5JCJD

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 91
structure length 247
sequence length 267
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjD00
1B16A 1DRUA 2IXAA 2FR8A 3Q0EA 4J7UA 4A26A 1G0OA 3PRJA 3MTJA 4OAQA 4I5EA 3LZ6A 3VZQA 4RL6A 4YJFA 2B35A 4MDHA 4RORA 1GCOA 1GAEO 5F3RA 3NT4A 3SX2A 4E0BA 8LDHA 1VL0A 2HU2A 4RPGA 4CLEA 3E1KA 1I3LA 1OOEA 1ISJA 3JD0A 1PSDA 3GRPA 5L40A 1EZ4A 3U49A 4UUMA 3F1KA 3ZNNA 1DPGA 3JD3A 3TFOA 4ZQHA 1ZXLA 4R9RA 2ET6A 2CSUA 3I9OA 2VUTA 1UAYA 4XCVA 3F4BA 1NR1A 1ZO8A 5B12A 3GNQA 3UCXA 1W73A 2I6TA 1U3UA 2IZ1A 2YV2A 4RPHA 4IJVA 1JTVA 2FPIA 4FFMA 1DFGA 1DSSG 3AUTA 3CZMA 2PV7A 4W4TA 5CDGA 3L6EA 1N1GA 4UULA 3Q2KA 3K96A 1C14A 2DBZA 5JDIA 4CMIB 4D46A 3STHA 1BVUA 2AE1A 2JCYA 1PGPA 2OP1A 3HDHA 4FJ1A 3HJAA 5K6AC 4A5OA 1LX6A 5AXAA 3PDUA 1LRJA 3KYBA 4PLHA 1FDTA 1ZMTA 2DPHA 2X8LA 4U6QA 4ITUA 5JAZA 4CM7A 3RJ5A 2DTXA 1P3DA 3PXXA 1SBYA 2HMVA 3JCZA 5I7EA 3NJ8A 1DLIA 5COBA 2ZB3A 3GZNB 1E1MA 3GHHA 2BMAA 1NR7A 3OQBA 3PHHA 4IBOA 2AQIA 4OXKA 3U5TA 2H9IA 3FWZA 4BO8A 4RVUA 3JV7A 2UAGA 1G0NA 3PDJA 1GY8A 4IQ0A 1VL6A 4RPJA 2QX7A 2DT5A 4U6SA 3UVEA 2DUUA 1E7YA 2EJVA 2B83A 1YQGA 2AQ8A 2FN7A 4QFDA 2EWMA 3TRIA 3VDRA 2IZ0A 3U62A 4UVEA 1W0CA 4GWGA 3JQCA 4ZD6A 5A5FA 2P5UA 4FB5A 3BXXA 2GF2A 5IDWA 4O1MA 1D8AA 2X58A 4HNGA 3KETA 4HV4A 3FNFA 2AEMA 4Q3EA 2ZTMA 5F5NA 3ITDA 1PEDA 1M76A 4F6CA 3I83A 1MXHA 2I67A 1J6UA 5FYDA 4OMUA 3PHJA 2FPGA 3A28A 1VM6A 2E82A 4RQTA 3X2FA 3W4IA 3DWFA 4DLAA 2FWMX 4MP6A 3LC2O 3MJSA 5HS6A 1B2LA 1HDZA 2Y0CA 4KWHA 3EZLA 2DVMA 4D44A 1PJLA 2Y93A 4OHUA 5IDYA 5G4LA 3WGGA 2P9CA 3PJDA 3VH1A 3WSWA 3FSRA 3JQBC 2RBEA 3TPCA 3U9LA 3RUCA 4PLFA 2XPCA 4LSMA 4QX6A 4YA6A 3KSUA 3JYQA 4RVHA 2WE7A 3ZHZA 1YJ8A 4J16A 4IXWA 1PS8A 5EPOA 5B4UA 5CDYA 1N92A 2JFHA 4FPXA 1NX6A 1UH5A 2C2YA 2JD2A 3PHGA 5IFLA 5BT9A 4OM8A 4J1SA 5IZ4A 3DC2A 3KYDA 1H9BA 4XZ3A 3GNSA 3H9EO 3WWYA 2DAPA 1V0JA 1Q2XA 2FMUA 2FRDA 2O48X 4R69A 2DLDA 1V9LA 1GCUA 4UUPA 2HK9A 1N9GA 2VN8A 1W4ZA 4HUJA 4NU5A 2AXQA 3JD4A 2YDXA 4FGSA 3EY4A 3VDQA 2NNLD 1H6DA 2JCVA 5G0SA 5JAQA 4A7PA 3Q3CA 1AGNA 2AEJA 1U1IA 3GQVA 2NUAA 3R1IA 5TIIA 1EE9A 1NASA 2ZYGA 1DAOA 2VUUA 2Z1MA 3DBHB 2Q2WA 2Y1EA 1KYQA 4PLVA 4MVJF 1FMCA 3EAGA 1YDWA 2X9NA 1U4OA 2PZKA 5KJ1A 4WLFA 5AOVA 1GL3A 4CMIA 1E0DA 4LK3A 4YAKA 1B8PA 1T2CA 3COSA 1WPQA 3WMXA 3CINA 5HS4A 5KVCA 3X2EA 3U4DA 4OSOA 1NHGA 1GUYA 3FN4A 4OKNA 4ALIA 1PJ3A 3I6IA 5BR7A 1V3VA 3TSCA 3OEYA 2EW2A 3E5RA 4Z3DA 1E7SA 4EUEA 2WYVA 1QV7A 2VYND 1C1DA 4WASA 1NP3A 3GN2A 2CDAA 3NKLA 4FJ2A 2POQX 4M49A 1NVMB 4PZEA 1AXGA 2OHXA 3JQ8B 3F4LA 3GT0A 2PZJA 2FOIA 2FHSA 2AW5A 1Y8RB 2PTGA 1ZSNA 1MX3A 3D5QA 3C1AA 4ND3A 3ROQA 2ZYDA 4D7AA 1SZJG 4DMMA 1EVYA 4BNZA 3GDOA 3U4CA 4LCJA 4TQGA 1HSOA 2W2KB 3QVTA 2AQKA 3Q1LA 5JDCC 4FFLA 4OIMA 4WLVA 5DNAA 2Z5LA 1DIHA 1KC1A 2C7VA 4E21A 5A03A 1GV1A 1LXCA 2GZ3A 1UXKA 3MOIA 4JGBA 4WNIA 1EK6A 3FPLA 4GAEA 4IDAA 4E3ZA 4RVGA 1UP4A 3ZWVA 5TJ9A 3D4PA 2DKNA 4RPKA 3VPGA 4FC7A 3P2YA 4RO0A 3LLVA 2CDBA 2O50A 4XGNA 2P9GA 5C7IO 5GZ6A 3O8QA 4KDFA 3P7MA 3KB6A 1WWKA 1Q7GA 1QRRA 5A3VA 1XHLA 3HDYA 1NFRA 3CKYA 4MIYA 5I9MA 1GZ4A 4FJ0A 5KVVA 1F17A 3PI7A 2FY8A 4GGOA 2IZZA 2HMWA 1OZAA 1T2FA 1LSJA 4OOFA 3QWAA 4HFNA 3TL2A 2FZWA 4JP2A 1DRWA 4CR8A 1CQJA 1PWZA 4TZTA 1KY5A 2GDZA 4Q3DA 3L6OO 3WYBA 1ZK1A 1J5PA 1R0SA 2O7SA 2CUKA 1EEHA 2OUIA 4PRLA 1YXMA 1IE3A 1DC6A 2NTJA 1LLQA 1LDMA 2E37A 1K2WA 4D3DA 4NFYA 3WTBA 3E9NA 2PY6A 1ADBA 3MOGA 3D3EA 3ZNQA 4ALNA 2O4CA 2BFPA 4Q3CA 4Q3NA 4CV3A 5TLSA 4LMRA 3DONA 4ZJUA 1OC2A 5EQFA 4YPOA 2WJPA 1DIRA 4UUOA 3HE3A 1QLJA 2SCUA 4HBGA 2E6UX 1QYXA 3EUWA 2YQ4A 3K92A 4NH4A 5HRUA 3GVXA 1EVZA 2EKQA 2VYNA 2P2SA 2C2XA 2FP4A 2UUPA 5TNXA 3UCFA 1Y8QA 4TVBA 1OI7A 1JU9A 1VC2A 3SC4A 1I2ZA 3RC2A 1H2HA 1YVEI 1EUCA 2I9PA 2PZMA 4FIZA 3WICA 4HX5A 3DO5A 4AJJA 2UUOA 2IXBA 2J5KA 4ZHSA 1N1EA 3PTZA 3R0IA 2D2IA 2H6EA 3D5TA 2C5AA 3BMOA 3VH3A 3GMDA 1DBVO 3PJGA 4GI2A 2JL1A 3OJFA 3TZKA 3E6AA 3IKTA 3DBHA 4E2XA 1TT5B 3IP3A 3IUSA 4L74A 5TT1A 3FTNA 4CMGA 4I9UA 4H16A 4J0FA 3VPHA 3CUKA 3F9IA 3QVWA 1H6CA 3OQ6A 3P5SA 4S1VA 2Q4EA 2O3JA 4CLRA 3AY6A 1A4IA 1HKUA 4DIBA 2EGGA 4J4TA 3R3SA 5DOVA 1PGQA 5L53A 1E3WB 4BL5A 4AJ1A 5A3JA 1YB5A 2PZLA 3RUFA 1WDLA 3PIDA 3CZRA 1V3TA 3PVZA 4YR9A 2ZCUA 3AUSA 4PLGA 1KVQA 4R51A 1X7HA 3NEPX 5L45A 1G1AA 2VT3A 5U1PA 1CWUA 1X0VA 4OJNA 2DUWA 4MPDA 3DMTA 3ZDFA 1F8FA 4D42A 3KEQA 2CF5A 2BD0A 2X22A 5IDQA 4UUNA 4IGFA 2GZ2A 5DOZA 4BKOA 4E30A 3DBRB 4ZQFA 2VZ0A 3H6KA 2ILTA 4Z9XA 2OXIA 3C7CB 1X0XA 3GH3A 1I36A 2FR1A 2IDZA 3DZFA 3DHYA 3ANLA 3PFWO 4J9UE 4L8VA 2X4GA 4CQLB 3ZGYA 4LVUA 3I1JA 1C0LA 3Q9UA 1LDBA 5TSDA 5JY1A 2ZB8A 3SC6A 1ISIA 3ONFA 3C1TA 4K6CA 1P45A 5T6BA 3PQFA 2ZKLA 4YT8A 2ZB7A 3EVNA 2RH8A 3VHRA 4XYLA 1KY4A 4WEOA 1PJ2A 1IHYA 4XQGA 3V8BA 4B3IA 3GVIA 1FDWA 5G4KA 4FBGA 4P4NA 1Q7CA 3TZCA 4RQUA 5JCXA 2NU8A 3FBGA 3ZV3A 3TNLA 5BSFA 4NK4A 3WQSB 3RUIA 2PGJA 4JXKA 5COAA 5I8ZA 5CPFA 2OORA 4N5MA 3O4RA 1CERA 4EI2A 3NYWA 5LC1A 2P91A 4NBTA 2O3TA 4IMPA 3ENKA 4WLOA 3HN7A 5EIOA 4B8ZA 2VHZA 4EEXA 1WZEA 3WBFA 4WKGA 4MKXA 2Y05A 3PZRA 