5JCJD

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 91
structure length 247
sequence length 267
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjD00
4YAKA 3JTMA 4U7WA 4QFDA 1J5PA 4H15A 2VHZA 1ISIA 3UCXA 1ZO8A 3DZIA 2BLLA 5JO9A 3A28A 1B0AA 3ZWMA 2V6MA 4AJPA 4E5KA 1N1EA 3WWZA 1XQ1A 1K2WA 4QO7A 1HDYA 5KVQA 4O6VA 3WR5A 3AUTA 2QZZA 4IZHA 2GZ2A 1SMKA 4R69A 3OQBA 2AG5A 2O2YA 3ITDA 3HZZA 1TT7A 1EE9A 4PLPA 3TZKA 2HU2A 1X1EA 2HJRA 4WOKA 1LLQA 2O50A 4DQVA 3H4VA 1RYEA 3FBGA 3BTVA 1HF3A 5H82A 3B1JA 2PD3A 2PNFA 1AXEA 4JJGA 3R0IA 3MWEB 2X9GA 2XXBA 4UUOA 1KETA 1M2WA 2FPPA 3VZSA 2WDZA 1D7OA 2OO5A 1X1TA 2W2KA 2FR0A 1EUZA 4ALLA 3I4FA 5DN9A 1YO6A 5A3JA 2PZJA 1A27A 3BMOA 1EVJA 3K30A 1XU7A 2A92A 3D4NA 3FTPA 3LC2O 1I0ZA 1ZEJA 3DAGA 1ZW1A 3IIEA 4DPKA 2WEKA 1AXGA 5FEUA 4D45A 1VPDA 1GPDG 4CM3A 2X5KO 4MIYA 4NK4A 3D4PA 1E3IA 1BSVA 1I2BA 4F45A 3WX0A 4GLLA 2OGUA 5ILOA 5JCJD 2FPIA 4JXKA 1X15A 4RVHA 2OHXA 2PKQO 1V0JA 3UAGA 3AUUA 1GV1A 2IXAA 4PRLA 4YJFA 4L4SA 4R9RA 3H9QA 1HE2A 1HLPA 4PRKA 4CMEC 2FSSA 3DFZA 2J5QA 1U9JA 5DDIP 4BGEA 5H83A 3OFSA 3BHMA 3T4XA 2O3QA 4J7CA 1KYQA 5KWEA 2BMAA 4CLRB 3B1FA 4E31A 3DWFA 1PSDA 3ICCA 3I6QA 2PV7A 3FNHA 3QVSA 3HUDA 3EZLA 3AM4A 3AFNA 2Z1NA 1GZ4A 4RLSA 2JCXA 2I99A 1DBVO 3KOUA 3FNFA 4TZKA 3OMLA 3GK3A 3NKLA 2ZB8A 1ZH8A 1CQIA 4DREA 2HKIA 4NK5A 1SO8A 1T4BA 1ENOA 1JQBA 1R0SA 1ZBQA 3GY0A 3JD4A 4E6PA 1X7GA 2AW5A 3KM0A 4B3JA 4ZQGA 1QYWA 1FK8A 1ZK3A 3V5NA 3WTBA 1GTMA 1QYXA 3ADOA 3LT4A 1UUFA 2HLPA 3WLFA 3WYCA 4BNYA 1LBEA 1R4MA 2OORA 1VRWA 1T2DA 1UZLA 3N58A 3TJRA 2Z5LA 4CQLA 1PGJA 2HCTA 5CEEA 1QYCA 1LLCA 4LN1A 1M67A 4XCVA 4O5OA 2EKPA 3FI9A 4L9RA 4ZJUA 5L51A 2P9CA 1MV8A 3DBRA 2BI7A 2P4HX 4L74A 3ONDA 3MJTA 4RL6A 2FHSA 4W9NA 1C0PA 2J5KA 4DWVA 3IKTA 3COSA 3ON5A 2VOJA 4BB5A 4FFRA 3DAPA 2VYNA 4BNMA 1TVEA 4MP6A 4A0SA 1HZJA 3K6JA 3VVCA 4GBJA 2CF5A 1LQUA 2VTDA 2C59A 2PKRA 1YJ8A 5ITWA 1D1TA 3VTFA 5JMPA 3HSKA 3OETA 1WLYA 4J4TA 1Z75A 1YB1A 3GT0A 2WM3A 4PZEA 3LLSA 1ORRA 3H2SA 4XQGA 3SLGA 3H8VA 1GZ6A 4I5FA 1GQ2A 3LVFO 1QYVA 2Y99A 3E1KA 1AHIA 1HE3A 1PJ2A 5EQFA 1XHLA 2Y0DA 1P1JA 1V3TA 5EJ2A 1GD1O 4PLYA 1RM4A 1SPXA 1U8FO 1OZAA 4J2OA 3ENNA 2RAFA 3UFXA 2VYND 1DIGA 4BMVA 4EDFA 4Z3KA 5JC8A 4CMEA 4YAIA 5CDTA 3DXFA 3W8EA 1DIRA 3PJGA 2X9VA 3OF2A 1ZK1A 4O63O 3JQAD 4NI5A 5JMWA 4E2YA 5JXWA 3ZH2A 3BXXA 3DBHA 4C7JA 4WNIA 1B8VA 3E82A 3BTUA 1HYGA 3DZJA 3LF2A 3PIIA 3RC2A 3VPHA 4F6LA 5T8KC 1XGKA 4JJIA 4JP2A 4OQZA 1B2LA 2YV1A 4DQUA 2C5AA 5ICSA 3I3OA 5IDYA 5T67A 3P7MA 1UDBA 4MVJA 3OQ6A 1HDOA 5G0TA 5G0WA 4UUPA 1HT0A 4QO8A 2YDXA 5FF9A 3VOSA 1PTJA 4E3ZA 2FRDA 4YACA 2Q50A 3ZHBA 1HLDA 1NASA 1GZ3A 5JBIA 1JVSA 2YHIB 5COQA 4FFOA 3G1TA 3KSDO 3JYLA 1YB5A 4Z9XA 4HFMA 1ONNA 1T24A 4OOEA 3DMYA 3H3FA 3GZNB 4XKJA 1E1NA 1UAYA 2NACA 1YL5A 4JP3A 3D7LA 3S1LA 1BRMA 1K0UA 3QVXA 1LDNA 2ZYGA 1E1KA 3K73O 3PLNA 4AJ1A 4ROSA 1KVUA 3HNPA 2C29D 4KQXA 4EEXA 2Z1MA 1OFGA 3DBLB 3DOCA 3LC1O 3JD0A 3LYLA 1SNYA 4PLFA 1N7HA 4G65A 3UCEA 1BHSA 1WP4A 4MVJD 3ZNNA 1IB6A 4FW8A 3JQCA 3FD8A 4NR0A 1QMGA 3U3XA 1GUZA 2IYOA 3K9QO 5IAAA 3VPSA 3FR8A 5F1PA 4CJXA 1FDVA 1V8BA 1H6CA 5FWNA 4ZN6A 3AOEC 4DGSA 3D1LA 2E82A 1CDOA 4J2HA 1UZMA 4BGUA 4J1TA 3AI3A 4PG4A 4E2XA 2PTGA 1NP3A 3WSWA 4YYZA 4RVUA 1R15A 2I67A 3NTRA 1YDWA 3KEOA 4KWHA 4DYVA 2BFAA 1RWBA 1U2GA 2WTBA 4IJVA 4GGPA 1R12A 2X6TA 4NJMA 5CP8A 2HMWA 1A9ZA 4GWGA 1Q7GA 3MZ0A 1AGNA 1YE3A 5C5IA 4GQAA 3I9JA 1N92A 2ZB7A 2O3SA 1E5LA 4GWKA 2HMTA 4GMGA 4TVOA 1DSSG 3GG2A 4BKOA 2NM0A 5HTOA 3RC1A 4TMFA 1X13A 1U2DA 5JNLA 4J49A 2PGLA 2Q2QA 4FGWA 5T6BA 2AEJA 4E0BA 2AMFA 1SBYA 3GAZA 1EQUA 3DO5A 4OHUA 3LSYA 3JD3A 5CPFA 1NNUA 2NUAA 1U5AA 4KUHA 5GZ6A 2VCYA 3H9UA 1WZIA 1S6YA 5KJCA 4L8VA 1E6EA 2DLDA 2G82A 1IE3A 2VWQA 3ZI0A 3GDFA 2Q45A 2ZYAA 3L6EA 2B37A 4QUKA 4KDEA 3H9GA 5TLSA 2HRZA 3OH8A 1QORA 1T1SA 1GQYA 3O26A 4OIMA 3WLEA 4Q9NA 4OQYA 1E92A 3Q3CA 2FP4A 1DOHA 1DHTA 4GPD1 4IINA 4Q3CA 4QQRA 2C82A 4GVLA 4FC7A 3U4DA 3P2YA 3GOHA 5CG1A 1BMDA 3U4IA 1WDMA 1VM6A 3HB5X 4TVBA 1O94A 3G17A 2EKLA 3JQ6A 3WWYA 2B69A 4J9UE 4EEZA 5ADHA 1UJMA 3ENKA 3GVIA 1C1DB 3JQGB 3R6DA 3NV9A 4JJFA 2EP5A 4RGBA 3Q2KA 1PS0A 1YRLA 1H6BA 2FZEA 3JQ7B 2VHXA 3WGZA 4JBHA 3WYBA 4YA6A 5IN5A 1PX0A 2HUNA 3U4HA 4A27A 4M1QA 9LDBA 3ZWNA 1YWGO 1UP6A 2WE7A 3RBZA 4R16A 4Y6RA 1O8CA 1VL0A 3RD5A 2NVWA 2ZTMA 3INRA 3JYPA 3A14A 4IDAA 3TFQA 3JQFC 1ZNQO 1TT5B 2C2XA 4MKRA 1IZ9A 4PG6A 4YQZA 4Z0HO 3IDSA 2Q99A 3D5QA 1VC2A 4D3DA 2DKNA 1QG6A 3S55A 1TEHA 4IXWA 5JW6A 1Y1PA 4XQ9A 1P1HA 4CM9D 2O7QA 3QVTA 4D0RA 5B4VA 3RUEA 3UUWA 1I24A 4CODB 4RDIA 1C0LA 4N5LA 5LDGA 2XF8A 3JSAA 4B3HA 3T7CA 4KTVE 1AHHA 3MWDB 1I33A 1UAGA 1XCBA 3CTMA 1E7RA 3I1JA 3FWZA 2AEMA 1NVMB 1QLJA 5B4UA 3ETGA 5IFLA 4JN6B 4HFRA 1YQGA 4NJMB 3I5MA 1RM5A 4BO7A 1QR6A 1GFSA 4NU6A 4PG5A 4WJZA 3GNQA 4YXFA 1LNQA 3WMWA 3DMTC 3JQFA 3I6IA 4JNKA 1LTHR 4XIYA 5EINA 2D8AA 4IS2A 4GSKA 2Q2VA 5A9TA 1HWYA 2JD2A 5A9SB 3TL2A 4GSLA 1XU9A 3FTNA 5BSHA 4RPJA 2YFQA 3GNTA 5BQFA 2DUUA 3ZNQA 1G6KA 1ENZA 5MDHA 3JQ9C 3PI7A 4BIIA 1NQ5A 3F3SA 3PQFA 4BNZA 1B16A 2XPCA 4BV8A 4CMJA 