5JCJD

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 91
structure length 247
sequence length 267
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjD00
1XWFA 3HDYA 4Q3BA 1T2EA 3HFSA 5JDIC 4JJFA 3DWFA 5L4NA 2BGLA 4RCVA 1U8XX 3G3EA 3OEWA 3GUYA 5BQFA 1ADCA 2PY6A 3GLQA 2WDZA 1K5HA 4WLNA 1FMCA 4Z0PA 3RKRA 3SX2A 2AA3A 1NM5A 4DBZA 4QQRA 5COBA 2FHSA 4GPD1 4HFMA 4CM8B 1S6YA 1YL5A 4J9UE 1O94A 2E49A 4BQRA 1CETA 3GNQA 1R12A 3OICA 1YBAA 1CWUA 4C4OA 3RFVA 3DEYX 4L8VA 4XYGA 3TZKA 3MWEB 1KY5A 2JL1A 2GPTA 3AFNA 3H9QA 1DRVA 3GZ4A 4NBUA 1QMGA 3S2IA 1VSUA 4CPDA 1OAAA 2QIOA 2IXAA 4YJDA 4GWKA 3HHPA 3KB6A 1OBFO 3VH4A 2OFPA 2X6TA 2G76A 4NK4A 2W2LD 2ZYDA 3FN4A 2DAPA 2JD0A 1L1FA 1PTJA 2W2KA 4QFCA 4CM7A 1Y9AA 4UEKA 4Z0HO 2D5AA 1RM0A 4KMSA 1SAYA 2VYVA 3I9KA 4HUJA 4HX5A 4BGVA 1UAGA 3Q2KA 2GRAA 4JJIA 2GD1O 1I0ZA 3F5SA 5F1PA 2QYSA 2GZ2A 4PIVA 4B7UA 4N18A 1O8CA 2EGGA 3GNSA 3KZVA 4KUGA 4E33A 2B4TO 4UVGA 4TRJA 5ADHA 4GBJA 1UH5A 4ID9A 3I9MA 3WJ7A 4A27A 2C2XA 2PD3A 3JQBA 3MCVA 4ALNA 2CZCA 4TRRA 4IS3A 3EAGA 1X13A 3B20A 3Q6IA 4D45A 3LT1A 2VCYA 3QY9A 4QTZA 3CSDA 2NUAA 2OP0A 4RPKA 4LMPA 4QSMA 1V6AA 3H3FA 4BNLA 5A1TA 2B5WA 2UYYA 5F3RA 2VWGA 1G6KA 2VHZA 1Y8QA 1BXZA 3ASVA 5T64A 2G0TA 3H9GA 4MP8A 2RHRA 5A02A 2WYWA 3DL2A 3X2FA 5LDGA 4W7IA 2XXJA 3B1FA 4KWHA 1PJQA 1Z7BA 4RDIA 2EEZA 3E9MA 4OIMA 2D3TA 3PJDA 1WZIA 2E6UX 4QFDA 4XEHA 1RM5A 4E21A 3AY6A 3FNFA 4FGWA 1XLTA 3WOHA 2FPIA 4S1VA 4ROSA 2FP4A 5DCWA 3BMOA 1WZEA 3K73O 1SZJG 7MDHA 3WLEA 3MTJA 3D1LA 5TS3A 3ZW9A 1EUZA 2IZZA 1JKJA 1ENOA 1Y81A 3QJ5A 5IZCA 4AJKA 1DJNA 3EK2A 5TX7A 1ADGA 2HQ1A 4R1SA 1NHGA 2NVUA 3OF2A 3PWKA 3O38A 1UXJA 4F45A 2Q2VA 3KYBA 3NV9A 1LUAA 2B36A 3JQFA 3NJ8A 2WD7B 4ZVVA 3GH3A 2DTXA 3D3WB 1QP8A 1U3UA 4TROA 2QG4A 1VKNA 4IXWA 2P9CA 3VZSA 3V2UA 1H6CA 3R6DA 3IJPA 3TWOA 4LVCA 1M75A 3GDFA 4U6SA 1NFRA 5I7VA 4NJMB 4RZIA 2YV1A 4YACA 3ZH2A 3TJRA 4J7CA 1GYPA 1A71A 3BTVA 2AQ8A 4RQTA 4CM8A 2PGJA 1RWBA 1DAOA 3VPFA 4WLFA 2EP5A 3HNPA 3RBVA 5KCZA 3PHHA 2NTNA 3AU8A 1J0XO 3UN1A 4IPTA 3NX4A 3A06A 1ZCJA 2VUTA 2DPHA 5KTKA 1BGVA 5I9LA 4Y6RA 4EJMA 2LDXA 2QX7A 2RIRA 1LDEA 1C14A 3ANLA 1JTVA 2P9EA 5T8KA 5A9SA 3RROA 1T25A 2VRCD 2WJPA 1NPDA 1TXGA 4CV1A 5FI5A 1DJQA 3NJ4A 4G5HA 1NPTO 1ISMA 1NFFA 1SB8A 4I5GA 2J3IA 4QX6A 2G17A 2VNAA 3DHEA 4P38A 4UUOA 5A9TA 5IXSA 1YDEA 3DZIA 3IS3A 4ZU3A 3JYOA 1HDZA 3TL3A 2AQHA 4RV9A 4R9SA 4LK3A 4OKIA 2I3GA 2WTBA 2ZYAA 2CY0A 3OIFA 3NGLA 2BFMA 4CMJA 1X15A 4WLOA 5JCJA 3SEFA 2TMDA 1ZNQO 4BO8A 2Q3EA 4TRNA 1ZXLA 1HDYA 4RVGA 2PH3A 4J16A 3UUWA 2PZMA 3H3JA 4JK3A 4K6CA 4I5FA 2LDBA 2Q50A 3NRCA 4J3FA 3MOGA 1UAYA 3U4HA 3S1LA 1AXGA 1HZZA 1L7DA 1ZVMA 2RAFA 2C2YA 1LBEA 3AW9A 2I66A 3DZJA 3WXBA 2W98A 5CDTA 3IKTA 1DB3A 1P45A 4KOAA 5JY6A 5DN9A 2HMUA 4LSMA 3K9QO 3AI1A 5K9ZA 5JE8A 3DTTA 4PLVA 4O0LA 4I9UA 4JIGA 2VWHA 4J43A 4F6CA 3VVCA 1DAPA 5TSDA 3PLNA 4J4HA 4WJZA 2GR9A 1PR9A 3HFGA 1JDJA 4YR9A 4IQ8A 3RD5A 3LC1O 3HB5X 4IDEA 2YV3A 1FJHA 2E4AA 4HXYA 4L0QA 5G0UA 1DDOA 5AXAA 1NAIA 4BGEA 2X5OA 3BHIA 4U7WA 5ENDA 4DGSA 1Y9EA 4GLLA 4H15A 3H5RA 2BMAA 4B7XA 4OYRA 4FIZA 2V6BA 4E5PA 1R4NB 3JQAB 2Q2WA 4TVBA 4WCFC 1UP7A 3KBOA 4MIYA 4FFPA 4MVJF 3HADA 5EINA 2TMGA 1EZ4A 3OQ1A 4M55A 2PGDA 2PWZA 5IFLA 3MJCA 4WCFB 2D5CA 1SO8A 3ITDA 2J8ZA 2X0IA 4E2XA 4YA6A 4ILKA 2NTJA 4GMFA 3DFUA 3KRTA 1HE5A 3LT4A 4PG6A 3TFOA 4YT2A 1KIFA 3TPCA 5ER6A 3OJ0A 4R9RA 3FNEA 4Z3KA 4CQLB 3T4XA 3GVPA 4CM3A 4A10A 3O4RA 3JQ6A 3KSDO 1H2BA 3JQGB 4YT4A 2GN6A 4LW8A 2HO5A 4OO3A 3H65A 4PZEA 4BNNA 2I5PO 5BR7A 1QLHA 2GN8A 3CZMA 5B1YA 4L76A 2PLAA 3DTYA 3IJRA 1UXHA 3AM4A 9LDBA 3SJ7A 3VH2A 2YHIB 3D3WA 4PG8A 4DREA 1TI7A 4EUHA 2BD0A 4YRAA 4CLXA 5CEFA 3TSCA 3IKVA 4YAGA 5JLAA 4PG7A 3ADPA 5EQFA 5COAA 3PWSA 1Y5MA 3DDNA 5G4KB 4MPDA 3OFSA 1YQXA 4Z0TA 4II2A 4BO0A 3JQDA 3VAZA 1GQQA 1HDXA 5DBIA 1UUFA 2VUSA 3KEQA 1M6WA 4XR9A 4AJEA 1CDOA 4EZBA 1KVQA 3S2EA 3G49A 1J5PA 5T5QA 2AE1A 1GV1A 3KYDB 4NBRA 1MC4A 1A9ZA 4HY3A 3S2FA 3H9EO 1KVSA 2OORA 3VZQA 5TJ9A 5ILOA 4PFJA 1B2LA 3W4KA 4UEOA 2Q2QA 3EY4A 4XB2A 1Z73A 2O3UA 2O4CA 3OJEA 4MKRA 2EKLA 3H2ZA 5EMHA 5CG2A 1GFSA 2P2SA 1EVJA 1YO6A 3OECA 2AQKA 1RM4A 5ES3A 3L9WA 4R68A 2IE0A 2GSDA 3ZI0A 1VL0A 5BSGA 4DQVA 4OGWA 3V1YA 1XEAA 4X54A 4YRDA 4WKGA 2X0NA 5AVOA 4Y67A 4LSWA 4J4BA 2VHWA 1AHHA 3FBTA 4KUEA 1G0NA 3ZWNA 4R5MA 4XQ9A 4XRGA 2C0CA 2O2YA 1IHXA 5L53A 4RLHA 4R4JA 5FWNA 1F06A 2RCYA 3DBLB 2JCXA 4O59O 4DUPA 4FDAA 1E3SA 1ZEJA 4A26A 3FTPA 4CLOB 1Y6JA 2NVWA 4U6QA 2I76A 2P5UA 3G1UA 4R1UA 4RO0A 1D3AA 3ANMA 4OQZA 2D4AA 4P4LA 4AICA 2H5LA 4MVJM 1I10A 3WYBA 1VPDA 3CEAA 3KYCB 3KETA 1PJBA 1ZK0A 2QW8A 3SLGA 1J6UA 1YOVB 3SBOA 3FHLA 2FR0A 3DOCA 1DRUA 2RH8A 4J2HA 1R6DA 1DHRA 5AQ1A 2C5AA 4N5LA 4IQGA 4PLGA 3KM0A 1QR6A 4J1TA 2JHFA 5JAZA 2JD2A 3WIEA 3G79A 1KEVA 4FD3A 2O4UX 1UJMA 4CV0A 2IZ0A 1TT5B 2GYYA 3ZWVA 1I33A 1YJ8A 1LRKA 4BB5A 4L9RA 3DZBA 2BFOA 5IDWA 1R4NA 2HMWA 3JQAA 3I23A 2BF7A 3VKVA 1XU7A 1YB4A 1UDCA 3RUAA 1HYEA 4HP8A 3SLKA 3X2EA 3A1NA 3WMXA 5ICMA 3RSHA 4ALMA 1E1MA 2DBVO 3A9WA 1X7GA 3MZ0A 2BLLA 1DBVO 1OZAA 3JTMA 2FN7A 3F5QA 4AJJA 