5JCJD

Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 91
structure length 247
sequence length 267
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jcjD00
2GCGA 3VHRA 3ZNNA 4YQZA 4YT2A 2I65A 1A9ZA 5FFFA 1DXYA 3BMQA 4RORA 4CM8A 1EFKA 2WM3A 4FDAA 5TT1A 4FD3A 4WCFB 3RAJA 2OL4A 4RL6A 5HBRA 3NDJA 5KJEA 1E7RA 5IXSA 1Q1NA 1M67A 3K73O 1NFQA 2C7VA 1KVTA 3PHJA 3TZKA 4D45A 1PJ2A 5CG2A 3HJAA 2BH9A 4HY3A 1PEDA 1WW8A 5G4KB 1YB5A 2X23A 1GEEA 4BNJA 2J3JA 2ZQYA 2O7QA 3WMWA 4RVGA 4XJTA 2O50A 1XU7A 5DCYA 2NSDA 2UYYA 3G1UA 3NDIA 1ZXBA 5JO9A 4R54A 3RUCA 4I08A 4CL3A 2UUOA 5CDSA 3A9WA 2YW9A 5DN9A 1U2DA 4ZICA 1B15A 3OHSX 3JQ9A 1L7EA 3EK2A 3Q9NA 4CR6A 4DRYA 3JCZA 1ULUA 1PS0A 5JAIA 1OZAA 1Y9EA 5KJCA 1U28A 4ND3A 3KEOA 4CV1A 2DM6A 2EP5A 5JYEA 3JQ6A 1XGKA 3SC4A 2C5EA 3OA0A 1ZH8A 1T2FA 4MINA 1YXMA 1GEGA 2VWQA 3WMXA 1ULSA 2A92A 1CDOA 4E2ZA 1R0LA 3IJRA 4R1TA 1O8CA 3H9UA 4DQUA 1TLTA 3GDOA 2O23A 3AOEA 3ZH2A 3B1FA 1QG6A 2YUTA 4ND2A 4TRNA 1YDWA 2AQHA 1QSGA 2C2XA 2G0TA 2EERA 2ZYDA 4RF2A 1H6DA 3INGA 3RBZA 3GMDA 4J0EA 5THQA 4B4OA 1CQIA 2FN7A 3GUCA 3H6KA 3IL2A 3ROPA 5KOIA 3GOHA 1HTBA 3AU8A 2Z5LA 2WMDA 2D3TA 1PZGA 3LVFO 5F1KA 2IE0A 5KTKA 3E9NA 3QVXA 1NR1A 4O63O 1MGOA 1VRWA 1U2GA 2DPHA 5I8ZA 1U5AA 2HRZA 4D79A 2BFMA 3PTZA 4MVJA 4E21A 3R3JA 1NP3A 3VZRA 3WNVA 1UDAA 2QZZA 1E7YA 2HK8A 4FB5A 2AEJA 5B1YA 3BMCA 1FDTA 1Y9AA 2X9GA 4EUEA 1TI7A 2Q1WA 3WIEA 4BO0A 4Y6SA 4IGFA 1BTOA 4ILKA 2EJWA 2Q2VA 3KZVA 3EMKA 3QIVA 4J2OA 5JAQA 4OSPA 4YAEA 4YWJA 1DAOA 1OMOA 3GDGA 3JQGA 1VSVA 3LT4A 3OBBA 4IZIA 4MP6A 4Q3CA 4KZPA 5CAEA 3RVDA 1FF9A 2QHXA 1PJBA 4XQCA 1WP4A 2HUNA 4HV4A 5KVQA 1GCUA 1PJLA 2VUSA 4JLWA 2X22A 4CV3A 2AA3A 2OP0A 3IJPA 3ZHXA 2PTGA 5EINA 3S55A 5DZSA 4CV2A 3GNTA 4RPKA 5IN5A 3WTCA 1PJSA 2DFVA 2Q2WA 1E3IA 3GT0A 4J91A 2SCUA 1NQTA 2EWMA 4B4VA 4F46A 5L9AA 1FMCA 2VNSA 3DMTC 3F5SA 1EVJA 1KY4A 1TT7A 3RROA 3WIDA 2NTNA 5A02A 3KTDA 2P4HX 4U6SA 4N54A 2YJZA 2ZCUA 2X5OA 3VPSA 3FPLA 5H82A 2YV3A 1Q0QA 4GWKA 4Y6PA 1R16A 4PG6A 5L7TA 5A9RA 1SPXA 2CUKA 4XJSA 1V3TA 3KUXA 2Y0CA 4D0SA 4R69A 5IZCC 1GCOA 4UVEA 3ROKA 4GX0A 5A9SB 4URFA 2VNAA 1LEHA 2H9IA 3A28A 3MTGA 5GZ3A 5C3MA 1SOWA 3TDKA 1QYXA 1JQBA 3OJFA 2C7GA 2GN6A 5JDCC 3MJVA 2NTVA 1CIVA 1N2SA 3BHIA 1ISFA 4U6QA 3D4NA 3A1NA 4Z9XA 1U1IA 2IEBA 4OKIA 5JE8A 3SC6A 2I6TA 4Z0TA 3WX0A 4D0RA 1QORA 1U5CA 3VTFA 1SC6A 3WQQA 4I9UA 4MVJG 4R68A 2ZTMA 5K6AC 4KUGA 4RPLA 3BMOA 2DUWA 1RKXA 4OGWA 1Z6ZA 1DC4A 5ILOA 3F6YA 1ENOA 2Z95A 3E03A 3FN4A 3E9MA 4M54A 4OHUA 2VTDA 1L1FA 4XIJA 1FXSA 3WSVA 3EVNA 1DC5A 3DAFA 5GY7A 