4CPDA 1HYHA 2EIHA 3AOGA 2JKVA 2W98A 5IZ4A 1WVGA 2HMUA 1HRDA 4NFHA 3GUYA 4FFMA 2AEFA 3WGHA 4JCOA 4TWRA 3DZKA 2VHVA 5HA5A 1U5CA 1I32A 3RKRA 2ZATA 3HFSA 3L9WA 1ZVMA 2PFGA 3OA2A 4FJ2A 5TQVA 4XYMA 2DUWA 4DPMA 3GAFA 1P0CA 3B1KA 4BNIA 3E9MA 2QW8A 4XDZA 5TSDA 1ZFNA 3SJUA 3FSRA 2ZTVA 1CF2O 4R9SA 3OEWA 1LSJA 3GGOA 2JFFA 2YQ4A 3KYDB 1LDMA 3NX4A 3EUWA 3GEDA 4L4XA 1XA0A 2Q1UA 1H6DA 4YJDA 5I7EA 3HDQA 3GLQA 4AJHA 2OOSA 1IULA 1PS8A 3HQ4O 2Y68A 3TRIA 3FPCA 1LRLA 3VH2A 1RPNA 3ITKA 4BO0A 1TB4A 1Y81A 1C1XB 4WEOA 3OJFA 2YV2A 4DBVO 4EW6A 2GD1O 2EJVA 1ID1A 3P5SA 5A3VA 4BNXA 1ZK0A 2UDPA 4UULA 3KYCB 1NXQA 1ONPA 2DFVA 2Y66A 4BNUA 4DMMA 1ISHA 2JFGA 4ZHSA 2I3GA 3NAQA 1NQAO 3G3EA 4E30A 3HB4X 1RJWA 1QXSA 3RCBA 1YONA 2I9PA 3UICA 2VUSA 3V1YA 1D8AA 4W4TA 3WGTA 3DEYX 1K5HA 3NJ4A 3MOGA 3B6ZA 1SCUA 5CAEA 4IM7A 1E1MA 1E0DA 2QHXA 3ZW9A 1NPDA 2VT2A 4RVFA 1JLLA 4DIOA 1JW9B 1Y9EA 4R41A 2JCYA 5BT9A 2IYPA 2VNSA 1LDEA 5ICMA 1ADBA 3BMCB 1Q0QA 4CMIB 4W82A 3GGPA 2WJPA 1Y8RB 4J0EA 4PLVA 5G0SA 3STHA 3ZWOA 1BXGB 4ZQBA 3ZV6A 1NPYA 1O0SA 2O3JA 4NQZA 3IKVA 1NBOA 2BH9A 3OICA 1YVEI 3EHEA 4ZRMA 1YOVB 3OIDA 4OYRA 2X0NA 2P2SA 1ULUA 4Z3DA 5IF3A 3BHJA 4E21A 3ZU2A 1LUAA 3QY9A 1Z6ZA 4U6QA 4YT2A 3H9JA 4NFSA 2WD7A 2OP0A 4PN3A 4I5GA 1R4NA 3GFGA 4XGNA 3S8MA 1P1RA 4D42A 3WTCA 2FZWA 1JWAB 4CM5A 1UXHA 1NVGA 1G0OA 3M6IA 3VVBA 3M1AA 2BKAA 1E3LA 3QWBA 2YY7A 3RFTA 4YAGA 4O0LA 5ILGA 2B0JA 4ZICA 2Y0EA 4DYDA 1Y5RA 2RHRA 4UVIA 1I36A 4M86A 3NYWA 1DAOA 1SC6A 5FI5A 3ROQA 5JLAA 3FN4A 3KZVA 1P77A 4MINA 5DT9A 2OFPA 1B15A 4Z9YA 1MFZA 3PWSA 2IZ0A 3SJ7A 5IDXA 4MIEA 5IJZA 4G2NA 3NT2A 3H6KA 1MP0A 4UAGA 3A1NA 4BO3A 2JHGA 5DBIA 3KSUA 1C14A 3PWKA 3O4RA 5ER9A 2D5CA 3IC5A 4YAEA 2VNAA 2C5EA 3AWDA 1K6JA 4YQYA 1DIAA 1W73A 3AI1A 2RHCA 2DT5A 1U3TA 4FIZA 1HDXA 4ZGWA 1VKNA 3I9NA 3ZW8A 5CDSA 3F6YA 2IE0A 2RBEA 5L7YA 3DC2A 4R54A 1WAMA 5IXYA 4U0KA 2JAPA 5CDUA 2B5WA 2X58A 1W6UA 3EAGA 2OBYA 3BTSA 4H3VA 3A4VA 4BO9A 2GRAA 3DZBA 3WDSA 1N9GA 1U3VA 2ZKLA 4R1NA 4WASA 3B70A 4BGVA 4Z9FA 5CG2A 4KOAA 4IY1A 3HDHA 3GC6A 2NU8A 2IZZA 3JCZA 5A02A 1EVIA 3CIFA 3DHYA 3PFWO 3INGA 2G17A 1F14A 4IUYA 1LXCA 2DQ4A 2O2SA 4IMRA 2GYYA 4CMAA 4OXKA 4UVHA 2PZLA 3QA9A 5I7VA 4E5YA 4XWYA 4CM4B 2DM6A 2Y93A 3NDIA 4EJ0A 1A71A 1H6AA 5HWSA 4CR8A 4DC1A 2B4QA 1X0VA 3FR7A 4HADA 4YJHA 4B8WA 4S1VA 3ABIA 3RUIA 3HDYA 5GZ3A 3K5PA 5DOZA 3V1TC 4GMFA 1DXYA 4PLWA 4WLOA 4L0QA 3RBVA 2RH4A 1VLLA 5C3MA 1P9LA 3RC7A 4QX6A 3VDRA 3GVPA 4R68A 1F8FA 4CM8B 3U49A 1LI4A 3MCVA 4PCVA 2GO1A 5FYDA 5HS6A 4WCFA 4FFLA 1HDZA 2QRLA 2YYYA 5TC4A 1Y5MA 4E33A 2ZB3A 1C0KA 3C7CB 5BSGA 5KCZA 4CM9A 1M6HA 3BYZA 1XWFA 2B83A 1FJHA 2Y1CA 1U1IA 3DOOA 1LDBA 3UGKA 3PK0A 1ZJZA 4K9DA 2RH8A 4LMRA 1BGVA 5K6AA 2CY0A 4XD2A 4DLAA 3NTOA 3I9OA 2FSVA 3MJEA 1ZKMA 5KJFA 3VTZA 3T7EA 1V9LA 3ZDFA 3DHEA 2PGJA 4WEQA 1ARZA 5JCJA 1GYRA 1BXZA 2IRWA 1MFPA 4J90A 3VAZA 3DAFA 1HSZA 3W4JA 4CLHA 2YDYA 4BKRA 4RPLA 4N5MA 2ZTLA 1KVQA 3GVHA 2ET6A 3PPIA 3TZ6A 3TFOA 3NJ8A 3EYWA 5T64A 4II3A 1DIHA 4TRMA 1R16A 3LF1A 2ZJ0A 3IP3A 3W6UA 3KTDA 1NAIA 3DB2A 1A5ZA 2CD9A 3D3WA 3V1UA 4Y67A 1N2SA 3JYQA 5I9NA 5JYEA 5FFFA 5K6AC 4OH1A 5AXCA 3E9QA 5KJ1A 1CYDA 1MGOA 3IJRA 4ESOA 4BO1A 2NTVA 4RV9A 3WJ7A 4LCJA 4Q3BA 3IL2A 5AVOA 2NWQA 3VPXA 3DONA 2A9FA 4HY3A 2GDZA 3QVOA 2UAGA 3CXRA 4MIOA 3RFVA 2ZJ1A 4WPGA 3C8MA 2A94A 3O9ZA 4XYBA 1I2ZA 5LCXA 1PS9A 3RQSA 5CEFA 4LSMA 2CNBA 3AY7A 1H0KA 4RZHA 4HBGA 4YPOA 4HNHA 3V2UA 4YT4A 1EFKA 2NTJA 4WLUA 4WLEA 3GPDG 1PL6A 1HETA 1Q7BA 2X86A 1PJ4A 4I5EA 2J3HA 3ASUA 4U0JA 5AXBA 3WGYA 3KBOA 3AK4A 4YJFB 4A7PA 1F0YA 4BHTA 4BKQA 3QP9A 4RO0A 1P1FA 3A06A 4BNJA 1Q7CA 3KYCA 1YDEA 4NIMA 3GEGA 5C37A 5I8WA 2EHDA 1OBFO 2H1SA 4D0SA 3PVZA 1JTVA 2TMGA 1SB8A 1H93A 4DXHA 2H5LA 2EXXA 1KOLA 3ZWWA 1JAXA 1N7GA 3ZNPA 1CQJA 1Q0HA 3UW3A 4BMSA 1NHGA 1Z74A 4L73A 5TX7A 3PZRA 3JQ8A 1YL7A 1E6UA 1R6DA 3VKUA 3GR6A 1PL7A 1M66A 3Q9NA 1Y8QA 4R3NA 1GAEO 5ES3A 5H81A 1T25A 1LC3A 1JAYA 5DP1A 2Q46A 4YWJA 3UCFA 1IY8A 3JQAA 4B4VA 3FBTA 1T2FA 4MVJG 4BNTA 5A9RA 2CMDA 2EERA 2NSDA 1BW9A 5F3RA 3I52A 4H7PA 1SAYA 1YBMA 1GQQA 1IL0A 5TJ9A 5A03A 3RC9A 5TGDA 1KIFA 3WQQA 1IPFA 3JD2A 4K26A 2YJZA 5L95A 1CJCA 1DRWA 3GG9A 1V3VA 1A9YA 5JAZA 4FBGA 3F46A 2CSUA 4AL4A 3IUSA 1EUDA 3OP4A 4CM1A 4FOOA 5TNXA 4AJIA 4GX0A 3V8BA 2VZ9A 1GR0A 5IN4A 5HRUA 2VYVA 4FPXA 4GKBA 5AYVA 3QW2A 2FR1A 5DCYA 4HFNA 3W4IA 4ZQHA 1Y8RA 1LSUA 3H2ZA 3KETA 4FCCA 3EMKA 5AOVA 1Y8QB 3RUAA 5U4QA 4JX8A 1IZ0A 3ZWXA 1VSVA 2JFHA 4MKXA 1DRVA 4JGBA 4RLHA 3JQ8B 4E5NA 2GZ1A 2OZPA 3OIFA 3OIGA 3W1VA 1PGPA 2QIOA 1DRUA 5T57A 1JKFA 1Y7TA 2AXQA 4HV4A 3KYDA 5JDCC 4QFCA 3L4SO 3SC4A 2O3TA 1DFHA 4DLLA 2GR9A 4IDBA 1X7HA 4QSMA 4FC6A 1KEVA 2GPTA 4YB8A 4IQ8A 3D4OA 2X4GA 3U5TA 2V6FA 2D3TA 4U8GA 4K6FA 1KVSA 4RCVA 1YB4A 4IIUA 4GAEA 4HX5A 1QP8A 2GNAA 3QJ5A 1D1SA 2Q4BA 4J7XA 1UXKA 1AN9A 3LT2A 3Q1LA 3HN7A 1EVZA 1KBZA 1T1RA 1DC4A 1Z7EA 4XDYA 3WJAA 1XIVA 4DQXA 3AU9A 3P2OA 4YT8A 3DZGA 2IEDA 3QVWA 3PYMA 1PJBA 1WMBA 4AFNA 1UDCA 3Q0EA 2V6BA 5ENVA 4CV3A 5DZSA 2AQKA 2X0JA 3NT4A 5EQDA 4PLHA 5U9CA 2PK3A 4CQLB 5CPBA 5JSFA 2VRCA 4D79A 