1LDMA 3PYLA 1M6HA 3AOEC 1U2GA 1P0FA 1ZBQA 5TF4A 3EC7A 1P1HA 1EDOA 2O3TA 3NDRA 2VYVD 4FFRA 1ULSA 4E13A 2PFGA 3ENKA 3N58A 4NPCA 1UP6A 4CQLA 3GGPA 2I67A 4NH4A 4DVJA 1A72A 3CH6A 1I5RA 3GGGA 2FZEA 2Q4EA 4ALJA 1E7RA 3JQ8A 3Q9UA 1V3VA 2AG8A 3BXXA 1QYXA 4K28A 3ZV3A 5CDGA 3CIFA 3NTQA 2ZCVA 4XYMA 1VI2A 3GN2A 2YHIA 1P1JA 1C0IA 1T4BA 3VHRA 4YPOA 2YZ7A 1SOVA 4FC6A 1U4SA 4BNYA 4CODB 3UHAA 3D4OA 4BNIA 5KJ1A 2ZCUA 3IUSA 4BKPA 3NTRA 1ISHA 3B1KA 2DC1A 1XSEA 4G81A 4BVAA 3QVWA 3ZN2A 1NVTA 1XR3A 3FPCA 4ZRNA 5JDCA 3TZ6A 2Y1DA 5EIOA 1A4IA 4WOJA 1F0YA 1PS0A 1HYGA 1P44A 1VL8A 3KYDA 3P5SA 5F5LA 3RU7A 4BGUA 3PYMA 4PRLA 2PA3A 3GRPA 2I9PA 2NQ8A 4BNJA 5ICSA 1ZFNA 2GZ3A 1N2SA 4W6ZA 4C7JA 5ITVA 4RVUA 3ROMA 3DOOA 5COQA 1N5DA 2D0IA 2F1KA 3PZRA 4XYLA 4WCDA 3O26A 1P74A 4A03A 5AXBA 3RQSA 4N5NA 1FDTA 4YWJA 2B4RO 1P0CA 1U2DA 4YYZA 4YDRA 5IN5A 3D3EA 4AJPA 1XGKA 2ZATA 4BKQA 4CMBA 3WSWA 3ZHZA 5A5FA 3JQBC 4HNGA 3CKYA 1O6ZA 4B8ZA 1L7EA 3V1TC 5FFFA 1GQ2A 3DBLA 2D2IA 1PL7A 1HT0A 4AJ4A 5KVCA 4OM8A 1KOLA 4N5MA 1CEQA 2NADA 3RAJA 4ZJUA 4CM9A 4CLOA 4DIFA 1T1SA 2ET6A 1AGNA 3IC5A 3L4BA 1ZMTA 4FPXA 4LMRA 5AXDA 5AXCA 3VC7A 4CL3A 2GF2A 4NQZA 5A3JA 2HMSA 4L74A 5KIAA 1R15A 2NVBA 3PJGA 1F8GA 2C82A 3JCZA 4D7AA 3KYCA 5IG2A 4EDFA 5B4TA 1KBZA 2BGKA 3KUXA 1YB1A 4YQYA 3WLFA 1YOVA 1ZSVA 1BSVA 2HLPA 3C1OA 3E48A 4DC0A 1PS8A 2JFFA 1I3LA 3U4IA 5KVSA 4GVLA 1WXDA 4XKJA 5JO9A 5A3VA 4F3YA 1EMDA 4XR4A 3F1LA 3RVDA 1EVZA 3JYNA 5DP1A 2VOJA 5KKCA 4NBVA 3CPSA 3PHIA 1I30A 1TT5A 3BTSA 3VDRA 1FDWA 1BTOA 3I6QA 4GX5A 1BMDA 2R6JA 2PGLA 3GMSA 3ZWOA 1DC3A 2A35A 4LCJA 3GEGA 5IZCC 2PK3A 2Q1UA 1EQ2A 3ZHYA 3BMOB 1BXGB 2X4GA 3P2YA 1WWKA 2P68A 3ASUA 3JYLA 3B70A 1I3MA 5B12A 3LT2A 3JSAA 2J3HA 4OQYA 2YFQA 3DBHB 3FNGA 4L4RA 1E92A 1FDSA 2YY7A 4RLSA 5TT0A 2X8LA 3JQFC 3DMTA 3OIGA 4MVJI 4R41A 2WE8A 2NU8A 4ALIA 4BNMA 5JCJD 4JGBA 3RU9A 3W1VA 2NVUB 3VZPA 1UDBA 4D0SA 1IE3A 4N7RA 2J3KA 4CLDA 1B16A 2A4KA 3WFIA 1YONA 2ZK7A 3FRJA 4WE3A 4CM6A 3QE3A 1E3WB 3TZHA 1U3TA 4PLHA 5JCXA 2B69A 5DCUA 3K2EA 4CR7A 5ILGA 1YL6A 3JV7A 2VN8A 1IOLA 2I3AA 3E6AA 3JQ7B 1JAYA 2VYNA 4XZ3A 2A9FA 2VOEA 3ETEA 2IXBA 2B4QA 1BVRA 5EL0A 2AHRA 4RPLA 1H5QA 4Q39A 5IDQA 1C0PA 2X5JO 3I6IA 4GKVA 1H6BA 3RKUA 3VDQA 5CDUA 3GQVA 1ML3A 1SPXA 3L6EA 3OJOA 5T8KC 1FF9A 2NNLD 3JD0A 1EUCA 2GO1A 4EW6A 4ZHSA 2O7SA 1JWBB 5IZ4A 2C7GA 3FNHA 2FPPA 1A5ZA 3NDIA 4E5KA 1BW9B 3QA9A 4PZDA 1P31A 2EG9A 1GYQA 3EZLA 3GVHA 3V5NA 2Q1WA 3OH8A 2AE2A 5A9SB 5KJCA 3COSA 1KEUA 1DFIA 4GSKA 2Y67A 5MDHA 4A0SA 1MUUA 1PGOA 1XELA 3TRIA 3KLPX 4IQ0A 4EJ0A 4RDHA 5DF1A 3F4LA 1KYQA 2DQ4A 4FFLA 4J0FA 2DTDA 4IGEA 4BNHA 1ONOA 3W4JA 1BHSA 3QRWA 4K26A 3RUDA 1I8TA 2V65A 1QKIA 3K30A 4U8GA 2X22A 3JQEA 3BAZA 4GH5A 4KZPA 1HE2A 3GNTA 3LDHA 1NR7A 4JLWA 4BO9A 5K6AA 3GGOA 4U5QA 2O48X 1EUDA 1ZJYA 1IUKA 3I1JA 1ISFA 2X23A 4CMIB 3SJUA 4F6LA 1MGOA 5DULA 5JXWA 2DFVA 1N92A 1DHTA 3HB4X 1Z82A 4KWIA 2Y05A 4Q9NA 1HRDA 2ZTMA 3AY7A 3WX0A 3V2GA 3F47A 2PH5A 3G17A 3WFJA 4FQ8A 2AW5A 2DUUA 5LDHA 4Q3AA 2OHXA 3RBZA 5JC8A 3R3JA 1B8VA 5IXYA 3GRKA 2NWQA 4TSKA 4PLZA 4XJSA 4ZQGA 3HE3A 1IHYA 4F46A 4MJLA 4XQCA 3MEQA 3EZYA 1YVEI 4BOYA 4H3VA 4EUFA 3BIOA 3JQ9A 1KETA 3DXFA 4L4XA 3ZNNA 4MVJA 4UUMA 2P4QA 4I9HA 2HUNA 5L4SA 3HSKA 3WDSA 4ND4A 3GUCA 3RJ9A 4ND2A 1K6IA 1JW9B 1PJ3A 1GPDG 4R54A 2DBRA 3M6IA 1UXIA 1X7DA 4WECA 3INGA 3VTFA 4BKRA 3QWHA 4ND5A 3UICA 4JXKA 1F14A 1O5IA 4JX8A 5A4DA 2OO5A 4OMUA 4MKXA 2NU6A 1LI4A 3VKUA 3SC6A 5TT1A 1BXGA 1HWYA 2EJWA 4IGFA 3DOJA 3CE6A 1QLJA 3IOYA 1PZEA 2ZB4A 1Z7EA 4GGOA 1UXGA 1PSDA 3DBHA 1EK6A 2BH9A 1LJ8A 2X58A 1MB4A 1YDWA 4A5OA 1GTMA 1FXSA 1ISJA 1LLQA 3GFBA 3GHHA 3ADOA 4MVJG 4YXFA 1ZK1A 4IDAA 1NQOA 1HLPA 4XGKA 1GEGA 3P7MA 1D4FA 1GQYA 2ZB7A 3AUUA 1O0SA 2YW9A 4R5HA 2O3SA 3WGTA 1E3WA 4CLEA 1T2FA 3PPIA 4XGIA 4BO7A 1UZMA 4CM1A 4DMMA 4W82A 3JQ7A 3ITKA 3AFMA 1NASA 1NAHA 1QYCA 3AJRA 4WPGA 5I8ZA 3ROPA 3IIEA 4Z9FA 5I9MA 3F46A 2GNAA 1KC1A 3DQPA 5L40A 2H6EA 5CEJA 2ZJ1A 1RYDA 4HFRA 3ZU4A 1X0XA 1JA9A 1E7QA 1P1IA 2B83A 3I4CA 1TVEA 2VHXA 1LU9A 4INAA 4BNFA 4E30A 2CFCA 2B0JA 4I5EA 1KERA 1VJ0A 1LEHA 3WTBA 4YAEA 1BW9A 2Q49A 1K6XA 1ZK4A 1SB9A 2NV6A 2YQ5A 3ETDA 5L9AA 2VZ8A 3JQAD 1QORA 2WEKA 2XOXA 4YQZA 1NP3A 4FN4A 2NM0A 4AJ1A 1LC3A 4GI2A 2AMFA 2Y93A 3JD4A 5B4UA 4UULA 5G2OA 3DBVO 4LRSB 3KXDA 1G1AA 3W4IA 4W99A 1JVSA 1B26A 2WE7A 3ANNA 4II3A 4BO3A 2YYYA 1B15A 1U9JA 3LF2A 2CNBA 3OSUA 1DSSG 4PCVA 4Y6SA 1H0KA 4CMIA 1N9GB 3NT2A 1PIWA 4E2ZA 1ADBA 1E5QA 1DC6A 4EI2A 1XKQA 4JP2A 3CINA 3GK3A 4R1TA 1HSZA 3FSRA 1M66A 3IAHA 1BVUA 1Q7BA 2X1HA 3TNLA 2AXQA 3LLVA 4Y6PA 1XYGA 3U0BA 4E2YA 4CMGA 1AN9A 4RF3A 2FR8A 3RWBA 2V6MA 1PS9A 2I6TA 1EQUA 4PLPA 1ULUA 3NKLA 4M8SA 1A9YA 3WICA 4YJGB 4NG5A 5TLSA 3R3SA 2YJZA 2FSSA 5KJ6A 3DMYA 3GEMA 4XQEA 1HZJA 2PD4A 5C37A 3IP1A 4BQPA 2VZ0A 3TFQA 3W6UA 3UAGA 3TOXA 3AI3A 2OOSA 1AE1A 3BMQB 4GX2A 5T67A 1VJTA 3M1AA 3OIDA 2HK9A 1V3UA 2DLDA 4DLBA 2E82A 1OI7A 3GVIA 4E5MA 2EHDA 3GDOA 4XDYA 1KY4A 1Q0LA 4PLCA 3I4FA 1EFLA 1M67A 2VTDA 4KTTE 2OMEA 3UVEA 3VVBA 1WNTA 2C29D 3O03A 3PRJA 4IM7A 3AUAA 1LSOA 3MJVA 4JBIA 3A28A 