1YWGO 1ZEMA 1HDZA 4RGBA 3IUSA 1IE3A 5T6BA 1DC3A 1I3MA 4PVDA 1W6UA 5AXDA 4RJTA 2OZPA 1DIAA 3PHHA 4O0LA 2HLPA 3M2PA 1N7GA 3B1JA 1Z7BA 3DEYX 1QYVA 1EZ4A 4YJGA 1YBVA 5CG1A 1A72A 3TFOA 4ITUA 1ZK2A 1ORRA 2P68A 2VN8A 2DT5A 2PKQP 4O59O 2VYVD 5T67A 4BO5A 5L53A 4B3HA 1J0XO 4W6ZA 2AG5A 3SBOA 3COSA 3K2BA 2Q1TA 3WGYA 3GK3A 3PQFA 3AI3A 1RJWA 1WWKA 3ITDA 3HDYA 4AJOA 3JQBC 1LUAA 4LRTB 1T2DA 4OYRA 2QRLA 3PP8A 4D3DA 1DRVA 3B20A 1VKOA 2BGLA 4I9NA 5ES3A 4CUZA 4D46A 2HSDA 4MVJE 3WQSB 2Y1EA 5LCXA 1DLJA 4DPKA 4CMJA 4CMIB 3V2UA 4IM7A 3I3OA 3RKUA 2X5JO 4Z9FA 1I2ZA 4D3SA 1PGNA 1UZNA 5TNXA 2G82A 2PKRA 2VWGA 1DBVO 4L4XA 1I24A 1YVEI 4L74A 4CLOA 2V65A 2ZB3A 2UV8A 4FJ2A 3C7DB 2B5VA 4PLFA 1LQUA 4YAGA 1BGVA 3SLKA 4EJ6A 3D1LA 1HF3A 3OF2A 5G4KA 3DBVO 3HADA 2G17A 2O48X 1ISMA 3G79A 4KQWA 3ST7A 4BO3A 3KSZO 3WBFA 1L7DA 1UJMA 1KEPA 1K6JA 4RF5A 1TXGA 3H9JA 4PG7A 1EFLA 3KSUA 3W1VA 3X2FA 1ZMTA 3BHJA 4WCDA 3MWDB 5KIAA 4R4JA 1QP8A 4OL9A 1IULA 1V0JA 1DRUA 3KBOA 4YR9A 3BMOB 1LDEA 4HWKA 1P31A 1T26A 1MC4A 2O3UA 4IDCA 3ROMA 3AI1A 2X0NA 1LLQA 2XOXA 3PWSA 2VWHA 4W7HA 1KYQA 3H4VA 5B12A 3LQFA 3VPFA 4MIOA 1RPNA 4BNFA 4BKRA 3RUHA 1HYEA 2G1UA 3UW3A 3NKLA 3OJ0A 3PI7A 3JD4A 1SB9A 3U49A 3PJDA 1CYDA 3ABIA 3H5NA 4B4UA 2ZYAA 3GPDG 5JDIA 3IUPA 1N8KA 4NBUA 3GEGA 3TQHA 3P2YA 3RKRA 4M8SA 1PGOA 3VH3A 4OSOA 3WYBA 3L6OO 2GERA 1HDCA 4I1IA 3LT1A 4PN3A 4AJJA 1MP0A 3BHMA 1OOEA 3AI2A 2RAFA 1LSOA 2TMDA 5A5EA 2B4RO 4FFPA 1DHRA 3CXRA 3I1JA 3DWFA 5ITWA 5C5IA 1HRDA 3OM9A 2JCYA 4QFDA 2XPCA 4YA6A 3K5PA 4J7UA 5L45A 2BELA 3IS3A 5A4DA 1XYGA 4RQUA 3I6QA 3Q2KA 1ZO8A 3PGXA 3EW7A 3FTPA 3FRJA 1RM5A 4IIUA 1P33A 1KVRA 2A9FA 3W8DA 3H3JA 2IZZA 2Y93A 2X9NA 1E0DA 2OORA 4Y98A 4CMIA 1B8VA 4CQMD 4WJZA 4BQPA 5KVVA 1UAYA 2CY0A 1J5PA 5TJHA 1KVQA 4G81A 3DBHB 4GLOA 1YL5A 3DAPA 2E6UX 4Q3NA 4FFNA 3AM4A 2UDPA 2FPIA 2ZK7A 4WOKA 3F1KA 4CR7A 9LDBA 2NUAA 4FN4A 4WLNA 4IS2A 5BSGA 5FWNA 4IDBA 3PGJA 4DLAA 3OJEA 4BVAA 2JFFA 3L4BC 1LRJA 1G6KA 4G65A 4GMGA 2AXQA 4UAGA 1Z75A 5KKCA 4ALIA 3OSUA 1Q7BA 3NTQA 4MJLA 3VTZA 4G2NA 1DOHA 4IY1A 3QQPA 3MJ4A 3VPGA 3GNSA 4OQYA 4E2WA 1VJTA 3TN7A 3KHUA 2JL1A 2HK7A 8ADHA 3N58A 3DDNA 5IN4A 3DR3A 2JD1A 1Q2XA 2FHSA 4EUHA 1OAAA 1ZKMA 2PR2A 3OETA 4AVYA 2NADA 4KUEA 4OOEA 2Y1FA 5DP2A 3TZHA 4ZN6A 4L9RA 3MOIA 5U9CA 3FD8A 1LDGA 1EK6A 4CMEA 5I7FA 1U3VA 4DLBA 2GDZA 4BIIA 4LSMA 1SOVA 4TZKA 2H1SA 2VHWA 4R3WA 3LC2O 4CL8A 4GH5A 3ZWBA 1UZLA 3IKVA 1K2WA 4YAIA 3LF1A 4NU5A 3FSRA 4HFJA 3F5QA 4BGEA 5L4NA 2HJRA 4RPJA 4ZQHA 1YOVB 4BNTA 4KWIA 4QUKA 3GMSA 2Q1SA 1IOLA 3FF4A 1QMGA 2BFPA 