4YRAA 4R1UA 4BNWA 1B7GO 4DPLA 4ND3A 4X54A 4GGOA 5L7WA 5CEJA 1FDTA 1BWSA 3LDHA 1HE5A 3W4KA 4NNJA 5KVSA 4IGEA 2Q1SA 5F5LA 3RVDA 3U62A 2V7PA 1U7HA 4W7HA 1B3BA 2VN8A 5JDIA 2O3UA 4DMLA 2BELA 3GF4A 3KSZO 1HXHA 4FFNA 1VL8A 2AQ8A 3CINA 3I9MA 4OL9A 1N1GA 1H9AA 3TF5A 2CVZA 2JD1A 2GASA 3GQVA 1TLTA 4DIBA 1J4AA 3WICA 2C7VA 4LISA 3GHHA 4A26A 4Q39A 4CQMD 5JY6A 4XRGA 5JO0A 3DZHA 4K6CA 3SVTA 3TWOA 1BG6A 1YBVA 2X9NA 4OOFA 3RBXA 2OL4A 1U8XX 4HWKA 3U09A 3BMQB 2OXIA 3BIOA 1JDJA 5LDHA 1YGYA 1H94A 3QE3A 1ADGA 3MJCA 3ZV4A 3IJPA 4OO3A 4U5QA 1ADFA 4UUNA 3NGLA 5F21A 1NAHA 4YCAA 4PG7A 5GMOA 1OOEA 2NV6A 4KP7A 4BNLA 4G81A 4HP8A 2EF1A 5JAIA 3JQEA 4C7KA 2VHWA 3OECA 3ZU4A 4MVJE 3ZV3A 2Y05A 3ROMA 1PL8A 3HDJA 5HS4A 1F12A 3CMMA 2XXJA 3ONEA 4ALIA 4CQMB 2CF6A 4ZQFA 1UH5A 3C7AA 1W4ZA 1ZMTA 2AG8A 5DBGA 2NVBA 3I4CA 5L3ZA 1O89A 3GHYA 3C1OA 2H63A 4XGIA 4DRYA 2IEBA 1DC5A 1NWHA 3U0BA 3UH1A 1B3RA 3JD1A 1ISGA 1M76A 2QRJA 5DNAA 4CLXA 4OKIA 2FOIA 4HNGA 4F6CA 1DFIA 4IDDA 5L45A 1E6WA 1V6AA 4WOJA 3EGOA 4AJ2A 4JBIA 2D5AA 2VOEA 2GN4A 5THKA 3ZCXA 3M1LA 4WK6A 1PJCA 4RJTA 4ILKA 1Q2XA 4CV2A 1RKXA 2VWPA 2ZK7A 4KTTE 4IJKA 4HFJA 2JCVA 1PGNA 4IDCA 3L4BA 4EGFA 2RCYA 1KVTA 1U7TA 4FSHA 4A5OA 4YEDA 4GX2A 4ALNA 1EDOA 1O6ZA 3GN2A 5TRTA 2C2YA 4A2CA 5THQA 2Q3EA 3WIDA 1SOVA 1NX6A 3AUSA 3PQDA 3OA0A 4GLOA 2W2LD 4OXNA 1GYPA 3KXDA 4EBFA 2D1YA 4GH5A 1VI2A 3H7AA 1PWXA 2POQX 1E7SA 5HBRA 4EYEA 3KUXA 2BGLA 3I23A 2EW8A 3PYXA 4QECA 1WZEA 3ROKA 1F06A 3BMOB 1DJQA 3CZMA 3GPIA 2DBZA 1WNTA 4YRDA 4ALKA 1PR9A 2Y1OA 4IS3A 3DZFA 3LC7O 2C07A 3MEQA 1E3WB 5L7TA 2FWMX 3ETDA 2Y67A 4CLDA 4E4YA 1TI7A 4XR4A 5B1YA 1I3MA 3WBBA 5JE8A 3PRJA 1YL6A 5JAQA 4CMBA 4B7XA 4D46A 3DOJA 4BO8A 4IPTA 3TOXA 1K6XA 1SZJG 3AFMA 3LK7A 3ZWPA 2E6UX 1PU2A 3PJFA 2ZB4A 2HDHA 3BAZA 1R4MB 1SB9A 4L75A 1GV0A 1T4DA 3TDKA 3BZUA 2Y1DA 1E1LA 2EEZA 4MP8A 5EL0A 2C0CA 1DFGA 1VJTA 4M87A 4NMHA 2ZIZA 3EDMA 4IQ0A 5F1KA 3G1UA 2PGDA 4ITUA 3WNQA 2D59A 1BXGA 4Z0PA 3JQBC 4OAQA 4PZCA 2Q49A 1P1IA 2HMVA 5IZCA 4Z0TA 1I3NA 1NFFA 1HYEA 4J16A 2LDXA 3H5RA 4WCFB 1UP7A 4F46A 1X14A 4NU5A 3OHSX 4ND4A 2R6JA 4LRSB 3F1LA 2FMUA 4AJJA 3WNVA 1ZUD1 1ZK4A 1I3LA 1LLDA 1LX6A 1EVYA 4AJOA 3LQFA 1E3EA 2P5UA 2PA3A 3WB9A 5DF1A 3ZHXA 3U4CA 1KVRA 4IZIA 3UKOA 2YUTA 1LSOA 1ZJYA 1C3VA 5F1OA 2DVMA 4XGKA 3QWAA 3CSDA 3ZN2A 1E3JA 1I8TA 1UXGA 4QEDA 4A03A 4TQGA 4TSKA 5IZCC 1T26A 2PD6A 2JD0A 3L6OO 5L9AA 3DTTA 4R01A 1PQUA 5G2OA 5TT1A 2LDBA 5DOVA 4N54A 2YHUA 4P38A 4CR7A 5C7OO 1KEUA 1M6WA 4YTEA 1DIBA 1GPJA 1OC4A 1OI7A 4J6FA 3RU7A 4ND1A 3WSVA 4QXMA 2PH3A 4Z6KA 4PVDA 2VWHA 4PGFA 3S2EA 1PQPA 3CKYA 4DC0A 2EW2A 1OC2A 4NJOA 2UV8A 1P1KA 4AG3A 4BUCA 2EP7A 2CVQA 3L77A 2W2KB 1I30A 2BD0A 3GRKA 3ZGYA 1NQTA 1FDSA 1KEWA 3WOHA 4YR9A 3U9LA 2YZ7A 4U6SA 2B4TO 1HSOA 4ND2A 3FCOA 1WMAA 3PLRA 1YQXA 4DL9A 5JFOA 4UUMA 1B26A 1LLUA 1QYDA 3HN2A 4PLTA 1ML3A 4RF3A 1P0FA 4YJGB 5BNFA 4EZBA 1K89A 1DAPA 2NVUA 4M54A 1KEPA 1YBAA 1A7AA 1KERA 1MC5A 4PLZA 4PZDA 1BW9B 3GA0A 4RPHA 3WFJA 3HHPA 2QG4A 4AJEA 4INAA 5EESA 1CRWG 2BHLA 2X23A 1JKJA 3PDJA 1B8PA 4MP3A 3EZYA 4P22A 4ZU3A 4B4WA 3KO8A 3TNLA 2IZ1A 3C3XA 3VH3A 4RQUA 3GZ4A 3WFIA 1HTBA 3NDJA 2BFMA 3ORFA 4D3FA 1QV7A 1BVRA 3KVOA 1NQOA 2HAEA 1ZZEA 1QV6A 2DPGA 2RIRA 3EY4A 5GY7A 4CQMA 4D44A 5T5QA 2YHIA 3C1TA 4B8ZA 1EUCA 2BRUA 4R4JA 1MG5A 2I66A 4FQ8A 4IMPA 3GEMA 5IDQA 4ONEA 5DBFA 1E5QA 4HXYA 3OQ1A 3TQHA 1FXSA 1IYZA 3SXPA 3IAHA 1LRKA 2PKQP 3RFXA 4BNNA 4RPKA 3DQPA 3PQEA 2PR2A 2A35A 2GN6A 3DBHB 3P19A 3PFFA 4FJ0A 4KZPA 1WW8A 3W6ZA 4I9UA 5JYDA 2E48A 5A5EA 3S2GA 4K1LA 5AXDA 2VRBA 4I9HA 1L1FA 1BVUA 4FFPA 5IDWA 1SEPA 1XLTA 1OMOA 2NU9A 2GERA 4IDGA 3JQBA 1G1AA 5KKCA 3CPSA 1MX3A 2FPGA 4MVJM 4WE3A 3E5MA 3WQRA 1ZXLA 2UUOA 5CDGA 5AQ1A 1VE9A 3GFBA 3BMNA 3R3SA 4TZTA 4YAJA 4S3MA 2H9IA 4KDFA 2ZYDA 1PJSA 1JA9A 2HSDA 2VTEA 2PZKA 5I9MA 4EJ6A 3NT5A 3AOEA 3JQAB 4JK3A 3IQDB 1P45A 2OP1A 1P33A 5I7FA 4DIFA 2R00C 4XB2A 1UDAA 2P9GA 4PVCA 4BNGA 1XYGA 3I9KA 1DDOA 1EZ4A 4OKNA 5TT0A 3FHLA 4N18A 2GCGA 3JV7A 2IODA 1AE1A 1EBUA 1LDGA 1J0XO 3BMCA 3RUFA 1DEHA 2UVDA 1XR3A 3E9NA 4NH4A 5DCUA 8ADHA 5BNIA 1PJQA 5K0ZA 3LT0A 3V2GA 3PJDA 4R51A 4CR6A 3VC7A 2DBRA 5TIIA 2XOXA 1R4NB 1MG0A 3PEFA 4URFA 3D5TA 4Q3AA 3F5QA 1XG5A 4PIVA 1GADO 1JWBB 4RVSA 1Y6JA 1LEHA 2FN7A 4R1TA 2QYTA 1V35A 1DC3A 2VUUA 4BB6A 4DTIA 3O38A 2D0IA 3TZCA 5G4KB 1ADCA 4J91A 3SBOA 3NDRA 4YJHB 3RAJA 4Q3NA 4KUEA 4HUJA 4KWIA 3AM5A 2PWZA 4M55A 4UVGA 1DJNA 4CMIA 3FF4A 3GGGA 1ZSVA 4D3SA 1PR3A 3A9WA 1SEVA 2C7GA 3JYNA 4YBZA 2E37A 2D2IA 1NYTA 4D43A 1WXDA 1Z7BA 1IOLA 2Q2WA 1UZNA 2AQIA 1ONOA 3GVXA 4P4NA 2D4AA 4QT0A 4I5DA 3PWZA 1ISMA 2JL1A 3EK2A 4YVFA 2CDCA 5A06A 1C1DA 1ULSA 3JQGA 1XEAA 3FWNA 5KKAA 4CMGA 4RPGA 3IOYA 3MJSA 4H16A 2NU7A 1NFRA 2GSDA 2ZQZA 3GZNA 1RM0A 1FDWA 3JQ7A 3MJVA 4BNVA 4F3YA 4L4RA 3BA1A 1CERA 1Q1NA 5L4NA 3FPLA 1EMDA 3RU9A 1WDLA 3H5AA 2GLXA 4LSWA 1QKIA 1MXHA 3GUCA 2GF2A 2PZMA 2G5CA 3IMFA 2P91A 1AUPA 3NRCA 4BKUA 2QZ9A 3DTYA 3BTOA 1MB4A 2Z95A 3KB6A 3CZRA 3WGGA 2YFHA 1N5DA 1R0KA 3QWFA 1HE4A 1E77A 4WGGA 3LT1A 1A72A 1O5IA 3RUHA 4IDEA 5KNLA 2PD4A 