4FFLA 1BDMA 3W4JA 1HWYA 3NEPX 2DBRA 3DQPA 1CERA 3ITDA 1PJQA 1H2HA 3KB6A 3C8MA 1XQ6A 1K6XA 4AJEA 3QWBA 5HWSA 3E6AA 3RBVA 1AHIA 2FY8A 3R0IA 4DREA 3V5NA 2WYVA 3B20A 4GX1A 2JCXA 2RH4A 3UCFA 3GOHA 4XQ9A 5F1PA 1RJWA 3JCZA 1E3JA 4I9HA 3HZZA 2VNSA 3L6EA 3HN2A 4CQLA 2P91A 3WWYA 1N9GB 4OQZA 1X7GA 1ZMTA 1HSZA 5F5LA 3GDOA 2VRCA 3H6KA 3JYPA 5JY6A 1PGQA 5ILGA 3WSWA 5A1TA 1I32A 1RYDA 4B4VA 3ROQA 3ZWCA 1LDMA 1LSJA 1CETA 4D42A 3RI3A 1GEGA 5G4LA 4J1SA 3RUFA 1EEHA 4EI2A 2ZYDA 3KSUA 3V1TC 5I9MA 1ZBQA 3CZMA 2YV3A 1N9GA 3FNEA 3KSDO 4I9UA 3QY9A 4PVCA 4ZQGA 4DPMA 4DYVA 3U3XA 3ZU4A 3BHMA 4RPLA 1Z73A 3JYQA 1NYTA 3CE6A 4W7HA 3S2IA 1U5CA 1C3VA 1UXIA 5G0WA 1SOVA 1MUUA 5DOZA 4OXKA 3T4EA 4CPDA 5HM8A 4Z9XA 1D1TA 4BO2A 2Q1UA 5GY7A 1IL0A 1UDAA 3R3SA 4D7AA 5JCJA 2CVOA 1B26A 4LN1A 1GYRA 3ASVA 4BV9A 5A5EA 4M54A 3ADPA 3F4BA 2GD1O 4E33A 2UVDA 4FW8A 3H2SA 4E32A 1DRUA 3Q11A 4IMRA 1HZJA 1NXQA 4OJNA 3SLGA 2G5CA 4D43A 3C1AA 4K26A 5T67A 2P9EA 1Y1PA 1JN0A 3EK2A 3VDRA 1UXJA 1BRMA 4J2OA 4NQZA 5T5QA 2B4RO 2GN4A 4D0SA 1HETA 4LGVA 1QXSA 2DC1A 2CSUA 4ZQEA 4J4HA 3KYCA 3ROMA 1P74A 3W4KA 4L75A 2R6JA 1Z82A 3H9EO 5A4DA 4KMSA 1L7DA 1YBAA 3G1UA 4YJDA 3PLNA 3MTJA 1IHXA 3DZHA 3P5SA 2C59A 2HMSA 2IE0A 4CQMD 3K73O 4PVDA 4FD3A 2X8LA 2NU6A 1PZGA 2Y66A 1UZMA 3NDRA 4HP8A 1LX6A 4IQ0A 2PLAA 1DRVA 1YS4A 3ZWYA 4DLLA 5I9LA 2PNFA 1DFHA 4JBIA 4R3WA 1SEPA 1M6WA 3RUHA 1YO6A 3PVZA 1PU2A 1XA0A 3MJCA 1NX6A 1DC3A 5B12A 2GGSA 1PIWA 4YQZA 1XQ1A 1QP8A 5J23A 2VHZA 2PH3A 2PKQP 3GRPA 1EDZA 5BSFA 4K1LA 8ADHA 1Q1NA 5JE8A 4NJMB 4BKOA 3A4VA 1OI7A 2NUAA 1TT5B 4WCFB 2JKVA 2PR2A 3GVIA 4E13A 3QVSA 1I01A 4D3FA 1NTOA 5DT9A 1SC6A 4M87A 3AUTA 1I8TA 5JBIA 4PZEA 1Q0LA 2DUUA 4Z6KA 2FN7A 4BNGA 1V6AA 1I33A 4XGNA 4F45A 2ZB7A 2B5WA 4KP7A 4XYGA 1LRKA 3QIVA 3UW3A 1TT5A 4WCFA 1JU9A 3KYDA 4J4BA 4MVJD 1EBUA 3FCOA 5ER9A 1XR3A 1SCUA 3IUPA 4BIIA 5KNLA 2NV6A 3OICA 3GMDA 3IP3A 3ZH2A 1GL3A 2PZLA 1JQBA 1QG6A 2NU8A 1ZFNA 1G0OA 4BMVA 1MG5A 4WCDA 3UGKA 1OZAA 2A9FA 3FBGA 2O3QA 4YDRA 3X2EA 1LLUA 2DAPA 3JQ9C 3WFJA 8LDHA 3JQ8A 2R00C 3DHNA 4B3IA 5I8ZA 4BO1A 5BR7A 4J7XA 2BGLA 1ZEMA 1UXKA 1CIVA 1I3MA 1YDWA 2HKIA 4HY3A 1V3TA 2Y0DA 3GG9A 1DSSG 2ZCUA 1E6UA 3EC7A 2A35A 3B1FA 4R1SA 1C14A 3CEAA 3D3EA 5EQDA 2FP4A 1KVQA 3VH1A 5IZ4A 1X7DA 4GKVA 4A73A 4JBGA 1T2CA 3GF4A 2FSVA 3MEQA 3GY0A 3MJVA 5LDGA 1IUKA 4AL4A 4GQAA 4AJJA 3OEWA 4BB5A 1DAPA 4CLHA 1KY5A 1ZSVA 1AUPA 1KERA 4D45A 2AEMA 4II3A 5KJCA 1QYXA 5TSDA 3IJPA 3WIEA 1GZ6A 1ISGA 3L77A 1EVJA 3NJ8A 4JBHA 3U62A 3ZWOA 2OUIA 2BI8A 4MKRA 1DHRA 3MJEA 3M2PA 4MKZA 4R68A 1MXFA 3OETA 4I8XA 3DBHA 2VTEA 1VC2A 1IOLA 3C1TA 1BW9A 4BS9A 2ZYAA 1VSVA 2BLLA 4FC7A 3LT2A 1E1KA 4DXHA 3KYBA 1ZJZA 3AI3A 4FSHA 4N7RA 3PHIA 1XGKA 1DC4A 2VWQA 2W98A 3OECA 5F3RA 2AE2A 3F6YA 3EHEA 3BMQA 4RDHA 5ENDA 3I4CA 1ZUD1 5K0ZA 4MVJP 1V8BA 3FSRA 3VKVA 2AW5A 1KVSA 4QECA 2TMGA 4J7UA 4I5FA 4MIOA 2P68A 3E1KA 3JQFA 3O9ZA 4BUCA 4FFPA 1E6EA 3V2GA 5A9SB 1Y9EA 4CM9D 1O5IA 4MVJE 1HSOA 2C0CA 3MZ0A 1VL0A 2WJPA 3GA0A 2VT2A 3WTCA 4B8ZA 2PTGA 1YKFA 3I9JA 4N5MA 4EYEA 4YAEA 2QX7A 4CL8A 4CMJA 1OBFO 1NFQA 1D8AA 1P1KA 3WBFA 5I7VA 3FN4A 4BO9A 5IDWA 1YONA 2ZK7A 3K31A 5EPOA 1WLYA 3DMYA 2EGHA 3INRA 4YVFA 4ZQBA 3PIDA 4CODB 5K6AC 1E7QA 2O50A 2O4CA 3GGGA 2J5RA 3GLQA 4UVDA 1LI4A 4Q3DA 4KOAA 1Q0HA 4UAGA 5FFFA 3DAFA 1GPDG 4UUPA 4ID9A 1PS9A 1U2DA 4Q3CA 1OFGA 1QYWA 3TWOA 3IOYA 3IJRA 4IUYA 1BHSA 3RC9A 2BFMA 1E3IA 2Y0EA 3DMTC 2OFPA 3ZNPA 1DOHA 1PQWA 1CWUA 1QV7A 1VRWA 4BNNA 3NYWA 2VOEA 3RC7A 1P77A 4UEOA 3AM4A 3L4BA 1T1RA 3GG2A 3O03A 3G49A 3CTMA 2Y93A 4J3FA 2ZYGA 1TLTA 2IXBA 3JQAB 4G5HA 3GHYA 3RKRA 3I9LA 3ZWXA 3GUYA 4RLHA 2X9NA 5COQA 4WCFC 2FZEA 3SJ7A 3D0OA 3F47A 4YB8A 4GKBA 3WGTA 2HCTA 5KKCA 1WP4A 4PFJA 4E2XA 4EJMA 1GYQA 3KEQA 1IZ9A 4IDDA 1O94A 2ZQZA 4K9DA 5C7OO 1TA4A 2AG8A 3G1TA 5I9NA 3HDQA 3JD4A 4YYZA 2AQKA 1DB3A 2VWGA 4FJ1A 1EMDA 4FOSA 4B7UA 3HDHA 4BGUA 1X0XA 4OQYA 5DNAA 2VHVA 3JQAA 1GV1A 2DKNA 1B16A 4L9RA 3DEYX 2G17A 3S2EA 4MINA 3WGOA 2DTXA 3BMCB 4RF3A 1HE4A 1HYGA 3A9WA 4CM3A 4UVEA 4HNGA 2FHSA 2IXAA 4M86A 5FI3A 2CY0A 1QRRA 3K2BA 1BVUA 1YRLA 3WJAA 3WMWA 1HXHA 3EDMA 4P38A 5B37A 5JMPA 3JYLA 3V8BA 1DC5A 4XYBA 1B2LA 