4RVHA 4A10A 4CM9D 3SVTA 2GASA 4BKQA 4HFRA 1C0PA 5T8KA 5COAA 1Y5MA 3ZV3A 3IOYA 3QE3A 3BMNA 1P9LA 4IQ8A 1W0CA 1EDOA 4P4GA 4J9UE 4RDHA 1FJHA 3VKVA 5EPOA 4BV8A 3WS7A 2NWQA 1VSUA 4GAEA 4DYVA 1GQ2A 3HSKA 2FZWA 3QP9A 1ZBQA 4UULA 3GZ4A 4GL4A 4J3FA 4Q3EA 3ZCXA 6ADHA 4KTVE 3TF5A 3JSAA 3PDJA 3PJFA 1H6BA 3RC2A 3GZNA 4E4YA 4TKMA 1DFHA 3KYBA 4XKJA 4KUHA 1U7TA 2PZKA 4YDRA 5G4LA 4YJGB 2NVUB 2W90A 3UN1A 3LC7O 1NQ5A 2OBYA 2GD1O 3QVSA 4II3A 4RDIA 3BYZA 4IDEA 4JK3A 3OIDA 5B37A 3SJ7A 4H3VA 2O3RA 4UVGA 3PYMA 4EGFA 4HFMA 3O9ZA 2J5KA 3AM3A 2ZTUA 5TIIA 4NDNE 1GAEO 4FJ0A 4XWYA 5TS3A 4YYZA 1JA9A 3UF0A 4TROA 3UFXA 4AJPA 4YT5A 4CM7A 1VI2A 1ADGA 1XQ1A 1H0KA 2D5AA 3RI3A 1HE5A 2BD0A 4PRKA 1HL3A 3PLRA 1QYWA 3PHLA 1LNQA 3CUKA 1YL7A 2WD8A 4IS3A 3WGZA 3D7LA 4A7PA 2Y0DA 1CEQA 2DBZA 4H7PA 2YHIA 1GU7A 2EJVA 2BFOA 2VYNA 5L7WA 4UEKA 4E2YA 3E82A 2YQ4A 5ICSA 5G0TA 1I3NA 1LQTA 2FRDA 3DOOA 3F47A 1K89A 1EVZA 3JQFC 2XXBA 4RZHA 1ZUD1 1LLCA 4YEDA 3IIEA 4FFRA 3WYCA 3RFTA 1K6XA 1IZ0A 1GPJA 3IP3A 4Z3KA 5IAAA 4EBFA 3JQAB 4PCVA 2WJPA 4FGWA 1BXGB 5IJZA 3C3XA 1FDVA 3H5RA 4WNCA 1PZFA 4O1MA 2FPPA 2IZ1A 1O5IA 1E5QA 3VZQA 1IL0A 4IUYA 2ILTA 5TQVA 4K6CA 4BNIA 2EW2A 2ZKLA 4D43A 4GGPA 1W73A 1OBFO 2BLLA 1SB8A 3KOUA 3KM0A 4MPDA 2DBRA 5CHEA 1H6AA 1I32A 4N18A 3H8VA 4P38A 1ZMOA 4EEXA 4HUJA 4RZIA 3M1AA 3HZZA 2Q50A 2JD0A 2GN8A 4IXWA 3RIHA 4MKXA 3PZRA 3VPHA 2VRCD 5JY1A 2VZ0A 4NPCA 2X8LA 5TX7A 3VH1A 4D7AA 3FR7A 1J4AA 2JCXA 1UXKA 5EL0A 3H65A 4J90A 4BMNA 5TT0A 3ZHZA 3L0DA 1TT5B 2V6BA 5I8WA 3R6DA 2C20A 2D8AA 1R0SA 1J49A 4XYEA 3RCBA 3WOHA 3RUIA 5MGBA 1T2AA 3GDFA 4R51A 2PGJA 2R2GA 3LF2A 3ZZNA 4YT4A 5I9NA 1YQGA 4K1LA 2J3HA 4BNHA 1BVRA 5C7LO 1PL8A 4CLRA 5JAZA 1XQ6A 4DIOA 4B3IA 3JYQA 2VHYA 5ER9A 2FR8A 2I3GA 3JD0A 3N7UA 3AUAA 3HB5X 1DJNA 2IXBA 1ZSNA 2EKLA 1JWBB 1WZEA 3OIFA 4J4TA 4NI5A 4DC0A 4W82A 1Q7CA 5ICMA 3JQ7B 1ADFA 4OO3A 3NDRA 1LDMA 4DPLA 1LLUA 3WSWA 1ZJZA 1KVUA 2IZ0A 5TF4A 5JO0A 3DBHA 4E31A 4WECA 1M2WA 1O6ZA 4CM4A 5AVOA 1EK5A 4N5NA 4PIVA 3ONFA 2JHFA 3ICPA 3RJ5A 4I5GA 3ZWNA 1ZSVA 3MWEB 2GNAA 2FP4A 2B69A 4D42A 2VT2A 5EESA 1D4FA 2VCYA 3E6AA 3KYCB 4BKPA 4GMFA 4FFOA 4MVJD 3TZQA 4D41A 3U5TA 1XSEA 2CVOA 2O4CA 4JIGA 3WWZA 2DBVO 2D0IA 2Z1MA 4RLHA 1P0FA 1PJQA 3QWAA 2AQIA 1P1KA 2WD7B 1D3AA 3HN7A 4E13A 3AU9A 3RASA 1AHIA 4E12A 3HDJA 2Y05A 1LRKA 3C1OA 1DJQA 4YT8A 2PY6A 1WNTA 3GGOA 5FEUA 4ALKA 4BO9A 1BG6A 4TWRA 5GZ1A 4R5HA 3CMCO 3TWOA 5TJ9A 2H6EA 4WNIA 2D4AA 5L95A 2J3IA 2C59A 4G5HA 4OOFA 2B83A 4A73A 5MDHA 3HQ4O 4HFNA 4E33A 4I5EA 1Z73A 2DVMA 3ANMA 2CVQA 3S8MA 4NJOA 