4CL8A 3F5QA 3UAGA 4YAJA 1L7DA 3AOEA 4YJHB 3VOSA 1ENZA 4BNYA 3WYEA 2ZB4A 3ZWOA 3WJAA 1GZ3A 2PR2A 3PHIA 4OXYA 2EP7A 2W2LD 3GPIA 2I3AA 2P68A 4UVDA 1LQTA 4GMGA 5ADHA 1PR9A 2OFPA 3JQ9A 1XR3A 2VWHA 3ZZNA 2CMDA 3FD8A 3AUUA 5JSFA 2D3TA 5L4LA 2E48A 1XGKA 1R37A 2GNAA 2NU6A 4J7XA 2Q99A 3ICPA 4XYEA 1WLYA 2Q46A 4WCFA 3C3XA 4WLNA 4MJLA 5BNIA 4YBZA 2EG9A 1GUZA 3I9KA 5T67A 3QE3A 3PLRA 3TOZA 1EFLA 2ZYAA 4NNJA 4KDEA 3AOEC 1XG5A 4ILKA 1LSUA 3DOOA 4E5NA 4E2YA 1GD1O 4CMEA 4D43A 1VL8A 1E5QA 2WD7A 5ICSA 4JJGA 1GR0A 3JQ7A 3LLSA 4WJZA 1SEPA 4GBJA 5JY6A 2QYSA 3ANMA 4YB8A 3QW2A 4NZ9A 4CMHA 1J0XO 5LDHA 3LF2A 2Q3EA 5H82A 4H7PA 1UXGA 1QP8A 5GY7A 1ZW1A 3JQDA 4BNFA 4D0RA 4EUFA 3DHEA 1ENPA 3UHAA 1AXEA 3IDSA 4KOAA 4C7JA 2AG8A 3Q11A 4I5FA 5A06A 1IPEA 2G82A 1NPTO 3FI9A 1KVUA 1UAGA 4JLWA 1RPNA 4ZRMA 4HFRA 1NQOA 2FSVA 4XR9A 1U3WA 1VPDA 3H5RA 2CFCA 1MG5A 2JHFA 2PD6A 4DBVO 3GOHA 4WEQA 4NU6A 4WLUA 3NTOA 3RJ9A 3TZHA 1DO8A 1NAHA 4A27A 3K9QO 5IZCA 3NDIA 4EJMA 1F06A 3VH2A 2IE0A 1MUUA 5CFZA 3VZSA 5IXYA 4BMVA 1FF9A 1SEVA 1BDMA 1E3WA 4NBWA 3WG9A 4O63O 4UAGA 5F1KA 3DQPA 2VTEA 2VWPA 4CV2A 3BMCB 1J4AA 3WNVA 1O0SA 4BKQA 2Q45A 3GZ4A 5DF1A 3JQAA 3ADPA 4Y8VA 3E03A 3NAQA 5CDSA 2YW9A 3GGOA 4XQ9A 4PN3A 1PS0A 1M67A 3ZWPA 3PHLA 1YGYA 4XD2A 3CXRA 4XEHA 4UVGA 4RF4A 3L9WA 3T4EA 5ITVA 1AUPA 3LT0A 1ZK4A 3GAFA 2Z1NA 1V6AA 3KM0A 3R3JA 1SCUA 4E2WA 3OJLA 3ICCA 3DEYX 1MB4A 1RWBA 3BHIA 2Q49A 4O6VA 3KO8A 2E4AA 2B4RO 7MDHA 5IJZA 3LF1A 3PFFA 1PL6A 2VQ3A 2NU7A 2A35A 3VPFA 3ZU3A 3H5NA 5ER9A 5IF3A 4CLDA 4E31A 4FCCA 2EJWA 2J6IA 5BSEA 2BELA 1PX0A 5IN4A 3H2SA 3BTOA 3W8EA 4A10A 5ICMA 3HG7A 4XJTA 5HWSA 4BO3A 4DTIA 1ZZEA 3E5MA 4R01A 4WK6A 3JQGA 4AJKA 2O7QA 4FFOA 2Q2QA 3OBBA 5BNTA 1UDBA 4QO7A 4W99A 2YJZA 3I52A 4EEZA 1QMGA 3OSUA 2WM3A 4BB6A 1WW8A 3MJEA 1DJNA 1VSUA 3AUAA 2WD7B 5JFOA 2JD0A 4WLEA 3ETEA 3NX4A 1CQIA 4WPGA 1QKIA 2DBVO 2YDYA 3E18A 3GVCA 3WLFA 4E2ZA 5F21A 5C7OO 1P9LA 4NJMA 2PGLA 4RDHA 4E33A 3U4IA 5EL0A 4Z6KA 3E9MA 4BIIA 2LDBA 3L6DA 1ULUA 1GTMA 1E1NA 2B4QA 1A5ZA 3ADOA 4IM7A 5I7VA 3D4NA 4FR5A 1LBEA 4IZIA 3ROMA 1E3LA 2V65A 1RM3A 1HDRA 4UEKA 4WOKA 4FS3A 4Y6PA 4IDGA 1Z73A 4HFJA 1ONNA 4I9HA 1PJ4A 2P5YA 2QG4A 3A1NA 3RAJA 2EGHA 3WTCA 1ZIDA 3BYZA 3N58A 3D3WB 2AQHA 3BTUA 3VH4A 1NQAO 3QWFA 2VRBA 3GGPA 4K9DA 3D64A 4LMPA 4YACA 1HSZA 5ER6A 3DTYA 5C5IA 5L7WA 2WTBA 3DHNA 2EF1A 3NT5A 1FXSA 2CDCA 1D4FA 3CH6A 5AVOA 4MKRA 5KNLA 1IY8A 1XDWA 4YJHA 2X9VA 2VHYA 3KYCB 4M87A 4ND2A 4CQLA 4J9VA 3RSHA 4CJXA 4GSKA 1MP0A 1ADFA 4CR7A 2EERA 3K6JA 5CG1A 5IAAA 1YJQA 3ZWNA 1S7CA 3I9NA 1IL0A 3G17A 4DC1A 3A14A 1JVSA 3IL2A 3EC7A 6ADHA 2E49A 2YHUA 3SJUA 2QYTA 4JNKA 3ZCXA 1E7WA 3INRA 1JKIA 3JSAA 5ILGA 4II3A 2AMFA 2IYPA 3MWDB 2HMTA 4YXFA 1DC3A 2JHGA 3HZZA 4D45A 4DQVA 4CM8A 1DHTA 3VAZA 1EQ2A 4YWJA 1N8KA 4B7CA 3PZBA 4ZQGA 4Z3KA 1SAYA 1HDGO 2VHVA 1CDOA 4IDCA 3LDHA 1K6JA 2EP5A 1B7GO 1UDCA 1R4MA 3TL3A 1XU9A 2BKAA 4R1TA 3KZVA 5DCYA 2WMDA 1TVEA 4BO6A 2V6FA 1OAAA 4PLYA 3C85A 4W6ZA 4KUHA 4JJFA 4GLOA 3B1JA 4GL4A 4MVJM 2OGUA 4Y9DA 1Q7BA 4BNHA 4M86A 4FOSA 3OA2A 4IIUA 2VHWA 3GHYA 4R16A 1U5CA 1DHRA 3D4OA 4Z9YA 1YL7A 1KVSA 4BO7A 3QJ5A 1B14A 1EUDA 1HF3A 4AL4A 4PLCA 3IAHA 2OO5A 2O3SA 5A1TA 1LC3A 3V1UA 1UXIA 4XQEA 3TZQA 3BHMA 3FHLA 1DB3A 1P44A 5EMHA 3V2GA 1MC4A 1F8GA 1IZ0A 2YFHA 5T8KA 4Y6SA 3SXPA 2B37A 3GG9A 3HB5X 3P19A 4JX8A 3ROKA 2LDXA 1YOVA 4ALJA 5AQ1A 2BRUA 5JYEA 4CM1A 4MVJA 2EXXA 1PQWA 1A9YA 4KP7A 4BV8A 5MDHA 1ML3A 4A03A 1E1LA 1H6AA 5J23A 1AE1A 4N54A 3ZN2A 4GLLA 5T8KC 5BSHA 2GASA 4GSLA 4AJ2A 1PZGA 1UZMA 5H83A 3LT2A 4W82A 3JQAB 4YRAA 3PQDA 4U8GA 4FD3A 3DZGA 4F3YA 4JBIA 5DDIP 4I1IA 3UKOA 2VNSA 1ZNQO 2J3KA 1HZZA 3IJPA 3C7DB 3JTMA 3KYDB 4L73A 5L3ZA 1Y9EA 4TRJA 5JAMA 1SB8A 4IGEA 4MO2A 1Q0LA 3INGA 4BNNA 1GZ6A 1I5RA 1EUZA 3NDJA 3ZWCA 4IJKA 4KUGA 1TI7A 4Z0PA 3UGKA 3FF4A 2B69A 5KWEA 5COQA 4PVDA 4IS2A 1CEQA 1YB4A 5KVQA 4QT0A 1YQXA 2GR9A 5CEFA 2G1UA 1TXGA 2IEDA 4TROA 4A0SA 3QP9A 2Y1CA 3WBBA 4TZKA 1T2EA 1Z6ZA 4B4OA 1R4NB 4DLLA 1HDXA 1Z74A 4ZQEA 2YHIB 4M55A 4ND5A 2X6TA 3WWZA 3RKUA 2I3GA 3FNHA 1K6XA 5CP8A 4D79A 4FOOA 2BGMA 2JFFA 3MCVA 3UCEA 1Y9AA 4AFNA 1T1RA 3H2ZA 4PLZA 1HT0A 1ZJYA 1WXDA 4B4VA 4JQCA 2AEFA 4L75A 3PWKA 4ZQBA 1IULA 2HLPA 1TLTA 4GVXA 3JYLA 5G0WA 4YJGB 4AJEA 1JKFA 2EW8A 1H5QA 1ONPA 3VZRA 2GCGA 3GN1A 5JCJD 3M2TA 3WIEA 2GO1A 4YQZA 5LDGA 1KETA 1D3AA 4OGWA 4QFCA 4MP8A 4URFA 5BQFA 2WE8A 4EBFA 4ALLA 4TVOA 1UP6A 3PWZA 1NFQA 1T1SA 4RGBA 3K5PA 1WP4A 4Q39A 4JK3A 4BO5A 1ZXBA 3ETGA 3RD5A 1LA2A 3EHEA 3F46A 4TRNA 5IG2A 4L0QA 3ZU5A 4NFSA 2JJYA 4CODB 4DQXA 1P0FA 1DC5A 4IDEA 3WFJA 2C59A 2V6GA 1YBAA 5KCZA 2ZJ1A 4IUYA 4ZRNA 2Q50A 1WMAA 1NYTA 2CVQA 2WDZA 4FQ8A 1F14A 5I8WA 1Z45A 4MVJD 1WDKA 2HMUA 5A9RA 1EFKA 1L1FA 2ZIZA 3KSZO 1N7GA 1WVGA 5ENVA 2GRAA 3PYLA 3BTVA 3SJ7A 4U5QA 1P1RA 1BRMA 5A4DA 5JDIC 2BFOA 1KIFA 3W1VA 3QHAA 1QYCA 4CM3A 3NT2A 5LCXA 1DAPA 4QECA 1U3VA 5CAEA 3K8ZA 4BVAA 3OIDA 5DCWA 5AXCA 2G5CA 1JW9B 4BV9A 4CQMB 2I99A 1EMDA 5TC4A 3QVSA 1HDOA 1NPYA 1VRWA 1U8XX 2EKLA 4U7WA 5CPBA 3WS7A 4JN6B 1Y7TA 5L9AA 1UDAA 4RLSA 4BUCA 5KOIA 1K6IA 