3QSGA 1KY5A 4NPCA 5GZ1A 3INTA 4Y98A 3QIVA 3L0DA 3DBLA 4AJLA 2X0RA 3RUCA 1DC6A 4W7IA 4WNCA 4AICA 3D64A 4J1SA 4O59O 3G49A 4BO4A 5MGBA 2R2GA 3Q11A 4BMNA 3CUKA 1ENPA 1BTOA 2B5VA 3FNGA 4J4HA 5CDYA 4JBGA 1VSUA 1L7EA 1D3AA 4GL4A 1XKQA 3MOIA 3UOGA 7MDHA 4M8SA 1GU7A 4Y6PA 3WYEA 4WCFC 3OM9A 5EMHA 1GEGA 4TKLA 3V2HA 1FMCA 1LJ8A 3W8FA 1R37A 1PGQA 4Y9DA 1C0IA 4CLRA 4CUKA 5I8ZA 2Y1FA 3E6AA 5L53A 1TT5A 4J43A 4XQEA 4BNHA 3ZV5A 4RVGA 4OXYA 6LDHA 3JQDA 4N7RA 2I76A 3PP8A 4R5HA 3OBBA 5B37A 3FRJA 4RF2A 2OMEA 2VYVD 3RJ9A 3QWIA 2EGHA 2G1UA 1NPTO 3RJ5A 2NQTA 4CM4A 5HM8A 3VZPA 3ZNOA 4UEOA 5T8KA 4FDAA 3X2FA 2BF7A 3VDQA 4NDNE 3QV1A 1EFLA 4UEKA 2QYSA 1E7MA 3NUGA 3IP1A 3BHIA 1IPEA 1PZHA 4W9NC 2DC1A 4CMCA 1I10A 1G0NA 1TA4A 3G79A 3AU8A 5KJ6A 1T2AA 1BDBA 4WLNA 2O4CA 1LA2A 3C85A 3LZ6A 5JY1A 1FDUA 4DBZA 5KVCA 2IXBA 2X5JO 4GKVA 1OAAA 2OBNA 3DR3A 4ZA2A 4PG8A 1FF9A 3PXXA 2AHRA 4BGIA 3VZRA 2QX7A 2UUPA 1KS9A 4WLFA 5AXAA 4Q3DA 4WUVA 1YXMA 2WSBA 4BO6A 4FR5A 1W0CA 3CE6A 3VH1A 4I8XA 2Y1EA 4Y6SA 3AJRA 1ZK2A 4YJGA 4BL5A 3SC6A 4TKMA 5J23A 1T2EA 3KEQA 1HEUA 2Q1WA 3QHAA 1EEHA 1H2BA 3VH4A 4BKPA 1YH3A 2PLAA 1X0XA 2EKQA 1QLHA 2TMDA 1PJTA 1Z82A 1F8GA 2GGSA 1EBFA 1R0LA 1YS4A 1ZEMA 5CFZA 1U4SA 1ISJA 3RKUA 3TZQA 3OJ0A 3F4LA 4MVJP 2VHYA 3ZHZA 4KUGA 2W90A 4AJNA 2ZQYA 4NG5A 1XDWA 4BO5A 3PYLA 4IJUA 4EJMA 4BS9A 3GVCA 1Q0LA 4EUEA 4DLBA 3OJOA 3ZWCA 3RWBA 4LVCA 4NZ9A 3GH3A 4CLEA 5COAA 4MKZA 4BV9A 1L7DA 1HDGO 3O03A 4XX0A 4NHEA 4ZVVA 4XJSA 1Z45A 1VKOA 1ZIDA 4JROA 4TRRA 5A04A 3EW7A 2X1HA 1MLDA 4DUPA 3NEPX 3TN7A 4MOWA 5TS3A 3M2PA 4MJLA 1PIWA 3LU1A 4FN4A 2X5OA 3E48A 3GN1A 3L07A 3C24A 4Q3EA 2O23A 2X22A 5U1PA 1LU9A 4D7AA 5A1TA 5IG2A 5EN4A 3PDUA 4OMUA 3TSCA 3D3EA 1YOVA 1A4UA 2W4QA 4MO2A 4XZ3A 4XYLA 1LDYA 5DCWA 4DVJA 3PHIA 1EK5A 3Q6IA 4GVXA 1EQ2A 1LQTA 3K92A 1LSSA 1YKFA 3WS7A 5IXSA 4I9NA 4LRTB 3S2FA 1HL3A 2B36A 7ADHA 4XJTA 5ENDA 3ZHYA 3Q9UA 3O8QB 3GDGA 3Q2IA 4BVAA 2ZTUA 1E3SA 2AQHA 1DHRA 3N74A 1HZZA 3R1IA 4E12A 4LVUA 5B4TA 1SOWA 2B35A 2WMDA 3ZWVA 2O48X 4TRJA 2NNLD 4BOYA 2AA3A 1U3WA 4MVJH 1V3UA 1B14A 1XSEA 1LC0A 5A9SA 5JAMA 1IHYA 3BMQA 3H65A 3AM3A 3C7DB 3SLKA 5C7IO 2F00A 4RQTA 2V65A 2I3AA 2I65A 4E32A 4J4BA 3DBVO 1MXFA 4A73A 3RSHA 4RF4A 2DBVO 4XR9A 1IHXA 4II2A 5EIOA 4LCEA 4E13A 3ANNA 3F4BA 3VKVA 1O9BA 2DPHA 3F1KA 3PGXA 3PIDA 3ST7A 1LRJA 3ANMA 3CMCO 2FY8A 1K3TA 3DL2A 1UR5A 1KY4A 4CMKA 2ILTA 3VPFA 3KRTA 3WQSB 4M49A 2V6GA 6ADHA 3G0OA 8LDHA 3OJLA 1X7DA 3I83A 2NQ8A 4J7UA 4NBTA 1DB3A 4E5MA 3EVNA 1M75A 3DDNA 3HJAA 1N8KA 5JPIA 3S2IA 2BFPA 4WECA 2DU8A 5KIAA 4J1NA 2WYVA 3W8DA 5G4LA 4R1SA 3ZWYA 2WD8A 2VWGA 1QRRA 3DFUA 5ITVA 5BSFA 3PHHA 5BNTA 2GZ3A 2WE8A 2E49A 3ONFA 5TF4A 2VUTA 3OSUA 5L4SA 3RI3A 4UEJA 1NWCA 4B3IA 4ID9A 1P44A 3DMTA 3PZBA 1ISFA 1TXGA 3M2TA 1WWKA 4IBOA 1I5RA 4XB1A 3R3JA 1ENYA 4UREA 4XEHA 5F5NA 4CLOB 4E5PA 2AE2A 3PJEA 1E3WA 4WCDA 3F47A 5KVVA 2C54A 1U28A 1ZXBA 3GNSA 5G0VA 4I08A 3MTGA 3TPCA 4ZD6A 2J3KA 3QQPA 2HQ1A 1GEEA 4EUHA 3EC7A 4UVDA 1VJ0A 3T4EA 1IUKA 3PHJA 3AI2A 5ER6A 2UYYA 1PJLA 4FD3A 1WPQA 2CFCA 1I01A 3C1AA 3H9EO 1CWUA 3KLPX 3AY6A 2EWMA 4AJKA 1UXJA 1PGOA 3SX2A 5KOIA 3WXBA 3CH6A 1DLJA 3CEAA 1NM5A 3RUDA 3E5RA 1KC3A 4NBUA 2NADA 2DAPA 5DP2A 4BNKA 4KMSA 2O7SA 3IS3A 3WMXA 3JYOA 5TJHA 3MJ4A 3B20A 3H3JA 1I3KA 1P74A 1C1XA 2J3IA 1E7QA 2VQ3A 3ASVA 3TOZA 2NVUB 3GRPA 3TL3A 3HE3A 2H6EA 4FS3A 2JHFA 4NBWA 1RYDA 3QWHA 1PJ3A 2BFOA 2C20A 1A4IA 2O3RA 3UN1A 3WGQA 4TRNA 4KQWA 4O1MA 2VZ8A 2WD7B 1PEDA 2DTDA 2E4AA 4PLGA 2P9EA 4DA9A 4CM6A 2G0TA 2PY6A 2HK9A 4E2ZA 3PTZA 2G76A 2P4QA 1NHWA 3RROA 3X2EA 1CEQA 1XELA 1P31A 3K31A 1GCOA 5DULA 4EUFA 5C7LO 4ZRNA 4P4GA 1K6IA 2HO5A 1JKIA 4JIGA 3GMDA 4AJ4A 4I1IA 5COBA 2BGMA 2CDAA 1DPGA 4R5MA 1UXIA 2A4KA 2X8LA 3PHGA 3H5NA 4RORA 3E03A 4CM7A 4IDFA 4NFYA 2WWRA 2CZCA 2Q1TA 4HKTA 4LW8A 2O4UX 2NTNA 4OSOA 3EVTA 4ALMA 4LMPA 1WDKA 3ULKA 1NR1A 4XQCA 4W6ZA 2OUIA 2GN9A 4CUZA 3DHNA 3K96A 1PZGA 4CL3A 4OM8A 4ZQEA 5JDIC 4WLVA 3FNEA 1KC1A 1DLIA 3L4BC 3ZU3A 2GN8A 1H5QA 1QSGA 1H9BA 1PZEA 1HDCA 3K2EA 4N5NA 1UP4A 2JAHA 3KV3O 2Y1GA 1MC4A 4GX5A 3BMNB 2VRCD 3WIEA 5I7SA 4CUJA 4MPDA 5A5FA 4GI2A 1O95A 1JVBA 2GUGA 4MVJF 4CL8A 3AY3A 3E8XA 2DBQA 3ETEA 1GY8A 4FOSA 4J0FA 4FB5A 4B7UA 1P3DA 3ICPA 4IIVA 1N9GB 5EPOA 2F1KA 1D4FA 4IJWA 4RF5A 3QRWA 2P68A 4B79A 2HK7A 3QLJA 4MVJI 3GDOA 3WGIA 2EGGA 3PHLA 4Y8VA 2EV9A 2J8ZA 3WBFA 4IXTA 1BXKA 2EJWA 4BNFA 5FI3A 2YQ5A 3RIHA 2ZCVA 3JQ9A 1ZCJA 4JQCA 1RM3A 1NR7A 4B7CA 1ZSYA 3ANLA 5EERA 2HMSA 4XRRA 1JU9A 3O8QA 4CM8A 3UVEA 4AVYA 1NTOA 1F17A 2HRBA 3ZU5A 4YT5A 1E7WA 5JDCA 4ND5A 4PFJA 3WG9A 4OGWA 4BO2A 4WKGA 3OEYA 2P5YA 4MDHA 4J9VA 2HK8A 5G4KA 4P8RA 3ZWAA 4G5HA 3E18A 2DFDA 4XA8A 4L76A 1PZFA 3UHAA 3ZWBA 2W8ZA 5JS6A 3NTQA 3HFGA 1CIVA 9LDTA 4LK3A 1BDMA 2WYWA 2YV3A 3PGJA 4GX1A 2I5PO 1MUUA 2BGKA 1NFQA 3K2BA 5KTKA 5LC1A 5BSEA 2PH5A 1YJQA 5K9ZA 1U4OA 4NBVA 4M89A 4TROA 3VHRA 1EE2A 2WYUA 1W8DA 1U3UA 4E2WA 3SEFA 4C4OA 1DO8A 3N7UA 4FGSA 4R3WA 4XYGA 4CV1A 4EITA 4CMHA 4B4UA 5A4DA 2I6TA 4K28A 3KHUA 1JN0A 3KYBA 1PWZA 2NLOA 2J3JA 3D3WB 3VZQA 1CETA 1HDRA 3HG7A 