1P1HA 1PSDA 3JQ8A 2JAPA 3PWZA 4XGIA 2NVBA 3H5AA 1X0XA 2GGSA 1PU2A 2OGUA 4YJFB 3STHA 2EP7A 4PLGA 1HXHA 2WE7A 1SNYA 1MFPA 4WGGA 1R4MB 2R6JA 1OC4A 2Y66A 3N74A 1C0KA 2W2KA 5G0WA 2O4UX 3I9JA 1O94A 5I9MA 3BMNB 1C1DA 3AY7A 4FGSA 3FHLA 3HUDA 1LX6A 1I0ZA 3LSYA 5IZCA 1ZJYA 3IMFA 1PR9A 1UR5A 3GHYA 2BGKA 4WCFA 3E5MA 2HJSA 3KVOA 3L9XA 3PQEA 3U09A 1I3KA 2QZ9A 2B5WA 4BO7A 1YJ8A 5IZ4A 5FI3A 2GYYA 2C07A 1PGJA 2O3TA 4XYGA 1I5RA 2PH3A 1UDCA 4Y8VA 1ADCA 3I83A 5U4QA 5A1TA 2Y0EA 3GLQA 5H83A 3C24A 3ZNPA 3E5RA 2PGLA 3JQAD 4E30A 4E0BA 1PS8A 3D4OA 3EZYA 3WGQA 4IXTA 3P7MA 2X0IA 3H9GA 4IQ0A 4BNZA 1TB4A 5G0VA 3DQPA 4J0FA 5JYDA 3KLMX 1U3WA 2ZJ1A 4IJWA 4MVJF 4PG4A 1R15A 3UCEA 1GR0A 1FDUA 4NBWA 2GUGA 3WLFA 3RUDA 4BOYA 2H63A 2UUPA 4EZBA 4QECA 3UOGA 5L3ZA 2YDXA 3NT2A 1X1EA 1PZEA 4LCJA 5G0UA 1Y8RA 4PG8A 4AJ1A 2W2LD 4BO2A 1HLDA 2QX7A 3TZ6A 1PX0A 3B70A 4AG3A 1PIWA 4CM5A 3PYXA 3P5SA 4TRRA 1IUKA 4CUKA 3UCXA 1E3SA 2UVDA 1F12A 1F14A 1K6IA 4A26A 1DO8A 2TMGA 3RQSA 3GEMA 4GWGA 2WDZA 4NK4A 5BNIA 1LSSA 3I23A 1PGQA 1D1TA 4PLVA 2PLAA 3PYLA 1HE4A 4LRSB 1E77A 1Z82A 4E2XA 5KVSA 2Q1UA 3JQ8B 3U4HA 3ZWAA 3U4DA 5IF3A 2I9PA 3DZFA 4UEOA 4CMCA 5G0SA 3V2GA 1CWUA 3GVPA 2DBQA 3W6UA 4GVLA 4LMRA 2OOSA 3KSDO 1SO8A 4TZTA 1N92A 5JLAA 3L6DA 3X2EA 3DOJA 1JKFA 3IDSA 3C8MA 1C1DB 1NPYA 3I9MA 3QJ5A 1Z7EA 3TPCA 7MDHA 4LCEA 4AJLA 3GVXA 4BO6A 3G17A 2CNBA 1ZFNA 2E4AA 2LDXA 1JVBA 2VZ8A 3JQCA 2HU2A 2Z1NA 5DOVA 1C3VA 1X15A 3FBTA 1E7SA 1B2LA 1W4ZA 5ITVA 2HMSA 1BDBA 1A7KA 2IXAA 1P74A 4Q39A 2D2IA 2E82A 3ANNA 3I9LA 1EEHA 4NIMA 4RVUA 1UP6A 2Q99A 1GD1O 1V3VA 4HX5A 2D5CA 2I66A 3C85A 3MJEA 4KDEA 1G0OA 4J4BA 4FOOA 1HE2A 4YQYA 1EQ2A 2HMWA 4W9NA 3EVTA 1QV7A 3QSGA 1DRWA 2WSBA 3OEWA 4J4HA 4O5OA 3V8BA 3JV7A 5ER6A 4WLFA 5CP8A 3BZUA 4YAJA 1N1GA 1M66A 2YY7A 2P9EA 4WPGA 3ZNQA 4GPD1 4WLVA 1QKIA 5BSHA 2FWMX 2VOJA 1UH5A 4LGVA 4YJHA 4JJGA 3BMQB 3KYDA 5JDIC 1KC1A 1GL3A 1YRLA 3OEYA 1MG5A 3BTUA 2CZCA 2Q46A 4JROA 4I5DA 4BNXA 2GO1A 5JC8A 3VZPA 2UAGA 5C37A 3WYEA 3A4VA 2JD2A 4WLUA 2PH5A 1VL6A 2P91A 3OP4A 1Y8RB 3L07A 3JQ7A 4L4SA 4ZVVA 5EN4A 2AQKA 2W2LA 1DPGA 3JQ9C 2J5RA 1N5DA 4FC6A 4TRJA 5LDGA 4DIBA 3DONA 4J43A 4CM4B 2I5PO 3S2IA 4MKZA 4NBVA 4OAQA 2XXJA 4TVOA 4WUVA 3FWZA 4IDFA 1P1RA 3GHHA 3W6ZA 2NACA 3WJAA 1SZJG 1NASA 4CJXA 4DREA 1QV6A 1EE2A 1WZIA 1ZEJA 5KKAA 3TJRA 5I9LA 2D59A 3QRWA 4KQXA 3RSHA 4BUCA 3D3WA 3WGGA 2JAHA 1B16A 1A27A 1I2CA 1JKJA 1VKNA 3V1YA 4PLZA 2WD7A 3L6EA 4ND5A 2R00A 1IPEA 3RUAA 3UVEA 4NK5A 2A4KA 3NJ4A 3SEFA 4ZGWA 4YXFA 2HMTA 2I67A 4U8GA 2P9CA 1YBAA 4XCVA 1X7HA 2NM0A 4XX0A 