3GAZA 3MEQA 3OP4A 2PK3A 4M8SA 1YB1A 3B1FA 4J3FA 2R00C 2VHXA 4TKLA 1R15A 4J1TA 1A27A 1R4MB 3GG2A 1KVRA 1P77A 2GUGA 2QZZA 4M1QA 1EDZA 1CIVA 4HADA 2YUTA 3BMNA 1NTOA 1FDUA 2X1HA 4NBVA 3RUHA 1A9ZA 3TDKA 3R6DA 1BHSA 2CF6A 4EZBA 1Y8QB 4L76A 4YAEA 1I8TA 3RCBA 5EN4A 5K6AA 1GUFA 1Z7BA 3HQ4O 2C07A 1X1TA 1F0YA 4MVJG 4Q3BA 4G5HA 3OIFA 3PYXA 1WMBA 4W9NA 4YVFA 3HDJA 3BTSA 1MV8A 1P1KA 3D1LA 4OO3A 3AU8A 2YZ7A 1XA0A 4PFJA 4WECA 2BHLA 5KJEA 3QIVA 3RASA 4IJWA 3WDSA 2Q2VA 4P4LA 2W2KA 1UP7A 2O3QA 2RHCA 4CLOB 2GN9A 3ZV5A 5T5QA 3FR8A 1DIGA 5A02A 1FJHA 3LYLA 1Q1NA 1R6DA 4C7KA 5L95A 1XQ6A 2YV3A 3HSKA 5CHEA 2UV8A 4ZA2A 5GZ1A 2VOEA 3G79A 2BH9A 2BI7A 3EDMA 1Z82A 1A7AA 4BNUA 5CEJA 1LJ8A 3AU9A 1D1SA 2D5AA 1GEGA 1I3KA 1Y81A 1ZEJA 4UREA 2ZQYA 3JQEA 3IUPA 5AXDA 3NRCA 3WGZA 4CMBA 2XXJA 2V6MA 4BNLA 3LVFO 3INTA 1PGNA 3UICA 3QWBA 3H9GA 4TKMA 3ZWAA 4LGVA 2PKRA 5KKAA 2DPGA 4R54A 5DT9A 5TT0A 5CG2A 3W8FA 1B8VA 3VKVA 1K3TA 2GN8A 2DBRA 2A9FA 4F45A 4FGWA 4UVIA 4CM4B 4FFNA 1LC0A 1GFSA 3VPSA 2D1YA 4R5MA 4OSPA 3I3OA 3WGIA 1IB6A 1LDNA 5EQDA 1XSEA 2VRCD 1GPDG 2CNBA 1P33A 3TF5A 4PRKA 1H93A 9LDTA 4BO0A 1E6UA 2C0CA 1ULSA 3GMSA 3TN7A 3I5MA 1C1DB 5G2OA 8ADHA 3OM9A 1LLUA 2NQTA 2R2GA 1R66A 1OC4A 4FDAA 3AY3A 2D0IA 2Y66A 1NQTA 2EHDA 3GUYA 1DJQA 4DQUA 4ESOA 5G0VA 1Y8RA 3TOXA 3ASVA 2YV1A 2VT2A 3C8MA 1O95A 3ASUA 4WCDA 1BVRA 3RIHA 1I30A 4IPTA 3SLKA 3CIFA 3DAFA 3G1TA 3D7LA 4AJHA 1P1HA 3RVDA 1XWFA 3EK2A 3MWEB 4RCVA 4GKVA 4OOEA 4J0EA 4XA8A 2I65A 2VTDA 4AJOA 3A4VA 3UOGA 2F00A 3JQBA 5C37A 2FR0A 1QYDA 4CM6A 4DA9A 5JS6A 2I5PO 3WMWA 4OQYA 4PG8A 3GK3A 4MKZA 1RYEA 2BF7A 3AM3A 5JNLA 5B4VA 1C1XB 3I9MA 3WXBA 5A9SB 4QO8A 4DYDA 3ZW9A 3S2FA 4H15A 1HDYA 2HJSA 1ZCJA 2VCYA 3LC1O 2VYVA 4NFHA 1Z75A 5KJ6A 4TSKA 5I9NA 2QHXA 4J1NA 1TT5A 3ZNPA 1NXQA 1RM4A 1LQUA 2JKVA 2RAFA 3H5AA 3EW7A 2HRBA 3F5SA 3WYCA 2IYOA 3GDGA 1JLLA 4NG5A 4TWRA 4OKIA 5DZSA 4F46A 4GVLA 1E7RA 4J43A 3WLEA 1PL8A 4IQGA 1XCBA 3ZWMA 3PIIA 3W4KA 2JFGA 2G76A 1PQPA 1GADO 4AJPA 2YHIA 5KKCA 4QTZA 5TJHA 1IOLA 1M6WA 3VTZA 4IDDA 1IUKA 3O38A 3AFMA 5G4KB 4YDRA 4AJNA 3GEGA 3QWHA 1JKJA 2WYWA 2NSDA 3HADA 3N74A 5F1OA 3V1TC 1P1JA 3ANNA 1B26A 3ZH2A 1PWXA 2Q1TA 2X0RA 3RC7A 3WGTA 1QORA 5ES3A 3PYMA 1VJ1A 2H1SA 1E3EA 2JD1A 2JAHA 2DU8A 4IQ8A 1QLHA 1HL3A 2V7PA 4LSWA 3CE6A 2Q1SA 3TQHA 4W7IA 4IIVA 4Z0TA 2VRCA 4HY3A 3I9LA 4B79A 1PZHA 1O6ZA 1K0UA 1CJCA 2J5RA 1HE5A 1E3IA 2DM6A 4L4SA 4R68A 1NHWA 3TWOA 2UVDA 3VVCA 5A05A 1HE4A 4CMKA 4ZICA 3RUDA 2D4AA 4B3HA 3RI3A 3UXYA 3FR7A 3ZU2A 1CETA 1T4BA 4EJ6A 3ENNA 2HKIA 3FPCA 2BGKA 4CM9A 4HWKA 1HYHA 3LC7O 1VLLA 1O9BA 2PKQO 3H4VA 1DEHA 1PGJA 1VKNA 2B5WA 1ZJZA 3SVTA 3GUCA 1TA4A 1IZ9A 2CY0A 2O3UA 3I6QA 4YJFB 1EVIA 4AVYA 3DBVO 3ONEA 1UUFA 4KTVE 4RDIA 3WJ7A 4CLHA 4LVCA 5F1PA 3RWBA 2XF8A 1I0ZA 3RBVA 4BHTA 3RFTA 3VVBA 5DBGA 2TMDA 3LU1A 3ZWYA 1PGOA 2G17A 5I9LA 5L51A 4CLRB 4BOYA 4CQMD 1UZNA 1UZLA 3UF0A 2HUNA 3UH1A 4DC0A 1HLDA 2ZK7A 1VJ0A 1VKOA 1XQ1A 3AI3A 3WIDA 1GQYA 1QV6A 1WZIA 2D8AA 3ZNOA 4JROA 3AW9A 2WWRA 4NIMA 4WUVA 5L4NA 1HEUA 3GFBA 3ZI0A 5CDUA 4WOJA 3IQDB 3DAPA 4IDFA 2GN4A 3U3XA 3RU9A 2NVUA 4E32A 2O2YA 1Y5MA 2EKPA 5KTKA 1EDOA 4XDYA 5TF4A 3OECA 4CL3A 4IY1A 1LSSA 1TB4A 4G2NA 1BWSA 5JXWA 3OA0A 1PR3A 1SC6A 4OYRA 3VPXA 3K31A 1E3JA 3PPIA 4J49A 3K2EA 4PVCA 4QXMA 1G6KA 2B4TO 1S6YA 5CEEA 4CUKA 3NJ4A 3KBOA 3GA0A 1B3RA 1Z7EA 4BNKA 1PL7A 4KMSA 4MVJI 2A4KA 3KLMX 1B15A 3HB4X 2W90A 1BTOA 3GEDA 1PTJA 3M2PA 1E3SA 3OEWA 3HDQA 2FPPA 1LDYA 4I5GA 4RPLA 4W9NC 4XDZA 4BNWA 1LDEA 3DMTC 4NDNE 1BXGA 3A06A 3QY9A 1PZFA 5HTOA 3JD1A 4EDFA 3RKRA 1FDSA 4J2OA 1HDCA 5H81A 2O3RA 1KEVA 2I66A 2P4QA 4UEJA 2QQ5A 4Y98A 3WGOA 3MJVA 1N5DA 1SPXA 1LI4A 1I32A 2O4UX 4W7HA 4Z0HO 3RROA 2ZCVA 4M89A 5L4SA 4MVJP 4J6FA 1YE3A 1I3NA 3GVPA 1X7DA 4ZVVA 4EITA 4B7XA 3DL2A 4MP3A 4O5OA 3DZIA 5K9ZA 1YH3A 1DRVA 1U7TA 4E5YA 2HO5A 4LW8A 1O89A 5HBRA 2X23A 3G3EA 4PGFA 1ZSYA 2I76A 1EBUA 5EERA 2UDPA 5JE8A 1JWBB 3T7CA 1I33A 2X5JO 2CVZA 3OJEA 4DPLA 3ONDA 3SEFA 2RIRA 5C3MA 7ADHA 2QW8A 1YO6A 2WSBA 4ID9A 2VZ9A 3S8MA 3IP1A 1XU7A 1W8DA 1P1IA 1PIWA 1ZMOA 1H6BA 4NI5A 3CMCO 2C5EA 3RBXA 4R3WA 3WQQA 5JDCA 3H3FA 5AXBA 6LDHA 4P38A 3TFQA 4A2CA 3ST7A 4YTEA 1DC4A 1E5LA 5HA5A 5T64A 4JIGA 4GX5A 4YYZA 1NWCA 3QWIA 3RUAA 3GC6A 2VWGA 4XR4A 5JMPA 1HYGA 3DZKA 3ZU4A 1GV0A 1QR6A 4JJIA 2WYUA 4IXTA 4CM4A 2X7HA 3H9UA 5JMWA 4GWKA 4G81A 5DBIA 1EBFA 3L77A 1GYRA 3RBZA 4CMEC 2DFDA 3KUXA 4WE3A 4E5KA 5KVSA 3GRKA 4Z9FA 2RH4A 4NR0A 3L4BA 1ENYA 4DWVA 1HTBA 1D1TA 1PJQA 1PJCA 4BKRA 4DIOA 2HJRA 1H0KA 3JD2A 2W8ZA 4R4JA 5A9SA 3G49A 5B4TA 1SOWA 4CV1A 1N7HA 2NTNA 1ORRA 3FNGA 4KUEA 3BMQA 2EIHA 2ZTVA 1RM0A 4PIVA 1X14A 1AHIA 2NVUB 1T26A 4BNXA 4J91A 1MC5A 3DTTA 4FSHA 2AHRA 2OBNA 1ENOA 2DC1A 4UVHA 1IHXA 5FWNA 2ZTLA 3WOHA 4RJTA 3I4FA 4KQWA 1FDVA 2NQ8A 1NNUA 4PLTA 2ZJ0A 4DPKA 4DRYA 1KEWA 3SBOA 1B0AA 4L4RA 3EYWA 1XLTA 2HSDA 3N7UA 4NBUA 5FF9A 1LTHR 4DIFA 5IXSA 4K26A 3C7AA 2C54A 3O03A 4WCFC 2EEZA 2W2LA 3L4BC 4YT4A 4R1UA 5GZ3A 4TMFA 4XX0A 1NBOA 4LISA 4BGVA 2PKQP 4E12A 1HRDA 4DYVA 1BXGB 1YBMA 4A73A 4KZPA 3ZWWA 3GF4A 4XIJA 