1YQDA 1VJ1A 3D0OA 3DBRB 4PLCA 4XYEA 2J5RA 4YRBA 2DTEA 3L6DA 1HKUA 4XIJA 3I9LA 4B4OA 5G0UA 3HWRA 2ZCUA 4IQGA 2VT3A 5BR7A 5JCXA 1H2HA 2CVOA 1MA0A 1Z73A 3NGXA 4JLWA 4UVEA 1GYQA 3LLVA 1E7YA 4LGVA 1NVTA 5JC1A 4FJ1A 4CLOA 2HJSA 1A7KA 2W2LA 3WGOA 1PQWA 1VL6A 2R00A 2IDZA 1R66A 1S7CA 2AE1A 3GMSA 4QTZA 1B8UA 5L4LA 3ADPA 2QQ5A 4D41A 1I2CA 1J6UA 2Y0CA 1EK6A 2NU6A 2X7HA 3IUPA 3KLMX 3AW9A 5I9LA 1J49A 1ZSNA 2VZ0A 4W99A 3L9XA 4YDRA 4J1QA 2CDBA 2XAAA 1GL3A 3ZZNA 4OJNA 3F9IA 2FR8A 4RDHA 2X0IA 3AUAA 4P4LA 5L40A 1GUFA 3MTJA 3HADA 2JJYA 4BQPA 2Q4EA 3TZHA 4OSPA 5B12A 3VPGA 1ZMOA 4BQRA 1T2CA 1GDHA 4A10A 1XQ6A 4ALJA 3ROPA 4RVDA 4J3FA 4NBRA 1GCUA 3UF0A 5A05A 4CV0A 5KJEA 4EI2A 3RASA 2QRKA 5CHEA 2B4RO 2CUKA 2EG9A 3F5SA 3K8ZA 3OJEA 1EDZA 1GUYA 2YW9A 2DTXA 3UXYA 2J6IA 4RZIA 2BI8A 4IGFA 1Y9AA 2SCUA
chains in the Genus database with same CATH superfamily
4WBXC 4YAKA 4JBWA 3JTMA 5B6JA 1UPXA 2GM5A 2QWXA 4QFDA 4R2LA 5B6PA 2FXIA 4IV0A 1JHAA 1NXXA 1H9CA 4C5AA 2ZSFA 4MVYA 1ISIA 1J33A 3UCXA 3O8RA 1Y4AE 2G9VA 3DCNA 3W7BA 1QQBA 2B6HA 1H3FA 4P53A 4JI1B 4AJPA 5F2EA 2OBMA 3ZWMA 1NGSA 5DM60 4FI3C 1MENA 1XQ1A 3QNWA 4TSRA 1K2WA 4HXEB 4QO7A 3SY8A 4O6VA 1OI3A 3U9SA 5B2ZA 3WWEA 4YXWA 5CFPA 1OSNA 3AUTA 4Y2GA 5AW5A 2OZKA 4HH4A 2ZVQX 2QZZA 1M7GA 4IIBA 4WWHA 5IF9A 4HRVA 3I42A 5DVZA 1R64A 2F3PA 3KFLA 1A76A 3KB1A 4ZTBA 5BY2A 2R66A 3LDFA 2Z5VA 1MJNA 2YJGA 4EPXA 4WAUA 3TZKA 1FUIA 2OGZA 1UJ2A 1X1EA 2F64A 3A31A 1LLQA 4WOKA 1Y1QA 3O7MA 4IHJA 4MYDA 4ZI5A 5D7BA 3H1BA 3AJAA 2N0SA 1XD9A 1HTWA 3PVSA 3NTUA 3NORA 4QBKA 1AXEA 1IWPB 2GJAA 3DVAB 4RXTA 5EY5B 2X77A 3U3JA 4RGVA 1G3QA 4UUOA 3V7WA 1YDMA 4B2IA 2C9OA 1M2WA 4JJ7A 4MUJA 4JI3B 3VMFA 2ZSDA 2GNOA 3VZSA 4BC1A 4AAYA 5LKAA 1PWEA 2OO5A 4BQOA 2W2KA 1NC3A 3IPRA 2WA2A 2YX1A 3I4FA 3W8RA 1MJGM 3FMIA 5LLDA 3L01A 4O4LF 5DN9A 2K5UA 2Z3VA 4WINA 3CYFA 3F90A 3UMGA 4NV1A 1Z6AA 1J2YA 1EVJA 4A0GA 1Z4MA 4D80A 5C1DA 4NEQA 1J70A 1TO1E 1VB5A 1CQPA 1WS6A 1ZRNA 4XUDA 1U7UA 1WD5A 2A92A 3HYRA 3OKAA 4MUXA 1OXMA 3IIEA 1ETHA 3CISA 1N75A 4D45A 1VPDA 3L82B 4JUDX 4RAQA 1EK2A 4MIYA 1GZSA 4R05A 1DVRA 1QHGA 2QJWA 1X1RA 3M6XA 3QX9A 3UB4A 4F5WA 1UXOA 3WX0A 4KQEA 2BL4A 3VSCA 3V4VB 3B5JA 3MT7A 5I47A 3G2OA 1DBWA 3PQ4A 4HHEA 2IH4A 5JCJD 3NW9A 1Z47A 2WF9A 1MO5A 4RD6A 1GV1A 1QPGA 4PRLA 2BHRA 4PHFA 1MO4A 4GPIB 4KWEA 4LOAA 4R9RA 1HLPA 4G1BA 4X95A 1Y6FA 2FSSA 2PCJA 2YV4A 3Q3HA 3HACA 3N07A 3OKPA 1NZJA 2J5QA 1M8FA 1CJTC 4ZGBA 5JWRA 5H83A 1G3MA 3LUBA 2O3QA 1KYQA 1ULZA 4F06A 3N0XA 3LWNA 1MQSA 1LY1A 1P9WA 1V45E 1YAHA 3DWFA 3ICCA 4JGGA 4OUKX 3FNHA 2KE5A 4RMHA 1Y3HA 1II9A 4WVFA 3AM4A 3UW1A 2PBFA 2Q8PA 3M82A 2OHHA 4Z0NA 5DM1A 1ZOIA 1GA1A 1ZCZA 2Z1NA 1JFFA 1OTYA 1UWKA 2JCXA 2RBKA 4G2TA 3TMYA 4HUTA 2X40A 4PICA 4TZKA 2EKBA 2QT9A 3OOHA 5LU8A 2ZB8A 3RJTA 4WVLA 1CQIA 1VJDA 1JKXA 1FUYB 3DPIA 1C8KA 1Z6QA 3FZYA 1T4BA 2QSUA 1R0SA 3JD4A 2OYCA 4NYMR 2WF7A 4AF7A 5KOYA 1N6LA 2AW5A 3INNA 3KM0A 3PFKA 3QOXA 1BDIA 3UV3A 1I4EB 3TSWA 1ZK3A 1T10A 3W3AA 1JEAA 1UM8A 3B9RA 2WSLA 3LT4A 1UUFA 2A0UA 2HLPA 2PL3A 3PL1A 1W94A 3WYCA 2WAXA 4BNYA 3MELA 1LBEA 2OORA 1GFIA 1TAGA 3FNQA 3W3ZB 1UZLA 2XODA 3N58A 1N7JA 2ZREA 4M36A 2PBLA 4CQLA 4E11A 4F8JA 5LMUB 2FPKA 1WSWA 2HQBA 4B6OA 4D96A 5TS2A 3RH0A 3TR0A 4REOA 3OZCA 4O5OA 3KSMA 2PQMA 4CT4B 3FI9A 4ZJUA 3A3YA 1Y1KE 5E3JA 3PA6A 1QVRA 5L51A 2BI7A 2P4HX 3ONDA 2IPMA 1ZOPA 1WQ3A 2J5KA 4MVWA 4BB5A 2VOJA 4HYQA 3CRMA 3ECSA 3FUWA 1XEXB 3R0XA 3T3DA 3DAPA 3RS8A 4BNMA 1OB5A 4W63A 1TVEA 5C35A 1QS0B 2VXCA 1HZJA 1WMEA 3R5JA 1RZUA 1OU4A 4KEAA 3GFFA 3OLZA 5BV1A 2RHOA 1LQUA 2VTDA 3DCYA 3VPBA 5JQGA 2V3CC 2PKRA 4OQLA 4BVJA 5IPFA 5ITWA 5JMPA 1HO3A 1AK9A 2Z8ZA 3DE1X 4AMBA 3ZTTA 1XKXA 4J4TA 3PC8A 4YAUA 5HJEA 1DBIA 4PZEA 3WIVA 1KWKA 5I4BA 3CIOA 1R3UA 2PRIA 4BBZA 2A14A 3P1JA 2HA4A 5TQ0B 4PANA 1C9NA 1BVYF 4ZAWA 3FIUA 5AM2A 3H8VA 1BMFD 3GEPA 2BY4A 2OD7A 2Y99A 2AW3A 1HE3A 4UCXA 5E4TA 1E69A 1G6HA 1P1JA 4ZVKA 4JOSA 1V3TA 4N47A 2GSWA 4GP9A 4BEJA 1SCQA 1SPXA 3QG1A 5FBLB 5G40A 4ESEA 4QDXA 3QKRA 4L5JA 1UBRS 1W1WA 5KHOC 2VYND 3I45A 4BMVA 4Z3KA 3B9PA 1CY6A 4K03A 3ORHA 4CMEA 2Z4RA 3CB4A 4EGQA 3OIUA 4EO7A 1E6KA 4OEHA 2ID7A 4YCNA 2YYSA 4O63O 1W4RA 3KOWA 3SEQA 1KHTA 2QNRA 1ZX1A 3EGDA 3ITEA 5JMWA 2PUDA 1M8KA 4E2YA 3MAAC 2CFRA 1SUFA 3N2KB 2OC4A 4R7GA 3ZH2A 1RQ7A 1XRQA 2CLEB 2ODEA 2QVBA 3BTUA 3VPHA 1R9GA 2Y9PB 2IUUA 3OIVA 2W37A 4G9EA 2LUOA 3CXUA 3HU1A 4AWBA 2WWFA 4CKEA 4DR4B 4JP2A 1K7YA 2CVFA 3F2IA 2C5AA 2PMBA 5ICSA 4KQIA 3A6LA 3VM6A 5HNKA 2YIVX 5FF9A 1WP9A 1NF9A 2YDXA 2GYVA 5EFZA 1PTJA 2FRDA 1AB5A 4OYLA 2ZI3A 3ZHBA 3RVNA 4EJSC 1GQRA 2FDCA 4XD7A 2YHIB 3BH6A 2QJTA 4Y9RA 2XA1A 3JYLA 2R25B 4HQNA 4P86A 1GTZA 2QRMA 3A1DA 1VGVA 4KIJA 4RGQA 1P4RA 4LJAA 5DNEA 5EJGA 1T24A 2WWHA 4OOEA 2I78A 1U8CB 3BXPA 3H3FA 3L1IA 5ALOA 5GONF 3K0EA 1UAYA 4U5XA 2OAQ1 2ZAYA 4ZT4A 5J3JA 1G9TA 4QLOA 4RNCA 3SAJA 3N8HA 3NPAA 1OYOA 3JXEA 5IAOA 4YRLA 1R2QA 3O31A 2ZJYA 5AHKA 2PNJA 4AQ7A 4MLCA 1H5NA 4GI5A 2YWCA 1ZNXA 1KVUA 1GZ7A 2C29D 3PXDA 4H27A 3SCZA 3W5UA 3WLHA 3G9QA 2HCRA 3O1IC 3ZEAA 1OFGA 4JEIA 1E5VA 3DOCA 2YASA 4JEUA 