4YAJA 2IEBA 4FBGA 1K0UA 4O5OA 3V8BA 4FC7A 3T4EA 5F1KA 1DC4A 1E6UA 3VPXA 5GZ1A 3FTNA 4ESOA 3C1AA 1E1KA 4D0RA 4DWVA 5IDYA 2AQIA 3HN7A 2BFPA 4IS2A 5G0VA 2RBEA 5JAIA 3BMCB 5JW6A 1F17A 4CM9D 4YVFA 4MOWA 1QG6A 2QYTA 3WIDA 5DOZA 3K31A 1JN0A 3RCBA 1I3NA 2GDZA 4I8XA 4B4VA 5JDCC 2O3RA 4CV3A 4BV8A 5KOIA 1H94A 4W4TA 2O7QA 5JBIA 4OOEA 2W4QA 4RVSA 4WEQA 1N7GA 3W8EA 3ICPA 4IIVA 1BRMA 3QQPA 1H6AA 1WMAA 2QRKA 3KEOA 4J1SA 5I9NA 5L45A 2Y1EA 5U1PA 4R51A 2V7PA 5HS6A 4CM4A 4MVJE 5ITWA 2ZKLA 4BNGA 1LDGA 1PJ2A 4NR0A 2GGSA 3WGGA 1WDMA 3CTMA 1GADO 4P4NA 1I36A 1XG5A 1PU2A 4GLOA 3RFXA 2HKIA 4KDFA 5BNFA 4RGBA 1GUZA 5J23A 4KP7A 3INRA 1PJLA 2EKPA 2HK8A 3AK4A 2WYVA 3EW7A 4BB6A 2ZTVA 3QWFA 3M1LA 4D3FA 1H6DA 1LA2A 5TNXA 2HMVA 3D4PA 4NU6A 4RF4A 3I83A 9LDTA 3ZCXA 3BZUA 1ZH8A 1P1FA 3ON5A 3ZHXA 4E6PA 1YWGO 3WSVA 1PGNA 3BMNA 3L6DA 1R0LA 4B8WA 4FOSA 4EYEA 2VTEA 4OXYA 3GG2A 1KVRA 1XQ1A 2EJVA 1VE9A 2CDBA 1Z74A 3ZV5A 5I7SA 3HWRA 5EQDA 1N9GA 4D44A 3L4BC 3K92A 4L75A 1WPQA 3GN1A 4IJWA 1BWSA 5KVVA 4J9VA 4QECA 2Y99A 3L9XA 3KOUA 3ZU5A 5FF9A 1E1NA 3AUTA 2DM6A 3DAFA 3PHGA 3ROQA 4EITA 5C5IA 4GSLA 5JAQA 4IDBA 4PLTA 3PI7A 4TWRA 3QVOA 1MP0A 4XWYA 1JWAB 4CUKA 2VYND 4ALLA 2VHYA 4LCEA 2XF8A 3N74A 3HDQA 5TJHA 2AEJA 2PKQO 2GASA 5JPIA 5EPOA 4DQUA 4IDDA 4YJGA 2O3QA 2CDAA 3LZ6A 4PVCA 1ID1A 4I08A 5HA5A 1DEHA 4TVOA 2X9GA 1DIAA 3HUDA 1DPGA 4P8RA 4ZQFA 1E3EA 2H63A 1TEHA 1IPEA 3H8VA 3QP9A 1E5LA 3RC1A 3HZZA 1T2AA 4XYBA 3QVTA 3WQSB 4FR5A 1LTHR 1TLTA 4CMKA 4G2NA 4KQXA 2C5EA 4E31A 1G0OA 1W4ZA 2IZ1A 3BMQA 4IJUA 1GCOA 1E3JA 2NQTA 1P77A 2Q46A 1E0DA 3PIIA 3FR7A 4PRKA 3RC2A 3DMTC 1PGQA 1U3VA 4O63O 4OOFA 4AG3A 1AUPA 2IRWA 3JD1A 3ORFA 1LRLA 1XA0A 1SNYA 2C7VA 2BFAA 1MXFA 1LX6A 3R0IA 3OHSX 3ZNOA 2DBQA 2VRBA 1E77A 1Z75A 5B4VA 5A03A 3RUIA 3KLMX 3Q2IA 3IQDB 3UH1A 4E5YA 1NQ5A 1MFZA 4ITUA 4ZGWA 5BT9A 2D8AA 1ZMOA 1BDBA 2Y0EA 3PZBA 1S7CA 1GV0A 5KWEA 3ICCA 3UCFA 3GMDA 3BMCA 2Q1TA 2PR2A 1U5AA 4MINA 4XJTA 1IYZA 5KJEA 4YAIA 4XB1A 1QXSA 4G65A 5F21A 3ETGA 3I5MA 1HLDA 3MJEA 2Y66A 3KSZO 3PIDA 3KVOA 1E3LA 1X7HA 2EXXA 3U4DA 1PJ4A 1GD1O 5THQA 4HFJA 4R01A 3GHYA 3EHEA 4YJHB 3KTDA 2QZ9A 4MVJD 4BMSA 3WQQA 1M2WA 1Z45A 4YAKA 7ADHA 3Q1LA 4WEOA 1EDZA 3FWNA 3ZWAA 4AVYA 2A92A 4U0JA 1CYDA 1A7AA 4DL9A 3AI2A 4Y98A 5F1OA 2C20A 1GUYA 2YFHA 3N7UA 4GMGA 3A14A 2HCTA 5K6AC 3B6ZA 3HG7A 3MWDB 4MIOA 5KJFA 3O8QB 3SXPA 1SCUA 4LRTB 1RPNA 5JNLA 3WGQA 2HJRA 4WLUA 3WGYA 3BTUA 1Z6ZA 1ENPA 3I9NA 3TZQA 4FCCA 2CD9A 3VOSA 4TRMA 2JD1A 3FD8A 4DLAA 2CUKA 5GMOA 1YBVA 1R0KA 3V1UA 1PZHA 1EK5A 3ULKA 1JVBA 4PLFA 4YJFB 4HADA 2HRZA 3PFWO 4P4GA 3WBFA 3IP3A 1H2HA 4IDGA 1D7OA 1D1TA 3QIVA 4M49A 4M87A 4A73A 4CJXA 4D43A 3DAPA 4LISA 4CV2A 4J49A 3AU9A 1T2CA 3NDJA 4FOOA 4IZIA 5L7YA 4CMCA 5HTOA 3ZGYA 2Q99A 3RC7A 3ZWYA 2PNFA 2ZIZA 4OHUA 1A27A 1XDWA 4R16A 3VPSA 4R69A 1UP4A 4Q3CA 1T4DA 1ZW1A 2VT3A 5U9CA 1DO8A 3H9JA 4GL4A 2O23A 1PGJA 4OSPA 4CMAA 5THKA 3LSYA 3Q9NA 3GEDA 1LQTA 1Q1NA 1YL7A 1RJWA 3JQ9C 2FRDA 4GKBA 4C7KA 4DYDA 5A04A 5DBFA 1WP4A 3L6OO 2X0JA 4FFNA 1YQDA 4NHEA 3D0OA 4BO1A 3F1KA 1GAEO 2OGUA 4RPGA 1B7GO 1FDUA 4ZQHA 4YB8A 1JKIA 1RKXA 3IUPA 1MFPA 3NUGA 1ENYA 3DAGA 4ONEA 3OP4A 4E3ZA 4E5NA 3NEPX 1DIRA 4B4WA 5LCXA 3F6YA 3GZNB 5BSEA 2RH4A 2NACA 4BNKA 2XAAA 2GCGA 4J7XA 1IZ0A 2QZZA 3GY0A 3PDJA 3I3OA 4B3IA 2GN4A 3P2OA 3FWZA 2IDZA 4IDFA 3FF4A 1GZ3A 2Z5LA 3KV3O 4FSHA 4W9NA 4D3DA 6ADHA 2BI8A 1W6UA 2Y1GA 3OEYA 3QW2A 1NTOA 3GPDG 4EEZA 3RC9A 5BSHA 1H9BA 3PEFA 4EEXA 2CVOA 2OP1A 2X0RA 5TQVA 3T7EA 3ZWBA 1R0SA 1PEDA 4PZCA 3FCOA 3BHMA 2DUWA 2X7HA 3S8MA 4IBOA 3OBBA 4W7HA 2HAEA 3K8ZA 3AUSA 3EMKA 4NFYA 2J6IA 2VQ3A 1C1DB 4FS3A 1NNUA 5IAAA 2FR1A 4AL4A 4BIIA 4DPLA 2RHCA 1CIVA 4I5DA 4IJKA 1HE4A 1Q7GA 1T1RA 3GG9A 3HDHA 3KSUA 1YKFA 2EGHA 4BV9A 1LLUA 4CM5A 3GA0A 5JSFA 4Z9YA 1O89A 1CF2O 3E18A 1NXQA 4HNHA 1E1LA 3C3XA 4IINA 4TMFA 4NI5A 4Z3DA 1NBOA 3ABIA 4PG4A 4E2WA 2Y0CA 2B35A 4JROA 4I1IA 3BHJA 1PZGA 5L3ZA 3ZWCA 1F8FA 5I7EA 3PQFA 4OL9A 1JAXA 4URFA 1YE3A 1P33A 4RPHA 1NX6A 2CF6A 2EP7A 3E9NA 3WR5A 4JQCA 2CDCA 1ADFA 4D41A 3ZU2A 2GZ1A 4M1QA 4YJHA 5A05A 4K9DA 5GY7A 5DT9A 1HE3A 4IMRA 1H9AA 4FFOA 1EE9A 3HQ4O 5TGDA 1DLIA 3C24A 1F12A 3PWZA 4J1QA 2HU2A 1LC0A 4BKUA 5C7LO 4LGVA 3H5AA 5EESA 3UCXA 5LC1A 2A94A 2CSUA 5IDXA 3PK0A 1HEUA 3ZV6A 1CERA 2BKAA 2OUIA 2X5KO 3ZZNA 3O8QA 1E6WA 2BGMA 4NBTA 3ONFA 4XD2A 5JFOA 2W90A 1QRRA 3JQCA 2QHXA 5CEEA 3AOGA 1ISGA 2V6FA 1HDRA 4FW8A 1NPYA 1DIHA 1XU9A 3NT5A 4YJFA 4B79A 1E7MA 2NU9A 3ZWXA 1V8BA 1PZFA 4RVHA 1GR0A 1VJ1A 3PQDA 3WGIA 4CLRA 1EFKA 1J4AA 4AJHA 3OETA 4ND3A 4Q3NA 4CMEA 4BO6A 3PQEA 1WLYA 2D1YA 4JCOA 1YS4A 1OFGA 4XGNA 3V2HA 3NAQA 3DC2A 2H1SA 1LDNA 2O3JA 3QVSA 4IY1A 1UR5A 3NT4A 3BYZA 8ADHA 3PHJA 1CQJA 4L73A 5L51A 1ARZA 1QV7A 3WB9A 2FOIA 1T2DA 3E8XA 3PFFA 1OMOA 3IMFA 4JN6B 4IUYA 1C1XB 4J1NA 3MJTA 4CQMB 1DC5A 1V3TA 2YDYA 3H7AA 4QXMA 4XQGA 5JMPA 3I9JA 4GX1A 1GZ4A 1D8AA 4KDEA 1B3RA 1K6JA 5C3MA 4OXKA 3LU1A 3UF0A 3AM3A 1XIVA 4H7PA 4QO7A 5AOVA 2EKQA 3CUKA 5CG1A 3C85A 1KS9A 4WK6A 4Y8VA 4FJ1A 1GDHA 4PN3A 3LVFO 1YRLA 3NYWA 1VC2A 5JYDA 1GU7A 3D64A 