1TB4A 5G4KB 4L0QA 2NQTA 3K2EA 4JROA 4WLUA 2PKQO 3OIGA 3BMCA 1SEVA 3ZV4A 2X0NA 2PD4A 1GTMA 4GMFA 3W8FA 4DBVO 3FTPA 3LSYA 1RKXA 3OHSX 3GFGA 5F1OA 1I2ZA 4TVOA 3AI1A 2J8ZA 3WX0A 5KVCA 1ADCA 4DLBA 5C3MA 4IIUA 3KV3O 1NQAO 2JAPA 4AFNA 2JAHA 1O6ZA 2X0IA 1CQJA 1X7HA 1DBVO 3UFXA 3ROKA 4YAIA 5JAIA 1A4IA 3OQ6A 2G1UA 5JDCC 3DZKA 1A72A 4IDCA 1HT0A 3BTOA 2Z1NA 4ND3A 5F21A 4BNUA 4ILKA 2QRKA 1KVRA 3WQSB 1HLDA 3DZIA 3UXYA 1PEDA 1KETA 3CPSA 3GRKA 3RJ9A 3AFNA 4WLOA 5CEJA 3QA9A 4MVJA 4XRRA 2DQ4A 3ABIA 4IJVA 2BKAA 2V6GA 3INGA 3QRWA 4LK3A 3TL3A 2C2XA 3TZ6A 5A9RA 2YQ5A 3EYWA 3OJLA 5IDXA 4D41A 4YQYA 2GO1A 4DVJA 4B4WA 1HYEA 4R51A 1U7TA 2OL4A 1Y8RA 4NU6A 1WZIA 3ZHXA 3OQ1A 1JTVA 1U2GA 4YBZA 3DTYA 1FK8A 1JDJA 4R69A 1SZJG 1PL7A 1Y6JA 3DOCA 4L74A 1FDUA 4FGSA 1V35A 4P4GA 4I1IA 4JJGA 5T64A 1JWAB 4GAEA 2DBQA 3IAHA 3F5SA 3JD0A 1UDCA 1F8FA 3MOGA 1PGNA 2GSDA 1R6DA 1OC4A 3GK3A 4NH4A 2O2SA 4J49A 1WMBA 2PV7A 4QQRA 2VT3A 4IZIA 3ZCXA 2VOJA 5DBIA 2Y1OA 3VZSA 1GQQA 4II2A 3RC2A 4D3SA 3DR3A 4AJ2A 1VKOA 3F1LA 1EBFA 4MP8A 1VJTA 4CMEA 1R66A 3B1JA 3EVTA 4NK4A 1O89A 3ZWMA 1TVEA 4YRDA 3B1KA 1HRDA 1F8GA 3Q1LA 2DFDA 3T4XA 4KUGA 4DYDA 4MVJH 5I7SA 2IRWA 4YJGB 1B15A 1UZLA 2IZ0A 1XCBA 3LF1A 5L51A 3H3JA 3SLKA 4E5YA 4C7KA 5BSGA 3ENKA 2Q49A 2WYWA 3UHAA 1KYQA 2BF7A 2I76A 2VZ0A 4O1MA 2WMDA 3DZJA 4TKMA 4FOOA 2EIHA 3PJDA 4XWYA 3AUAA 2BFOA 4E21A 4URFA 1Z74A 2XOXA 1Y81A 4IDGA 4CLDA 3ZNOA 5IXYA 3H3FA 1B3BA 2GDZA 3UVEA 4TKLA 1WDMA 5KVQA 3PPIA 1JAXA 4L76A 3WJ7A 5C7IO 4DIFA 1Y8QA 1LRLA 3AY6A 5L3ZA 3RC1A 3VKUA 4GVXA 3TDKA 5HTOA 1LLDA 5B1YA 5CP8A 4L73A 4XX0A 3G17A 4E0BA 1OOEA 2JFFA 3LC2O 1E5QA 1RM5A 1ZSYA 4IZHA 4PLGA 3VH2A 3DTTA 4B4UA 3VHRA 5T8KA 3IMFA 3LLSA 3QQPA 2FZWA 3KM0A 2NNLD 4LW8A 3U4DA 2GASA 3A28A 4EUEA 5JAZA 2UV8A 2GN9A 4XZ3A 3JQ7B 2NQ8A 4ND4A 1DIHA 3AJRA 4BVAA 2W2KB 2YFHA 3ZV6A 3OIFA 2WM3A 1LRJA 2A4KA 2HDHA 1ZNQO 3OJ0A 4P4NA 3MOIA 3VH4A 5L95A 1YWGO 1K5HA 2EKLA 5JLAA 3LT0A 3F9IA 4IXTA 4OYRA 4WLVA 5A3VA 4NU5A 1S7CA 1CEQA 4CL3A 5JO9A 7ADHA 3GVHA 1DLIA 1VJ1A 2CMDA 2I6TA 5L9AA 3OJEA 4R41A 1ZK4A 1DXYA 3GPIA 3JQ7A 2R2GA 3M6IA 3AOGA 2W2KA 2XXJA 4RV9A 5CDTA 2V6BA 3A14A 3EGOA 1PJBA 2O3SA 3WB9A 3HSKA 3FHLA 1E77A 4Y67A 4YT2A 3BHJA 1YL6A 1ZMOA 2OHXA 5H81A 3I9KA 3W6UA 2VTDA 4IBOA 5JW6A 2WD7B 5DCUA 1X1TA 1M75A 3OMLA 3QV1A 3H5NA 3VAZA 4E2WA 4ND2A 2DTDA 3PHLA 4YEDA 4YPOA 2YFQA 1A4UA 4J7CA 4CR8A 4NNJA 3DZBA 4QXMA 4R1UA 2NTJA 1B3RA 3C24A 4UEJA 2PY6A 2IEDA 1TXGA 2Y1DA 4XJSA 3HNPA 4J1QA 4DLAA 1U4SA 3I5MA 1DFGA 2X6TA 1P1FA 3GAZA 3QWFA 4OKIA 3ZHBA 1R16A 2D59A 4ALIA 1W0CA 4Z9YA 3H9QA 2WD7A 3HN7A 2V7PA 4AJPA 1ZXLA 1P3DA 1DIBA 1TI7A 3VZQA 4CQLB 3DWFA 4BHTA 1P1IA 3E8XA 5KVSA 3Q2IA 2AQIA 3MJTA 4HFRA 4TMFA 1J5PA 5EQFA 2EG9A 4E3ZA 1Q0QA 1XWFA 4PN3A 3UUWA 3TZHA 5KJ6A 3K6JA 4XIJA 4PCVA 3U0BA 1ZJYA 4ZVVA 5CEFA 3A06A 1OMOA 4MIEA 2VZ9A 2DPGA 4QSMA 4RLSA 3UF0A 1H94A 3PYLA 1FF9A 3RUAA 2HU2A 1LQTA 3ONDA 2LDBA 2C7GA 1NVTA 3OQBA 4RGBA 3SC4A 3IKVA 1L1FA 1N5DA 1K6IA 3NRCA 4F46A 3D4PA 3QWIA 4PG6A 3W8DA 3HWRA 1XHLA 2PGJA 1XU9A 3GN1A 5TJHA 1UJMA 3FBTA 3IS3A 4LMPA 2YV2A 1VL8A 5G2OA 5AVOA 3ANLA 1DEHA 1O95A 1SO8A 3L6DA 1KS9A 2WTBA 5IG2A 4M49A 3RFVA 3GN2A 4UVGA 3VOSA 3WMXA 2RHCA 4BNZA 4FJ0A 1MG0A 1ENYA 1FDVA 2C5AA 4QFCA 2B4QA 3R6DA 1ENPA 4XQGA 3JTMA 1HL3A 1EZ4A 3X2FA 2ZIZA 3WNVA 2JD1A 2GUGA 3JD1A 3TFOA 1PJCA 3CIFA 2OOSA 3ONFA 4CM6A 1ENZA 4BO8A 4ZRNA 2FOIA 4J0EA 3L4SO 3KOUA 3E03A 1T26A 2I9PA 4N5LA 1P44A 4PLFA 1PGOA 4IDAA 4P4LA 1MX3A 1ONOA 3KYCB 4DRYA 2PFGA 3ZNQA 2X5KO 4IIVA 3NTQA 4Q39A 2E48A 1NBOA 2B69A 3M2TA 5A02A 1T24A 3Q0EA 3ZV5A 1U5AA 2HSDA 1YJ8A 2XAAA 4JP2A 4BNXA 3OA0A 5CDYA 1JVSA 4NI5A 5HS4A 1JAYA 1EDOA 1P0FA 3GAFA 2W90A 4LMRA 2V6FA 1I10A 3D4OA 4W82A 5CG2A 1R0KA 5IZCA 4XYMA 1P33A 1E3WA 1WPQA 4DWVA 2X9VA 1VM6A 2JCYA 5JS6A 3LC1O 4CM8A 1NFFA 5JO0A 1Z7EA 2VHXA 2XPCA 3DBRA 3U4CA 4CLOB 3WGGA 3O8QB 1HE3A 3AWDA 4O63O 2Y1GA 2VWHA 3NAQA 3LZ6A 3NT2A 4NZ9A 4QO7A 3F4LA 3PQEA 4BNLA 4XGIA 2E82A 4GSKA 1K89A 4Q3NA 1E3EA 4A26A 2WWRA 4HXYA 3S2GA 4TRJA 3ADOA 3AM3A 1WW8A 3AOEC 2E4AA 5AXBA 3NT5A 1NQTA 5TIIA 4RQTA 1YXMA 3GDGA 5CFZA 2C20A 4CLOA 3O8QA 3JQBA 2J3KA 1U9JA 1ISFA 3AY7A 