4YCAA 1VC2A 3BAZA 4FPXA 3GR6A 1YL6A 5F3RA 2QG4A 1BWSA 2O3QA 4J2HA 4WK6A 1Y6JA 3LLVA 4E32A 4XD2A 1EDZA 5T57A 4GKVA 3GVIA 3CMMA 4J49A 4R1NA 4Q3DA 5F21A 1GPDG 2FY8A 2WYWA 4QT0A 4NFHA 2QW8A 2HMVA 5B4UA 2IYPA 3B1KA 4UEJA 3D3EA 1Q7GA 3CPSA 5CEEA 2HKIA 1C1XA 2VHXA 3S1LA 5KJ1A 3I9OA 3RBVA 5C7OO 2X9VA 1U3TA 4UUPA 1XU9A 4CMEC 3EHEA 1PL6A 2X1HA 1ADBA 4QEDA 4IDGA 4PLTA 4YJHB 4E6PA 3JQGB 2VYVA 4PGFA 1FDWA 4EEZA 1MA0A 3ZN2A 1P44A 2ZYGA 3AY6A 3M1LA 1HYHA 3V1UA 2QQ5A 1HKUA 1PQUA 3ZDFA 4L76A 4D44A 4JNKA 2VTEA 4AICA 2QRJA 3RUFA 1E6UA 4CLOB 1AUPA 1WMBA 3WGTA 2Y1CA 1N9GA 3K8ZA 1SBYA 3C7AA 4PLPA 4Y9DA 2EXXA 3ASUA 3ETGA 5U1PA 5BT9A 2VHZA 3PQDA 1XLTA 3CSDA 3D4PA 1UZMA 3VH2A 1B0AA 1EUZA 3OQ6A 2ZCVA 3F4LA 3DBRB 5TC4A 5JCXA 1XDWA 1P77A 1J6UA 1UXIA 2BRUA 3E1KA 1BW9A 3KXDA 4CLXA 1I3LA 3IAHA 3UCFA 1WAMA 1Y8QB 3QWIA 3T4EA 3T7EA 1DB3A 3P2OA 1T25A 3SX2A 2HAEA 3C1AA 1JW9B 2O7SA 1H2BA 1ONPA 1XR3A 2DU8A 5EQFA 3VKUA 1Y5RA 4B7UA 4Q3BA 1UXGA 2AEMA 2POQX 5ILGA 4F6CA 2PD3A 4HNGA 3GUYA 3SXPA 1Z74A 3I6IA 5JDCA 1XIVA 4Z6KA 5A03A 4U0KA 2VUUA 2YV2A 3DZIA 3GG9A 3JYLA 3QVTA 2VYND 3UUWA 1PQPA 2AEFA 4TSKA 1PJ3A 1ZVMA 4P8RA 4UUOA 3MJCA 3CIFA 1DFIA 4LISA 3KETA 1PJCA 3DTYA 4HBGA 4ALLA 5L4LA 1PZHA 4J1QA 1VJ1A 5CDTA 2GPTA 1PGPA 1E1KA 5EIOA 5AXAA 3GAZA 3BIOA 2V7PA 3TNLA 3QY9A 3UGKA 3EZLA 3PIDA 4BNYA 1DIHA 2B4QA 3ZW9A 3S2FA 1MX3A 1NPDA 4OMUA 5ENDA 4ZRMA 4XYLA 3TFQA 1M76A 1YB1A 3H2ZA 3KV3O 3NGLA 1KVSA 3E9QA 4OQZA 4QSMA 3GN1A 3W4KA 3QW2A 2AQ8A 1BRMA 1E6WA 1GV1A 4BMSA 3HFGA 4LVUA 2HO5A 3GQVA 4CQLA 5AXCA 2EEZA 1XEAA 2Y1DA 3QA9A 5EERA 4DYDA 4EW6A 5TGDA 1VJ0A 4BKOA 4ZQBA 2VQ3A 4FSHA 3PXXA 4JP3A 1BXKA 4JX8A 4OKNA 3WBBA 4N7RA 5CEFA 3GGGA 3ZWPA 3GF4A 5HS6A 5JMWA 5L7YA 5DOZA 1HYGA 4NG5A 4EI2A 4NFYA 1V8BA 2C2YA 4Z9YA 1MV8A 5DBIA 3L77A 3PJGA 1GQYA 1DSSG 3VDRA 5LDHA 2GSDA 1T1SA 3ZI0A 1NWCA 1LA2A 3LC1O 3SLGA 4IJVA 3TL3A 1RYDA 3G0OA 4CODB 3OECA 4DL9A 3ANLA 7ADHA 1VLLA 5F1PA 1XG5A 2IYOA 3HHPA 5DULA 4LK3A 4BHTA 1GZ3A 1KIFA 3GVHA 2QYTA 3DZGA 4LSWA 1UXHA 4TVBA 4K6FA 3P19A 1HZZA 3OJLA 5BNTA 1X1TA 1P3DA 1T2EA 3GVCA 3KYDB 3K6JA 1P45A 3JQDA 4GSLA 1K0UA 4R9SA 3NTOA 1JVSA 4BB6A 1I30A 2O2SA 1CQJA 3BTSA 4IQGA 4K26A 3O8QA 3D5TA 4S3MA 1IHYA 3PFWO 4GSKA 1YQXA 1K3TA 1NVGA 4R1UA 3ROQA 4ND4A 1I2BA 3HB4X 4RF3A 4J1NA 3ON5A 4R01A 4IZHA 4A2CA 4RO0A 1JDJA 3KEQA 3NJ8A 3VOSA 4F45A 3RUEA 2QRKA 4WLOA 5KJ6A 1DFGA 1NQOA 3PK0A 1D7OA 4TKLA 5JCJA 4YRBA 4UUMA 1NXQA 1GUFA 1NAIA 5KNLA 3HG7A 4IMPA 1V9LA 5I7VA 4IMRA 5L4SA 1U8FO 3VVBA 2OXIA 3FNHA 1UP7A 3U62A 3AOEC 1H6CA 3ETEA 4A5OA 