2E37A 2GUGA 1NQAO 3DB2A 5T57A 1LNQA 2OBYA 3PGJA 1R66A 1MC5A 1RYEA 2IYOA 4PG5A 3MOIA 4BKOA 1C0KA 2VT2A 3GZNA 5L7WA 3I9LA 1LLCA 3WNVA 3ONDA 4YT5A 5HM8A 2EW2A 3GOHA 2PKRA 1BXKA 4LVUA 4OH1A 4J2OA 5T6BA 4YBZA 3C8MA 4LN1A 1PX0A 2VNSA 1DOHA 5ENVA 3D7LA 2Q1SA 5IJZA 3OMLA 4TKLA 1HF3A 1IY8A 1QYVA 2CMDA 5G0TA 3QSGA 3L07A 2HK7A 3GFGA 3R1IA 3D5QA 4PLWA 1R37A 2ZB8A 1X1EA 1BG6A 1NFQA 4DYVA 5JY1A 1ZO8A 1Y7TA 2NLOA 3ZWPA 3RJ5A 2FSVA 3EVNA 4UUNA 5I7FA 3I9OA 1K3TA 1C1DA 4RZHA 1ZK2A 4BNXA 4EBFA 3E5RA 5CPBA 5CAEA 4GWGA 1FK8A 5DNAA 3W6ZA 3CZRA 1YQGA 1U3WA 4MP6A 1Q0QA 1HTBA 1JQBA 4BNVA 1ONNA 1MV8A 3GPIA 4GQAA 1ZJZA 4ZICA 3ROKA 1GZ6A 3E03A 3GAFA 1K89A 2UAGA 2GN9A 4E4YA 2I99A 1LQUA 5IF3A 4DC1A 4OSOA 5GZ3A 1O95A 3FR8A 1EVYA 1DRWA 1VM6A 2JCYA 3L0DA 1FDVA 1MG0A 2BRUA 4B3HA 1Q7CA 4BS9A 4CM4B 1VSVA 1PJSA 1DXYA 3L77A 1JKFA 3K6JA 3DHYA 4AJ2A 2AEFA 1MG5A 5JYEA 1I32A 4B7CA 3DZKA 4OXNA 5KNLA 2XPCA 2QQ5A 1GCUA 1ONPA 3F3SA 2R00A 2CVQA 3WNQA 4RVFA 1EEHA 1Q0HA 1B14A 4UVEA 1R4MB 3LC7O 4CR6A 1XHLA 2G1UA 1E6EA 3DONA 1P9LA 3UXYA 3WGOA 4CLHA 4NJOA 5ER9A 2HMTA 3RI3A 1XCBA 2HRBA 5JDIA 4HBGA 4ZQBA 4JBGA 1RM3A 5IN4A 3BMNB 4OJNA 1PWZA 4XYEA 4BUCA 4AJIA 5EN4A 4EJ6A 4JNKA 5BSFA 1AHIA 5A9RA 3RFTA 3VPHA 3MJSA 1MXHA 1ISIA 2ZQZA 4WLEA 3WJAA 3LQFA 5B37A 3U62A 1UXKA 1TB4A 4BO2A 2P9GA 5CHEA 2EERA 4WNCA 1LDYA 3A4VA 4QT0A 1W73A 4YT8A 1A7KA 2P91A 2G82A 2QRJA 3P19A 1C1XA 3ONEA 4ZA2A 3WBBA 4CQMA 1SBYA 1SC6A 2DTEA 1B3BA 2JCVA 3I52A 2PD6A 4GGPA 3F9IA 3UFXA 1ZEMA 3B1JA 3EDMA 3GF4A 4ZRMA 1QYWA 1LXCA 4N54A 2VHVA 2G5CA 3GDGA 3TL2A 1X14A 4FGSA 2HSDA 4IMPA 1YH3A 1WW8A 4AFNA 4TZTA 1V35A 2JAPA 5H83A 1KEWA 4Z6KA 2PZKA 2Y1FA 1PQUA 3CMCO 2DBZA 1E7SA 2ZTUA 1NWCA 1N1GA 3OQBA 4YCAA 3INTA 4E32A 1DIBA 1LDBA 3UCEA 4J0EA 3DBRB 1VL6A 1KVUA 2UUOA 3ZU3A 1U28A 1V0JA 1HDGO 2J5KA 5CPFA 2R2GA 4MKZA 4UVDA 1Y8RB 3E9QA 3ZNPA 4DPMA 3U4CA 1YXMA 1O9BA 1HDCA 2IYPA 1WDLA 1PQPA 4K6FA 4PVDA 2VUUA 4MO2A 4KQWA 2AEMA 4RL6A 3K96A 1IPFA 4B4UA 3TN7A 5JMWA 3E1KA 4M54A 3LC2O 3Q3CA 3WWYA 5HS4A 4ALKA 5TRTA 5DCYA 4HV4A 1PJTA 2HJSA 5H82A 2FZWA 1SEPA 2UDPA 1Y5RA 3QWBA 2SCUA 1VLLA 2OL4A 4UUPA 4DQXA 1GY8A 4GX0A 1H93A 5CP8A 5EERA 1EBFA 1HYHA 1N1EA 1PJCA 1B0AA 5H81A 4EUEA 4GAEA 1PL8A 3T7CA 1UZNA 2NU7A 4FJ0A 1HKUA 1HXHA 3ZDFA 1GEEA 5DZSA 1AXEA 3LT0A 3LF1A 2C59A 2W2LA 5BNIA 2BELA 3FPLA 2PKQP 4KTVE 4XCVA 3WGHA 2Q4BA 3C7AA 2W8ZA 3TQHA 4BNZA 2VWQA 4XRRA 5CDYA 3SVTA 4D3SA 1E7WA 1PGPA 2POQX 3H6KA 4NNJA 1NWHA 3RUFA 2DKNA 1HDOA 1U8FO 3MJ4A 1KVTA 1QV6A 6LDHA 1U4OA 5HBRA 4AJNA 5DBGA 2WSBA 4K1LA 3C7CB 3PDUA 4U0KA 2O50A 1E7YA 2EWMA 3UW3A 1ZSNA 1X0VA 1CRWG 2JFHA 2WD7A 2JFGA 3OQ6A 1JLLA 1NHWA 2J5QA 1TA4A 3CMMA 4MDHA 3SC4A 1B8UA 3EVTA 3GVXA 4NZ9A 3VPGA 1YBMA 4ZQEA 4NBWA 1R4MA 4BL5A 4R3WA 1MA0A 3PLRA 2B5VA 2Y68A 4NJMA 1ZIDA 4M86A 1I24A 1SEVA 4IXTA 3RASA 1U1IA 1PL6A 1ZXBA 1KC3A 4OKNA 4IIUA 3TDKA 5FI3A 2CVZA 2WMDA 1GUFA 1IB6A 2IEDA 4D46A 2YUTA 5C7OO 1B8PA 1ZUD1 2EF1A 4BNTA 5G0WA 4QEDA 1QYDA 1A4UA 3JYPA 4IJVA 1OOEA 4NFHA 3JD2A 3WYCA 3DZHA 3TF5A 3MTGA 5MGBA 4CR8A 1D1SA 2VWPA 2WD8A 2PZJA 3IL2A 1VRWA 3RBXA 3ZHBA 4Q3DA 2ZYGA 3GC6A 4O1MA 5GZ6A 3RUCA 4NMHA 1CQIA 4XDZA 2YQ4A 1PWXA 3PGXA 5KKAA 3ZW8A 2Z1MA 3NTOA 4UEJA 3L4SO 4HFNA 2JKVA 2Y1CA 3TZCA 3ZWMA 4L4SA 1DFHA 1EE2A 4DLLA 5FYDA 1QSGA 4DIBA 1Q2XA 1YJQA 2EIHA 3HDJA 1HL3A 2ZQYA 1W0CA 3OA2A 4QO8A 3C7DB 3BTOA 3VTZA 4RJTA 1IULA 4TKMA 4W9NC 5CFZA 3GAZA 3EGOA 1HETA 4WLVA 1I01A 5JAMA 5C7IO 3M2PA 1P1KA 3DBRA 3PXXA 3U9LA 5G4LA 2PV7A 1ZK3A 4DA9A 5HWSA 4UREA 2E48A 2WWRA 3VH1A 1U5CA 1Y8RA 5DP2A 3ST7A 1DLJA 1PQWA 3C1TA 5DDIP 1Y1PA 1ZKMA 3QLJA 4I9NA 2J3JA 4CUZA 4BO5A 1K2WA 3QVXA 4UAGA 4CUJA 2DT5A 3DR3A 2PTGA 4RQUA 2JAHA 3U5TA 4CMHA 3HN2A 3ENNA 4JJGA 3W8DA 2FMUA 2IODA 2P4HX 4BNUA 4JP3A 1T24A 2C07A 1NR1A 3QV1A 4RORA 1UDAA 3D4NA 3D5TA 3O9ZA 2VZ9A 4AJOA 1T26A 2VRCA 4NK5A 3S55A 2OZPA 4B3JA 4DPKA 3BA1A 4BNWA 4IZHA 3AM5A 2JJYA 1GL3A 3JD3A 4EGFA 4HWKA 2NSDA 1HSOA 4A7PA 2WM3A 4WCFA 3WGZA 2DFDA 4Q3EA 1NVMB 5FEUA 1WMBA 2EW8A 3Q0EA 4MVJH 5L7TA 2UVDA 2XXBA 1XQ6A 3OJFA 4ZN6A 2EV9A 3LK7A 1M76A 4GVXA 1I2CA 4O6VA 2ZTLA 3E82A 4R1NA 4J90A 1JU9A 2GERA 2JHGA 3H4VA 4ZD6A 3RIHA 3K2BA 2PZLA 4NFSA 3JQGA 1YGYA 5A06A 2YHUA 1IZ9A 3OA0A 3OJLA 3JQ8B 3DZFA 3GVCA 3ZWWA 3VH3A 4H16A 3WG9A 5L95A 1VKOA 2V6GA 1E3IA 3WQRA 1U7TA 4J6FA 1ZSYA 1LSSA 1I3KA 3IDSA 3DHNA 3KO8A 4NU5A 3HJAA 4S3MA 5EJ2A 3U3XA 3DO5A 4QUKA 3RUEA 4WASA 5G4KA 2ILTA 4CMEC 3QWAA 5L4LA 3TOZA 3WMWA 2UV8A 5JO0A 1EVIA 4P22A 2CF5A 2Y0DA 2GLXA 5JC1A 1I2BA 1TT7A 4CLRB 5U4QA 5CDSA 4MP3A 4BGIA 4XA8A 1ENZA 1WVGA 4DXHA 3PJEA 1J49A 1NVGA 3U09A 3G0OA 4Y9DA 2OBNA 3NGXA 1I2ZA 4TZKA 2WYUA 4XIYA 3GT0A 2Y1OA 1SMKA 2QRLA 4YRBA 4JBHA 2YDXA 3QHAA 1LSUA 5K0ZA 1EBUA 2C54A 2W2KB 3PJFA 3PYXA 1IL0A 3H9UA 2AG5A 2ZB3A 4XX0A 4DMLA 3H2SA 3PP8A 4Z9XA 1LRJA 3G1TA 5G0SA 4BO4A 4IDCA 4A2CA 1N7HA 1N8KA 4OAQA 3OM9A 1DFGA 4WUVA 4DIOA 1LSJA 1ORRA 4B4OA 1GYRA 4HKTA 4DRYA 3STHA 4RF2A 2HDHA 4YEDA 2Z1NA 4E0BA 3W8FA 3M2TA 3DFZA 3QWIA 3KHUA 4FFMA 3AWDA 3UGKA 3WTCA 4FB5A 3LLSA 4BHTA 2B37A 1BDMA 5TIIA 