2WD8A 4BNMA 3RU7A 4U0KA 1XIVA 2DBQA 2EV9A 1KERA 4YJDA 9LDBA 2PH3A 1MLDA 1N2SA 4RZIA 3H7AA 4YRBA 5BNFA 5IZCC 2Q4BA 3LQFA 3O8QB 1ZFNA 2QZ9A 3KTDA 4HKTA 3B1KA 2GERA 4S3MA 1H2BA 5GMOA 3PWSA 4DXHA 4AICA 4CV0A 1BXKA 4EGFA 3PJEA 1YQDA 5JCJA 1AHHA 1VSVA 2X5OA 3TZ6A 1GDHA 2H5LA 3CEAA 3RFXA 2HK8A 4K1LA 2IEBA 1W6UA 4ZN6A 1LLDA 2PWZA 3U0BA 2QRLA 4I08A 4RVDA 1LUAA 1GQ2A 1HXHA 1XYGA 4IJUA 5B37A 1MFZA 3OFSA 4J7CA 5ITWA 3EGOA 2DTEA 3S55A 4CR6A 3UN1A 1DIBA 4HP8A 1C3VA 2Z95A 3ON5A 5I7FA 3V2HA 1KVTA 3GY0A 1LU9A 3OMLA 4GPD1 2DFVA 2YFQA 1DFHA 4NMHA 2NTVA 4LCEA 3ROPA 2PH5A 1R0KA 5DULA 4DREA 4N18A 1ZBQA 3RQSA 5CDTA 2A94A 5HM8A 1PS9A 3UW3A 4B3JA 5JW6A 3D3WA 2G0TA 1E7MA 1E77A 3B70A 3MZ0A 4XB2A 1QXSA 4CM5A 4IZHA 1ZEMA 4JP3A 3DZBA 3ZHXA 4EJ0A 5DCUA 2FSSA 4FFPA 5TS3A 1H9AA 4GKBA 4HXYA 4RF5A 2WEKA 3U4HA 4CUZA 1VI2A 3DFUA 3VTFA 4PG6A 2O2SA 5JAIA 4CM8B 2NVBA 2AE2A 2OMEA 3FNEA 1U5AA 4I8XA 3W6ZA 3WB9A 2W98A 4K6FA 4J1QA 3T7EA 4U0JA 1YKFA 3JQ6A 1YL5A 3C24A 3CTMA 4R5HA 1ZK2A 5JBIA 1E6EA 1U3TA 3DB2A 3C1OA 4HFMA 4NJOA 4CPDA 1JQBA 4F6LA 2BGLA 2P4HX 3HN2A 3OIGA 1I2CA 1NWHA 2QIOA 3V2UA 5ILOA 1BW9A 4GMFA 3O26A 1NPDA 5FI5A 2OZPA 5KJCA 1OBFO 1UXJA 4XB1A 2C82A 3GEMA 2Y67A 3L0DA 2ZQZA 2PD3A 4BB5A 2P9EA 5THKA 3L07A 3E9QA 1U2DA 1CRWG 1ISHA 3DOJA 1LRLA 2PLAA 1UR5A 3AK4A 3P2OA 4BKPA 5DBFA 4E5PA 1BG6A 3K30A 2PNFA 3QLJA 4G65A 5TQVA 4BKUA 1O94A 4JBHA 3TJRA 1ARZA 3D0OA 4Q3AA 3GDFA 3MTGA 3WGQA 1KBZA 3NGLA 1U8FO 4R1SA 5DP2A 1P74A 1Y1PA 4YT5A 3BMOB 3DR3A 3KRTA 4P8RA 3AI2A 1HETA 3OICA 4DL9A 2D59A 3AOGA 3E82A 1Q0QA 2X9GA 1D7OA 3K73O 1PQUA 3ZHYA 4C4OA 1ISMA 3ZWXA 3PGXA 1LEHA 4TRRA 3KLPX 4TRMA 1T2AA 2PD4A 3PJFA 3MJTA 1GU7A 4QEDA 4D41A 4BNTA 1ONOA 2CZCA 2OL4A 5TRTA 3DMYA 1ADGA 2HRZA 4ROSA 4AG3A 4Q9NA 3DXFA 4BS9A 1JDJA 1U28A 4J2HA 1JAYA 4BO4A 2J3JA 2HDHA 4GX0A 3GR6A 3BMQB 4XYBA 1AN9A 5FEUA 5MGBA 1HZJA 1I2BA 1K5HA 4UEOA 3RC9A 1M75A 3PP8A 3IC5A 1JVBA 5JC8A 1HYEA 3NV9A 4E5MA 1YDEA 1E92A 3RFVA 4BNVA 1QSGA 4XYMA 2X86A 4GX1A 4E6PA 3JQFA 1SB9A 2HMSA 2GGSA 3ZV4A 5A04A 5I7SA 1DFIA 3BHJA 2VZ8A 4OQZA 3DBLA 1DIAA 3G0OA 1IPFA 2GPTA 1ISGA 4FFRA 1R4NA 3JQFC 4J90A 3KXDA 3FWNA 3MJ4A 1T25A 5A9TA 3AFNA 4BMNA 1I10A 4BGEA 2YQ5A 3BMNB 3NGXA 4XQCA 1MA0A 1YOVB 3G1UA 5THQA 2YYYA 3JQ7B 4AJ4A 1VE9A 1NVGA 1VJTA 1OMOA 1LDGA 2NU9A 3AWDA 3WNQA 4YJGA 4YCAA 2X0NA 2UYYA 2J8ZA 1YRLA 1I3MA 3WSVA 2W4QA 1A72A 1PZEA 4MVJH 1F12A 4CUJA 3OETA 3PK0A 4IINA 2X0IA 1A71A 2C20A 1TEHA 4B8WA 1A7KA 2GD1O 3DDNA 1KEUA 3DZJA 1QG6A 5IN5A 2Y0EA 2XAAA 4FC6A 4WCFB 4D3FA 4BO1A 1K89A 3W4JA 1NFFA 4II2A 5EINA 4D0SA 1C0PA 4EYEA 2RCYA 3FCOA 4OL9A 3AI1A 2CD9A 3B20A 3IJRA 3LSYA 3WR5A 3GGGA 1MXFA 1E6WA 4MOWA 1E1KA 3AY7A 1EVJA 3DZHA 4L4XA 4E4YA 2F1KA 2R00A 2QRKA 4CM9D 2JAPA 3OH8A 4LRTB 1JAXA 3O9ZA 2GYYA 3CPSA 3JYNA 4P4GA 4XJSA 1LLCA 4B4UA 4YEDA 4PG5A 3LT1A 3QQPA 2NV6A 4ONEA 2NVWA 3EVTA 1EK5A 4OH1A 3H3JA 2R6JA 1ZK0A 1GYQA 4RF2A 3B6ZA 2GN6A 4NBRA 2BI8A 2XOXA 1I01A 3QVXA 4R9SA 1MFPA 1ZK3A 3BMCA 1T2DA 3DBRA 1UJMA 3S2IA 1R12A 3EZYA 1SMKA 4P22A 1KEPA 1O5IA 1RKXA 4ND4A 2Y1FA 2IODA 1BMDA 4PZDA 4ZU3A 4CQMA 4XYGA 2HAEA 1I24A 1YL6A 4PCVA 4PLPA 3S2GA 4KQXA 1M6HA 1QYVA 2AA3A 4CMAA 3HHPA 4IMRA 1J49A 3ABIA 3I9JA 1ZKMA 4RZHA 1ZSVA 2A92A 3HUDA 4RLHA 3U09A 2Y1GA 4R41A 1SOVA 4RVSA 3ITKA 5TX7A 1RYDA 4EW6A 4XWYA 1GEEA 4E13A 4RF3A 3JQ9C 4IDBA 3RC1A 4XGKA 2GLXA 3ULKA 4AJLA 3FBTA 2AG5A 1C0IA 2XXBA 2D5CA 5EESA 1EE2A 5K0ZA 2NLOA 3F47A 2H63A 3GZNA 3HNPA 1BDBA 4K28A 1O8CA 2J5QA 2NM0A 1NM5A 3H65A 4RV9A 4ALKA 5JLAA 2HQ1A 5FI3A 2NWQA 4X54A 4BQRA 1YWGO 3IIEA 3HFSA 1GYPA 3AJRA 1YS4A 1CYDA 1M66A 4CMCA 4CLOA 2J3HA 2RHRA 3I4CA 4GQAA 4BQPA 4LRSB 1Q0HA 1BSVA 1L7EA 4MVJE 3RUEA 5KJFA 3H9QA 4NQZA 2NADA 4H3VA 3OJOA 3CSDA 1V8BA 5DP1A 4GX2A 1YBVA 4Y6RA 2Y1OA 3HWRA 3V5NA 3BAZA 1YONA 5JO0A 2GSDA 4AJIA 4ALMA 1CF2O 3QV1A 4NHEA 5A5EA 4YAIA 3QA9A 4BMSA 3Q2IA 3HFGA 3NTQA 5F5LA 3M1AA 2B36A 1Y5RA 3OF2A 2Q1UA 1BW9B 2VWQA 3GVHA 4NJMB 3W8DA 3GNTA 3DAGA 3IS3A 1NQ5A 1HE3A 1ZUD1 2VYVD 3JYPA 4BO2A 2OOSA 4Y67A 4EUHA 4BGIA 3AM5A 4R1NA 4ZGWA 1B3BA 3VZPA 3S1LA 1P31A 1ADCA 1X13A 4GH5A 2JCXA 4BNJA 2V6BA 4I9NA 1PJBA 3WGYA 1DOHA 2HK7A 3KOUA 3QVOA 3IKVA 1U4SA 2VOJA 5B1YA 3DFZA 3JQGB 4DBZA 3DBLB 4M54A 2BFMA 1RJWA 3LK7A 3OHSX 4KWIA 3F1LA 4BO9A 1JWAB 4QQRA 2PFGA 5JPIA 1C1XA 1ZH8A 4HNHA 4O59O 2X0JA 4R3NA 3M1LA 1ISFA 5L7TA 2B0JA 3QSGA 4WNCA 3ZV6A 1N9GB 3FRJA 2HCTA 4ND1A 4J4BA 5KIAA 3UFXA 4CLXA 2Y1DA 3GFGA 1JA9A 4PG7A 3M6IA 3GLQA 3IMFA 1RM5A 2C29D 1ZVMA 2OP0A 1MGOA 4XRRA 1NAIA 4YAGA 3WGHA 4CMJA 4DLBA 5T57A 1LSOA 3CMMA 1HWYA 1V35A 3KHUA 5BSGA 1U2GA 1H94A 1PJSA 2Y99A 3DOCA 3H9JA 2Y0DA 4YRDA 3NTRA 2QRJA 3ZWBA 1WNTA 1V3UA 4KTTE 1R0LA 5JYDA 1KS9A 5EJ2A 1M2WA 1LNQA 4XRGA 3E48A 4DGSA 3Q9NA 1SNYA 1XKQA 3ETDA 1FK8A 2O23A 1XELA 1JN0A 1MG0A 1KOLA 4DPMA 5JC1A 2VUSA 2YY7A 1GQQA 2C7GA 4J4HA 3SLGA 2NACA 1BXZA 3H8VA 3MJCA 4FW8A 3Q6IA 5IDXA 3NUGA 1A4UA 3L4SO 1T24A 1U9JA 1T4DA 3E8XA 3W6UA 1R16A 1UXHA 5G0TA 4O0LA 5U9CA 1SO8A 4QSMA 3GPDG 5JO9A 3T4XA 5TGDA 4B4WA 3FTPA 3JQAD 4N5NA 4XGIA 1NVTA 3VC7A 1WDMA 