4LRTB 1PQPA 4Q3AA 4R54A 4BO7A 1VSUA 1D3AA 2H6EA 4OOFA 2C2YA 2OO5A 4L4SA 4R1TA 3EW7A 2V65A 2QZZA 4I5EA 4O59O 1XYGA 4UVHA 5IN5A 3UAGA 4RCVA 5CEEA 4J9VA 3I23A 3KYDB 1MB4A 5JDIA 3T7CA 2WD8A 4LVUA 1CYDA 4QFDA 1NR7A 2VYNA 3H5RA 1A7AA 5KIAA 3IL2A 1EE9A 2PA3A 3OP4A 3QWHA 5EERA 4Z3KA 2GZ3A 3SX2A 2UAGA 3I3OA 4D46A 1EFLA 2FR0A 3WSVA 1HEUA 2EHDA 4GI2A 4U5QA 2EEZA 2VRBA 4MOWA 3PDJA 3JQ8B 3NGLA 5L7YA 1UDBA 2VUSA 3AUUA 2EKQA 3PWZA 1F06A 1OC2A 1PGPA 2X1HA 2NTNA 4FFRA 1UUFA 4QEDA 5DDIP 3ZNNA 3D3WB 4BB6A 4E6PA 3PJFA 3CINA 2X9GA 3B6ZA 3QVTA 4XJTA 5U4QA 3N7UA 4Y6PA 2O48X 5EJ2A 3VDQA 1BWSA 3BTSA 2HMUA 4MVJI 3QJ5A 4BNJA 5DOVA 3PP8A 4YAJA 3VC7A 1ZZEA 3K5PA 4OH1A 4DMMA 3FTNA 1GDHA 2C29D 1RM0A 3WS7A 3FNGA 1PJ4A 3LC7O 5AXAA 1WVGA 2V6MA 3D3WA 1A27A 3DDNA 2GYYA 3H9UA 5JYEA 3AUSA 3JD2A 1KY4A 4K6FA 4TROA 1ZK3A 1V0JA 1Z75A 1HYHA 1YQDA 3R1IA 1LU9A 3WDSA 1ZH8A 2CVZA 2HRBA 2JL1A 2J3HA 3IC5A 1U8XX 3SEFA 2JJYA 3H7AA 4B4OA 3N58A 3DHEA 2P5UA 1RM3A 3VVCA 4BGIA 1WDLA 4BKPA 3NKLA 2VYVD 4WK6A 5TNXA 4RPKA 4J0FA 3WGQA 4J1TA 1HDXA 1UP6A 2D2IA 1DO8A 3DBHB 5G0VA 1P1JA 2FMUA 1BW9B 2O3TA 3JYOA 3SVTA 4LRSB 1JA9A 4AJOA 1A7KA 4RL6A 3I9OA 3GEMA 1P45A 4Z0TA 4ALNA 4E4YA 5COAA 1IB6A 3K8ZA 4FB5A 2UYYA 3GC6A 1SAYA 3NV9A 3RUIA 4LVCA 3K92A 1NAIA 3BMQB 5JAMA 2EV9A 3JQCA 2GPTA 4GH5A 3ZI0A 4B7CA 3GZNB 4DBZA 3AM5A 3RJ5A 3RWBA 1H6CA 1PJSA 3U4IA 3WIDA 4DQXA 4FGWA 3KHUA 3BMOB 3CMCO 4BGVA 3PI7A 4R1NA 2NVWA 1M66A 4N54A 3PLRA 3LT1A 2HO5A 3BTUA 1CQIA 1PZEA 2P9CA 1O8CA 3HADA 1NPDA 2D4AA 4WUVA 5TLSA 1ZK2A 4RVUA 2BELA 2ZJ1A 4PLYA 1WNTA 1EVZA 1R15A 3GZNA 1JLLA 2OXIA 5L53A 4BNYA 1IYZA 2HJRA 3P2YA 4BO6A 3COSA 3HQ4O 1NASA 1YBMA 3HB4X 4IM7A 4O0LA 1GY8A 3BMOA 1WAMA 3ANMA 1NM5A 3QVXA 3WQRA 2BHLA 4E5MA 4BMNA 1BTOA 5ITWA 2GRAA 2E49A 3PZRA 3FF4A 3ONEA 3DAGA 3JQEA 3DOJA 4IQ8A 3GEGA 1EFKA 4NPCA 4XA8A 5CPBA 5CDSA 3H2ZA 5DP2A 1BGVA 1KVTA 1KOLA 1ID1A 2X86A 3UCEA 3DO5A 1SB9A 1C0IA 3W4IA 4S3MA 4MVJM 4G81A 4CMKA 2H5LA 4NBRA 2PKRA 5JFOA 3H4VA 1M6HA 4CR7A 4UULA 1YE3A 1S6YA 3JQBC 5A06A 3NUGA 2JCVA 3GZ4A 3RCBA 4E31A 1A5ZA 3IP1A 1UXHA 2NM0A 6ADHA 2EW2A 2WDZA 1NWCA 1G0NA 1BXKA 1YVEI 2SCUA 2ZTUA 4GX0A 4NFHA 3ZWPA 2CZCA 4INAA 5EINA 2IYPA 5JPIA 1DLJA 4XQCA 3ROPA 3TPCA 3MWDB 4DQVA 3Q6IA 3CSDA 3EY4A 4J43A 4R4JA 5T6BA 3S55A 2YYYA 2QQ5A 2QZ9A 1XG5A 4CMBA 3DAPA 4KWIA 3RROA 1T2FA 2YY7A 4K28A 2VWPA 2BGMA 2TMDA 5BT9A 3HJAA 4AJLA 4HFNA 2VHYA 2RCYA 4BO5A 2X0RA 4A2CA 4OL9A 5ENVA 1HKUA 5JSFA 5EL0A 5CDGA 1P31A 4MJLA 4CQMB 3TZQA 1U3UA 4YCAA 2Q2WA 3RU9A 1EK5A 4XYEA 2FPIA 5KCZA 3TZKA 5L7WA 2Q1TA 3K30A 2YZ7A 3GGOA 1EQUA 3GEDA 3WICA 1GCUA 4XDYA 5KVVA 1DIRA 1EVYA 3DXFA 4JLWA 4W99A 4EJ0A 1R0LA 4PLHA 2ZB3A 1YB4A 4P8RA 1U7HA 1I5RA 5JXWA 2DT5A 1ML3A 1E7WA 1GCOA 1NHGA 3F5QA 4CQMA 4R9RA 4KDFA 4AJ1A 3KLPX 2J5KA 4FJ2A 1MV8A 3MWEB 2P2SA 4ZA2A 4UVIA 4YT4A 3O4RA 2VQ3A 3MJSA 3CKYA 2C82A 4ITUA 4H16A 2OZPA 4NFSA 1VKNA 1GEEA 2BD0A 1H6AA 1MC5A 3V2HA 3RFXA 3GFBA 1ADBA 2DM6A 3E5RA 3RVDA 4OSPA 5TX7A 3TOZA 2DUWA 1E5LA 1JWBB 4BO3A 4FPXA 4PGFA 3PWKA 3OJOA 5EMHA 3C85A 3WXBA 3V1UA 2C07A 1PSDA 3AU8A 3ZW8A 4TVBA 4WJZA 2BRUA 3FR8A 4WEQA 3D1LA 2ZJ0A 3I9NA 4DIBA 1WWKA 1ZK1A 1F0YA 1MC4A 5THQA 4EEXA 3DFUA 3I83A 1LUAA 2NTVA 4U7WA 1Y8RB 3U4HA 2AA3A 3DFZA 1FJHA 1HLPA 1HDZA 1GQ2A 1ZKMA 1EUZA 1NAHA 3AK4A 4IMPA 1PL6A 2PZKA 5IFLA 4BNFA 2P5YA 2CNBA 2EF1A 2VN8A 4I5DA 4JP3A 5TRTA 4ALJA 3O38A 4XKJA 2B36A 3TSCA 2ZTMA 3FI9A 4HV4A 1K3TA 2AXQA 4ALKA 1I3LA 2F1KA 4CMGA 1DDOA 1NQOA 3DZGA 4ROSA 4WKGA 2X22A 1QV6A 4W9NA 4ZQFA 2C7VA 5DZSA 4DPLA 3OFSA 3OIDA 5A05A 5EN4A 2X23A 3PQDA 3RQSA 3EAGA 3WQQA 1DJNA 1QR6A 4A5OA 3QVWA 4M89A 2OBNA 5BNIA 4EUHA 5CG1A 1HE5A 3JQFC 4RPJA 4U8GA 1A9ZA 3PGXA 5TGDA 1PWZA 5K9ZA 1L7EA 1H9BA 5JCJD 3HFSA 4ZHSA 4Z0PA 2WE7A 2Q3EA 3ZZNA 1Q7BA 1U4OA 4HFJA 4GLOA 2DU8A 4JN6B 1JKFA 2O7QA 1I3KA 1Z45A 5A03A 1GUZA 1P0CA 3NTOA 2AE1A 1UP4A 5G0UA 1J49A 1NWHA 3WLFA 3E9QA 4TWRA 4BMSA 4WNIA 2W2LD 1TT7A 3KLMX 5KJ1A 4PLCA 3DL2A 4DQUA 3RUDA 3OF2A 3ICPA 5KJEA 5MGBA 1P9LA 1GPJA 2X7HA 3OSUA 4NG5A 1H6DA 1Y7TA 1QYDA 3G79A 5IF3A 4BOYA 4ONEA 5AQ1A 5THKA 3W6ZA 4KTVE 4OSOA 2OMEA 3EZLA 4IJWA 2HMTA 4AG3A 4F6LA 3JQ6A 3QE3A 1IHYA 