1MX3A 3PTZA 1SOWA 5AYVA 4E12A 1CJCA 5I8WA 3LYLA 3WYEA 4UVHA 5BNTA 3AY3A 4RPJA 3ZV4A 2O2SA 2BI7A 1P3DA 4WNIA 4XIJA 3VZRA 4PLYA 3EYWA 2OXIA 1R16A 3H5NA 4DBVO 1Y8QB 1NYTA 3GR6A 5DOVA 1WAMA 3Q11A 2FY8A 4TQGA 4M89A 1YB5A 4MIEA 4NDNE 2ZJ0A 3DZGA 3S2GA 3K5PA 2D59A 2I65A 1P1RA 1MLDA 1KEPA 3E5MA 3PHLA 3PVZA 4RVDA 3UKOA 2DPGA 2X86A 1LLDA 4BMNA 1V9LA 4D79A 3CXRA 5JS6A 4UVIA 3JYQA 4CL8A 4FJ2A 2J5RA 5A5EA 1OC4A 1PR3A 5KVQA 1UZLA 4ND1A 1OC2A 4BMVA 2X9NA 4WGGA 3FBGA 3RUHA 1GPJA 1C0LA 2YV2A 1U7HA 3FI9A 5F5NA 3UOGA 3F4BA 5TC4A 1X1TA 4J7UA 4CQMD 2Q45A 2X9VA 3U49A 2BHLA 4DTIA 1ZZEA 4WOKA 4MVJP 3WS7A 3EUWA 2NTVA 1DIGA 4NIMA 4AJLA 2P5YA 1C3VA 2Z95A 2H9IA 2DU8A 4J91A 4R3NA 2F00A 4D42A 1NQTA 2R00C 1WDKA 2FWMX 2FPGA 3AOEA 4KUHA 8LDHA 4PGFA 1W8DA 4J4TA 3ZNQA 4YTEA 4RF5A 5HRUA 2DVMA 3WWZA 2UUPA
chains in the Genus database with same CATH superfamily
3O2JA 3D3JA 3ILVA 4PZLA 4Z0NA 4QDTA 3SXUA 3HDYA 3MWYW 3KZKA 4OFZA 1YJXA 1HEIA 4JB3A 4JJFA 5JDIC 5L4NA 3GGSA 2V97A 4AD8A 4ARSA 5BQFA 2F7SA 2RH9B 2RI6A 2XT6A 5KOJB 2UVQA 2H4HA 2DGDA 4KMRA 3FM9A 3GLQA 4WLNA 1OYVA 5A6SA 2WKRA 4D9KA 4R7TA 4M0FA 2Z9CA 1TW2A 1YACA 3LL4A 1V1MB 4UCWA 1FVFA 3IEVA 1SVLA 4R2IA 2PUGA 1E9CA 1WBJB 1S6YA 3AR8A 4HEA6 2WYOA 4RENA 4FGZA 4WESA 4WZBB 1FTQA 3I2YX 2FETA 4BQRA 1Q2UA 2WMOB 3RSZA 5HJEA 1DEKA 2ZI4A 2AFIB 1E9BA 4L5IA 4OFWA 4B2IA 1A98A 2J30A 2WAXA 3RFVA 2W2VA 1IUNA 1W19A 2QU7A 5AHKA 3MWEB 1KY5A 4REQB 2GPTA 4YCCA 1EXNA 1KYYA 1DRVA 2F3TA 3PVCA 1Z4QA 3QMPA 4IMIB 3NEAA 1Z7YA 5CFOA 3P5BA 3D54D 3IT3A 4X7BA 2WJ6A 3CIOA 5LQNA 3CUYA 5ELMA 3KXLA 2V7WA 4GWKA 1YC5A 3KB6A 3KCNA 2II6A 1E6KA 3FN4A 4LE0A 2DAPA 2J9YB 4ZODA 1K8ZB 2O8NA 4QFCA 1ORHA 4XFDA 2G0AA 1FMFA 4KSBA 3IBFA 1JYSA 3PPWA 2GYVA 1RM0A 5GTDA 2WMNB 4ZOBA 4L7QA 1X7WA 4LOHA 4HX5A 4Y1RB 2J09A 2QN8A 4IKEA 5HCIA 2GN0A 3KHKA 5LB4A 3KXIA 2H11A 1WBDA 4TMYA 5H80A 3A2NA 4KWEA 4C5CA 3ZGNA 1XQYA 3HA3A 2JPDA 4UOZA 2VP4A 2GZ2A 3S4YA 6YASA 3WJ1A 1O8CA 4KUGA 4X8LA 4IG9A 3VA7A 4JJ7A 4KIJA 1JHAA 4LXXA 3OKCA 1DUIA 4TRJA 3PFCA 3EVAA 4ID9A 3I9MA 4OP2A 2C2XA 4A8JC 3KHSA 4EFNA 2FSIA 3MCVA 1WY7A 3FUXA 2X77A 4URWR 2H2DA 4J0KA 3QY9A 2VHEA 4TLMB 2ZI7A 4QSMA 2TYSB 4ZOEA 1F7UA 3QLVA 2ZYHA 4XWOA 3H3FA 4X0EA 4JOSA 1TU3A 4TT3A 4HAZA 2I2BA 1ZESA 3IPXA 1R8YA 2HJVA 1JE0A 2VAVA 1BXZA 1UK9A 3MWGA 3B78A 5T64A 3S40A 3NHMA 2H9AA 1UEXC 1GCGA 2C5BA 4MP8A 3RE1A 3H13A 2BBTA 1XJQA 1FNBA 2XEXA 2PUAA 3N8GA 2BGUA 2D5LA 2VDKB 5ALNA 3W3AD 4QPPA 4K6OA 3TSOA 3BL8A 3QF7A 4BASA 4RDIA 2EEZA 1JXAA 3HVHA 4MUYA 5D3ZA 1WZIA 1XZIA 1XL1A 1RM5A 4DAEA 3ZK8A 5J4KA 3VZDA 5HE8A 4FGWA 4IRUB 1H0HA 1XLTA 2FQYA 1XF9A 1ZH6A 2QUBA 4S1VA 1TUIA 2ZI9A 1CY8A 4ABYA 4GUAA 5JXJA 3B3QA 5DT2A 4A0HA 2GA9A 1ML4A 3HBMA 5EXXA 1DKOA 1XLUA 1SIBE 3D1LA 4CW7A 1RI1A 1IIBA 2A6PA 5DW0A 1EUZA 1ESEA 1N6NA 1OZHA 1B76A 3AYZB 3PT5A 4IO1A 4NAUA 4UM8B 2YXLA 5J2UF 1Z29A 3KOWA 3M7IA 2ZBEA 2IZZA 1Y81A 1CZKA 2QM0A 4OHVA 3DTNA 4AJKA 1DJNA 2FPKA 3EDYA 5BSUA 5TX7A 2WTNA 4EY7A 1U1DA 4JUIA 2PX5A 4GBGA 5EZYB 3KZXA 1U02A 4IIGA 2QEQA 3PLAE 2P8SA 4R6WA 5LQDA 2VP9A 1E1QA 3Q4GA 2X15A 3IEPA 3HP1A 3OZ7A 5DN6A 4F45A 2ZRLA 3L0BA 5AVRA 4MWEA 2VSFA 1E4EA 2XCQA 3TW8B 4U7FA 1KTIA 1U8EA 2LE0A 4MUAA 4N3NA 4E94A 4EF4A 3B13B 2DTXA 1PNVA 3P0JA 1QP8A 1U3UA 1ECJA 2V7XA 4UQOA 2QG4A 3S2SA 2IX3A 1CJUC 2KLBA 3TD9A 1VKNA 3HCWA 4OP3A 3VZSA 2QW1A 4TYQA 4EG1A 4OXXA 1ZI8A 4G2TA 4MUGA 4RPIA 3IJPA 1N6KA 2C7PA 3TWOA 1JJ7A 1QJ4A 1YUMA 2K4MA 3WYDA 4YONB 1X8KA 5I7VA 4NJMB 3KZCA 2YV1A 2M1ZA 3ZH2A 3IDQA 3A0UA 3TCNA 3D8TA 4P5PA 2P3QA 1L7AA 1ZOSA 4U6NA 2FN8A 2AQ8A 3HABA 4YP0A 2PGJA 5FBVB 5ECYA 2DUNA 3RBVA 1GSIA 4X7RA 2TRSB 3B9PA 3UNXA 1JAHA 4MARA 4ARZA 3OCWA 2HR1A 2HJWA 3PHHA 3OU6A 3O1LA 2ZJYA 5IVKA 2XNDD 2QL6A 1RCFA 2QRNA 2VUTA 2DPHA 5K0NA 3D3QA 1CY4A 2W6JD 2LDXA 1IEWA 3ANLA 1F8XA 2QTGA 2ZBUA 1VMAA 4OHYA 5T8KA 1FX0B 3TTUA 4QU5A 3NHWA 4DG9A 1TXGA 3V4FA 3TLXA 4DB4A 3BIXA 4R1LA 1NPTO 3LSTA 1T6YA 4Z4FA 2J3IA 4QX6A 3A6LA 3DHEA 4P38A 5IXSA 3NWJA 3DZIA 3UW1A 4P80A 5I01A 5JJKA 4FCVA 5I8PA 4I1OA 5B36A 5F9FA 2AQHA 5LA6F 5KTTA 5FBWB 4R9SA 1FDIA 1JZQA 4FT4A 3VR2D 3OIFA 3RVMA 2BFMA 4CMJA 1QPGA 4WLOA 4ZAGA 5T4HA 5JCJA 5BOVA 1HFWA 3ORRA 3SEFA 4FS8A 3V80A 3ICEA 4BO8A 3A05A 3T7TA 4YRKA 3SSMA 4J16A 3R3HA 3UUWA 3VOTA 2D00A 2BFBB 2OYSA 2BSAA 3EEBA 3JWPA 4KLNA 4A0FA 1NN5A 4JWTA 4S1NA 3DEJA 2BVNA 1BH2A 2AG0A 3MOGA 2YJGA 5FUBA 1TRHA 1V11B 4TYWA 2W2XA 4E5VA 1ZVMA 3AW9A 1LBEA 2IF0A 1GKKA 1S4MA 3DP9A 3EFOA 1T3ZA 1U0NA 3F96A 1KSJA 4MUEA 1SKUA 5FPHA 3RVSA 5JY6A 2R84A 1A9RA 2HMUA 2P77A 3A4TA 3FAZA 4HQKA 2W93A 3LHFA 3HXOA 3AI1A 5K9ZA 5A1JA 5LKRA 3MBOA 2IHNA 1PT8A 2XNJA 4BX8A 4I9UA 1UODA 2ZRFA 1S8FA 4K9SA 4MVCA 4PE5B 3ODPA 4C4TA 3FYUA 4FI3F 4MWBA 3VVCA 5I6DA 1DAPA 1OU0A 2J0UB 1XZCA 5IAGA 4WJZA 4C0AC 1JDJA 3HSSA 4YR9A 2QF7A 3LC1O 2PIDA 2F55A 1WABA 3LLMA 4Y9RA 3DEAA 3EZ7A 4ZVSA 4I1RA 1FC0A 4BGEA 4D82A 3OTOB 2A9QA 2CHEA 4BVEA 5EXDA 4F9EA 5HM6A 4C78A 3TCXB 5CB4B 2H08A 4ZDIA 1Q6YA 3KAKA 3H5RA 3H04A 3BRCA 1XUOA 2BPOA 1K3FA 1Z2OX 4JT2A 2V6BA 4OYRA 2I6QA 3TRDA 3B48A 3KBOA 4KVGA 