1WAMA 2PA3A 1HE2A 4LN1A 4BNIA 4BNGA 3ORFA 4MINA 3ZW8A 5C7LO 2DTDA 1EQUA 3A9WA 5AYVA 1Y6JA 3KYCA 2PGDA 4WGGA 1BGVA 4N7RA 4XKJA 1PU2A 3I23A 1E7QA 1X1EA 3K2BA 4RVFA 3KSDO 3OQ1A 2Q1WA 5L7YA 3BIOA 5FFFA 1OFGA 1P1FA 2FZEA 3IOYA 1DXYA 4L9RA 3BZUA 5G0UA 3ZHBA 2Y68A 3WX0A 2DQ4A 3JQ8A 3UUWA 4D3SA 1XEAA 2BLLA 3PGJA 1KC3A 4JCOA 4OXNA 3PQEA 4FN4A 1B8UA 1X7GA 1LRKA 3V1YA 4DMLA 4IS3A 3PEFA 3KVOA 4I5DA 1ID1A 1HLPA 1PJTA 3AM4A 1QYWA 2IRWA 2TMGA 3NDRA 3PLNA 2CVOA 1TT7A 3JYOA 4YQYA 3WFIA 3KEOA 3QRWA 4DVJA 1IYZA 3F6YA 5U4QA 4YT2A 1DDOA 1DLJA 3L9XA 4PZCA 1GPJA 1X15A 1C0KA 4JBGA 2VNAA 2BFAA 3EMKA 2GZ1A 3F3SA 3WQRA 2OBYA 4GGPA 1U7HA 3KV3O 1P0CA 4MIEA 5ENDA 3VKUA 4NPCA 4XIYA 4NK5A 4INAA 2ZATA 4PLWA 4QUKA 2ZTUA 3BA1A 2J3IA 4BGUA 4PG4A 4B7UA 2B5VA 4DUPA 4N5LA 3LT4A 3OJ0A 5DN9A 3S2EA 4MIOA 2X5KO
chains in the Genus database with same CATH superfamily
5AI0A 2QI9C 1SVWA 3Q0EA 3UO8B 4A26A 1ZUNB 4QNNA 1G0OA 4KQHA 5CVJA 4BLVA 2N1BA 3QUBA 4EZEA 4I1PA 4I5EA 1YJ5A 4LC9A 3JVUA 1KARA 3KEGA 3LZ6A 1K7CA 3FH0A 4KXMA 4MDHA 1PV4A 5F3RA 1UBTS 5I3ZA 2WILA 1Z2DA 3NT4A 3SX2A 8LDHA 2V0NA 1VL0A 2NZ8A 2WAAA 4L4UA 3V3TA 3EBOA 3E1KA 3F7OA 4HZUB 4RY0A 3WLPA 2IIBA 4TTPA 4ETIA 4PYNA 1ISJA 1XZGA 3EQ8A 4LHSA 3AJ8A 3GRPA 1N8SA 3AEQB 4BPRA 3TLGB 5FD8A 4KSBA 1FNDA 1JDTA 3W5BA 4TQ9A 3F1KA 1DPGA 3HA2A 5I51A 2HQSA 2A9PA 1IZYA 1A2KC 3HGTA 2VUTA 1E4VA 4F71A 3ER8A 2WTAA 1E66A 4XCVA 2Q28A 3F4BA 1JIJA 2Y71A 2EOAA 3HR7A 1LY1A 3GNQA 1S2DA 2ATIA 2CLLB 2I6TA 2XR1A 4G1UC 2A1UB 4RPHA 1QWOA 1JTVA 1KZ7B 1TJPB 3KJNA 3QFTA 4IJVA 3GQBA 1V1MB 4ZPXA 1XD9A 4UDYX 4J3NA 1DSSG 3SEQA 2CXPA 2W0MA 2VSQA 1ZN7A 2PV7A 3UMFA 4W4TA 1ATIA 1YT5A 2J08A 3OG9A 2C1EA 1K66A 5CYOA 4BWGA 1FUYB 3K96A 1UBFA 4UHBA 1E94E 5F4BA 5FX2A 5JBQA 2HLNA 3AR5A 3MTEA 3TJMA 1ZI6A 3T06B 4AYWA 4B3FX 1IY1A 1FMJA 4CMIB 1J8FA 1OYOA 2PRSA 4FGJA 2V7WA 5D7NA 5J1TB 3F67A 1L4MA 3AI7A 4WOCA 3UG6A 1O94D 4G0WA 1IK6A 1C41A 2OP1A 4DJEC 4FJ1A 3HJAA 1NR5A 1DKRA 2EQAA 1M5TA 1Z9BA 4A6PA 1YJBA 5KQLA 4ITRC 3V3KA 5THXA 4BJ3A 1LRJA 4DLVA 2QOEA 3KYBA 4PLHA 3OD1A 3SD7A 1X2BA 2X8LA 1VE5A 3D59A 4N5HX 4UHCA 3ULKA 4CM7A 3PNBA 2DTXA 1P3DA 3D02A 5K09A 4RANA 5JXJA 5C8YA 2HMVA 4CI9A 5I7EA 4PY2A 1XHFA 2ZB3A 1E3QA 1E1MA 1HG1A 1A9TA 3C3CA 3PDIA 4JDPA 4LY9A 4J0IA 3WWDA 3U5TA 4CXMA 3SIXA 2H9IA 2O1XA 5E7QA 1IXSB 1FSFA 5IHPA 4RVUA 3JV7A 2O20A 1A8HA 2AV6A 3PDJA 2O7VA 4KL8S 4RHTA 1U9YA 1VG8A 1QK3A 3OZXA 2QX7A 2IYNA 3I3SR 3TDNA 3GEIA 5E3IA 4X45A 5CXXA 1E7YA 5P8WA 2EJVA 4MYRA 2EWMA 3VDRA 4DNPA 4EY5A 2IZ0A 6GPBA 2XBMA 1W0KD 4ZALA 4ZD6A 3CO0S 1UOQA 1RWPA 1U2DC 5IDWA 4N3NA 1JXMA 2X1LA 3S27A 2M6RA 1Z68A 1D8AA 4HNGA 3SYLA 3X1JA 1L7BA 5HJ5A 4HV4A 1UPUA 1QO9A 1SC4A 2AEMA 3FNFA 4HGQA 5F5NA 1PEDA 1QO7A 3IDZA 4YMIA 5H3LA 3CPHA 3CNOA 5EHGA 1DAFA 1MXHA 2AFIE 3AETB 5IKMA 3TUJC 2HNBA 2H51A 4JLDA 2G25A 2CJFA 3R0QA 3MGAA 3PHJA 3RNOA 3EZ2A 2E3JA 2ZJBA 3HU2A 1L7QA 2XWBF 4XM2A 2QENA 5TMPA 1EG7A 3A6LA 3BHNA 4LF7B 1P0MA 1OILA 3H83A 4A5SA 2FWMX 1U02A 4MP6A 4F3NA 4K2AA 3KT0A 1Y9DA 3MJSA 3OX3A 3O2JA 3BXHA 3P9KA 3W3AA 4RA9A 4UXJA 5AK6A 1SXJD 2GAOA 4KWHA 4MICA 4DIMA 4XASA 5CFNA 3ZCVA 5K05A 1PJLA 1O0CA 4OHUA 1R4ZA 1QO0D 4MW1A 3W2FA 3W6PA 4Z54A 5CFMA 1EWKA 2P9CA 4ENRA 1TEXA 5EZ6B 1V5WA 3JQBC 3TRHA 3U9LA 5KX5A 3B7PA 1GG5A 4PLFA 4K87A 3PD0A 1PEYA 5TQ0B 3USZA 3BSYA 3LSTA 4BEBA 5SZJA 4G25A 3BN3A 5BYJA 3G2NA 1ZR2A 4UNQA 5B4UA 3CX4A 3PDWA 2C2YA 1T8WA 4RGQA 4E15A 5BT9A 1GZVA 5JFTA 2GYVA 4OM8A 2QJOA 4UU7A 2X8AA 5IZ4A 1N9KA 3DFIA 2WIJA 3ORQA 3H9EO 1V0JA 2CMFA 4HZUA 1GSOA 1TCAA 4R69A 3WDMA 3AM1A 4MAAA 1CX9B 4UNNA 4OM7A 5JDCA 4JI2B 1P73A 4N3AA 1NDHA 4Q47A 4YDQA 1W4ZA 5GM2A 5AWFC 1DWQA 4G5RA 3HCFA 2XRYA 2YDXA 4V2UA 5I4KA 4G0OA 3QOXA 4P3PA 2W42A 1L5OA 4CI0B 1AGNA 5ADUS 2XXAA 3GQVA 1EE9A 1NASA 2QN6A 2QTNA 5I9SA 3W77A 2YRWA 4EA6A 4YLYA 4ZVPA 4BQSA 5K2OA 1TUGA 2QSYA 1E2PA 1FP2A 4KPYA 1XXHA 2OHGA 4GXRA 4BFSA 3L4EA 5JVDB 4YV0A 2QTHA 3DEIA 1FMCA 1QANA 4AROA 3HVRA 2X9NA 3CG0A 3TUIC 4TV9F 4CMIA 1XYYA 5BQOA 3R7SA 2VP6A 1E0DA 4LK3A 1NZDA 3I0MA 1FUKA 1PLJA 1SFRA 2XUDA 1F5SA 1XBTA 3PT5A 3IKMB 4Q7EA 1WABA 2YR0A 3HYRA 2KX7A 2BEUA 3LFTA 3V8NA 1WD7A 4C0WA 5HS4A 3G2KA 4AMBA 3X2EA 3FHTA 3U4DA 1CY1A 4YXWA 1FA9A 2C3OA 4YAOA 3CJTA 2ODWA 3FN4A 1UZAA 3SKVA 4DQKA 3P8ZA 1N7JA 5KC9A 2QRPA 2IXTA 5IHXA 1ZH6A 3DPUA 2EW2A 5LB4A 4DS3A 3E5RA 5EUBA 1E69A 4P7BA 4KYUA 4KIUA 3E9DA 3D1JA 3HK2A 1RWQA 4NNOA 1QV7A 1ESEA 1NUUA 2VYND 2JH8A 1NP3A 1XTQA 4WASA 3ZKAA 3O82A 1P4AA 3NKLA 4XXHA 2D7DA 4CHGA 2QUAA 4CRWB 4LOKA 3ESBA 3GT0A 5IJXA 1OUMA 2AW5A 2XE4A 1CUSA 1EXDA 2JHAA 2VHQA 1WEHA 4IIHA 5FPTA 2Z9BA 3D5QA 3QU2A 5IYZF 5JV5A 2A5JA 4YONB 1SKUA 3T7TA 1EVYA 4DMMA 2GFQA 3HO8A 1W88B 1XZPA 3Q0IA 4LCJA 4O2BF 2ODPA 4TQGA 5EMNA 1HSOA 3DS8A 2OLEA 5ECWA 1DUSA 2LRHA 1FLNA 5JDCC 4WLVA 1XRPA 1T3TA 4W1PA 2P7IA 5AM1A 4AZVA 1KC1A 2C7VA 2QL7A 2CLSA 2WB2A 2F3SA 3ZH9B 1LXCA 1T9CA 2GZ3A 3MOIA 4JGBA 4WNIA 1T5IA 2AMLA 1OY1A 3DE1X 1TZMA 1J22A 1QAMA 3B38A 3CNEA 2Q5IA 3K0KA 4FE4A 3KELA 2F48A 4RVGA 3ZWVA 3B48A 3A9CA 4N12A 5DTIA 1J0CA 2J87A 3FPSA 1M6VA 3VPGA 