4PLFA 1SNYA 1Z0IA 1ZJ6A 1TU3A 3L6CA 4G65A 3C6MA 2X2OA 5AUQA 3ZNNA 1V5FA 2C98A 3O21A 1XEFA 2C58A 3TRHA 4WZBE 2ZRJA 3C15C 2IDKA 4NR0A 4HAWA 1HFKA 4LYEA 1FXUA 5HFNA 5HIMA 2VPIA 3EGEA 4QGSA 1PZMA 5DB4A 3BWEA 2V7TA 3U3XA 2IYOA 1ZCFA 1L1QA 3KT6A 4U63A 3RM3A 3KXIA 4YV1A 2JEZA 2ZUEA 3AOEC 5IKOA 2I7TA 4KH0A 1ZLYA 2R8PA 4MRAA 1VB3A 4R8LA 4ZARA 3ET5A 3ZJ5A 3K6SA 1CDOA 3FCUB 3MB8A 1YC5A 3N7TA 1RP7A 3G7SA 1BEUB 4BGUA 3GJ3A 4J1TA 4LF7B 4CEJB 4PG4A 4E2XA 3E05A 1NP3A 1F8XA 1XL1A 5CVTA 3JWEA 2I67A 4AUMA 3RVKA 1YDWA 4DYVA 5GPBA 1RWBA 3NBZC 4EGSA 4JFRA 1U2GA 2WTBA 2GPWA 4GGPA 1R12A 1VPTA 1DXOA 1HPLA 2BM1A 3KKZA 4Q4DA 1JHQA 2HMWA 2W6CX 4PIMA 4M8NE 1QH0A 4OX9B 1AS2A 1DKLA 4BPRA 2ANBA 2ZB7A 3K9GA 3BILA 5JNWA 4F9GA 2R6AA 3B2QA 3KKOA 4ISCA 4GWKA 4KWCA 5FWYB 3LUGA 1Z2CA 3VC1A 5JCOA 2SCUB 3NHBA 4ZTZB 2DR2A 7MHTA 2RC5A 4N0QA 5JRZA 3FFBA 4BKOA 3AHGA 4O25A 1X70A 2AS0A 5CGZA 1W5EA 1X7YB 1X13A 1U2DA 2ZFUA 5JNLA 3Q12A 4FGWA 3CHYA 4Q9LA 1WU7A 3CEPB 4NARA 1JDVA 1AKTA 3EBPA 4FYWA 5T6BA 5C80A 2AEJA 5CRIA 3CM0A 1ZGBA 1GHTA 1SBYA 2PUTA 3DO5A 5LZ2A 1DX6A 1UMDA 3RU3A 4JLBA 4MQBA 2NUAA 3DXYA 4KUHA 1SXJE 2WNSA 4TSFD 1CRZA 3L06A 3H9UA 4P4SA 3D8HA 5A4KA 5B2FA 5LMZA 4L8VA 1E6EA 2WG1A 3UOAB 1CB0A 2C3MA 3ZI0A 1MTOA 2XMGA 2ZYAA 4LFAB 1QO0A 3H9GA 4WTOA 3R3VA 1PDVA 4DDUA 3T54A 3CFYA 1OXVA 1E92A 2BFCA 3Q3CA 2FP4A 1E79A 5TE9A 2IIQA 4TWBA 1A2KC 4IINA 4RHCA 3AL2A 4MI3A 4FC7A 5E9JA 3T3NA 3C3PA 3P2YA 4XPIB 3LDGA 2GFIA 3Q40A 2QUAA 3U4IA 3QVJA 1K4YA 4BQNA 1F2DA 2NXCA 3G5MA 4NMXB 4ECEA 4OF4A 4PWZA 2CLSA 3ABQB 3JW8A 3L8MA 4JA2A 4TVBA 5IJAA 4CCWA 4PF1A 3GDHA 4UE2A 1G9XA 1I4DD 2JVKA 3QLTA 4J9UE 3UWPA 5JPDA 3A6KA 3Q2OA 3TGLA 3L4JA 1DDIA 3GVIA 4B32A 4EMUA 4IF6A 1JHVA 5AJVB 3JQGB 1RQPA 4DLNA 5BV8A 5BYAA 2D0DA 2EP5A 2V0NA 1W29A 5F9FA 3A8TA 1CTQA 1FLVA 3JQ7B 3L6BA 1EWRA 3UA3A 3GUZA 3SHWA 1HOTA 4N0MA 1H3NA 1QVAA 4I9FA 3H8JA 4YJ3F 1CB7A 1C30B 3HR7A 1AY0A 1NSTA 1JSRA 1NY5A 1Q5PA 1YB2A 5CM8B 4EG4A 4EY3A 1PX0A 2YMMA 3O75A 1P3Y1 9LDBA 3QEBZ 4M21A 1G38A 2BKVA 2WICA 1YWGO 2HF9A 3LO5A 4LX0A 2BLNA 1QAOA 1UP6A 2EFJA 3U4GA 2H7YA 1W75A 1OHHA 3IR5A 3C3MA 3EC2A 1V4VA 5ALFA 2J46A 1JEYA 2I3ZA 1E1CB 2XHEA 3V4FA 1M6EX 2GA8A 3RD5A 5LZ9A 3OMXA 3REGA 3VHXA 3TFQA 3A14A 2ZROA 2Y6UA 4CIDA 2P41A 1EJ0A 1IZ9A 1TYZA 2GEJA 1Z62A 2OORC 2Q3DA 4QDTA 4WESB 1CW2B 1DAEA 2DKNA 3H5OA 1Z5VA 3JQRA 4IXWA 4QA9A 3S55A 1Y1PA 4XQ9A 1P1HA 5E0OA 4CCAA 4CM9D 3QVTA 5B4VA 4OFXA 1I24A 2PWPA 3G68A 2VSYA 3JSAA 5A6SB 4B3HA 1FP4A 2Z8XA 4UD6A 1QE0A 3PE4A 4B31A 3EOAI 4FMCF 1UAGA 4V0OA 3HKDB 5LIPA 2VVTA 5DW0A 3CEHA 3NB0A 2G8LA 3DE4X 2AEMA 3DXZA 1PJAA 2C5BA 3HR8A 5BOSB 3NATA 1PTKA 5GVSA 3O4IA 4BNDA 6ABPA 1YQGA 1PUIA 5EJ7A 4WJZA 5A4MS 1W87A 1D4ZA 3C1UA 2W58A 2ZU0C 2E5FA 3WMWA 3DMTC 3ZHTA 1QQTA 3VU9B 2O8FA 1RSZA 1LTHR 4XIYA 2E5LB 1O7JA 3YASA 4IS2A 2AMJA 4KU4A 3ROXA 4LRWA 2Q2VA 5FWDA 3VNQA 4AMGA 1A5SB 2J0UB 3L46A 3CF2A 3M4YA 3D6UA 3O2QB 4BUJA 4EG6A 2XNDA 3GRUA 1Y9JA 2IEZA 4GXRA 2YFQA 3GNTA 1WXGA 2ADMA 3TCKA 2NO4A 5IUKC 4RLFA 2BP7A 2DUUA 1ZWKA 5MDHA 1FP2A 3JQ9C 3MPOA 3DDHA 1NQ5A 4ZOAA 2G25A 1ZD1A 2IY8A 2C1ZA 1YZFA 1ZGCA 4BV8A 2YVUA 4D81A 2B2XA 2DR0A 2WMYA 4Q9HA 3UJ3X 3USZA 3C8UA 1HYHA 4XAQA 4BJ5A 1K8RA 2W98A 5DLEA 4EKDA 4TUYB 4RSMA 3O2NA 3GUYA 1WG8A 2AEFA 2BMDA 4B5KA 4JCOA 4QRHA 4ZO9A 4PO9A 4M1MA 1KYYA 1LS6A 1QRUA 2ASVA 3P26A 4KE7A 1U8EA 2JVIA 3KT8A 3LNTA 3MTBA 1ZVMA 2PFGA 3DCIA 3AEQA 1XTPA 1CP3A 1A5TA 4KWTA 5BV0A 3FYUA 5FBVB 1XDZA 2DUWA 2RGNA 2WU4A 5IJ9A 1BJRE 2N1MA 3B1KA 3E9MA 1H0SA 1TK3A 3SJUA 4B46A 4I6EA 1JJAA 4R9SA 4Y1RB 4KYVA 3IALA 1J1IA 2RC6A 3NKFA 2JGDA 2JFFA 1LDMA 2VJMB 3E7FA 1ATZA 2Z2YA 3NX4A 4L4XA 4QULA 4EKIA 4MUAA 3V6MA 3H2GA 4B71A 4A8JA 1BHO1 1Z18A 3ZGZA 1CF4A 2QVYX 3MSCA 4K5QA 3H9EO 2OOSA 3CKMA 2O2ZA 3E3OA 4PIPA 3LIIA 4N7JA 1KI1A 3TRIA 3KEMA 3WAKA 3O6VA 3KOOA 1CVIA 1RPNA 1SQ5A 4BMYA 4EMSA 1TB4A 2CL0X 4MQ4A 2EHJA 4U2EA 4WEOA 5T4HA 4A91A 5JFGA 5JSZB 3O3NB 1E9FA 2R1TA 3QVLA 3FLEA 3TW4A 3D8SA 4AYTA 4RETA 3T3PB 1ID1A 1JHDA 5CA0A 1YNSA 1D2EA 1HOXA 4UULA 5JEDA 1M1XB 3KYCB 2DFVA 3EVZA 4V0NA 5D01A 1IDN1 5HFJA 4B6SA 4B44A 4YLYA 7REQA 2X2FA 3FB1A 1Q1GA 4MLDA 3PNPA 3SHVA 1WW2A 4KVGA 5PNTA 3GARA 3EDRA 1ZI6A 4LV8B 1Z5OA 2ZBRA 3G3EA 4OP2A 3HJBA 1UDXA 2CXTA 5AIAA 1YFLA 4GZLA 3UICA 4Y2SA 3D6MA 3V1YA 4FNOA 3CLSC 3WNDA 4GE3A 1GL9B 2HX1A 2PL1A 4GOKA 1K5HA 1WEHA 2NYVA 3QPVA 1Y6ZA 2EFDB 1WCIB 2VHTA 3QJGA 4UHCA 4EK9A 2ATXA 2GN1A 2VDPB 4FHZA 4IUDS 3WMEA 1VE6A 3ZW9A 2D7JA 5B1IA 3QUTA 4F9TA 4UEQA 5IVDA 1O6BA 1JW9B 1TMOA 1KSFX 1D6SA 1AZWA 1KDRA 1RW4A 3BQMB 3GJ7A 1E5DA 4P6VF 1OFUA 2RH9B 4EFMA 5ICMA 1ADBA 4Q1VA 5DTQA 4CMIB 1JTEA 4KN5A 1VIAA 4J0EA 5G0SA 1R5NA 3ZWOA 5CJPA 1BXGB 3HCRA 4FUQA 4MICA 4PBSA 1O0SA 2EJUA 4OG2A 1NONA 2IUYA 1NBOA 3KTOA 3TLEA 3BSYA 3OICA 5CLFA 5BSVA 2GHRA 2MWMA 5JAPA 4KNYA 2DQZA 1KQFA 3CUUA 3GQBB 1MQ9A 4HNAA 4YI3A 2FPWA 3DTVA 5MFPA 3LBYA 4Y2JA 1LUAA 2VP5A 3AGPA 3RRBA 4RK7A 3QU4A 1GZ5A 4DNPA 1ILEA 4D42A 1TTPB 1NI3A 1EK0A 3KTAB 3WTCA 1JSLA 1P2TA 3Q3IA 1OE0A 3NRJA 3NBXX 3X1XA 1N0IA 4J3JA 3M6IA 5D8DA 3VVBA 