4NU0A 4JDUA 3OBIA 3WGJA 1I7SB 1F5NA 1PT6A 2TMGA 2Z08A 3KB1A 1FS4A 4NULA 4RJLA 5EINA 3OQ1A 3TLKA 1EUYA 3MINA 2JLAA 4KR9A 4MQ6A 2AB0A 2PWZA 5IFLA 2B6HA 3HRHA 3MJCA 2YV5A 1RJEA 1C29B 1B73A 3JS5A 4E2XA 2J8ZA 4PC7A 4YA6A 2P2NA 2VTVA 1HC7A 3DFUA 2G9RA 2UZAA 3KRTA 1MENA 4I50B 1OLSB 1BQ3A 2JJ8A 3TTTA 1KFCB 3WWCA 5KX5A 3TFOA 1JFSA 2DLCX 2NMVA 1KIFA 3HKCB 3CTPA 1MDBA 2BFCB 5ER6A 3VSCA 1OILA 3BJZA 2RAVA 1WQ4A 4KE6A 2XOEA 3I2KA 1Z0DA 1Q0ZA 1LK5A 3K0BA 1NI3A 4I8IA 1NF2A 4A10A 5BORA 3KSDO 1J8YF 1GITA 3JQGB 4H59A 5BQPA 4LJ8A 1AKNA 1DQNA 3SFZA 4GR9A 4HDNA 4YT4A 1ULZA 4EKEA 3BXPA 1ECBA 2HO5A 3I2IA 4Q82A 3ZE6A 4CYMA 5BR7A 5C9ZA 2YTZA 4AMZA 1NW9B 3I28A 4X8HA 4BVLA 4L76A 3LPMA 5LIPA 2OCYC 2JFQA 2BEWB 2OBMA 4MB2A 5KREA 3PV0A 4PG8A 2ZJ7A 1TI7A 4EUHA 3GEEA 4BYGA 4YRAA 1WS6A 4MUJA 5ECWA 1PNTA 4YAGA 3ROZA 4HQ0A 5EQFA 4CGZA 3CW2A 2QAGB 1Y5MA 2VPWA 2XOKA 2ZRGA 3BDVA 4MPDA 4X93A 3IR7A 4Q02A 4II2A 4FOLA 3P9YA 1G21E 1XRPA 2IS4A 1ESNA 2BFDB 2IXEA 4OXRA 3VAZA 3ZOZA 1X8XA 1CY0A 5DBIA 3NM5A 3K7EA 2Z2IA 1UUFA 3KEQA 2W6QA 2DERA 3K9FC 3G49A 1J5PA 1WUJS 4UXIA 1GV1A 5CVVA 5FNZA 2CC2A 1MC4A 1YBFA 1WTAA 2FE4A 4LY9A 3VC2A 2CLHB 5ICCA 2G08A 3ZHQA 5KYNA 4KHPB 3WNBA 1Y3FE 5ILOA 2FWJA 4S0ZA 1QRSA 2JFBA 1C9YA 2VAMA 3VR4A 4K46A 5JSYA 5DLPA 4XB2A 1Z73A 1RJ9B 3KR1A 5JBNA 3GW8A 4IWXA 2WWWA 2YXNA 4YROA 4X60A 4EGAA 4J8PA 1TO6A 3IMKA 3OECA 1KDOA 1TD1A 1XTBA 2ZZKA 1V95A 4R68A 1MV5A 2GSDA 2QM7A 4CHGA 2H1OA 2RHJA 5BSGA 4RH3A 4D99A 3QXCA 1XEAA 2E9SA 2WF6A 4X54A 2O7VA 5TB5A 3HU2A 3LKBA 4CEJB 3K0AB 3AL0C 4NYMQ 2XDWA 4ILEA 4LSWA 3SYMA 2J31A 1RIFA 2VHWA 1AHHA 4Y2RA 2A59A 4OMFG 1VL5A 4OI1A 4BC1A 1VHDA 3AHDA 5HUQA 2RBKA 1GTL1 3ZWNA 4XQ9A 1FJGB 3OQHA 1MIOB 1KARA 2O2YA 2W6IA 4KBFA 4YCDA 3O4VA 5FUWA 4B75A 4RLHA 4R4JA 3VRHA 4DT1B 5FWNA 3G9UA 4BNDA 2MYUA 1LPOA 2RCYA 1WKVA 1N3LA 1WO8A 1Z39A 3CJTA 3LBIA 1E3SA 4OHBA 1N7IA 1TUBB 4CLOB 1JH8A 3O9MA 4LYHA 2NVWA 3AZQA 3GCZA 1NUTA 1UQTA 4MRPA 2P5UA 2Q1XA 4LJ5A 3G1UA 4MXDA 3S29A 1BHJA 4RO0A 4JLSA 5EWJB 3H7IA 1K63A 3WJ2A 4Y6LA 3THWA 2H5LA 1U8CB 2I7TA 4LI3X 4R98A 5CLHA 1OIWA 1VPDA 3CEAA 3IH5A 3O8LA 4C7MA 1SUWA 4KN6A 3ZG6A 3L7AA 1HMYA 1KYVA 4C0BA 5KINB 3D7NA 4LF7B 4DTCA 2BL4A 2ZS7A 3OY7A 4O4LB 3ZUGA 1YOBA 2FR0A 3DOCA 1K8QA 4L8WB 1NMQA 1RLOA 1KPGA 2V5VA 2YICA 3F3KA 3LQKA 3VVMA 5KS2A 3R9KA 1K8RA 1JHMA 2HSJA 2BFEA 1P2UA 1TD9A 5JAZA 2B8WA 1VGRA 2RC6A 2WF8A 4XI9A 5ALRA 2JGIA 2H17A 1FRNA 4GC5A 3FVQA 1KEVA 3PB3A 2O4UX 2RGBA 3CR7A 3EXHC 5C1PA 3M6MD 2GYYA 1ZIPA 3T3EA 4DF3A 1YJ8A 1LRKA 2YL2A 3BL5A 3S68A 1O6CA 3DZBA 2PUVA 4RLQA 1QZZA 1R4NA 3UB2A 1VCNA 2PSSA 4FINA 3IVAA 3LUKA 3MT0A 2EJBA 4IUBS 3P9SA 1XXHB 1OBOA 4HP8A 3SLKA 3TIVA 3GYGA 3WMXA 3EXIB 1DWPA 1P5ZB 3KSRA 4DGQA 3HRKA 1EWTA 1N2HA 4IILA 4XTCS 5ALQA 5C8DA 3TZBA 5M29A 3QF4A 2WB2A 3CNEA 3LIIA 3JTMA 3ZW7A 3ZLBA 3IEIA 5ELXA 3R76A 4DA8A 3PYLA 4MR8B 1M6HA 4HEHA 3H5VA 1NURA 1N57A 3TDNA 1P0FA 4IDPA 4JYAB 5IMSA 3NVMB 2ZRMA 1EDOA 4Q7LA 4WJKB 3QPBA 3COPA 1E3DA 4PC2A 4UZEA 4DRXB 5K5EA 1L7BA 1ULSA 4AZ0A 4UBKA 2YJ6A 3LY8A 2RGEA 5CFLA 4ACBA 2YY5A 4OLAA 5FTKA 3GJTA 5AW1A 4GKAA 4CQLA 3ZYCA 1RWVA 3GGPA 4Q34A 2FLKA 4DVJA 5GPBA 1JLSA 1ZD1A 2HCFA 1I4TD 4XVRA 2IU0A 1ZH2A 1A72A 1RVV1 2FSGA 1I5RA 3A6DA 3C8DA 5BWMA 1FLDA 2F9FA 2Q4EA 2FZCA 2Q5QA 1V1JA 3FZGA 3JASB 4BPBA 1CZOA 1SQ6A 1Z33A 2AG8A 3ZV3A 3SYRA 1BFUA 4EB8A 1G20E 3CIFA 3EEIA 4AXXA 4AN1A 7YASA 2YHIA 1QTNA 2J59A 3KPUA 3MTIA 3MBIA 4V0ME 2YZ7A 4Y0AA 1UJBA 3VHRA 4EB6B 3AXTA 4FC6A 3GEIA 1XV5A 3UHAA 3D4OA 5KJ1A 2CGEA 2VNHA 4DWOA 4F38A 3IUSA 2D0PB 1J25A 5AKIA 4BFTA 2ZT8A 4IDQA 2YS6A 1PEYA 3L8HA 2R6CA 5AM0A 3X1KA 3UBTA 1XSEA 3HKEB 3TTVA 2ZJ6A 3AY0A 3TW4A 3QVWA 2QTHA 4WH0A 4UTOA 1XR3A 2C5FA 3FPCA 3R3WA 3DNMA 4WESB 1X19A 4ZQIA 2PL1A 3TZ6A 1GU1A 1NMZA 1W5EA 2JNWA 2CBZA 1X2EA 1U2RA 2CMFA 4P35A 4P0TA 3ACBA 1GNVA 2FPPB 2JANA 4DEXA 3KJZA 4LJSA 1LBIA 1HYGA 1P44A 2AR9A 2DFPA 5F5LA 4EO4A 2P7HA 3NR2A 3QGMA 1H4SA 4GOOD 5LD2C 4OAPA 1VLZA 5E1OA 1PTJC 3FDZB 1UC8A 3GRPA 5C5DA 4J07A 4XSGA 2I9PA 1NG1A 2ZI6A 4BNJA 3I12A 4MGEA 4F5YA 2GZ3A 4NZZA 4C7JA 1IWBB 3WK8A 4JUDX 3DOOA 2BGWA 5D7BA 1BU5A 1J7KA 3R0JA 1PWEA 2VAPA 3KXKA 4TSRA 5KQSA 3KSBC 1PWHA 1RRKA 1FTSA 1QH0A 4H4DA 4UNPA 4X64B 1S2DA 1YZTA 1ATIA 1ZP6A 1YZFA 1GGEA 5AXBA 4N5NA 4YWJA 1E64A 2QTBA 4QC2A 4HOYA 1P0CA 5L3RA 2WKSA 2O8BA 4KXMA 3SEAA 3ZE8A 2MSEB 3B85A 3DMNA 4RFSB 2HNKA 5CYFA 3SYTA 4LYJA 4CRWB 1AY0A 3HUTA 4F2WA 2MMCA 4QM7A 5A5FA 1R9MA 4UHKA 4EX6A 3JQBC 3ZVNA 3AERB 1II8B 2CXTA 3RJZA 3CKLA 1AKWA 1CP3A 4B8ZA 1L7EA 2F64A 2G9VA 2R5WA 4RM3A 4TS9A 4ZT4A 3WGVA 1JAIA 1GQ2A 1XN4A 2QKYA 2NZJA 3L6UA 3ORYA 3ZHVA 4EY5A 4YV7A 5C46F 2YC2C 1QYIA 1M10A 1KOLA 2NADA 4CM9A 1T1SA 4Z1MD 3HVIA 2XGOA 3L7MA 2FZLA 2BJWA 3VC7A 2I7VA 2XMZA 2WSIA 1MD9A 3O8CA 3NBUA 5A3JA 3TCKA 1DQZA 3T38A 4BMDA 3ISJA 1F8GA 3GEPA 2ZSIA 2PVPA 3HYNA 4D5GA 2CFRA 3IUJA 3NNSA 2IPXA 4TN5A 1AU9A 1H8HD 1YRAA 1KBZA 2J7PA 3WLFA 1WE2A 2J0SA 3ZX5A 1XMQB 1YOVA 2GK7A 4HZGA 2D1RA 2HLPA 2WIKA 3KLOA 4KGZA 2JFFA 3U4IA 4F3YA 5JO9A 4TV9A 2X8JA 5DMXA 2O6LA 3PNOA 2ZQ5A 3QPDA 2CJXA 