4FFMA 2YHIB 4FFNA 3M1LA 4PG5A 3PTZA 4HFMA 3CZRA 4IGFA 5IDQA 3D5QA 2W8ZA 4KDEA 2J3IA 2IZZA 4WECA 1C0LA 1BXGA 1Y8QB 1IY8A 2EJWA 3VH3A 1U28A 4RVDA 4YWJA 3L4BC 1E3LA 4CLRA 2WEKA 1YOVB 4BNWA 4AJIA 3D5TA 4RZHA 4YRAA 1ISIA 1PQUA 1FDSA 3E18A 5IJZA 2QIOA 3CUKA 2VNAA 2YHIA 2GN6A 1PJ2A 1U3VA 4N5NA 3NTRA 4A27A 4DC1A 2RHRA 4NK5A 3ZWWA 4E2YA 1G6KA 3WGZA 5ILOA 4AJHA 4GGOA 1QMGA 5LDHA 1O9BA 5BSHA 5TC4A 3LLVA 2D3TA 1PJTA 5TF4A 1YOVA 2DLDA 1JKJA 4CM9A 3GNTA 4KUHA 3WOHA 3RU7A 2I99A 2O3UA 4U6QA 2ZATA 2D8AA 1Y5MA 4D79A 2FR1A 4TZKA 2RAFA 4ZN6A 3NDJA 1GU7A 4HKTA 1PX0A 1VLLA 4PZDA 4CUJA 3T7EA 1JVBA 4Y6SA 4ZU3A 2FR8A 5TJ9A 3L6OO 4NIMA 2VCYA 5T57A 2ET6A 1DAOA 1HE2A 2OGUA 4GMGA 1GR0A 4GWKA 1ZSNA 3LYLA 3EVNA 4MVJG 3D64A 4XCVA 4BQPA 5KTKA 3FNHA 1D4FA 1ULSA 3WTBA 3PJGA 2YV1A 2QYSA 5BQFA 4XGKA 1PS0A 4UUNA 3TFQA 4LSWA 1I3NA 1Q7CA 2HMVA 3LF2A 3I6IA 5JAQA 3E9MA 4FC6A 2H1SA 5EESA 5I7EA 3HE3A 4BKUA 3LU1A 5G0SA 1R37A 1H9AA 1E1MA 1MGOA 4OAQA 2JHFA 4HUJA 5JNLA 5ER6A 3ZU5A 4CV3A 5TT0A 2HK9A 2G0TA 4TRRA 5IXSA 1NHWA 1ADFA 1U3WA 5KJFA 1ONNA 3H5AA 3HDJA 5CDUA 2HUNA 5C5IA 1LJ8A 1AHHA 4P22A 1V3VA 3RKUA 4IQGA 2NACA 4IJUA 4JJIA 5DBFA 5A5FA 4GX2A 2IDZA 1AXEA 4O5OA 2W4QA 3BXXA 4J6FA 4R16A 1MLDA 2B35A 2NU9A 3BZUA 2YJZA 4UUMA 1PR3A 3VZRA 1ZW1A 4MIYA 2Y05A 1HF3A 3A1NA 5AYVA 4AJNA 5DCYA 4W9NC 3JV7A 5U1PA 3AI2A 1ADGA 1Q2XA 1IPFA 1MP0A
chains in the Genus database with same CATH superfamily
1BZYA 5LQKA 3DBOB 3I4LA 3L0BA 4IW3B 4OKNA 1UADA 2NP6A 2FVXA 1RIFA 2GLTA 5DE3A 5JSZA 4AJKA 4Q9JA 5DHRA 2VYCA 4C4OA 3KQOA 1NRIA 3M5WA 3UOGA 2PGNA 1K0UA 2ZUUA 3KJQA 2O57A 2NVUB 3SIPA 2VDNB 1KO8A 3KJGA 4OXNA 4AS3A 3S2ZA 4UOQA 2WFAA 3RC8A 3NM5A 2FPGA 3AB3A 4LV8B 2I1LA 4RXUA 1SXJD 3IRUA 3CO5A 4J2HA 5HIMA 2PGLA 3DNPA 1DKUA 5KDDA 5FHQA 1XQ9A 1N8TA 1KORA 3VYUB 2H2HA 2QSYA 3PCRB 4O2BF 3N74A 4WAUA 1E1RD 2WU8A 1VL6A 4V39A 3RYCB 4CMEC 3N9IA 3A2NA 3IDOA 3SFTA 4GWGA 2O2HA 3KUCA 3B7GA 3I52A 1QLJA 1H2BA 4H6XA 3RJTA 2R00A 1VL5A 2HJWA 5DW0A 4CR6A 3VHXA 2YFYA 4G0QA 2WM8A 3OWOA 3GDFA 3LCCA 1GZVA 2ZS7A 2PSFA 5FF9A 1SOAA 4CTMA 1FLVA 2H3EA 4PZAA 2GPSA 5IDVA 1U0LA 1I80A 2NWQA 2XE7A 1VRVA 1M6YA 4HH1A 4R81A 5DN6A 9ATCA 2Q6OA 4DGSA 4NBUA 5DHUA 5JG7A 1W87A 3C7CB 3Q3CA 4IDFA 1VJGA 5EE9A 1VMKA 2YUTA 4UAUA 5J9FA 4JXZA 4O4IA 4PG8A 5BPHA 3ZWNA 2EW1A 1SOWA 2VAPA 4LV6A 1I1OA 1YMUA 2V9CA 2YV5A 4Z0HO 3EVFA 3PTLA 1M34B 4NDNE 5B1DA 3GAAA 4P3OA 1E3WB 1S2GA 1WXWA 2B9VA 2DBVO 4JWKA 4B3BA 3PDWA 3DULA 4LE1A 3KETA 2HCBA 1BQEA 2QN1A 2QG4A 1LBSA 3C8ZA 3NFRA 3PPYA 4NEHB 1F17A 3DBRB 1G2IA 1MA0A 3KXDA 1RQRA 3P9YA 5F2OA 1VLZA 5ALVA 1P62B 2HU7A 3OEHA 4E46A 2YZNA 1WX1A 3WNQA 2C03A 2R4QA 3INNA 1LDGA 4TWJA 3KUDA 5TT1A 5T3YA 4X97A 1Y6RA 1YE5A 1CP2A 3RNOA 1A7JA 4GICA 3TG2A 1ECPA 3NBYC 1L4EA 1WHTB 1CBUA 1VLQA 4N6GA 1IVNA 4PAOA 3CRQA 4WLFA 4YP9A 3V8EA 1NXVA 4Z7OB 4FVTA 3NHPA 4A92A 4AYXA 4L8VA 4P3PA 4PAWA 2EP5A 4RSHA 4OHWA 3P0JA 1E79D 4NMHA 5KTYA 1FU8A 3IR6A 5KNBA 2ZUFA 3L4JA 3OQOA 1JDBB 2XVYA 4KRFA 3BIOA 3AB8A 3H05A 3P9QA 4UQOA 5DGIA 1E0DA 1KC1A 3GGJA 4OAOA 1O94D 1GRQA 2NYAA 2P6PA 1C9DB 1KVUA 3C3MA 2O23A 5AXDA 1EFVB 4MS1B 2C9MA 4LPKA 3USES 5IHXA 1BX3A 3LFHA 1XPJA 4MWZA 5GM1A 3VHLB 2GVDC 2YHSA 3VR5H 4UTRA 2WIJA 4ZYYA 3C3WA 1J06A 3JQAD 4JX9A 3NPAA 1QE3A 1EGQA 1V5EA 4RTSA 1M33A 2R44A 2OXFA 1NJ8A 1YVRA 3LHKA 3U7QA 4QYXA 1TD9A 3OOEA 1KA9H 1QM5A 3HCRA 1U2PA 4PPGA 4X3OA 4O2AA 3PC3A 5AOVA 4IOMA 4RJIA 2N47A 3WE7A 3IVAA 4J6EA 4W7IA 4WBXC 1KL7A 2B7BA 1JV2B 1P75A 4LOKA 5FH9A 2C83A 5LOVA 1W2WB 4TPKA 2F2TA 3V97A 3GP3A 4DTCA 2HHLA 2VVTA 5TB5A 4EG5A 1XTPA 1II0A 1MGPA 4MI1A 5GJWC 4NXMB 1JE1A 2I91A 4G0ZA 5FWXA 1JHMA 1LX7A 1QIKA 5K6AA 3TW0A 4NZNA 3Q2KA 4U6NA 1KAOA 4KPFC 4JKYA 5C81A 1E5XA 5JEEA 1DKPA 2UZ4A 4MUNA 5FL3A 5EJ9A 4DCMA 1H93A 1KQPA 3H1GA 3DV9A 1EP1B 2I67A 5AKIA 4F8EA 1GPNA 1QCDA 2B92A 2VZEA 3QSGA 5KTNA 1U3TA 3PEYA 4JGBA 3QEBZ 2B4TO 4IJKA 3WADA 1DS6A 1XPOA 3N7AA 5EIFA 2GHRA 2ZUDA 2PH5A 1ECBA 2O8EB 2JANA 4KG7A 3RVQA 4XWWA 2J59A 2XHZA 2FUG1 3BYZA 3JD3A 1TQDA 1KBOA 4IVNA 5B3KA 3ELWA 3WBBA 5FI0B 1FDTA 4MROA 4WLEA 1YTUA 1JFFB 3UAXA 4WD3A 2IPMA 1NFRA 1U8YA 4KJZA 3JVEA 2QN6A 4BAUA 1B0AA 1NJ5A 