4CKZA 3P2YA 5AVYA 4JL6A 4RO0A 1JQEA 2REXB 3C2QA 2EJBA 5E9JA 3L7AA 2SECE 2P9GA 3H1GA 5FO1A 5FOSA 5GZ6A 3GJ7A 3GLHB 4R7GA 3BKWA 1H0SA 1WWKA 1QZXA 3SXUA 4C3VA 2JFVA 1O58A 1XHLA 2QAGB 2QTRA 2VJAA 2ASVA 1EX6A 1ST2A 2MSDB 3CKYA 4NF2A 4EW3A 1QHYA 1G2PA 4RA6A 4YCJA 5UKDA 1U98A 5KVVA 3OT4A 1F17A 3H04A 3PI7A 4ZJZA 5A2GA 4LFCB 1EK1A 3MT8A 4YPFA 1KZGB 1BCSA 2IOFK 1LSJA 4U9HS 4D9KA 4EVQA 2ERCA 3EIHA 4JP2A 3WLNA 1K68A 1JXAA 4QKQA 1SVIA 3RG8A 3VZDA 2P62A 1GAQA 1YHNA 5IBQA 1VFPA 1N0IA 1Z35A 3PDCA 2X7XA 2H57A 1RAIA 1QPGA 1GNPA 2ONYA 4I50F 4EG7A 1G8FA 3COVA 2FR8C 1KYVA 2GDZA 4U1RA 3FLBA 3VR6D 1NLMA 4C4RA 5HNKA 4GM0A 1VLHA 2ETXA 4GOND 3R5JA 4PC1A 3H13A 4PX3A 2C95A 1SG6A 3UJBA 1J5PA 2FOXA 4IILA 2CUKA 1OPRA 1GDDA 4HH3C 1E9FA 4PRLA 2GBFA 4MWBA 2GFHA 1KMHB 5TGTA 2O2GA 4ASUD 3UAXA 3SG0A 5AKJA 1BGWA 1JLSA 5FAXA 2Z5GA 1A5BB 3A7EA 2V3WA 3R7WA 2CYAA 4Y3UA 4ZT3A 4FFDA 4ODIA 4D3DA 2A0YA 2Q2OA 3DOFA 1KNXA 2FPIB 1P4JA 2WHRA 3HZRA 3MOGA 1RZRD 5DNDA 3D3EA 4BLQA 4E4TA 3WYFA 3FDZA 1ZH4A 4UCWA 4CV3A 2CFOA 2IZ6A 4AQ7A 5DBEX 4ON9A 8ABPA 1M2NA 4LNAA 1EG2A 4YPOA 1Y4ZA 4GP9A 3OF5A 4UUOA 4AMGA 5DHQA 1RLTA 5HRUA 1HT1E 3L1HA 1I7SB 2O8EB 1XQ9A 3VO9A 3BD9A 5KSZA 1X42A 1SVKA 2AVDA 2CXOA 3NAMA 2C2XA 1L5KA 1QC5A 1PE0A 2G71A 2P9JA 4WK4B 3HA3A 1Y8QA 4TVBA 3EEBA 4RU1A 5TNXA 2CXHA 1OI7A 2WJZB 3O4GA 3R4VA 3VDMA 3MTBA 2ZUFA 3TBHA 1I2ZA 4UM9D 2IITA 1RAAA 4M8LA 3T34A 1RHRA 1G8GA 3TK1A 1EUCA 5ITWA 4F11A 4DDHA 3FSGD 2J5KA 3FFXA 3T3HA 4KR3A 1N1EA 1RHUA 2CMGA 2ZR9A 1OBHA 1W46A 1ZOLA 2R1VA 2O2IA 3A6HA 3R0IA 5IFKA 1HYBA 5ITZA 1VPEA 5B1DA 1A04A 2BYTA 2GXAA 2OC9A 1A95A 3LLUA 5CDGA 2ZJOA 3TZKA 4U9IS 2AT1A 4ZYZA 1K7EB 3CKKA 3IKTA 4NWIA 2XYGA 3DBHA 3IIKA 1XD2B 3UQYS 3KOMA 1H3NA 4QGHA 3LQRA 1X1CA 4IEIA 1E0KA 3OHMA 3FFTA 3Q3JB 4L0CA 5DGXA 3RS9A 4L74A 4A82A 2YOHA 2MSLA 2DUNA 3U3MA 3VPHA 4KQFA 2O3JA 4RNDB 4TLBA 2HNKA 2PZGA 1HKUA 4PC6A 2OFFA 2ZI5A 1M1XB 1GPWB 2EGGA 1ZVVA 2IGBA 1RJFA 4JLUA 2X5NA 4YP1A 5K0LA 4EG1A 3TXAA 2O8CA 2WJIA 1YB5A 1G291 1HI9A 4Q9AA 5K1ZA 3RUFA 3TPZA 3P2JA 3PIDA 3PVZA 2XJ9A 1QF6A 2HHAA 5DGTA 2VJOA 1NXWA 2HTFA 3FHJA 4EFDA 1JKXA 2VKQA 3NEPX 5U1PA 1CWUA 3N0RA 3KHKA 4OJNA 4FILA 3DF7A 1W0JD 3FUWA 3ESAA 2IIVA 4N65A 3ZDFA 2O8FA 1F8FA 1ODLA 1GA1A 1IB0A 1KH1A 2BD0A 3BCSA 3GOQA 4MB0A 2PMCA 4UJ5A 2XADA 2ST1A 5DOZA 3OLZA 4L5AA 4E30A 1L9XA 3EIQA 2PMBA 4NCIA 4K88A 3QMWA 2ZSAA 1X0XA 4EJSA 2FR1A 2QQEA 5AW0A 1U0HC 1REQB 1D03A 3A25A 1JLMA 3CB2A 3M70A 3QUQA 4KPUA 1FU4A 3PFWO 3D0QA 4J9UE 2H7VA 4L8VA 4CQLB 2A58A 3NBYC 4KR6A 5HIIA 1VA4A 4LVUA 1N2IA 5E3HA 1JB1A 2VYQA 1C0LA 3ET4A 3Q9UA 3T1HB 1LDBA 2C77A 2E4WA 4B81A 3C1TA 3U1VA 3IEVA 3ZVLA 1STOA 2C5LA 3LPLA 4XYLA 4OFXA 2D5LA 2L2QA 4XQGA 1PJ2A 1IHYA 3MINB 4KEAA 3V8BA 4YUWA 1FDWA 4UE6A 3VKHA 3TSWA 2HNAA 2PO5A 3FYTA 5F78A 4RQUA 1YD7A 4XCQA 1ZX1A 1SC1A 1GGKA 5I01A 5BSFA 3GB9A 1YR6A 4M0UA 4F5DA 1N75A 1QUFA 1PYGA 1Y7IA 3KUUA 3IUYA 3B82A 4XWOA 4BX0A 1SU8A 4N5MA 3W06A 2RH5A 4EI2A 2XSZA 4B0PA 1MBZA 2O3TA 2LGJA 1GPAA 5GONF 3DXYA 1YI8A 3HN7A 2XVAA 3QUTA 3ZJ4A 2PR7A 1U0FA 3WBFA 2G7MC 2Y05A 3PZRA 4CL8A 5LL6P 3UAGA 1OWNA 4OP1A 4DJDC 2GM3A 2ZI4A 4YAJA 1L7DA 4KREA 5A3RA 4C04A 1CKEA 1GZHB 5LQMA 4AIRA 1L5RA 5LXTB 2UYGA 3CVOA 3FUXA 1P7PA 3KBBA 4GYKA 1ECPA 2QVXX 4Q9JA 3SZRA 3WLHA 3ZHCA 5A4JA 4JI4B 3ED5A 2JAQA 1GZ3A 3M3HA 1Y82A 3P9RA 2EP7A 3OZDA 1NIPA 4GC9A 1K4YA 1J7JA 1E8DA 2I3AA 5LB2A 1LQTA 3UAZA 4EGJA 2NXWA 3FDIA 2B30A 5ERYA 4I46A 1L5YA 1PR9A 3UYLA 3HS3A 3B8HA 3DULA 1XR3A 1Z47A 4GZLA 4MNTA 2KMLA 4Q02A 2IU3A 1Y4UA 2E48A 1OWPA 2OCIA 3M83A 2X77A 1R37A 3VKGA 2GNAA 5LYJF 4JXXA 1ML4A 1U3FA 3JSXA 5C80A 4J7XA 2PJRA 1H4VB 4PV7A 1YFKA 4XYEA 5LNK6 4RGYA 4YC7A 5JNTA 4FXOA 1RRGA 1GRQA 3B9RA 4ARUA 5T67A 3QE3A 3G0BA 3PLRA 1IHUA 2ORWA 3MYRA 1Q92A 4FCTA 5F9FA 4G4GA 1FYWA 2B9EA 1ZWKA 2WVJA 3AOEC 2G4CA 3TLBA 1L5WA 1C3LA 1M2HA 1GGVA 3UHJA 4NYIR 4PNHA 1J2JA 2PSFA 3N2KB 1QRDA 2WD7A 4D98A 4CKCA 2NZJA 2R7LA 2Z57A 4HVTA 3IVAA 4M38A 4KR7A 3JWPA 4JJGA 3A31A 3L06A 3JQQA 2A3RA 1D6SA 1R64A 2DHQA 3JQ7A 5DTRA 3UMVA 2CUTA 3MT0A 5BQ5A 2YMPA 2P9FA 4D6YA 5B5SA 3QW2A 4CMHA 1FYEA 1A1SA 3T8YA 5LDHA 3PKZA 4PC7A 3GFPA 2UZAA 1PYDA 4UBNA 5H82A 4H7PA 5C18A 1UXGA 1A8IA 2BOVA 2ZRBA 3PPVA 1HG0A 3JQDA 4UHDA 3RTCA 4TLAA 2AK3A 1QOZA 1G20A 4PTYA 3TR5A 1ENPA 4YCLA 4OK6A 4UW9A 3IDSA 3UAOA 5CCXA 4GS5A 4P4SA 2I3BA 3ISVA 2Y77A 3FI9A 4MW5A 1LWNA 3RRFA 4K6KA 4WNYA 3VR4A 3OM8A 1C0EA 3ORSA 1NQOA 2ACWA 2FSVA 4GYYA 4LDPA 1U3WA 3PNMA 4TV9A 4BJ6A 4C7OB 3AFOA 1B6SA 2VPPA 3M6MD 4MW9A 3E22B 4IWYA 4DBVO 1WCWA 1NSYA 4WKCA 4WEQA 2UZ1A 4WLUA 3WLTA 2WMNB 3RJ9A 1NAHA 3K9QO 4BC1A 1Q12A 1FJ2A 2AD1A 5K8TA 4TT8A 4M9ZA 4QD3A 5CX4A 3GV0A 5AM4A 1L7RA 4LYJA 2ODTX 3G0HA 1FYXA 3UAYA 1FF9A 1SEVA 1QB8A 1BDMA 1E3WA 3BVPA 4WN9B 1TVKB 1N1MA 1GHTA 1VE7A 2ZSJA 5K3FB 4TTAA 3CJRA 1Z5PA 1EFPA 1FRVA 4HDSB 3NTLA 4GMHA 4CV2A 1J4AA 2JLBA 2Y8EA 2QLMA 1O0SA 2C4NA 3G8YA 3P4YA 4GG1A 5F7JA 3GMTA 4F21A 1Z5UA 2NU8B 1JKMA 1TA0A 2YW9A 4OGLA 1L5SA 2ZI6A 3OMXA 5CX1A 3WKBA 1IFXA 4DV4B 4NAUA 1H2ZA 1UWVA 1K3UB 1CR0A 2BEWB 2BFBB 4JYBA 