3DDOA 2F3SA 1JHZA 1S2IA 4RXUA 5DP1A 1IN7A 3G2HA 3OZSA 4JP5A 4NBVA 3WDLA 2GXQA 3HDVA 3I76A 3PHIA 5P21A 2OBLA 2BDEA 2Q6LA 3ZH9B 1FDWA 7ABPA 2QXYA 4IICA 3T9BA 4B3CA 1WPRA 3GMSA 3K0SA 4G1CA 3COZA 5IZCC 2Q1UA 2PUBA 3BULA 4LZWA 4FKBA 1KPHA 3V4RA 1NULA 1NY6A 2GB4A 2YXPX 1NY5A 3A3OA 4LRXA 3E7DA 1VP3A 5CK5A 4TXMA 5LPNA 3NS7A 3UHPA 4A2QA 4FSXA 1OH5A 4X94A 1QO0D 1TZCA 5SZIA 4N5DA 3DBHB 3FNGA 3R77A 1E92A 2YY7A 4L4RA 3K0FA 4N7MA 1CUSA 3IDFA 4RK6A 4RLSA 3JQFC 3H8SA 3DMTA 2AX4A 3FSEA 4MR7A 2QSYA 2Q6TA 4MVJI 4DCTA 2R1VB 1QGYA 3PGKA 1TK9A 3HB0A 4XVUA 3GRVA 2JAQA 4LDNA 5J43A 1W0JA 2VT6A 3E0XA 4JZKA 1IE3A 3FPFA 4RBNA 3HXPA 3DDCA 2HQBA 4HX9A 2X0FA 1E4EB 3AXSA 1MDFA 2JDIA 2X9QA 5HDBB 1YONA 4WE3A 1ZU4A 3FRJA 3C4VA 5E9QA 1Y4ZA 4CM6A 3PEWA 1F20A 4FYKA 4QUEA 3GLSA 3NATA 3K2EA 4CR7A 2JI4A 5B3JA 3LVRE 1GRCA 4KAFA 1JAYA 3ESDA 1QTIA 4KAAA 2WZDA 4OHFA 3CEHA 3B51X 1KR2A 4G0ZA 5K3FB 3VR6D 2FKNA 3A1UA 2B4QA 1OSNA 2WT8A 2XEDA 3P9QA 3WHIA 3ZKWA 4DIMA 3OY2A 2QUKA 3I6IA 3RKUA 4GKVA 3I62A 4IIJF 4Q7JB 5CXQA 1DRKA 1T9GS 4RMNA 5DNUA 2QVGA 4UDYX 3ONNA 3RF6A 5ARCA 2XW6A 1CFJA 3X1ZA 3JD0A 3NKVA 1EUCA 3DB1A 2X9LA 3L7KA 4FCTA 3OIWA 5DM1A 5GV8A 4ARZB 1DIOB 2WIJA 4EW6A 4ZHSA 2O8EB 3KFXA 2DJ5A 3BF7A 1P5JA 2WWTA 1U80A 2C7GA 1A5ZA 2JVIA 1Z5OA 1XDDA 4E5KA 4K9KA 1X1QA 1ES9A 2V7QD 3D6HA 4RANA 2EG9A 3PEYA 1SXHA 5DX0A 3QKRB 3CLUD 3V5NA 3OH8A 3F73A 2AE2A 4F56A 5KJCA 3MWDA 2O8CB 4AMYA 5KTNA 5DF1A 1MRNA 3F4LA 3JQQA 1BFKA 4CEHA 4J0FA 4C0JA 1T8PA 4IGEA 4BNHA 1ONOA 1EB9A 1XFAA 1BHSA 3DC7A 1Y6RA 3RUDA 2V65A 3O2NA 1ZHOA 5I7WA 2VK8A 3K30A 3B60A 4WY8A 2G5TA 3BAZA 3GNTA 5L3QB 1NR7A 3FXAA 4PYLA 1IXZA 3GGOA 2O48X 3S1AA 5LLSA 4BTVA 5HGXA 1XZPA 1ZJYA 1IUKA 3P0IA 2PMFA 2JGEA 3SJUA 3Q5DA 3HYTA 2ISSD 3GLHB 2DFVA 1L5VA 4C7VA 4MUBA 4KWIA 1ZVJA 2VS1A 5E4YA 1WR8A 1VZ2A 3RV4A 1BGWA 2CKDA 3BJRA 3WX0A 1R0RE 3ZWKA 1M34B 1V7ZA 1Y9JA 1ONSA 3O9VA 3K1TA 1Y80A 1CEXA 2H5JA 4JSRA 2Q3HA 3B36A 2FTKE 3G17A 1DAMA 3S1SA 4YUZA 1E0KA 3HP7A 2AW5A 2Q6KA 3PXAA 4N40A 4Q3AA 5JC8A 2YIJA 3LKZA 2NT4A 3R3JA 5TMBA 1FFCA 3K0CA 2XRZA 1YI0A 3DD1A 2FSHA 4HWGA 5HVNA 4TSFD 4GBMA 3FYCA 5LJIA 3F8TA 4PLZA 2GEKA 2Z2JA 4FMPA 1YIOA 3T5TA 2IHUA 1BDJA 1L1EA 4PO3X 2ODAA 2DQSA 4JJ8A 3RYFA 2HGZA 3D0RA 3M9XA 1DV2A 4EHNA 5DYYA 2ZSKA 4HDRB 5KC9A 2CE7A 2RGUA 4EG0A 1U11A 1WEHA 5JISA 4F04A 2BHTA 4P58A 3G9XA 5DHPA 3TIIA 3BIOA 3EXFB 1RQ2A 3QNUA 4X3CA 3S28A 4L4XA 1JNXX 5D7NA 3A8TA 4UUMA 4PYNA 1NZJA 1JG7A 1GPUA 1YGPA 3CNQS 4WCVA 2AZMA 1IOVA 5I9BA 4G9EA 5IT5A 4GI5A 1CQZA 4GECA 1OX4B 3SJZA 3T94A 5SY6A 4Q18A 2F9MA 3HBAA 3PS9A 5AHOA 2DBRA 1INLA 4YP9A 1UXIA 1EFUA 2E87A 1L5KA 1A4XA 3KL2A 2B4AA 4ZHQA 1SKYB 4ND5A 3RPEA 2R79A 4NCNA 3UICA 4BX0A 1C7JA 5BV8A 3QU7A 2B3TA 3CRW1 3OT1A 5BSKA 3GELA 3UJPA 3LOQA 2FW8A 1P0PA 4OMUA 1II9A 5E6SA 4KQKA 1G16A 1Q1QA 1WG8A 2NU6A 3IAXA 5CVCA 3VKUA 5IRCD 3SC6A 3PX7A 4NCBA 3SKXA 2O2DA 2C3UA 3A1WA 1H2RS 1OT3A 1A8PA 1KO8A 1W1IA 1E9VA 3BH6A 3PIRA 1M2GA 1VSTA 4X24A 4DCVA 2P11A 1QLJA 3GZTB 1Z7WA 1Z0UA 3IOYA 1E2NA 4KFSA 1ZM9A 4NBNA 4UDXX 4GGOA 2JIZA 1UXGA 4FFBA 1QQ6A 1C30B 4D9MA 5EEHA 3CS3A 1EK6A 1HMPA 3NORA 3FZEA 1DKNA 2BH9A 4Q4DA 1MB0A 2J6BA 4JU9A 1MB4A 3QY0A 4M9QA 1GTMA 3STXA 5BR1A 4CXMA 4K2AA 1ISJA 1QH8A 4BE9A 1IY0A 1ZK1A 2Q0HA 3O47A 2K2WA 2I2WA 2ZJ3A 4HZUB 5TQ0B 1BROA 4O25A 1KORA 3O84A 1EFPB 4LUCA 2KHZA 2RGCA 3BD8A 2YW9A 3GRUA 4TUYF 2ZUTA 2CE2X 4PIMA 4WI1A 1E3WA 1JSCA 2DHEA 3VU8A 1MO2A 2J85A 3PPIA 3QNWA 4HH0A 4XGIA 4BO7A 2XWSA 1UZMA 3Q3HA 4CM1A 4DMMA 2GHIA 3AFMA 3AEXA 2D7JA 1CJBA 1IMOA 1P8AA 3VU9A 4N6OA 1CRQA 2VJKA 4PZ0A 5ALTA 3K70D 2D5IA 5ALDA 3B6KA 4KLCA 4Z9FA 1HGXA 3BCRA 3CRRA 4N12A 3UC5A 1KC1A 4HB3A 4C7XA 1Z6QA 2G1KA 3W2GA 3L7OA 3GGJA 1P1IA 2CFIA 2HU7A 3UWPA 1FSSA 1TVEA 3RS4A 1EP9A 1LU9A 4L9AA 3MQ4A 4BNFA 2REXB 4W5TA 1O3YA 1TL7C 4RK5A 2W2QA 1LEHA 3ZGOA 3WTBA 4GZ5A 3ZIUA 4KR7A 4YAEA 4YFVA 1ADYA 1BW9A 3ZTWA 3W7VA 1SB9A 5INTA 2VZ8A 1NVWQ 1D9XA 1FUKA 1ACJA 1QORA 1RYHA 2WEKA 2WSMA 3UV6A 2I8CA 1J2RA 3LW7A 1N2CA 1NP3A 1QC5A 2LP4Y 3NXKA 3I2GA 3OKAA 1A9PA 4PC6A 1JVNA 3RKSA 4G6ZA 2VK1A 2ORWA 2CXNA 1LC3A 1YVRA 2Y93A 2GILA 3FNIA 4LBVA 4LTNA 1SCNE 2JH3A 2WV7A 3BGWA 3IEXA 2N46A 1JVSA 1MB9A 5HK8A 5DRYA 2QLBA 2WQZA 4JT9A 4BWVA 3LF2A 3TB6A 3O91A 2CNBA 4UC0A 2V3CC 2Q6VA 4Y6SA 3IMCA 2PE5A 3PQ8A 1N9GB 3G2MA 1PIWA 5EFOA 2HU5A 1FSPA 3H2KA 3UOAB 3C14C 1XKQA 3GK3A 4JELA 3HBJA 3TW6A 4BNDB 4CIAA 2Z6AA 1NRXA 2WKQA 3FY4A 1IY2A 4W1PA 3FUCA 4C14A 5JSHA 3TNLA 1FPMA 3U7HB 2M32A 1R6VA 3ZDDA 5C2JB 3F9RA 4Y6PA 4EATA 2WBLC 2WD9A 3PX3A 3SEQA 1PS9A 2I6TA 3MCZA 4ZANA 4PLPA 1ULUA 2SBTA 3AR6A 3GWZA 2V4UA 5GJCA 2G7MC 5JZMA 5FTNA 1BHQ1 2SKCA 4M8LA 3R3VA 5FBKA 1N5KA 1XX6A 1X6VA 4LJRA 5A7FA 4YMVA 4OUDB 4ZEVA 5IHPA 5KJ6A 2RHMA 3SHOA 1M33A 3AV3A 3DMYA 4QYWA 2C95A 4UEQA 4XQEA 3ZDBA 2WTXA 2PD4A 2IYRA 4BV2A 4UPVA 3EFEA 1O96A 1HQDA 2V8OA 3LQ2A 4YLGA 4BQPA 2QI9F 3EC1A 1SHJA 4MKIA 5DGIA 5HIJA 2IWRA 1U3GA 3UAGA 4YRTA 1TYEB 2BFNA 5DASA 4X65B 3S99A 2HRQA 3ZDCA 1K7CA 3BMQB 5T67A 5G02A 1VJTA 3ILSA 5JSQA 1U2GC 5DB4A 4BKMA 4AF6A 4P81A 1T0IA 1OI7A 