1ISJA 1D2GA 2Z0MA 4RJTA 4NJMA 3VSAA 2RKBA 4HBGA 1P8JA 2Z56A 4IOLA 4R0NA 4XQEA 2Z30A 3OEYA 3VOAA 4A6DA 5A0FA 4QBTA 5JJIA 2BMFA 4JS0A 2GCGA 1EK6A 1SVSA 4DG9A 3U9LA 1BYIA 2Y67A 1NKVA 1P2VA 1EE2A 2H11A 4NBSA 5D3QA 4OHZA 4Z4EA 1U0TA 2WAYA 1R3UA 2XRMA 3OC0A 1P2FA 2O8DA 2WZQA 4KH1A 3CZ4A 2NXCA 3D6NB 3H9JA 3R6GA 4TL7A 4HNHA 1DX4A 4XPZA 1MVLA 2ZR8A 1RHRA 5CR9A 5AIAA 1G21E 2FK8A 1J2TA 2PT7A 4WE3A 4XI9A 1FMTA 2BH9A 2FEKA 1H1LA 3GR6A 3TQOA 4RTLA 5KNDA 2IPLA 5HILA 9MHTA 2BDTA 4HD8A 1XKTA 4TTSA 2WQ7A 3BHNA 3DM9B 1E96A 2XA9A 3WWZA 2M6LA 2OY0A 4KAAA 1XTSA 3HJTA 4RNCA 1NT4A 3L7IA 2WG1A 2XXBA 3NKVA 5DI3A 5WRFA 3PI6A 3UV3A 2B34A 3W1WA 3WG9A 3ZTTA 2LPMA 4RV5A 3DTNA 5C7YA 2PZGA 1GCIA 2EL9A 3OM0A 4BNDB 1Y5NA 2WIAA 3CEHA 4YXWD 1SMKA 1GRRA 1I24A 4CMAA 2DHQA 1F60A 2WM2A 4ND5A 2Z57A 2W9XA 3BBPA 3BIXA 3VR4D 3HC7A 4QQKA 5FL7D 4P5PA 5CTJA 1KEVA 4Y98A 1NLMA 4PIVA 5B3AA 2E6UX 4PAGA 5HM6A 1N2HA 1T4DA 3IB3A 5FPPA 5JZBA 4PQGA 1KI6A 1QKKA 1ZRHA 3KXLA 4PLTA 4NE7A 4RVFA 4XD2A 5H8WA 3P2MA 1I30A 3REGA 2IHZA 1GGHA 2LDXA 4XR4A 4HB4A 3M5PA 4QAJA 2PWZA 5JSYA 1IK6A 4EYKA 4RULA 4JB3A 3MMPA 4D81A 4MDYA 2FOLA 3OOJA 1TX4B 1D1SA 2A92A 4QYWA 4WZAB 2C94A 2QMHA 4QUBA 2QL9A 5E2BA 2BTEA 5BN3B 1UBEA 2BKVA 1BS9A 2IC5A 2ZKLA 3G2MA 1GARA 4KEAA 1QK3A 2HRCA 5D3KA 5J63A 1GL6A 1UC8A 5F9MA 3SXJA 3A04A 4MITA 3OCCA 2Y1EA 4CM4B 1HG1A 4RQAA 4YROA 4ZMRA 4ZT2A 1P4SA 1D9XA 1TAHA 3HDVA 4PSDA 3TYXA 3L8EA 3BQ9A 3QTLA 3L7OA 2HPVA 2ZM5A 3K9BA 3PQ5A 1BX1A 3UJ8A 1SKYB 1T3HA 2BONA 3FNFA 3MRXA 1R9JA 3V7UA 3VO8A 2Z2XA 5AVZA 1C7ZA 3A4IA 1GZ4A 4AZSA 2OVFA 3RDPA 4ZCTA 2A58A 2ODEA 1YJ5A 2W2VA 3EEIA 1C0KA 3KUUA 4FX5A 1R8QA 4ZXPA 3GCWA 3SKYA 2JFHA 3ZWVA 3DONA 3TFWA 3AFMA 3FJOA 1FDRA 3JQGB 3MOSA 4KVGA 4Q16A 1NYLA 1OREA 4Q93A 4ATNA 5M7EA 2C96A 3BRCA 5HYVA 1RZUA 2FPOA 3V80A 1TYCA 3TLYA 4QGSA 1G4HA 1MOSA 2FG7C 4NNOA 2V1XA 2G9ZA 2HJSA 4GLFA 4BNKA 1XUOA 4AD8A 1FSSA 3S40A 1E7SA 3HMQA 4DT1A 3T0FA 5A7HA 4QJ4A 4AICA 1QGYA 3Q98A 5H83A 1SG9A 3B2NA 4GLBA 3GVPA 3UOWA 4B31A 2CFIA 1CEYA 4EA7A 3BGVA 2ZPTX 2JI9A 3AR2A 1ULUA 2XGOA 2HBZA 2REXB 3C3EA 3C7AA 3FD8A 3M49A 1NXSA 2XIQA 3TLKA 1HTWA 1XQXA 3E1SA 3KOXA 2G25A 1NVFA 2QM7A 5AK4A 3TIIA 3HDGA 4I1OA 5HS6A 1V5WA 4J8PA 10MHA 2O52A 1ABFA 3LI2A 4P2BA 5B3JC 3NM6B 3TMYA 3DOUA 4WY8A 5JANA 1WZUA 1K7XB 1N3YA 3LNCA 1X7WB 2XA1A 4HH0A 2B5VA 2VK1A 4GC9A 3ZBUA 5A9TA 1NL3A 2IHYA 3AESA 4R8KA 3VYRB 4YRIA 3VNQA 2JW5A 1LBEA 3P9KA 5BN5B 2OLEA 1Z4OA 1CHDA 2FN3A 1THMA 2I6SA 3B9RA 3EGCA 4S1VA 4AF8A 1YGYA 2FMFA 2J6HA 2GBLC 2Y0CA 3C3XA 3NVAA 4DUPA 5BWBA 3AR5A 5IC4A 2GRJA 5M2QA 3IBSA 3F5DA 3DBLA 1A9XA 2DPMA 4QQNA 1V3QE 1OPXA 2AQHA 1HK7A 2UUOA 3E2IA 1N92A 4LZZA 3VPSA 3ZU2A 4C3UA 3BS4A 2DQYA 2IDMA 4FT4A 4OHUA 4PYOA 1ISMA 1Z0IA 2DFNA 4BKRA 3CSSA 3LKVA 1NQWA 2W93A 2VP0A 4FN4A 1SPXA 1VTKA 1GPYA 3QI2A 4MB2A 1AN0A 1Z6ZA 2DGDA 3EGVA 3EUFA 1Z5UA 3G0BA 4QU9A 1XZAA 1VBMA 2XYPA 2FE1A 3U26A 3TBKA 1WXHA 5CAEA 2YWEA 3HA5A 2VP4A 2FHPA 1FTGA 1MENA 3D4LA 3HL0A 1YACA 5AJTA 1MH9A 2O4UX 3ZTWA 3ZWQA 4GL2A 2W6MA 2X6QA 1G21A 4PLWA 1CHNA 5D1NA 1NBIA 4RPIA 3CHYA 2Z8YA 1PFWA 1XU7A 4JB8A 3UH1A 2VUTA 4FE7A 1SQFA 4X8LA 4DMKA 1KYZA 1TFUA 3GT7A 4ROTA 3PNBA 4L16A 1RXEA 5GJBA 4FNOA 4ACAA 1MW9X 4QSHA 3T3MB 1T0BA 4W5OA 2MYUA 2PUAA 4RORA 1YS6A 4FGLA 5C18A 3ZGYA 4MHSA 2HHAA 2GNPA 4I3GA 2JS7A 4XB6B 1NW9B 5K8JB 1RRMA 4MWCA 2H4WA 3ETLA 1TMOA 3OZUA 4UTPA 4CEIA 4N9QA 5DNWA 5MGNA 3FLEA 3S2SA 5A5VA 5IT0A 3ODGA 2PD6A 3KVNA 1W36C 1C9KA 5GIOE 2FMKA 2G04A 1S1CA 4IRXA 2WJIA 1Y7LA 1DHTA 1RHMA 1CDOA 2PUHA 3IDSA 4E12A 1XEAA 1WW3A 4XSGA 2HLDA 3LVFO 3R3VA 1CZLA 1ONPA 3EBLA 4I7EA 2PRSA 5EUQB 1QYCA 3OCZA 1THZA 3EE6A 4FHEA 1PLJA 4JI6B 3ROFA 5JH7F 1O0BA 3MWYW 1N2ZA 1HDOA 4YUXA 5CK5A 1GCGA 3J7TA 4JL6A 3EQ7A 3NGXA 1V2GA 1IFXA 3KWLA 4J75A 1PFGA 2YWRA 3CZAA 1F8XA 3AEKB 4LJYA 5H1YA 4YI3A 1T2UA 1T5OA 2M1XA 3ESDA 3EBPA 5LXTF 1TIBA 4FT2A 2I80A 1E3QA 4H6VA 4I2VA 2GEKA 2X0DA 4E2ZA 5IYZF 2JGRA 2VRCD 4WGGA 4JMLA 4AMZA 3JYHA 4CG2A 3GGPA 2ZJ5A 4D3YA 3B2QA 3QLVA 1GZ3A 1RPNA 3HKBA 3IT3A 1R4MB 4RMGA 5LWQA 3W5CA 3UC5A 3BKWA 2GZHA 3Q8WA 1E1LA 4GXNA 5E38A 4X85A 3UJHA 4D56A 4U02A 2DVMA 2GFHA 1TO2E 3TUJC 4GYKA 