1L7PA 2E9SA 5J4VA 4P83A 5ECYA 1XWIA 3N87A 4V0OA 4UVGA 2CN1A 2F1RA 3NATA 4RF4A 4XEHA 3SZ3A 3LT0A 3QPCA 6ABPA 4LDZA 1ZK4A 3GAFA 2J9XB 1V6AA 3LHFA 1F0NA 2AWOA 4S1WA 2BSQA 4FYJA 3LFUA 1A9XB 3MTQA 4DQLA 3GRYA 1RWBA 3RANA 3U7JA 3P2MA 3QYAA 1PSZA 4O2BB 7MDHA 2ZBGA 3LF1A 3R5TA 5IJZA 3PFFA 4EECA 2PXHA 1IU9A 3BE6A 4O25A 5EJ5A 2VQ3A 3CY6A 4HAWA 4KIWA 3VPFA 5IVHA 4OBBA 4PGMA 1V5GA 2GAJA 4EJFA 3SDSA 5IF3A 2QGNA 4GKKB 4MUHA 4KFCA 2ZI3A 1EESA 2EJWA 4NYJQ 5BSEA 4MV0A 4QDOA 5HF9A 3RRJA 1XP8A 5M04A 3KOZA 4L6IA 5TQ2A 4GMKA 2Q6IA 4FDTA 2JH3A 2EX1A 5AKGA 3HG7A 3UWDA 3EFEA 4EATA 1OXSC 1WXHA 1ZZEA 3E5MA 4AN1A 1XVVA 3KLNA 4EG6A 4AKGA 4ZCLA 2X8JB 3B3JA 3CS3A 5JH7F 1UKVY 1M34B 3MSCA 2ZANA 3T3EA 1GP2A 2Q2QA 3THWB 3GJRA 3QEKA 4A8JC 2UUCB 1FLVA 1QVWA 1WF3A 1LVGA 2ZRJA 1G8JA 4B73A 1BHQ1 2GI4A 2QRHA 1SBHA 3MJEA 1Z0KA 2BEVB 3A1TA 3Q8XB 3FUVA 4LWOA 4B3XA 3DJYA 2JIZA 2DBVO 2PYIA 2W2VA 3E18A 1AHNA 3BD8A 3GVCA 5F21A 3WLFA 4KQ9A 4TYNA 4JMLA 1L4HA 3T5PA 2XV1A 4E33A 4FSDA 4G0ZA 2NVOA 5AKLA 3OCCA 4BKMA 5A6SA 1HH4A 4BIIA 3KKNA 3HY4A 5K4GA 2WAXA 3RYHA 1AZTA 2B4QA 1TTHA 5CUQA 4FR5A 5JHGB 2ZE7A 2TS1A 3GCXA 3GJ5A 1VPWA 3IQIX 2XYPA 4DXDA 4PW0A 2V65A 1VCOA 3C15C 1HDRA 2NIPA 2QKYA 2WUVA 4WADA 4IDGA 4BLRA 4C4SA 2R0QC 3E4DA 4G4IA 1RPZA 1REQA 1VCNA 1GVNB 3A1NA 3NBFA 3AR7A 1G4AE 5J5VA 2GPBA 3BYZA 3N58A 4HJRA 3EVFA 1Q14A 2XLBA 3TINA 1YA4A 3KPJA 4QXRA 1DPFA 4LMPA 4MEAA 3TQCA 1ZGAA 3UWSA 1HSZA 5HR5A 1E18A 1UWCA 3JWIA 1JS1X 4EW2A 3L7JA 4K7JA 4NOKA 3I92A 2G7ZA 2XE6A 1R0ZA 3FCUB 4LY6A 5JI2E 3H11A 4YJHA 4B3GA 1JAZA 1DE0A 1SWWA 4LRWA 2RHLA 1CZOA 2ZXFA 3E8MA 3HNOA 3RSHA 3NWEA 3ZU6A 1MP0A 4MAMA 1KIMA 2AN3A 3Q8KA 4I2NA 3SHOA 5JWHA 3FZNA 2WLSA 3K6JA 5AOAA 3ZWNA 1S7CA 2OESA 3G89A 3WADA 1JQKA 1YQUA 4YO8A 2VBGA 4OQXA 3G17A 4F5EA 1NOKA 1KI9A 2FE1A 1DQPA 1JVSA 2C1ZA 2XTNA 3A14A 3ILSA 3KXPA 4MUKA 5J63A 1L5LA 6ADHA 2E49A 4LXGA 2IU0A 1XK6A 5JADA 4US1R 2QY6A 4MSUA 2EKDA 2D0OB 1WW3A 1E7WA 5IDVA 1JKIA 4D9CA 2Z5FA 2AMFA 3ZEAA 2IYPA 1D1PA 5CFQA 1JTEA 1WU7A 4HDRA 5CD1A 3DO8A 1XZAA 4C43A 4DQVA 4CM8A 1L7OA 2H2DA 1Z8DA 3VAZA 4P7GA 4MW4A 1N8KA 1UJCA 1PFQA 3NWJA 3OKPA 2BMFA 3QPDA 5FLXA 4MUXA 1SOMA 3DUWA 1SAYA 3GLRA 4FIDA 1IDOA 2YWEA 2VHVA 2JI4A 4Z3KA 4DLKA 1K6JA 1P0IA 4Y1EA 1JHOA 2EP5A 2BUAA 3EEFA 5J47A 1ZOSA 2XUKA 4K6GA 5SYNA 1W5TA 5K8UA 2BKAA 3TKAA 1NW5A 2PZBA 4KCGA 5DI3B 2QN7A 1FNBA 1TCUA 4MMYB 5F5XA 2EFGA 3ZY5A 2XWJI 2GM4A 2HB6A 2L17A 3K4PA 4QIHA 3ZPXA 1OAAA 4IIGA 3C85A 2C7OA 1XJ0A 1TW3A 2WJVA 3GP3A 4UAUA 4DDKA 3B1JA 3GPBA 1JV2B 3OPQA 4GL4A 3MOSA 1AKEA 5CFOA 1OKKD 2IDKA 4NCKA 1Q7BA 3B8EA 4BNHA 3P9SA 3LBIA 3OA2A 1KMIY 2ZJ6A 4IIUA 5CLFA 2FJ0A 3GHYA 3O8OA 5T3UA 2XNDA 5HKBA 4ZAZA 1KI2A 4ZV4A 2CV0A 3PNSA 3QJ5A 1W36C 4CU2A 1FFSA 5D7BA 2CGEA 2HWUA 3LKZA 3LPAA 3NDBB 1TRKA 1JU4A 1USVA 3O8LA 2X41A 4LRYA 3E58A 1I6LA 1QVAA 2OLKA 2OO5A 5FXMA 4FONA 2I3DA 1XE3A 3IILA 3V1UA 1UXIA 2F7SA 3UJ7A 1MAHA 3KE8A 4MW7A 5ADVA 5CBPA 5ELMA 1MC4A 13PKA 1D1QA 1MOZA 1F8GA 5FTMA 5T8KA 3W78A 1KPIA 2LD4A 3SXPA 3T1QA 5IC4A 5H1YA 3H2KA 3P27A 1JIKA 4IFEA 2QD5A 2R25B 1TC1A 2YS6A 3R74A 1X1QA 3QLVA 3E3OA 4MV3A 4C01A 1BXRA 2LDXA 3PD7A 5AQ1A 2H85A 1FC0A 2FPRA 4HSEA 3MG9A 3QH4A 3TAHA 1PQWA 1WS6A 2AF3C 1R8QA 2I1QA 2DPMA 1NU6A 1T1EA 4FQ7A 3EGEA 4KP7A 1OZFA 1T8YA 3BIJA 3LX6A 3PHBE 3Q8WA 1H6AA 2BGNA 2WIGA 3PFKA 4B6EA 1AE1A 1MHTA 1PJAA 4NU8X 3CONA 3BAFA 3QLTA 1HZZC 5T8KC 2JEOA 1XCLA 3ZN2A 2UVPA 4R2JA 5J2TA 4P34A 1PQ4A 3BT7A 2OQIA 4JGGA 2J0EA 4ZAWA 4W82A 2XA9A 3KZCA 1OVMA 1QHIA 5HMLA 4PO3X 1PKEA 1N2ZA 4BN4A 4N7JA 4U8GA 2V4UA 2OHOA 3DZGA 4JV5B 3HP4A 3AKCA 3TL6A 1U2RA 4JBIA 1E2DA 4NE7A 4I1IA 4BU0A 2AL7A 5J4YA 3EIXA 2WT4A 3KR0A 3CF0A 1N5OX 1NXTA 2OKCA 3NHYA 1HZZA 2X42A 4G67A 2ZIAA 4TMVA 4M21A 3C7DB 3V8PA 2E4ZA 3QLUC 1RRCA 2Y9PB 5DHRA 2O1SA 4KXWA 1ILWA 4M4SA 4O4IB 5L3ZA 2FWRA 5PGMA 4DMKA 1SB8A 1T3GA 3LPDA 3INGA 2F8SA 1PDVA 4DXAA 1YIDA 1EUZA 4Q12A 2QTVA 1M0EA 3ZWCA 2B7CA 1K3FA 3F3YA 3MJHA 2B69A 4H7JA 4KQ6A 3ZE0B 4WNAA 1SCIA 3SCZA 4M83A 2GR9A 2ZWOA 1ZIXA 1WSAA 1A3CA 2IEDA 2K6GA 2ZT5A 2P3SA 1KI1A 2Y1CA 3QP9A 3WBBA 1BHJA 3FKSA 4TZKA 1ODSA 1TU4A 1VQ1A 3HKCA 3OLXA 5ALFA 8ATCA 5ICGA 4DLLA 1XTPA 2ZBDA 1C4OA 3L8DA 2XF2A 4XIFA 4KHZA 4CEIB 3ZDCA 1GRCA 4ZAXA 1U11A 3CZ4A 3FNHA 3JVIA 2XTJA 2GA8A 2O2HA 4FNGA 1JQJC 4AFNA 2P11A 5HVNA 4UM5A 1V37A 4PLZA 1THMA 1ZJYA 1L4GA 4WKBA 3Q98A 1X8LA 2AEFA 4L75A 1U65A 4I1SA 2XVZA 3VNBA 4LGCA 2Q0HA 1IULA 2HLPA 3KVVA 4UCXA 3U6BA 4F9FA 2WWXA 3PKJA 4YJGB 3FCYA 1M8KA 3RK4A 3MNFA 4B31A 1NMSA 2C9CA 1RHJA 1JKFA 5DRTA 3V1MA 3QVUA 1P80A 1ONPA 2GCGA 4LXIA 3GN1A 3NFYA 2PJUA 2HBRA 3RRYA 1CHNA 2GO1A 5LDGA 1KETA 2ATVA 2NTYC 5TS2A 4Z4EA 3MK31 3TD6A 4M8IA 4URZR 1PNRA 1DV1A 1F9EA 4D92A 2Z6VA 4RACA 5FFNA 1P4RA 4M76B 5AIAA 3SJAA 5EIXA 1TD1A 2X3UA 3D7MA 4TVOA 5B2ZA 1ZICA 2Q5LA 3TZLA 2DETA 1T1SA 3T0IA 5E2IA 3K5PA 4N47A 3ETJA 3GARA 4BO5A 4OK5A 1WL8A 1ZXBA 2CL7X 1LA2A 2PIDA 1AQNA 2CK3D 1BC5A 2D8MA 4L0QA 3P32A 1NN0A 3A6ZA 1LPBB 1P0FA 1LV8A 1MOQA 2AN9A 3ODPA 4DLUA 4UU1A 4CODB 3WFJA 1JR3E 3I8SA 1C7FA 1ZVJA 2SBTA 4JWKA 