3OJOA 3ETDA 4MVJM 3INTA 1ENYA 4FCCA 3GGPA 2EGHA 2HRBA 4YBZA 1H2HA 3D3WB 3NX4A 4W99A 4BB5A 1KOLA 2CDBA 1V35A 4XZ3A 2H5LA 1R0KA 2YFHA 4MVJP 3L9WA 1YE3A 4XYMA 4CQLB 1ZK0A 4FC7A 3LT2A 1XCBA 3Q1LA 3DZHA 2BGMA 5DCUA 4NQZA 4AJKA 5EQDA 2OP1A 4HNHA 1MLDA 3GY0A 4XQ9A 3LZ6A 3UXYA 4NFSA 2ZQZA 1CJCA 5CFZA 1D1SA 3GFBA 4DMMA 1BDMA 4MO2A 4DLLA 1IY8A 3ZWVA 3ZNOA 1T2CA 4DC1A 5CDYA 5IFLA 5A9TA 4YVFA 3T7CA 1GYQA 1QYCA 4GLLA 3FTNA 2B0JA 2AG8A 3FPCA 1TA4A 1NAHA 1WDLA 4A03A 1P1IA 4BL5A 4PFJA 2JFHA 1LDYA 4GX2A 4F3YA 1YS4A 3Q6IA 2RCYA 1I33A 3W8FA 2YHUA 4C7JA 4XRRA 3EY4A 2J6IA 3GC6A 1C1XB 3FNGA 2FOIA 3O26A 4LN1A 1G0NA 5COBA 1CERA 3AUTA 5F1OA 1GYPA 4PZCA 3U4CA 3ZWOA 3F3SA 3GFGA 5HM8A 1SMKA 4RVFA 1O89A 2HDHA 1DIBA 3PWKA 4QO7A 1IPFA 1B26A 1F0YA 3Q0EA 3DTTA 2CF5A 4BGUA 1QXSA 2RHCA 3GPIA 2NQ8A 2Y68A 4DQVA 3CKYA 4OXNA 4KWHA 4FIZA 4RPHA 3OQ1A 2WYVA 3QWFA 2J8ZA 4Z3DA 4U0JA 2BMAA 2Y1GA 4YACA 3DMTA 5KCZA 2AW5A 4PLYA 1E3WA 2Y99A 3DB2A 3CE6A 1JN0A 1M6HA 3UICA 4DBVO 4EJ0A 2F00A 4BNGA 4FFLA 3NTRA 4Z0PA 2X58A 3C1TA 2G5CA 4FQ8A 2BF7A 3HWRA 1NX6A 5T64A 2NU6A 1QRRA 5JAMA 1ZCJA 3QHAA 3PEFA 3BXXA 2VOEA 1Y8QA 4WCFC 4CMHA 4Q3AA 2VRCA 2AHRA 1CF2O 3H2SA 4BV9A 3ZU2A 1HSZA 3O03A 2DTXA 4I5FA 3IP1A 2V6GA 3D64A 1P1JA 1WDKA 4NU6A 5FF9A 3Q3CA 4R5MA 2EV9A 1MC5A 2Q4BA 1R37A 2PWZA 4CM1A 4BNVA 1LLDA 2NVWA 3MCVA 1LSUA 4L75A 1B7GO 1U8XX 3RFVA 3M2TA 4M49A 3MZ0A 5JPIA 2BI7A 5HA5A 4JJFA 2GRAA 1DIGA 2JHGA 3VPXA 4XEHA 3DL2A 1ISGA 5THKA 5T8KC 1HE3A 1YGYA 4XQEA 3EGOA 4WE3A 3PHIA 1RWBA 2OBNA 3CZMA 4B4WA 1UDBA 4M55A 3C7CB 4CMGA 2B35A 2A35A 2FSSA 4BNLA 5JSFA 4IPTA 1X0VA 3U4IA 3QV1A 1QLJA 1XHLA 4UUNA 3RC1A 3ZV6A 1IHXA 3VH4A 3LT0A 2AE1A 4FW8A 1ZSYA 3QLJA 4WEQA 3K92A 1UUFA 1PL7A 5AOVA 2CSUA 4CLDA 1PJTA 4GVXA 4DMLA 4X54A 1ISJA 3JYOA 4MOWA 4XGKA 5A04A 4MP8A 2AMFA 1A9YA 4Y6RA 5IDWA 3BMCB 1E7MA 4KOAA 3ZHBA 1LBEA 4BO4A 3FWNA 3UKOA 4M89A 2O3SA 1HETA 4FBGA 4CR8A 4MVJH 4XIYA 2YDYA 4ZJUA 1YH3A 5EJ2A 3ZWWA 2PKQO 1IB6A 1HDGO 4EITA 3RU9A 4ZQFA 3TRIA 3ADOA 4BNNA 3PZBA 2X86A 2IODA 4OXKA 3WJ7A 3I9NA 4JP2A 2C54A 4INAA 4R9RA 2NVUA 2IDZA 1A4IA 4UREA 1HDYA 3CH6A 3OMLA 1JAXA 3JQBA 2Q2QA 3IC5A 4P22A 1GQQA 1RM4A 4TRMA 2RBEA 3PJEA 4Z0HO 3AFMA 1U9JA 3KYCA 1PWXA 5JFOA 1JLLA 1DLIA 1MB4A 1GYRA 1KBZA 1W8DA 2PV7A 3EYWA 3KO8A 4PLHA 4Y67A 1MFZA 2OO5A 2CDCA 4ZRNA 4YRDA 4WKGA 4XRGA 4ZD6A 3NUGA 3INRA 1E3EA 1E3LA 2QYSA 1G1AA 3MJSA 4XDZA 3DAGA 3FBGA 1JU9A 3HFSA 5F5NA 2X7HA 2WYUA 4WOJA 1BXZA 2NU9A 1LRLA 3HE3A 1YONA 1V6AA 1ISHA 2P4QA 3OH8A 4EYEA 4B3JA 1GFSA 4JGBA 4DWVA 3OQBA 4GI2A 4QQRA 