2O6HA 1N2EA 4RQBA 3AF5A 4CJXA 1NVMB 2EEPA 1G66A 2JHGA 4UXHA 3T38A 2H63A 4FM9A 3AVWA 1L5ZA 3TL2A 1SVWA 4BX3A 3I0MA 4YRMA 5KCMA 1CULC 2BKEA 2OQRA 3PU6A 2P35A 4LG1A 4RZQA 2I7TA 3JSAA 4IFTA 4JC5A 3VVMA 4H31A 1K7EB 2V7VA 3LY7A 2XD9A 1EXDA 3MMZA 2AT1A 4V03A 1M1YB 4C7OB 4YLEA 2ZIXB 4YALA 1XT6A 5LU8A 1VE5A 1VBKA 3GUCA 1XEXA 1QFJA 1Q0ZA 2COUA 3RG2A 2W6ZA 3T5TA 1Z0FA 3SQOA 2JATA 2R7KA 3BMNB 3H9BA 4MCJA 3PQ2A 2FKNA 1O4WA 4Q1VA 4CCWA 3WK4A 4OFZA 3WA7A 1Z4JA 2QPAA 2WJJA 2VJMA 5BUSA 2RGGA 3MYRA 4UBMA 1FW8A 1SVOA 3KJEA 4GW3A 4Z9FA 2GNAA 1AQNA 5FHRA 3FDFA 1XELA 4Z3OA 1LC3A 2OXRA 2YY6A 3RSHA 5MFZA 4GPEA 3FYUB 4ZEOA 1ARZA 4QNMA 2V7QD 1PUJA 1QUFA 2OAQ1 3E5MA 2WUVA 2BEVA 3WLLA 3EUWA 4A03A 1R0BA 2FETA 3V1LA 4PC2A 3DMGA 2EQBA 5ICSA 1PUXA 5HBRA 2R25B 2XQVA 4PCLA 2KBEA 2PQ0A 4KX3A 1YR6A 1OLSA 2J46A 1ENOA 3FG9A 2GPAA 1XXHE 4MPDA 2K2WA 2VYVA 4RY0A 4ZD6A 4DCPA 2AG6A 1C80A 1GADO 2R1VB 2IS4A 4YJFA 1CR4A 4JEMA 3MWFA 5GAJA 1UAYA 5HKKD 5HOEA 5ULLA 1WETA 2GHIA 1PR4A 3SC2B 3X1XA 2JIDA 2POQX 3NV7A 2I5PO 4OGGA 3BGWA 5JAPA 3F8TA 3I9MA 4ZCLA 1G2PA 4F92B 4B44A 4JCOA 2AFIE 3O95A 4ZRMA 4ZZ2A 4DM3A 1N5OX 1VE9A 3BGOS 2J6IA 4X0EA 4C4YA 2C54A 4LC0A 1DPFA 1ODTC 2IY8A 3DBVO 4G24A 4H7EA 2Z9CA 2E5LB 1N1GA 4IDEA 2E0IA 3WQBA 4EUFA 1TJ4A 2E4XA 4DV0B 1N7HA 1VIAA 4D57A 1IWBB 3N28A 4PONA 3KT3A 3L1JA 4QDTA 4ESOA 2JBAA 1R0WA 1D1PA 3OT1A 4HAZA 4HQFA 4R1PA 4ILEA 3T0IA 2QXTA 4C4AA 5DN9A 4EZIA 1CR2A 3QP9A 4L72A 4PGMA 5EI5A 5T4EA 5ICCA 3U7GA 4IL5A 4TSFD 4YCJA 4OIMA 5ENZA 3R75A 1E9EA 4IPTA 3K72B 3MJHA 4DQKA 4YS6A 2G88A 2H4HA 1X86B 2Q2VA 3HDTA 2P9GA 2FA9A 2WI8A 3KEOA 3WYBA 1EFDN 3PDUA 3W8EA 4AWBA 4ZTBA 2FFJA 1XLTA 3FCYA 3N2IA 1GILA 1L4GA 2Z2KA 4NCNA 3LY9A 3K1AA 4MGYR 1CUCA 2JFGA 3D1JA 3RK4A 3ZEAA 3LTNC 4BY9E 3O8OA 1I7NA 3OM9A 2AOXA 1W8IA 4MWSA 2X5JO 3TX2A 1CF4A 2FW0A 2VYND 2WB4A 4PINA 5ALYA 2X3UA 4ZICA 4O4HF 2Z4RA 3PDIB 3QV2A 1BJTA 1CD5A 4GR9A 4NCJA 2BHNA 3WGYA 3DEIA 1NXPA 1PNTA 1QZTA 3B3JA 4IUDS 2V45A 4L22A 5HZKA 2BZSA 2WSBA 4PXSA 3EXG1 3ZIUA 4C08A 2PO7A 1U7PA 1IEQA 1U31A 1O6BA 2FF7A 3GNSA 4I3FA 4K7JA 4LBYA 4NYMR 4FDTA 4UJ5A 4CMHA 4H1UA 1U02A 3G2HA 1F2DA 1XRJA 2V7BA 3KZVA 3T7JA 2FSSA 4PRLA 1HYBA 5E6SB 4Y2YA 2ATIA 2LVBA 4IIFA 5TEVA 4TMKA 4BECA 3FRJA 1GLNA 1URPA 1A5SB 2X5XA 4RF4A 1YQWA 1XL1A 3K6KA 4QBHA 3F7TA 5EYPA 4WOKA 3DTVD 2CDAA 2J0UB 1WUHS 1VL1A 4BNTA 3CCCA 4CM7A 1AG9A 1TQHA 2YNMC 1AE1A 4BP1A 1MPXA 2GHQA 1I14A 1P0PA 1WCWA 2ESRA 4KQKA 3N2GA 3QPWA 4ZMBA 1W6UA 1Q83A 2WOOA 4JOQA 4YAUA 2JFWA 3LQ1A 3QU2A 4FFVA 2NXEA 3HGTA 2ID4A 2Z1MA 4G37A 4CM5A 3ACBA 2NZVG 1XZHA 1J6UA 2P2DA 3BULA 2ZB4A 3FY4A 3GGCA 2MT9A 1E6WA 2J7PA 2F8TA 4S1NA 1NXWA 2XXAA 3L0ZA 3QMVA 4X24A 4E30A 2ZUVA 3EEYA 3GLHE 2Q50A 3HYTA 3LPNA 4OO3A 4DKXA 2IKQA 1ZO8A 2RGEA 2QMQA 3NR2A 4J1NA 4RFSB 2O3RA 3SBOA 2AMYA 2BRUC 3IA7A 3T5CA 3ANXA 2FWIA 3LO5A 4TN1A 3STVA 2VLIA 5PNTA 4EG1A 3JW8A 3TJRA 5HX7A 1WLSA 3JAWB 5HE9A 4DAOA 1CFJA 1NJ1A 4YV7A 1PEAA 4WGFA 4PR3A 1T2DA 5EQTA 5GONF 1NQUA 5FWNA 4CVNA 3SIWA 1IULA 1VHJA 1KDZA 4EB3A 1U0SY 2IYYA 1FTWA 4RNDB 5LVAA 1Z36A 4JXJA 3VKGA 1IEWA 2WM9B 3LY5A 2PIAA 3K16A 4RU1A 3TSZA 4DL9A 3BSSA 1C9JA 4F9EA 1NC3A 3WP1B 1R9NA 1DQSA 1HDRA 3MHPA 2PQ6A 3DLBA 3ZV3A 1N5JA 1NBWB 2NUPA 1YNOA 1WM1A 2GF9A 3D2CA 4LOAA 4QULA 4XM0A 4G0OA 2W6JA 3AIIA 1IY0A 1R4NA 2YIJA 3IQDB 3FZQA 3N86A 2O2YA 3R3HA 4LJ6A 1FFWA 3UK6A 4PZCA 1KJQA 3GFFA 2FWMX 3RVJA 3HZRA 1J0CA 1LDYA 5KWJA 1NXXA 1F4LA 2X4GA 2IODA 1V41E 2DOKA 2RH8A 1CRWG 3ETDA 2BGNA 3LZCA 3ZVKA 3DB2A 4KAJA 1NJFA 1XXHA 4O2LA 2PJDA 3TD9A 4C04A 4M46A 2NADA 3B1XA 4ZCSA 1DKLA 3SZLA 2P7HA 3QW2A 1TD1A 3W05A 4C0KA 5BN1A 5CVCA 4GSLA 3CN7A 1P9OA 5DHAA 2ZBVA 3HDYA 3L43A 5EIAA 1XJ5A 2K87A 4A8JC 1TUEA 1ZN7A 2A30A 4MMZB 4Z8YA 1H2HA 2AFIA 5B2ZA 3KB6A 1MVNA 1T5HX 1XQ6A 2MINA 4DS3A 4HK4A 2E85A 4HRXA 5HWSA 4FWTA 5AW3A 3RBVA 2J41A 2Z2ZA 4GWLA 1CUDA 3KWJA 1JIVA 4UBNA 2WYVA 3MXOA 3N0TA 2XCSB 1I3CA 3GOHA 3T3OA 5E7MA 2O5VA 2FP3A 1SZPA 5D5QA 1SUSA 5F1PA 3FXAA 2IUEA 3ZE2B 3D6JA 4RKYA 3HZZA 1IG3A 1CZNA 4CL0A 1EUYA 4Q34A 4CQLA 2P91A 2JLWA 4M9XA 1H2AS 5F5LA 4MUHA 3HCBA 3JYPA 4MULA 3ZXXA 4XASA 5JY6A 4YV0A 2F90A 5ILGA 2C3YA 5A1TA 4TMXA 