1G21A 3U7FB 4U7DA 2YY7A 3O2SB 1U04A 1VKHA 4FZRA 2H3HA 3W2FA 4P1ZA 3T3HA 3TGPA 1KFCB 4TMYA 1Y5RA 2A9JA 2RHRA 2XMQA 3OQMA 2Z2IA 4JBNA 3R74A 4NTZA 1ND6A 2P1DA 5IAEA 3FN4A 4DSUA 1TCVA 3H3XA 1EUDB 3A32A 3KZVA 3ME5A 2Y0PA 1FFWA 1Q19A 4MINA 4QXRA 3R8CA 4Q34A 3S28A 1VCHA 1G20A 1MFZA 2X7XA 3QFHA 5CDFE 3P8ZA 2QGZA 1Q12A 2IZ0A 2J3QA 3LY7A 2CJXA 1DG3A 5IJZA 3FJOA 2CBGA 1F0NA 4IYRA 1NXTA 3I6BA 4KRYA 3R3WA 4Q7EA 1OF1A 3AUKA 5C52B 3OF3A 4BLUA 4DB2A 2D5CA 2FW0A 3IC5A 4KREA 2GJ9A 1F3OA 3GMTA 3R3UA 2AJ8A 3BDIA 1JMYA 5DHPA 4MXDA 4FYHA 3RVOA 2I9KA 4ARSA 1FFAA 2CNOA 1IUPA 3JU3A 2Z98A 4FIZA 1DMSA 4ZGWA 1VKNA 5I6DA 3EXG2 4PO3X 5LKRA 2V98A 3AFOA 4L5YA 4MS3A 5CNMA 5D86A 1XXHB 2YJNA 3D4IA 3EAGA 5FFMA 4RAOA 3G2HA 4H3VA 3VSAA 4F3KA 3KYJB 2GRAA 3ANSA 4X8MA 3TQRA 2QTHA 3PG5A 4MA0A 2OC9A 3B70A 2X4IA 3RABA 3ZIAA 4ZHQA 5ES4B 3MERA 4BGVA 2VTBB 4QQFA 1H3EA 1SVKA 3PEUA 1DUIA 1YTUA 5FLKA 3G0GA 2NU8A 2IZZA 4N03A 4ZU6X 5A02A 4AY2A 2AC7A 1ZN2A 1WXHA 2CSXA 4U2GA 1H69A 4L6AA 1K6EA 4G85A 3OY2A 4FZ3A 2AXPA 1JYFA 1LK7A 3INGA 4D99A 1XPRA 3O8NA 4HNTA 4OY3A 4ZO7A 5IBRA 3EWSA 4O3MA 2C83A 3CN7A 4GYWA 4HDNB 2VEOA 2WIGA 5ETJA 2JFXA 5I7VA 2O2EA 3D6FA 1NMQA 1QFSA 2PUWA 2IT1A 3HEMA 2G1KA 1SKAA 3T0GA 5GJWC 1H6AA 3MT0A 4GR5A 4CKCA 4E5VA 2I6UA 4TV8F 3VR6D 2CNLA 4KODA 1CJKC 4B8WA 3KQNA 3AF2A 1C0EA 4IO0A 3K5PA 4RENA 2E6KA 4Y0NA 3AR6A 2W11A 2G7MC 3N3AC 3IUYA 4L0QA 3G1WA 2RH4A 5C3MA 4X3PA 2Y2UA 3TGWA 2QLJA 4E08A 3VDRA 3PHBE 3FVVA 5C46F 3SG0A 1FBNA 4BLOA 1A04A 2O06A 4O2AB 4G25A 1FFCA 4WCFA 4YN3A 4OHVA 3RNLA 2XVAA 2JLRA 2NZ2A 4KGXA 1HDZA 2QRLA 2W2NA 4NBLA 3WGJA 3RO7A 2YYYA 4F93B 1Y5MA 3RC8A 1DQYA 1CLEA 2ZB3A 5B58T 5IXJA 5B7PA 5BSGA 3KJGA 2BISA 4CM9A 1M6HA 1WBBA 3IURA 2GBIA 3UGKA 5BUSA 3PK0A 4Z49A 1KDPA 4K9DA 3FY4A 5TMEA 2P2CA 1L6IA 4B6FA 1BGVA 4K1XA 3LX8A 5BMOA 3CWQA 1II8A 3Q3EA 1J7JA 5F78A 3KLNA 3OPYA 3UWSA 2OM2A 2RGCA 3A1CA 1ZKMA 5EKSA 4HO1X 4ND8B 4Q18A 3T7EA 2XA2A 1V9LA 2YCBA 3E53A 5F12A 2PA0A 4WEQA 3IPXA 1OLXB 2GLTA 3NHUA 4WW0A 1GKUB 2HZBA 1XALA 1ZH4A 2QAIA 3ETCA 2A7XA 2ZSHA 4LK2A 1BE0A 4IEEA 4BKRA 2CK3A 3MTAA 1MB0A 1A0OA 1KVQA 4WZZA 2EBFX 2ET6A 3QEJA 4O4HA 3TZ6A 5AKIA 4A8JC 2C2BA 2OCYC 3A6EA 1YQWA 1DIHA 4II3A 2ZJ0A 4R0VA 3SS7X 3S2ZA 1NAIA 2VJYA 1PLJA 1AD2A 3V1UA 3IIIA 1GR1A 1BQ3A 1KH3A 4M4SA 2W6NA 4COOA 5FFFA 4QVKA 3CCCA 3EFOA 4M98A 3DJYA 4QXQA 3NMUF 5KJ1A 2R1VB 3NOXA 1O94C 4QUHA 2CV2A 1K06A 1MO6A 4ATNA 4MWSA 5ALTA 2RMKA 2ES4A 2IEYA 3BERA 4O33A 1G41A 3EOZA 1NBEA 1HNWB 4TLBA 3DE7X 2TYSB 2BJVA 3F5DA 3IAS1 4GVPA 5LA6B 4LOKA 9ABPA 1NN0A 1PQYA 4EY5A 5L3SA 1LGYA 4X24A 4WPGA 3C8MA 1F1JA 1BWRA 1G8JA 1U0EA 1UJBA 2R6R1 2Q9BA 1BYIA 1ESMA 2CLLB 3A2LA 3DAOA 5CDHA 4HNHA 1SRRA 3WIOA 1XVUA 2KBFA 2OPBA 3V2UA 3W2EA 4UHDA 3GPDG 4WLEA 5CFOA 4XM2A 4B3MB 1Q7BA 2VBIA 1HV8A 1G6Q1 1X19A 2WJ4A 3DHWC 4JKIA 3ASUA 1XHEA 4U0JA 1ST2A 4Y9UA 5AXBA 3UGQA 4BP3A 7REQB 3QH4A 3KBOA 2WABA 4RS3A 3LKVA 2AEEA 3R9XB 2QTWB 3S27A 3EEOA 3WLRA 1P1FA 4BNJA 1RE0A 2YN0A 3KYCA 3EEYA 3PFCA 1G7TA 1WXEA 3GEGA 4EYQA 4GBGA 4C9BA 4D3ZA 1V11B 2EZTA 4LYJA 4D0SA 2CHQA 4QC2A 2GD0A 2BEUB 4D92A 3HFRA 2I33A 4CQJA 4DXHA 3SX4A 2EXXA 2FSIA 2YWBA 1DAFA 4LJYA 1KOLA 3ZWWA 1FQOA 1N7GA 9GPBA 1CQJA 1Q0HA 4BMSA 4G4IA 3ROTA 3EPJA 1GILA 1L1RA 1JXOA 1VA4A 1Z74A 3BD6A 3MQ2A 4JJ4A 4L73A 1JEDA 3WKDA 4LJRA 1E6UA 4AZ3B 4KQMA 3VKUA 1BX3A 3MWFA 3O84A 1X7XA 5IUNC 5FEMA 1OKKA 1U8AA 1PL7A 4BZPA 4P5DA 2C7PA 1Y8QA 1ZUIA 2UXCB 4L8YA 5ES3A 4EG5A 3JQPA 2JG3A 4HAUA 2RGNC 5CFNA 2W22A 1DRKA 3LJKA 4UD2A 4URWR 1A9OA 2Z30A 1E9VA 4CYMA 3D6JA 2O5RA 3JQAA 4QYMA 3Q7SA 1T2FA 3VA7A 1W96A 2Z2KA 1CS4C 3T4UA 3CRW1 4K40A 5IMBA 3ZS8A 1EX1A 3O8LA 3I52A 4ZWNA 2C3UA 2WUVA 1GQQA 5CAEB 1IL0A 4FTWA 3RHTA 1D09A 4D4KA 3RC9A 3GJ0A 1E4EA 1SHKA 3DDWA 3OUZA 4KQ2A 2FE4A 1KMIY 1ZGZA 5ELMA 3S5JA 2EL7A 5KNBA 4C7OB 3JD2A 1YVUA 1CJCA 3GG9A 3GJRA 1V3VA 2R6ZA 2B8WA 4FBGA 3ZBPA 2CXXA 1S2NA 2CSUA 3R23A 3ZK7A 1T8TA 3FHCB 3WMRA 1K97A 1E20A 1M6VA 3FUXA 2J9XB 1EUDA 1NJFA 4I9GA 1BDJA 3HPRA 1CY8A 5M2QA 2GJ4A 4QELA 2PMEA 3V4ZA 3ZDQA 4GX0A 3W5DA 1GR0A 1VJRA 5I51A 1P80A 3IODA 4D57A 2VYVA 4GKBA 4C21A 2VP6A 3QW2A 1XCJA 3MMSA 5AYVA 4HFNA 1ZA2A 5BW5A 3RVBA 1Y8RA 2WMNB 3FYUC 1PUJA 1X39A 1NBIA 2ECQA 5ITZA 2F2TA 1XLUA 4FCCA 3EMKA 1IJBA 3BF7A 3RS3A 2BSXA 2BRUC 4FBMA 4CIWA 3EMBA 3EXEB 4OKSA 4U9HS 1IZ0A 5U4QA 3JTEA 4MWCA 1DRVA 2LZ0A 4JITA 4LDJA 1R5BA 1DBRA 4RLHA 5LP6C 3NC0C 3VKGA 3MBIA 3O94A 1JIXA 1MF7A 1MN6A 3Q15C 2OZPA 1TEZA 4QTTB 1A9QA 4OIFA 1Q57A 4DT1A 2C9BA 3C3EA 1L0BA 5KQSA 2Q2OA 5T57A 3RARA 1T0BA 3D8UA 5ALRA 2VTKA 1X1QA 5JDCC 8GPBA 4L0DA 5KPDA 3QUAA 3I32A 1QFXA 2GJSA 4K6KA 1EUYA 1CY7A 4DLLA 1MB2A 3IDQA 1X7HA 3S1AB 3TFWA 1BE8A 4LFBB 1DV1A 1KEVA 1CNEA 1E1QA 4CEHA 3U5TA 2MSLA 4H35A 2D3TA 3GH1A 3IQIX 4HX9A 2BM8A 2F3RA 2WR8A 3H18A 1RBZA 4GXNA 2H00A 2HBZA 2AFVA 3KOMA 2QTRA 2I87A 4HX5A 4NCBA 1J42A 3MBOA 1S01A 3GT4A 2E9SA 1PZXA 2WV7A 3BE5A 4GC5A 1AN9A 4NCXA 1VJGA 5TDHA 3AYXB 3TZLA 3LT2A 2GBFA 3DT8A 3HN7A 4BLPA 2NSYA 4LOHA 1CUZA 4G5RA 3WJAA 3ZGLA 3P2OA 4RA6B 1L9XA 2AOUA 3QVWA 3QEAZ 4KPUA 