4E5MA 4GMDA 4XDYA 5EKXA 1GXSB 3RVLA 3TGPA 4NCIA 1ZYUA 2DR3A 4LRYA 3IXLA 3IA2A 4EHLA 5EMNA 3H4TA 4PLCA 4MV9A 4KTTE 1CRLA 1G8SA 4TYNA 3W5UA 6REQA 1DJPA 2JFNA 4IF4A 3AUAA 4NX2A 3I58A 4JBIA 1XNRB 3QBEA 1TPZA 5EJEA 5BUSA 1I1NA 1UEJA 1K0UA 3HKDB 5EIBD 4YBRA 1DKPA 1N77A 4Q37A 3QBTA 1OAKA 3T4EA 1IXKA 5DRTA 4IVNA 1W46A 1O57A 4ESOA 3Q98A 3C6MA 4DWVA 2QD1A 3SAJA 4UNRA 2QNBA 1PLLA 4PZAA 3VR0A 2AJDA 4QPJC 3DWEX 3FTCA 3PEEA 5JAIA 1U2PA 2CD7A 1F17A 3BEOA 3NJRA 5JW6A 1VIAA 2Y92A 1QCZA 4L6CA 4R7GA 1QG6A 2QAGC 4IIJB 4LGCA 4S2EA 3HCAA 2YBEA 2H1IA 5LOVF 3AVUA 2WJHA 3OPYI 3AR2A 1JTEA 4URZR 3P71T 2GDZA 1Z6XA 2Y0BA 2O3RA 1UK6A 4BV8A 5IK2D 1N75A 1NLUA 2O7QA 1A2BA 2VJLA 1ESDA 2C2GA 4OOEA 2E4YA 4G5SA 4KPGA 3IMGA 5JYCA 1UPAA 4RTRA 2QD4A 1NXXA 5I9NA 3A6GA 2XD4A 1DTEA 2V7PA 5H8WA 2Q6IA 3QLUA 1ONBA 2GBCA 3GQBA 4RVCA 4ZV9A 3UH0A 4UM9B 1NUAA 4KYUA 5C5EA 1LGYA 4NR0A 4EOGA 3WIUA 1DO0A 3RFXA 2HKIA 3KVVA 3ZXIA 1RYFA 2ERCA 1GUZA 1P3Y1 4KP7A 3INRA 1PJLA 2EKPA 2GCNA 2HK8A 2WI8A 2IYXA 2WYVA 2XB8A 3EW7A 3W77A 1TEZA 3KVYA 3KFLA 2XE6A 4D3FA 5TNXA 2HMVA 3D4PA 4KRYA 4ZAXA 4X92A 3U1VA 4BZWA 4O4JF 1XCGB 2ODQA 2RHGB 3H86A 1UIMA 3JWHA 1BE1A 1K8XB 4X7PA 4UASA 3PD0A 3ON5A 1IWOA 3AETA 3HVJA 4H1VA 1YWGO 3R0XA 3WSVA 2O8BB 1PGNA 3QKUA 4B8WA 4G5QA 3LH5A 2AT1A 4EYEA 2R5FA 1PKXA 1KH3A 2R97A 4OXYA 1KVRA 1XQ1A 2VPZA 4Q7EA 3GLGE 5I7SA 2IPNA 4KO3S 2BE7A 2XSZA 3IMEA 4UTNA 2IEAA 5EQDA 5JRZA 4LHVA 3DAHA 1VB5A 1XK6A 4OK6A 1WPQA 4JV5B 2H4WA 1C4KA 1CUWA 2GM9A 2MIIA 2P9BA 3LFTA 1BWSA 1NI4A 2DFNA 2PSHA 4J9VA 4OQPA 4QECA 5KVVA 2UZ0A 1XTRA 1R6XA 1YZUA 2WY2D 3ZVRA 2ZJ2A 2D2XA 2HJGA 2P9YA 2AD1A 3DAFA 3NBQA 4RX1A 2WKWA 1TMGE 4GSLA 5JAQA 3VV2A 1Z4NA 1POXA 4KRXA 4PLTA 2ODBA 3PI7A 3BE6A 4AS2A 4B6OA 2RGNA 5T7BA 3LY5A 1U0LA 1JWAB 4HEJA 4F71A 5EJIA 4AF8A 1AZLA 2Q5LA 1RT9A 4EGQA 1OI3A 2XF8A 1Z2AA 3N74A 3R24A 4FGJA 2IEZA 1IG3A 4RHYA 4DLXA 4KFUA 3Q8LA 5KOHA 2AEJA 2PKQO 5JECA 2GASA 4KXLA 5JPIA 1L5HA 3RS8A 1I1HA 3UK2A 1Y3AA 1SXJB 4IDNA 4PVCA 2XKAA 3LZ6A 4K05A 4JBXA 4NYIR 5ITSA 4RTKA 2WF7A 1Q0PA 1SBZA 1XTTA 5HA5A 3B52X 3UXEA 2VF8A 1KQOA 1PUXA 3IPYA 2X9GA 1DIAA 2XMGA 4GICA 4P8RA 1TFRA 2QD3A 2X8JB 3OPMA 2DPXA 5FXMA 5CVTA 4A0GA 2H63A 3H8VA 1X86B 1UEIA 3F8SA 3C98A 1T2AA 4XYBA 1E58A 3C3JA 3O0DA 4FR5A 1DOZA 2CL0X 4E5DA 4ZDKA 5K0TA 2DR2A 2HM7A 4KGVA 2C5EA 4HUQB 2ZB2A 1NF8A 3AESA 3C3PA 2M1XA 4G0MA 4V38A 1YCGA 3ECAA 1C4OA 1GN8A 1P77A 1NE7A 3IKJA 1MR3F 1JEOA 2V0CA 4YJ2F 3UB4A 2BDTA 5K8CA 1S3IA 2XNCA 3QKWA 1L4YA 1PGQA 1U3VA 1T36A 2XA2A 4LZPA 3URKA 2JJQA 2QN1A 4AG3A 5FPQA 4IJQA 5AJWA 1JHYA 1SNYA 2C7VA 5EJ6A 1D2NA 3CISA 2BFAA 1R3UA 5J59A 5EPEA 2G9NA 3OHSX 3DVRX 2NSJA 3K0FB 4HN9A 4TUYB 1Z5WA 3V3TA 2BCJQ 4MR7B 2C4KA 5K3AA 2FDCA 4B6PA 1HH4A 2C4NA 3EPPA 3RUIA 3KLMX 3RDPA 1T9BA 1WCV1 4C5AA 3Q2IA 2XCTB 1ZRHA 4JSTA 4P7FA 1EAYA 4QGAA 2GBGA 4JI2B 4L7VA 1MMFB 5G41A 4UU0A 3SJBA 4HEQA 2FFBA 1FFAA 2WRZA 5KWEA 2C1XA 1MOSA 2IYSA 2XDAA 3BMCA 1JIKA 3LBAA 1IM2A 1RP7A 1SVOA 4XJTA 4DUGD 1Z63A 4YAIA 3G7SA 4CL2A 2KQUA 3VVLA 4QUHA 3HGMA 2JI7A 2PFSA 5J5VA 1S3GA 1T29A 3T1VA 3MJEA 4F9TA 3BQ9A 1BH6A 1S2GA 3HA5A 5E9AA 2VXOA 2PSFA 3BCHA 2C0PA 3ZKWB 3FCCA 3SE7A 1BX1A 4MV0A 1TYAE 4YX9A 2WFLA 4NEQA 3DOEA 1SPBS 2VF2A 2HUPA 1XEWX 4MVJD 3U4QB 5AFSA 4YALA 1EUCB 2XE7A 1IBLB 3PUIA 5IAJA 5LZ2A 2C7BA 1JMYA 1H05A 2FN3A 2VA8A 1DG9A 1KDRA 3P0EA 4I55A 4U0JA 2JLXA 1CYDA 1PW7A 3KPVA 2E18A 1M6YA 4K6GA 4RFLA 1KMCA 4LV8B 2YNMD 2DPLA 2B8JA 3H0EA 2PRIA 2VJCA 2ZR8A 3GEHA 4HO1X 3HU3A 1ZMXA 3B6ZA 2QPTA 4W5WA 3WB0A 2HHCA 1XD8A 3MWDB 4MIOA 5KJFA 3SHVA 3T7IA 3LA8A 3RS9A 1C2YA 1JRLA 2I6FA 3SXPA 1FZTA 3WGQA 1Q15A 1VDZA 4WKCA 2XR1A 3WGYA 3BTUA 4BLQA 4DJAA 4CEHB 1U65A 3VOSA 3DA8A 2B1GA 3NBMA 3FD8A 4YRLA 1L4GA 1AUVA 1NN1A 4X61A 4DLAA 1W36D 3OPXA 1JVBA 3IVMA 3TLYA 2NU9B 5PNTA 1ZA1A 2J3QA 2HA0A 4P4GA 1E2GA 4JL6A 2FPLA 3ETLA 5CIQA 1YDFA 1JDZA 2XGSA 4IDGA 3QIVA 4PSCA 4AQ7A 2FX5A 4FFVA 4YAFA 1TW3A 4FI3C 2C8KA 4D43A 5HJ7A 3QXXA 2VDJA 2F62A 2EKBA 3EMDA 1GGVA 4FOOA 5L7YA 2XZOA 1A04A 2BGRA 2Q99A 1O58A 3DM5A 3PX2A 4NENB 2ZIZA 2RC5A 3RC7A 3DYBA 3G2PA 4R16A 5BPFA 3EIWA 1TDJA 1JT2A 1CQJB 1UP4A 2C9YA 2OILA 2OKGA 1T4DA 3D6FA 4Q3CA 5U9CA 2BE9A 3GJ8A 3D7SA 2O8FB 2O23A 4YI3A 2HC9A 4CMAA 3FTDA 3HZOA 4Z99A 1Z37A 1XTKA 2Z2ZA 3LSYA 2PRYA 3KPWA 4M8IA 5E2IA 1Q0RA 2ZIWB 4EHAA 2Y1XA 1YL7A 3HXTA 4GKBA 1TM7E 5DXFA 2XUFA 2PX8A 1WP4A 5DBFA 2RGAA 1E1YA 3OUTA 4RDCA 2P8JA 1HG0A 4YRPA 1V7QA 3Q12A 3GLFB 3KQMA 4FFNA 5CM8B 3BXEA 4TQ9A 4U63A 3RYFB 3F8WA 4NHEA 4DA0A 6Q21A 2ZSAA 4YV2A 5IJ0A 3E7PA 5K0CA 1R4AA 4QELA 4EA9A 1C5KA 4YB8A 3IR6A 1Z06A 1TVMA 4CG2A 4NMMA 5E1DA 2VNIA 3NUGA 4LXHA 1N2XA 2UYQA 4QBTA 4E3ZA 4OI4A 4KR6A 1OXBB 1NSFA 4MRVA 4C30A 5CCBA 5KBYA 4P93A 4B7ZA 5BSEA 3BRSA 3CNLA 2OO5C 2NACA 4TTPA 4DCJA 2VDWA 4Q4CA 2VXYA 1CP2A 1AIPA 4D8YA 4TXNA 3I3OA 1WXXA 1U0BB 3PXGA 3FWZA 4MGYR 3ABZA 4ZT5A 4Y1EA 4BFZA 1Z2EA 1P19A 2ENUA 1KY3A 4ZKDA 3L6CA 4IDFA 5CLFA 3VNQA 1Z2CA 5ICEA 3SN6A 1GZ3A 4FSHA 2RH5A 5F2OA 1W49A 4EX7A 1UBNA 1N6LA 2ZS8A 2P0YA 3I2FA 3SGLA 4ZEOA 5IPFA 1HE1C 1UM9A 2IPOA 3AUX