3FDJA 1FP4B 2R6R1 5BSKA 1KZ7B 4MYCA 5B58T 4UE3S 1E64A 1K3UB 3QVVA 4NPAA 4KI7A 1LSJA 3PBKA 1TCCA 4HNRA 3RI3A 1OFUA 2GD2A 3DW1X 4DHEA 4MWBA 3MWKA 4PW0A 1GEGA 1PBNA 1OX4A 2C5HA 1EXVA 3CCFA 2P69A 1EFTA 2ZYDA 3V1TC 1KDYA 4ZYXA 2WMYA 1N9GA 2Y4NA 1K92A 4BQSA 3FNEA 1GM5A 3KSDO 2OMKA 4POOA 3GLUA 4PVCA 4AY4A 1CRPA 3TKYA 4RDXA 3PXAA 2H7XA 1GFIA 2IZ6A 2ZXEA 4RXMA 5FQOA 3VZBA 1KOJA 3CE6A 4GYJA 4NZOA 4W7HA 5CYPA 3UHJA 2P77A 2EJBA 3FYSA 1AX9A 4YP6A 3DVLA 2XNJA 2XUKA 2IEIA 3A36A 4MA4A 1MUUA 3NYQA 4NYIQ 4PHCA 3T4EA 1VXRA 2J45A 4CPDA 3N2KB 5HM8A 3PJRA 2IYQA 4HGQA 3RRJA 4UOEA 3OQMA 4X5OA 3LJKA 4BZWA 3K6SA 4I5IA 3KKNA 1VDMA 1VE1A 2Q29A 1VIDA 5EQJB 1B26A 3HFJA 1GYRA 4IEIA 4MKFA 4LDAA 721PA 2GD1O 3L0OA 4C22A 4LZJA 4EO9A 3AHFA 2PQ2A 3CLSD 5LYYA 1LTKA 3F4KA 4JI3B 2O06A 1NXQA 2P79A 1VMDA 1USVA 5FLEX 4UCFA 1NN5A 3GLHA 4MPRA 2R11A 2IVZA 1JJBA 3TW4A 1E6CA 3VDRA 4TZ0A 1BRMA 1CPYA 1RPJA 5HPYB 4HGRA 2GN4A 1ZCBA 4D0SA 3HEAA 2NU6B 3CF4G 3O4JA 1DEXA 3W9SA 2WP0A 5HG0A 4DWJA 2PJRA 3WV4A 3JVVA 3OOHA 3QOFA 4M3NA 1TUBA 3HVIA 3H1TA 4ZQEA 5IJ0A 4QNRA 4FZVA 1M6VB 2FSIA 1TZJA 1UFKA 1VYUA 3QBVA 4L75A 2WJ4A 4WXEA 2R6JA 1Z82A 5LKRA 5ALIA 4AUEA 3NLLA 4QUDA 4TL8A 4LVOA 2EQ5A 5DTMA 2ENWA 2HHCA 4MVYA 5A4DA 1JIQA 2D6FA 4KKVA 3MTJA 3IP5A 1FS6A 1T0JB 3IAS6 3MW8A 4R31A 1J0EA 5KYXA 4BASA 1BMTA 1SXJE 1Y3BE 3K73O 4RBNA 2X8LA 2ZIFA 4KXWA 3NDRA 4TSRA 4UEWA 3NYRA 4BVLA 3LZDA 4JBIA 3STYA 2BCEA 1YD7A 2AZ4A 3D7NA 2G1JA 1G8HA 2QTTA 1G8GA 2V7WA 1SRRA 2W6ID 1PU2A 4ND7A 5F73A 4FXOA 2FRDC 4F2HA 1NX6A 5CFPA 2XVAA 3O8RA 3EPKA 4Y6OA 1FUYB 3UQYS 1U2ZA 4AKSA 1MDFA 1IU9A 3NHYA 1XQ1A 1V6CA 4YRLA 5EPUA 2F17A 3SZUA 4LHWA 1Z39A 3UAOA 2PH3A 4JBLA 4EHDA 2Z6AA 4NU8X 1SOUA 2G36A 3B8EA 4K1LA 4WJKB 2JGDB 2PH7A 3W2TA 3YASA 5AJVB 1UBMS 4F3NA 3VO9A 3A3NA 3A4VA 4D9IA 3HYSA 3H1EA 4H1WA 3MT7A 4U8HA 3R40A 4KR7A 2QXYA 3G8CA 3OHMA 3TAXA 3ZE0B 1II8B 1GT6A 3GBVA 1QIMA 3IAFA 5AKEA 4ARZA 4D3FA 2I6GA 5BW8A 3WGUA 5DT9A 5EXPA 1SCUB 2F3RA 2I2DA 1RMQA 4CETA 3LD9A 4S35A 3R9KA 4D97A 3LUDA 5JBIA 4FUTA 3NHSA 1XK6A 3TEFA 1QQ6A 1BFKA 3ORQA 4PZEA 3QELB 1J9EA 2QTZA 5DEOA 4G97A 4EG7A 2DUUA 4OLHA 4BNGA 4PYQA 5LL6P 2Q6KA 3W5SA 2VKQA 3TB6A 5EZ5A 3RAEC 2EHJA 1O9HA 4BVGA 1OKKA 2WHQA 1LRKA 1EXWA 1TT5A 2QL6A 4J4BA 3AGQA 1FTQA 5IH3A 1EBUA 2N9UA 1K6EA 2G4CA 1QIGA 3P9SA 4MPTA 4DG5A 2FZ4A 4MQ4A 2Z04A 3GX1A 3LQ4A 2J09A 3QLTA 4DLYA 1E32A 5B36A 2QG6A 5BWCA 5CNIA 2PZLA 3ZLBA 3WGJA 3ZDXB 3DCIA 2CHFA 4LYAA 2NU8A 1G0OA 2BEKA 1V5FA 1MG5A 1NLFA 3MN1A 2BP7A 2CYCA 1LVHA 2BGUA 4N3AA 1VG9B 3FBGA 4EGCB 4F72A 4B3SB 4OHFA 1S01A 2FP4B 2HTEA 3IBGA 5SZIA 1XNJA 4CE6A 3ZGNA 2R00C 3IP6A 2P11A 3H04A 1E5TA 5IC6A 1JR3E 1Z5OA 1S8AA 2OB1A 4KE7A 4CG1A 2H8KA 3P9XA 4JBNA 3GLGB 1CIVA 4HY3A 4GE3A 3FHJA 2QD1A 4D4GA 1J2JA 3AIKA 1UKEA 4XDHA 5CYOA 5ITSA 1J9GA 3BWCA 3O94A 3UPTA 3EC7A 4B82A 2MCFA 4KLRA 3CEAA 1ZM9A 3P0FA 3T3DA 5EQDA 3TW6A 3TQIA 4Q7QA 1RXCA 1JAIA 2NTEA 1A8UA 1KVQA 1A9TA 3KHSA 4K5QA 2WNHA 1NF2A 4N3BA 4II7A 1Z0ZA 3WKDA 3T35A 5TXGA 1ITZA 1FYDA 4JBGA 3KQYA 4PYRA 3THYB 4ACBA 3B3AA 1BHJA 4U7PB 5IKOA 4B3CA 4AKHA 2FSVA 5E2AA 3HVKA 3MEQA 4AL4A 5AQ1A 4BB5A 2CFRA 1RQPA 3OEWA 4PC1A 4C0QC 3LPDA 3TB4A 4ARVA 1CB0A 1MJGA 4BLUA 4CLHA 3KPVA 1KOGA 4M4SA 4JODA 1AUPA 3CRNA 3R7WA 2YFKA 1L3BA 1P4AA 1OYWA 2AEMA 5FQNA 1E6MA 5KJCA 1J1IA 5TSDA 4C6TA 4LXQA 3KDPA 2CLFB 5EA2A 1ISGA 2PL9A 3ER9A 2WD9A 3BK1A 3L77A 4JBHA 4TKZA 4BAGA 3TTSA 1TKRA 4IVRA 1HLFA 4ZK2A 3P9ZA 3H8WA 3DFFA 3C8DA 2O0MA 4F0JA 3M2PA 1B6TA 4MKZA 3M7IA 4I2NA 2PZBA 3V4RA 4I8XA 3OD1A 1UJNA 2AEEA 3FOAA 5J58A 5C34B 1Q7TA 4MZDA 2VTEA 1IOLA 3RIMA 1BW9A 2JVKA 4HAXA 2JLZA 4LI3X 3WOVA 2JIZA 2H1WA 5LMUB 3ERCA 2DR3A 2PKXA 1SXJA 3B3FA 4TM7A 4Y0AA 2QT1A 3OJCA 3THXA 3S5JA 3G85A 1XGKA 1DC4A 3R5KA 1I6KA 3OECA 3OOWA 2XB9A 2AE2A 3EA4A 5EFZA 2WT9A 5B57C 2G4VA 1QO0D 4CF7A 1D2CA 4BN4A 4NSNA 1ZUD1 5K0ZA 3IR7A 1HMPA 2BZ1A 3N0XA 1NBME 3H5LA 2WMOB 4UASA 1SCBA 3V42A 2VXOA 2AW5A 1KVSA 2PU7A 4UFOA 4QECA 3VKVA 3WXMA 4Z7JA 4J7UA 4I5FA 5J2TA 4MIOA 3RS9A 4MAAA 1DAHA 1ORIA 3O9ZA 3CPHA 3HA3A 4FFPA 3CRMA 3V2GA 4CM9D 5A9SB 3A1UA 4FLFA 1VP9A 2X9LA 1MB9A 1K0FA 4OXXA 4BU0A 3AKEA 3KJNA 3R5TA 4QM7A 