5H5JA 2K2QB 3ACBA 2HRCA 2V4UA 2H9AA 2V7GA 2V6BA 3A04A 3FJ1A 3Q0EA 5D00A 3WHPA 3OQJA 1DAGA 2OESA 2BFDB 4LRQA 4PLHA 3T38A 5U9CA 2PK3A 2V4MA 3LL4A 3W9YA 4E46A 4LJ9A 4D79A 2LRHA 1QVZA 4AY3A 4YRAA 3BEDA 4YMLA 1V1JA 4QPNA 5JSKA 4ND3A 4X54A 5GADl 4INJA 4WZ6A 2AKAB 2EKDA 1ZONA 4MHTA 4HGPA 4XWWA 1PI3A 1P4AA 1JDTA 2V3VA 3LDHA 3KPVA 4AZWA 5JVDF 1LWNA 4IGEA 5KVSA 2V7PA 4EW1A 1PO7A 4DJ5X 1B3BA 3PT5A 1Q7TA 1Z0KA 3ZE0B 2O3UA 4JXJA 3UAVA 1UM9A 2OV6A 3GF4A 4PAWA 1N7IA 2FWJA 3KQVA 4X7PA 4FFNA 2AQ8A 4F5ZA 2O8DA 2EP8A 3CJTA 3I37X 1TW3A 3X1MA 5M04A 3I9MA 1F6WA 1CZKA 3GJTA 3LRXA 1N1GA 2NO7A 4OL9A 1H9AA 4AX8A 2GAFA 1F20A 2VBCA 3EOBI 4HS9A 5ADUS 1NVUQ 1W88A 2QORA 4DIBA 4TKZA 3DTVB 4S0XA 4XLLA 3WICA 4BZQA 2Z5GA 1KZYC 4CQMD 3H1PA 3U7EB 1GPWB 4KCGA 4HQ0A 1G8GA 1HDEA 2SHKA 6YASA 4KBGA 2FEXA 1JT9A 2O1WA 1CUWA 1EFVB 3TWOA 3SVTA 1FTQA 1BG6A 2GKGA 3AF4A 4JBYA 4OOFA 5K51A 2FRVA 2WUFA 4F4FA 4HLNA 1SCAA 1L5VA 4RJKA 1R6XA 4OHKA 1Y8AA 2L17A 3WKEA 3ZE7A 1BKYA 2D54A 2V9ZA 2WVAA 3OO0A 4UNIA 3TUJC 4AULA 1KQPA 3QXJA 3BCSA 1UPTA 2I6GA 1O54A 1VPLA 2QE7D 1QGED 2R4UA 1H94A 5AHOA 1W2HA 1ADGA 1FFXA 2GJKA 3HCFA 3MJCA 4FHGA 2WFLA 4M2LA 2UUAB 5DFAA 1WUIS 4GGMX 2GAIA 2H4FA 1D2CA 4OO3A 1O97D 4UUNA 3SBXA 3NGLA 4YCMA 2QP4A 3KE8A 4YCAA 4PGAA 5GMOA 3DAHA 2V97A 4KP7A 5KDLA 2OTCA 4ARUA 2VHWA 4MVJE 4C3VA 5TEWA 3WVNA 1VLQA 5MHTA 3CMMA 3FCAA 3ONEA 4ALIA 3SOPA 3NR2A 5EZYA 1JL3A 1W4ZA 4PX9A 1PL0A 3NWBA 1WCYA 4MSUA 4RK0A 2X6QA 5DBGA 5BOVA 1KDOA 1V47A 1W581 4NOJA 4QPJC 3WOVA 2WOOA 4I50F 2FSFA 1IY1A 1KFKB 4XGIA 3HWSA 2IEBA 1P1BA 3S7ZA 3ENVA 4PNZA 5IK2D 1B3RA 4N5DA 3A4IA 1C9DB 1M76A 2QRJA 2QYOA 3OZDA 2FOIA 5CFQA 1MDFA 4O29A 1YCDA 4IDQA 4F6CA 3ZZMA 4MUFA 4UUAA 1E6WA 4WOJA 3K0CC 5ALGA 5DLQC 4JBIA 4X7BA 5K8UA 2PCLA 4HF7A 2FW9A 2L18A 1QJCA 3B36A 1LCIA 1YR7A 3OTWA 3R77A 4MV4A 4UDYX 2GN4A 2XYQA 5FOSA 2VAWA 4C3ZA 3M1LA 1B2RA 1PJCA 1TE2A 4I3FA 4ILKA 5ESRA 1SU8A 1P4JA 1RKXA 3SQOA 4KTTE 4DPKA 1AA6A 3NWEA 1KE1A 3CUVA 2JCVA 3SKXA 4A23A 5GIOE 1M2VB 2QMQA 3G2NA 1L8LA 2HA0A 1ZIYA 4EGFA 3JVIA 1KVTA 4EHIA 1QAMA 4FSHA 2RKWA 4IYJA 4UMVA 1MO2A 4RM3A 5HHTA 3PDIB 1PVOA 4ALNA 1EDOA 4A2CA 4WKCA 1DJPA 1RC8A 4MWDA 1C1HA 1UZAA 2IU3A 3PQDA 3AR7A 4OXNA 1GYPA 1YOBA 1KR5A 2WKSA 3RJMA 1AGRA 4ENQA 4D5GA 5FO0A 2RH5A 3D2BA 4YALA 1BS1A 1J24A 2EEPA 1JQ3A 1I9GA 3AVVA 1DAIA 3H7AA 3U56A 4TQUS 4Y6GB 4RVCA 1BXRA 1M34A 2BBTA 4PZLA 5DHRA 5DTJA 2ZT5A 4KX5A 5AOBA 4DANA 4YRDA 1WZNA 1DE0A 1H05A 4J7AA 5JD6A 1PR9A 2IYRA 2PFSA 4DARA 1D1QA 4HTFB 2HJ9A 3VGJA 3T1HB 4Y6QA 2EARA 2Q62A 2ZYVX 3CNEA 4IGAA 3D7RA 3ETDA 3F49S 3OWOA 1SXJA 2CNWA 3FG9A 3K0AA 4E22A 4RH1A 1NVXQ 5LBTA 4CLDA 3WRYC 4E4YA 1QONA 3C4JA 2ZAOA 1PT6A 4PPNA 3UMFA 4B8YA 5CX1A 1D0VA 3WP1B 2AX4A 3GLFE 1H2FA 3KUKA 1L3IA 4IIFA 4U2BA 4GP7A 4LDNA 4MV6A 4HWOA 3F71A 4OXQA 3RWMB 2PEYA 3IIMA 4IPTA 3TOXA 5AK3A 2ZJFA 1UJ6A 1PU2A 1M7HA 1RHUA 4Q7KA 1EXNA 4W5NA 2YKGA 4B87A 3PJFA 1FNMA 5JATA 1Y4UA 2ZB4A 2FLKA 2FSUA 3CY6A 3ZDEA 1DJMA 1SB9A 1IM8A 1EKXA 3S29A 1I1QB 3ROGA 1NQVA 1BX1A 1DOAA 1RLUA 1U8UA 3TDKA 3BZUA 3NWOA 16PKA 1H4QA 5CT6A 1NW3A 3G02A 4MP8A 2C0CA 3UWOA 2AUTA 3EN0A 1HMPA 4Q93A 3E0QA 2VTBA 2NVOA 4GMXA 1OIXA 3NALA 1FYDA 3G1UA 1D0SA 2PGDA 3HVRA 4RS4A 1CYEA 3MRXA 2VIIA 2D59A 2Q5IA 4UZEA 1CY2A 5AKEA 4GPEA 1YUMA 3JQBC 4KLNA 4RM2A 5F3DA 4OAQA 4C6RA 4PZCA 3WAGA 3M70A 1P1IA 1M2OA 2ZZKA 4KKVA 1I3NA 1YHYA 5IZCA 1EA7A 2YHAA 2C4VA 2WPDA 2X6RA 3H5RA 4QGFA 2JFUA 4KQFA 5CXXA 5C1IA 1D9XA 4XI9A 2XZDA 1FQWA 3BWXA 3MSXA 1SKYE 2B1IA 4AJJA 4DA6A 1JHXA 1GCAA 1ZK4A 4JENA 4DM3A 4EL5A 1EQAA 4P58A 4MRPA 5H70A 4AJOA 1ZI9A 3LQFA 2P5UA 4EAQA 2XE6A 2W6ZA 4D9KA 1Q0SA 2XXAA 2MSWA 1XNQB 2F1RA 3OQVA 3U4CA 4JH0A 5KO2A 1AKVA 3NBFA 1ZJYA 4MW1A 4EQZA 4L9WA 2Q3BA 4QEKA 2WKQA 3EGDB 1JYEA 5FI0B 1A1VA 3SJBA 2OCXA 1UXGA 3Q7QA 3X1KA 3OQOA 1IUNA 3ICWA 5B36A 5CXSA 1XXLA 3K1YA 3EQ9A 3KOYA 4G63A 1RJ9B 3L6OO 5HK8A 5L9AA 2FP4B 2IOHA 4MV7A 5TT1A 4TKVA 4QDOA 2DXIA 3ELUA 4EKEA 1WKCA 4BBAA 4ENRA 1R0XA 1XFAA 4D9NA 1SUIA 1WETA 4ZQIA 3CG0A 2CHUA 1BQ4A 1M6WA 1NDUA 2HM7A 3DULA 2FWRA 3PUXA 4J6FA 1FU8A 3OLWA 2J08A 4P7KA 3WSVA 4BE4A 3R20A 2PH3A 2R6GA 4PVDA 4PGFA 2PLRA 3DTVD 1M1NB 2MSCB 1SK9A 3CKYA 3EASA 5BN4A 3BWYA 2XOEA 4DC0A 1OC2A 4YCSA 3E7PA 4DY6A 4YC7A 2ID4A 1OX4A 2PN1A 2O2HA 4DJEC 2CVQA 2PJZA 1A5AB 2P9ZA 3L0CA 2IZ5A 3UMMA 4HNVA 3GRKA 4RY8A 3O8OA 1TJ5A 3T3MB 4AURA 4BQSA 1FDSA 3K1ZA 1C29B 1ZU4A 3PC3A 3U9LA 1N6NA 4YR9A 5CK5A 1HSOA 1YRBA 3LX5A 2VQSA 1XLWA 2WFMA 3CEMA 3FCOA 1V2HE 5KI6A 1CY1A 1UZUA 3A9SA 4O8ZA 4V24A 1ML3A 1T2NA 3INYA 2XMBA 3L8EA 5JD4A 2JGJA 1K89A 2X2EA 2NVUA 5EPEA 4P0PB 4M0EA 4RPHA 5FOVA 2HIAA 3N0RA 4B6RA 4NMWA 3A36A 3TX6A 1L4LA 3SLRA 3AFIA 2R48A 5EESA 4DUYB 3H9BA 5KSPA 1JKJA 2ENUA 2GT1A 3HB0A 3NS7A 3PDJA 3QFCA 1B8PA 2YXNA 3AXTA 1B43A 2QM0A 4OSEA 5C5DA 2VDJA 2X8JB 3Q8WA 4OHZA 5JHGB 1SC1A 4QD3A 2IZ1A 3C3XA 3ORRA 2BONA 1EDDA 2QKYA 3VR3D 5CFRA 5JMTA 2YIJA 1ACMA 4FR2A 2VK4A 5IVKA 1SQGA 1TIBA 2BFMA 3NJRA 3ORFA 2NO1A 3OT1B 3I12A 5A6VA 3CBGA 2V7EA 3L4EA 5HMMA 2Z08A 3KVOA 1XXHE 1TA0A 3HEAA 1M7BA 5K20A 2RIRA