4FFMA 2NV6A 3EDMA 4II2A 1S6YA 1B3RA 3OICA 4PG5A 5JCJD 4BO8A 3JQAA 2C82A 1HEUA 1F06A 4BMVA 2I76A 3FI9A 3D5QA 1SCUA 4YJFA 3GG2A 2GZ1A 5I7SA 5A06A 3Q2IA 2DKNA 3ZU4A 1M75A 3DFZA 4QO8A 1LTHR 5DT9A 2I3AA 3ZU3A 1FDSA 5CDGA 1DEHA 1I01A 4DQXA 5I7EA 3GA0A 2BI8A 4FOSA 3TZCA 3CEAA 3ZGYA 2EKPA 1HZJA 4R3NA 4J6FA 2IRWA 5L51A 2PGDA 4JJIA 3ZHYA 4BGIA 1JTVA 1NFFA 4NR0A 3DC2A 3FR8A 3VVCA 3O38A 4E5YA 4NJMB 2WTBA 4DGSA 2XF8A 3NRCA 4MDHA 4PZEA 4TMFA 4BNUA 2ZB4A 4NNJA 1IYZA 3H7AA 4XGNA 1R12A 3AK4A 2I99A 5DCWA 3PLNA 1H5QA 4MIYA 2W8ZA 4ZA2A 1JAYA 3B6ZA 1R66A 3H9QA 4XR4A 1I36A 4PLWA 4QXMA 3JD3A 5CPFA 3HN2A 2R00C 3NV9A 4BNMA 2NNLD 2X5KO 3ENNA 5A05A 1WMAA 4K9DA 3WTBA 4HXYA 4P4NA 4B7CA 2NTJA 1E1LA 1MXHA 1VM6A 3LLSA 1Y7TA 5K0ZA 1ENZA 5JNLA 4XB1A 1PWZA 1AHHA 4D3FA 3LU1A 3ULKA 4R1SA 3EC7A 3ZWMA 5IG2A 1AE1A 4IDDA 1EUCA 2VUTA 3RFXA 4XR9A 3I4FA 3U9LA 1PTJA 3Q9UA 1XA0A 1E5LA 5T5QA 2V6FA 2ZIZA 5FYDA 2B36A 2X6TA 5LC1A 3V5NA 4WASA 2P5UA 1F8GA 2DQ4A 1DC6A 4JN6B 3ENKA 3NT5A 4WLEA 1MXFA 2VZ9A 3LK7A 2Q4EA 5GZ6A 5AYVA 3DZKA 4E5PA 3GAFA 1E3WB 4KDFA 2JKVA 1EUDA 5JXWA 1NBOA 2FR1A 1D8AA 3GEDA 5HS4A 3KLPX 5JS6A 1N1EA 4S1VA 4AJ2A 1V3UA 4JBHA 1RM0A 4BNWA 1UP4A 1GDHA 3WICA 4W7IA 1R4NA 3RJ9A 2ZB8A 5KWEA 3QWBA 4MIEA 5FI5A 1VE9A 2C29D 1C14A 1NYTA 2DLDA 4XYBA 3JTMA 3PVZA 1ISIA 1EQUA 1NQAO 3GRKA 4LMPA 3K31A 1OC2A 3TSCA 3E18A 2W98A 2Y1OA 3IKTA 1EVYA 1KEUA 4CM3A 4JBGA 4IIVA 4QTZA 4CLEA 4IBOA 4AFNA 3WGIA 3ZW8A 5JY6A 3FCOA 1B8PA 1YJQA 3MTJA 4NJMA 1JWAB 5TRTA 1B3BA 4OM8A 2WEKA 1GZ4A 1E7WA 3UH1A 1F17A 4ID9A 3GRPA 4A27A 4CM6A 2DPGA 2E37A 3OA2A 3GZNB 1F8FA 1KY5A 4O6VA 5HRUA 4OJNA 4ROSA 2XAAA 3JYPA 1HDOA 2WWRA 2X0JA 3DXFA 3JQEA 1U4SA 4ZHSA 4B8WA 1GZ6A 4QFCA 4HP8A 4R16A 4E5KA 3W8EA 4CMKA 1B14A 1YB4A 3U3XA 1LC3A 1Z45A 3S2GA 1T4BA 2P2SA 2VT3A 3IQDB 4H15A 3V1TC 4N5LA 4EDFA 2ZTVA 4RV9A 3ZV4A 2X0RA 2CDAA 2ZTLA 1A4UA 1NHGA 4IGEA 3A14A 4LVCA 1QR6A 1ONOA 3LDHA 4JCOA 3WXBA 4OXYA 4ALMA 3W4JA 1QYDA 2FZEA 5K9ZA 1QLHA 4IINA 3RC7A 1EMDA 5K6AA 3ONEA 1E6EA 4RF4A 4CV0A 4ZU3A 1I8TA 1EBFA 4NH4A 1Q0LA 5BR7A 2O3JA 1WPQA 2PFGA 2YHIB 3WFJA 2EIHA 2BFAA 3I9KA 2PA3A 5BSEA 4MKRA 2CVZA 1BVUA 3R3SA 3I52A 3OIGA 1YDEA 3AM5A 3MJTA 1PQWA 4HADA 4XQGA 2J3KA 1OFGA 4MP3A 4H16A 4XA8A 5C7IO 4E5MA 1E1MA 2ET6A 4YTEA 2PZJA 1NM5A 3WG9A 4RLSA 1CETA 4KMSA 4QX6A 1BXGA 2DAPA 4NBTA 5TSDA 1VL8A 3WB9A 1AGNA 3ASVA 1R4NB 1KERA 1HWYA 4BS9A 1HSOA 4PRLA 4U5QA 4JBIA 1H93A 3O4RA 3TL2A 2VRBA 1M6WA 5DBFA 3A06A 1KEWA 1NVMB 2NU8A 3MEQA 4PZDA 2PD4A 1AXEA 1LDNA 1A71A 1C0IA 1HLPA 3BTVA 3E8XA 3F46A 3D0OA 4YPOA 