4M1WA 3I9V1 3MZ0A 2Q8PA 5KOHB 5FOTA 4DLWA 4YP5A 1ZISA 2WJPA 4EUSA 3KQKA 1FUEA 2P9BA 3I9JA 5C8VA 5BMVF 5DXAA 4N5MA 3TLMA 2Y9PB 5JCZA 5EJ5A 1P2UA 2NPIA 1OBFO 3FSJX 3DOIA 2H2AA 1MJNA 3RSZA 1LVUA 2I1QA 4BO9A 3WAKA 4QUEA 3FDIA 3T1QA 4AKIA 3INRA 4ER3A 4WA8A 2JJ8A 4ZQBA 4C03A 4AUMA 5J2UF 4P0PB 5K6AC 3LP8A 2O4CA 5IT4A 1KXZA 3SBXA 4Q3DA 4K1XA 5CLFA 1C7IA 2XRFA 4KOAA 4HYQA 1A76A 5CA1F 2CEAA 5HIIA 1J0AA 3DAFA 1YKSA 4ZARA 5BRAA 2NT4A 5KWSA 3DDCA 4C88A 3LW8A 1E1DA 1U2DA 1FMLA 5HQJA 1MIOA 5HE8A 5EJEA 3U4QA 2OECA 1QYWA 1A3CA 2REQB 3W2EA 3DE5X 4JUAA 4A36A 2BFMA 4EF5A 4YH1A 4AZ3A 2ZZKA 4R6WA 4XPIB 4B85A 1PQWA 2ZYWX 3NRJA 4KJXA 5K7SA 2P7IA 1E6LA 4CXMA 3PXEA 3AJ8A 3RC7A 1VJDA 5J4YA 5CA0B 1KMHA 1T2NA 3GG2A 4G5YA 1H69A 3CTMA 2JEOA 3G49A 4RPCA 5EUBA 5LUBA 4B73A 1CUXA 1TLTA 3BJIC 2G1PA 4HPXB 3PKIA 1E6KA 2DWPA 1K6MA 4G5HA 3I9LA 1HE8B 1KPHA 1M7GA 4OGKA 3IIIA 4RLHA 5C31A 1JR3A 3WYEA 3CVUA 5JASA 4LJRA 1E79A 1NNI1 2ACVA 2EKZA 2OHJA 3ZKWA 3BEOA 1JIUA 4MYTA 3SDBA 1R2QA 1CUZA 2B20A 2VDJA 1OYVA 4IDDA 1O94A 4QTYA 1WZNA 5D6OA 1TA4A 2AG8A 3V00A 2GH1A 2AQKA 2WJHA 2F3QA 4LX8A 1X0XA 5KMGA 5CUQA 4OQYA 3R6LA 5DNAA 2AVDA 1Q91A 3MUNA 3JQAA 3HPRA 3LGXA 3UFBA 5AVXA 1CLUA 1O1YA 4FBLA 1T8SA 2JHCA 3EVBA 2GVNA 3OPMA 1B16A 4XD7D 1W6RA 3DEYX 2WJZB 4MINA 4GI1A 5DASA 3EUEA 3W1EA 3H8JA 1F48A 5K6TA 3D7KA 1BS2A 1JMYA 2R5NA 2VPZA 1XZLA 4LOJA 4P7KA 5TQ0B 2IXAA 4A0RA 4JSRA 3EG5A 4LY9A 5FI3A 1NW4A 4H3SA 2X77A 1RKVA 3ZYCA 2CY0A 4Q0MA 1R64A 2N46A 1YRLA 1N33B 2Y71A 3EDCA 3R44A 3WMWA 3KQPA 1QHIA 3F6RA 2BMJA 2IYNA 2FEAA 2IYRA 4IV0A 2XWBF 5C35A 2FEMA 3FOCA 5G4KB 1U99A 4L0QA 3C74A 2VK4A 1NBAA 5LP6A 4WLUA 3OIGA 1SEVA 2R5WA 2X8JB 3ZV4A 2FFQA 2AVNA 4P3YA 1IH8A 2PD4A 4ZKEA 2ZBPA 3W8FA 4BJ3A 3FTPA 4HO1X 3QJYA 4RW0A 4V1CB 3B9PA 3GFGA 4K9MA 1A5AB 5KSYA 2UU9B 2J8ZA 2VP6A 1LPMA 5KVCA 3WV5A 2BM1A 2IQIA 1ZX1A 3KDSE 3NKFA 8MHTA 3E4DA 1P9NA 3KV3O 5FTJA 4MMYB 3WZ2A 3WVNA 3TGLA 4JJAA 1KJJA 3V4VB 4Z4CA 5B64A 2JAPA 3HA2A 4FP9A 3AQIA 4OQXA 2XWJI 4XTCS 1X7HA 1DBVO 5F76A 1GZSA 3ROKA 3UFXA 4JA0A 1G98A 4I6JA 2CNOA 4KK4A 1RD4A 4KO3S 1X1QA 3ESYA 1KO4A 3FIJA 1LPNA 3O4HA 4RELA 3SR0A 2P4SA 4BNUA 4LRQA 1NBMA 2I2XB 3VU0A 3BWYA 3RAFC 3N2LA 2JFNA 3Q7TA 3H6HA 1X7YB 2XRYA 2VQDA 1SVNA 2Y6VA 4W5JA 4HDNA 2W2MA 4Q9DA 4ZP1A 5BOVA 4UD2A 3GRKA 3OURA 2D0DA 1V1RB 3QA9A 4XRRA 1T6ZA 3TRFA 2IE8A 3AZQA 2SKCA 3QENA 4MUGA 3UGTA 5HP4A 1FRVA 3CT4A 1PZMA 2V7XA 3GGDA 4OTZA 2C2XA 4TMVA 5EKXA 2QT0A 2OXTA 3EXHB 1YIAA 3KALA 4JSYA 5C52B 2A9OA 2C5FA 3ADCA 4ZVMA 4ENUA 3RRFA 1Y8RA 4FCVA 3AUJB 4IHJB 1WZIA 5I3ZA 1JEAA 4JI7B 4X20A 5J59A 1WV1A 1JTVA 3DTYA 2OD7A 3DE7X 4LDRA 2AC2A 4ADSG 1OPRA 4BVBA 2VXCA 1RZVA 3HUTA 1IY1A 2C7QA 2BUBA 1NMEA 2QSJA 5T64A 1KPGA 1JWAB 3M4ZA 2VJPA 3KC2A 3EPPA 1UDCA 1F8FA 2FUG6 4G5OA 4JLJA 4ZAYA 1BIFA 1OC4A 1R6DA 4JC0A 5M29A 1VE7A 3AF1A 2PV7A 4WOCA 3DXXA 3K9WA 4YXWA 3SICE 3O74A 3SQLA 2AW3A 3D7RA 1QHFA 1U65A 3ZCXA 5DBIA 1TVKA 1ECJA 5JS2A 5AHKA 3VR4A 3VZSA 4O8CA 5FL7A 1WMFA 2OA0A 5JQGF 4M36A 4BP3A 3DMRA 3DO8A 3FLMA 1SR8A 1Z12A 1TLFA 4AJ2A 3CISA 3N59A 1G20B 2XDAA 4YBRA 3RYIA 3GBPA 3B1JA 1JJVA 3GLFE 2FWNA 3RRZA 1T4CA 4E1VA 4EMTA 1DV1A 3EVTA 4NE9A 1PVDA 4KGZA 4HDRB 2Q9UA 2NYUA 3B1KA 3M9WA 2CLOB 3VMMA 2WHPB 2ID9A 4JI5B 3F6CA 3LUGA 4UKDA 3KJXA 3T4XA 4KUGA 5KWIA 1LW7A 3PNPA 2XZTA 4H6WA 4YJGB 1P6QA 1CS4C 5A3QA 1EBBA 1UBNA 5L51A 2BFWA 5C8YF 3H3JA 1SUDA 3L0SA 4KI0A 3OKFA 1CXZA 4A2WA 3X2SA 4E5YA 3E9CA 4YUAA 4OYLA 4HQKA 3MINB 1KQ3A 3LECA 2WYWA 1PR2A 4IXNA 2VZ0A 3UHAA 3T7TA 1YI1A 2FW8A 4GI5A 4IHQA 4KXUA 1W5AA 2FU5C 4XX0B 4TKMA 4R8LA 2OV4A 3JASB 4UMDA 5AJZA 1U3GA 5J3JA 1XDSA 2NO9A 5EIBC 3A6HA 4A6PA 1AGXA 2Z9BA 2RGCA 1MAUA 1Y81A 2MU1A 3C8UA 4OP2A 4YMWA 4YY3B 4F84A 2FW9A 2XCQA 2IYZA 2J9XB 3PPIA 1JAXA 4L76A 4LHXA 4S12A 3UG7A 3WJ7A 4GE0A 1FCJA 3AY6A 1WCIA 3RC1A 1ZUNB 1FVOA 1L8LA 3KXIA 4GVXA 5HTOA 2CXNA 3HU1A 4UHFA 2HRQA 5CFMA 3VV2A 1KI2A 3P2KA 5CP8A 4B6FA 5EJAA 5LQCA 1MW8X 5CFOA 1F2UB 4U9IS 3RWOA 4KR3A 3ASZA 3GZJA 4YREA 4E1AA 1OOEA 2JFFA 5AKJA 2WVJA 5G3YA 5IAOA 5JAHA 5DTEA 5SY6A 5H0IA 3DTTA 4B4UA 4F4CA 1SIUA 4DA6A 1GSAA 1OWOA 1O77A 4RH3A 5FV4A 5KYWB 1SC4A 5LB2A 1CJVC 3KM0A</