4TYPA 2XB6A 3DSRA 5K0CA 1NNEA 1YAHA 5JBNA 3WI7A 1WMAA 1NYTA 2CVQA 4WY8A 4DY6A 1ZD4A 4OQDA 4A6EA 5J4HA 1XX6A 4MVJD 4BVLA 3DZDA 1APBA 4EYKA 1P3JA 1VJCA 3KSZO 1N7GA 2NU7B 5AJHA 2CHQA 3HI6A 5CVEA 3PYLA 3SJ7A 4ER5A 5AJXA 4U5QA 4A2WA 1P1RA 1BRMA 3A37A 3FZQA 1YMVA 5C5CA 1KIFA 3W1VA 2FMKA 1QYCA 4TSFD 2EYUA 4TS9A 1AA6A 4QBHA 4YMWA 4QE3A 1CDDA 2V3CC 2IHVA 4JUIA 4LSGA 5HQ3A 1E59A 5ALJA 4B43A 2DKFA 2G5CA 5EWMB 2ODQA 3UFBA 3ZD8A 5LWHA 2PAAA 2I4IA 3CPJB 2I99A 5K3DA 4CDGA 5TC4A 2VAVA 2EKLA 3QVSA 1AZSC 1VRWA 3AT1A 4GRAA 4NCXA 4U7WA 1M34A 3D6FA 4PSAA 4JN6B 5L9AA 4BUCA 2PXAA 1KPGA 2MWMA 4PR0A 1K6IA 1SR8A 2OVFA 3TTUA 5AUOB 4YRQA 1E9EA 4IIDA 4R9UC 4BLWA 4RHUA 2R00C 4Z4CA 2OA0A 4JR2A 1V8ZA 3VZCA 1U1DA 1R4MB 4MO9A 1CIVA 2GN2A 1AQ6A 3AR6A 1JH8A 1NTOA 2DG2A 2X1HA 4NBVA 4BFCA 5BOSA 5DASA 1D0IA 1XPRA 1E2KA 4FGKA 2CBZA 3GLGB 1VMEA 4IOLA 2AYYA 3DR5A 2W6IA 1ZD5A 1NVXQ 2VS1A 3LV8A 1RKBA 5T4HA 1KAEA 1D6MA 3JVEA 2HJVA 2DECA 5JARA 1BFUA 1PTJC 2QX4A 1IIRA 4EVIA 3PYXA 4MKHA 2CT8A 5TE9A 3HDJA 3BTSA 4AN4A 2N47A 1Z4IA 4OO3A 3LGXA 2BV3A 4OHKA 4U6NA 1FUUA 1B23P 4CIBA 2WG2A 4X1YA 4TL6A 5AI8A 1ZA2A 2HCFA 2DB3A 3K0EA 2XKKA 1VBMA 3WL8A 2YYSA 3KX2A 2Q2VA 3UAWA 2GO7A 5ECGC 5LA6A 3T5TA 2W2KA 3WLQA 4IHAA 3TIIA 1MZPA 4EZIA 2GN9A 1GQRA 3MRSA 2FMXA 3SHQA 3D6TB 5A02A 1DIGA 5IF9A 1XMIA 2O0LA 5DM2A 1R6DA 4KKXB 4D57A 5JPDA 1TK3A 2AR9A 2X2EA 3DXXA 3HSKA 1WETA 4ZEMA 5GZ1A 3N5CA 1KYIA 3G79A 3I53A 3FFAA 1FB5A 1N5LA 2E1PA 2R8PA 1G98A 4REQB 3L0PA 4RELA 2JBHA 5ALEA 1GEGA 2EL7A 3DPIA 3BXOA 4OJTA 1RLMA 1UPAA 3JPWA 2XMSA 1Q0SA 3IUPA 3TG2A 3IP5A 3NRCA 3TGLA 4CMBA 2XXJA 1YRYE 3VR5H 1AQLA 1WCXA 3CN9A 3EGWA 5AW8A 4UU8A 4MQMA 2AN1A 3QEOA 4ARSA 1J5EB 1PGNA 5HF5A 3RYCA 2QXYA 1Z0DA 4N6GA 3QWBA 3H9GA 1CUYA 1G16A 1NVBA 3ZWAA 1UDXA 2PKRA 2XYRA 4I8IA 3RR2A 1VGVA 4R54A 4TKVB 3OLVA 3WB1A 2EJTA 5LZ7A 2SICE 4MV5A 4FMDB 3S7ZA 2BUCA 1M0TA 4Y9UA 2DWQA 4J0HA 5CM2Z 4LECA 4ZVLA 3W8FA 2QQGA 4YJ2B 2A9FA 1WD5A 4FGWA 1E60A 2QVGA 3QG5A 4MRAA 4CM4B 3QXCA 3UGQA 1E32A 2Q8QA 3EISA 5KSYA 1AV6A 4OAPA 2QLTA 4IIJF 1SBQA 3ABOB 3KQWA 3VPSA 3BD7A 3NBQA 4KPGA 1UOPA 3I3OA 2B8JA 1EQAA 1XVIA 1ZCZA 1FYVA 2DFPA 5EQDA 1XSEA 2XW6A 1GPDG 3RS2A 5AM3A 5C2JB 3OPYB 2A1IA 1F2UB 1T0PA 1WSDA 3O9VA 1O0BA 1CR4A 4ND6A 4KN9S 1K06A 5KYTA 2HL6A 1H93A 1JQ5A 1Z0AA 3TAXA 2ZDGA 2PKEA 2IIPA 2MYNA 4JLVA 3I5MA 5K0EA 2RI0A 1FL9A 2Q41A 3R3HA 1LLUA 5JCPA 2R2GA 4DG9A 1KZ6A 4ZT6A 3S3TA 3AY3A 1VMIA 1YJXA 1RABA 5CIYA 5F3DA 3GUYA 2OWDA 1DJQA 5FPQA 2H4XA 5G0VA 4B80A 3LQQA 2ZSEA 3E81A 4DSAA 1OLXB 4KRFA 1EM6A 2XVXA 1ZUWA 2IYRA 3VUFA 5ALVA 1K6EA 3NBMA 2A2ZA 4BV2A 5ED4A 1YDMA 2QXUA 1P1HA 4R2WA 5JH7A 1D0VA 3I9V6 3L6RA 2ZSKA 3R09A 4GXNA 9GPBA 3EK2A 2VTBB 4Z8YA 1C3OB 1C2YA 4RCVA 4O0MA 1NVKA 1ZN8A 2FB9A 4CEIA 1WMSA 4TL8A 2I65A 1DAMA 4CF4A 4D4GA 4EJSB 4Q18A 1GGEA 4K6HA 2JDIA 3G9UA 2PJZA 2DSTA 4EPWA 3PRHA 2OMKA 3L0OA 3NUQA 4DA9A 3AESA 4TLMB 2XYQA 4INPA 2I34A 2IF0A 3S2YA 4QUBA 1II8B 2X1VA 4RD0A 1Y37A 1QHHB 2M1XA 3OX4A 2MYPA 1X70A 3OVMA 5AHRA 4YN3A 1ABBA 5A9SB 1CY4A 3FNBA 2JGNA 5C3UA 4KWTA 2P4SA 3S2FA 1HDYA 1U9CA 1EK0A 3W7VA 1K75A 2P9BA 1GLNA 2AUTA 2VCYA 3LC1O 1UJBA 1MD9A 1YCDA 4KI0A 3REFA 3VYSB 5I9NA 3X1WA 4RMIA 2F3RA 3EUEA 3ZNPA 5LD2B 1LQUA 4S12A 4WW0A 3KR1A 3O8NA 1CHDA 3ETLA 2RAFA 3FYSA 3Q10A 5I9BA 2HRBA 3IUJA 4K0RA 1U0RA 1P7VA 1QCZA 2P41A 3QVJA 4PANA 3UB4A 2Y6UA 5IUNC 2OYRA 4V39A 4WWHA 4OKIA 2JARA 1OYYA 4J43A 1DUVG 1Z28A 3WLEA 1PL8A 2R8YA 1U2SA 5IANA 2JFGA 4P4TA 1PQPA 4RK5A 2JI8A 2C7PA 3SFTA 2Q5CA 1GADO 4RULA 1J5XA 2CB9A 4CEHA 1QHNA 2AFHA 4G8BA 3NLLA 1Q6ZA 5TJHA 2VP0A 3V8RA 4YS6A 3WP0A 5ALTA 3RJTA 5AP9A 5A6VA 3CLSC 1P0QA 1NLZA 4WD3A 1H69A 1NN5A 4PICA 5I4BA 3CUVA 1KI6A 1PUXA 4UM9B 2P2ZA 1AB5A 2NSDA 3CWZA 3HADA 4IF4A 1XZHA 3VOTA 2HCBA 1T9ZA 3V1TC 1P1JA 3LE8A 1B26A 1M1NB 1G3UA 2OAP1 1DG3A 5EE5B 1PWXA 2Q1TA 4JNCA 5EE9A 3ZH2A 1BWPA 1CJBA 1OAOC 3BCUA 3PYMA 4UBKA 2FRDC 4RXMA 3F73A 3GBVA 2FAXA 4PAOA 3C6ZA 2ZG6A 2WHEA 4Q3OA 4ZKEA 2HRQA 1A9QA 5J3JA 3RBAA 1G5FA 4A8JB 2Q1SA 4UZEA 4P58A 2P4UA 4Z0TA 1Z0SA 6CHYA 5LMNB 1ZS9A 1O6ZA 4YROA 1NVFA 4F06A 4FYKA 4ZAVA 1XAIA 1K0UA 2H9AA 5EKTA 2J5RA 1HE5A 1XL0A 3GX1A 2ISCA 1T0HB 2VUHB 2UVDA 5A05A 4I4TB 3RUDA 3UWPA 1HTWA 3QM1A 5FFMA 3RI3A 3K2IA 5DM1A 2QN9A 2GPSA 3AEKB 1JSCA 5H0IA 2VPXA 4IZOA 4B74A 4DN6A 2AXPA 3KDAA 3JY6A 3K0BA 4JLAA 3ZE1B 4GDFA 2BMEA 2YHSA 1TCVA 1PFUA 5FCDA 3RRBA 3B1VA 1X1DA 2HWYA 4AXXA 2PKQO 3OQVA 4LJ8A 4HI0E 4TX1A 1DEHA 1PGJA 1VKNA 4J0GA 1UT5A 5BURA 1MR3F 3V4PB 1TA4A 1FJGB 4GO1A 4OLFA 2O3UA 1TM5E 2QR2A 2QTWB 2XMGA 4EYOA 1GTG1 4B6RA 1G8YA 2VTVA 4ZDWA 4QEZA 4YJ3A 1GKIA 3DBVO 3NXKA 3ONEA 1TQ2A 1Z0IA 2OBFA 1IHPA 5GWXA 2OO3A 3WJ7A 1SC9A 4TS3A 2KPOA 3DFKA 1M1YE 1KRXA 2XF8A 1I0ZA 4TVKA 5J9FA 4N5IX 4L2IA 4U9UA 3M5WA 3RFTA 3AWIA 1N6KA 3ZWYA 4O4IF 4H18A 1O8BA 1UBOS 5H16A 5L51A 4A36A 1T6BY 2QVZX 3UF0A 4IUCS 2CXNA 4HG2A 1T36A 3BDIA 2J0VA 1RQPA 1FPQA 5LKRA 1VJ0A 1E5DA 1XQ1A 3HABA 2DY0A 2CYCA 3TB6A 3ZXYA 1RI1A 3ZNOA 3N6XA 1BDJA 4JROA 4MRPA 3ENZA 3M81A 4WUVA 5L4NA 4PC3A 3CF6R 5EIHA 3IQDB 1U7UA 2R1TB 2E4YA