5BQFA 1LXCA 1T1RA 4YRAA 2FSVA 3ADPA 1NWHA 5EMHA 1A5ZA 4DA9A 4DXHA 4GX1A 4AJ4A 4LW8A 2E48A 2X4GA 4OIMA 1OI7A 1BSVA 2OUIA 4DVJA 1HDRA 1KS9A 4GX5A 4GQAA 5F5LA 5CDUA 3JD2A 1Q0HA 3HDQA 5A5FA 2J5QA 4IJKA 3DO5A 4F6LA 1NPTO 3DHNA 4DPMA 1Y81A 4CLHA 1O95A 3TOXA 1AXGA 4L4RA 5JW6A 5G2OA 3R0IA 1ZZEA 1SEPA 3RD5A 4FS3A 1TT5A 2WE8A 4XB2A 3DBLA 3HDHA 1YOVA 3RWBA 2EF1A 4J1TA 3HNPA 4N5MA 2GN4A 4CQMB 2GR9A 1GY8A 1PR3A 2OHXA 3DOCA 3GN2A 4L0QA 1DIRA 3TOZA 1WXDA 4GBJA 5IDYA 3WFIA 1KEVA 4CM8B 4W9NC 4CLRB 4EJMA 2Q45A 4NMHA 1T24A 4XDYA 4NBRA 3FNEA 4R41A 4I9HA 1ARZA 1ENPA 4I8XA 1SAYA 3NYWA 5HWSA 1EVIA 4CPDA 1ONNA 1N9GB 3QWHA 1LDBA 3V2HA 4YJDA 1GTMA 1ML3A 1U3UA 3BA1A 3G49A 4ZQEA 1RYEA 4RVDA 1WVGA 4IJUA 1S7CA 1O9BA 2JFGA 1UAGA 1EE9A 1DHTA 4TQGA 3F9IA 2C0CA 2P5YA 3PRJA 4ND1A 3R1IA 4CMAA 3JYNA 3SJUA 1ZXLA 4ALJA 1LC0A 1U4OA 5JBIA 2Q49A 3CTMA 5A3VA 3F1LA 1ZK4A 4NHEA 4W4TA 3PHGA 2RHRA 1Y1PA 4MVJI 4P4LA 4DBZA 2EGGA 2GZ2A 2HQ1A 4AJIA 4DIFA 2NLOA 1YQDA 1YKFA 4HKTA 1HDXA 5IDQA 3AUUA 1NTOA 3DHEA 3DMYA 5JMPA 4EUFA 8LDHA 2PZMA 2FPGA 1BMDA 4KTTE 2ZB7A 1ZIDA 1E7QA 4PVCA 3KRTA 2JJYA 1SEVA 1X7DA 2FMUA 1NNUA 3DZBA 3JD1A 1NFRA 3NAQA 3M6IA 4DUPA 3L4SO 5IXYA 4FJ1A 2CD9A 4B7XA 2ZATA 3WGOA 3NT4A 3GH3A 4BO1A 3AW9A 2PD6A 1YO6A 5BNFA 2O2YA 2PNFA 2EHDA 3ZWCA 2CMDA 5BSFA 3VC7A 1U7HA 1R6DA 1X13A 3FNFA 3H3FA 5L40A 4ZQGA 5AXBA 3RC9A 4B79A 4NZ9A 4J7XA 3ZWXA 4BQRA 2GF2A 1IZ9A 4M87A 2VHVA 1AN9A 4M86A 1JKIA 3NEPX 1E3JA 3EAGA 4GGOA 1NVTA 2JCVA 1XKQA 2PK3A 5DDIP 1EBUA 3AFNA 3VZSA 4JQCA 1R4MA 1KC3A 3U0BA 2Y67A 3RBXA 5JC1A 4KP7A 3L4BA 1P0CA 3UHAA 3ZV5A 3ZWYA 3AOGA 5CEJA 1GUYA 2Q3EA 2AE2A 1DDOA 1ZNQO 2RIRA 4BGVA 3I5MA 1LJ8A 3QVWA 3UAGA 2DFDA 4M1QA 3MOGA 2B37A 1NHWA 3VAZA 2CFCA 2B4TO 2ZJ0A 3CINA 3PPIA 3WR5A 4CUJA 1WLYA 5AQ1A 4UVHA 2EKQA 2EG9A 2DTDA 4WEOA 5DF1A 1PS9A 2PZLA 3RU7A 2YQ5A 1MG0A 3ONDA 1H9BA 1VPDA 4J16A 4CMBA 2YZ7A 4L73A 5DBGA 1E1NA 4U7WA 1LI4A 1PJ4A 3WDSA 5ADHA 4UVDA 3ORFA 4AJEA 1K5HA 3K2EA 4UVIA 3G3EA 3GNQA 5B4TA 4PLCA 4E3ZA 3WWYA 2DUUA 4RVSA 5ENVA 4GKBA 2DC1A 3S2EA 2YYYA 2GN9A 2G76A 1A7AA 1N7HA 1ZK1A 1UXJA 1YBMA 1T4DA 4J1SA 1WDMA 3QVOA 3W4IA 2OFPA 1VL0A 4C7KA 1ID1A 4J7CA 4OH1A 2IEDA 2D1YA 2W4QA 2GZ3A 3O8QB 2VWPA 4BKUA 4DTIA 2NQTA 3G1TA 4AJHA 1KETA 1ZW1A 4RCVA 4IDAA 1LSJA 4ALNA 2F1KA 4ONEA 1P1FA 3WGHA 2A94A 4JXKA 5CPBA 2DTEA 4A0SA 5B4VA 4J9VA 1XELA 5A3JA 5A9SA 3DBRA 5KJFA 3DFUA 5H81A 4AJNA 3DHYA 1BW9B 3PFFA 1GUZA 1O0SA 4RPGA 4K28A 2V6MA 2CF6A 3ITKA 1X7GA 1H94A 3AY3A 4AL4A 3Q11A 3PDUA 4C4OA 1X14A 2EW8A 3WQRA 3CZRA 3AJRA 3H9EO 1HT0A 3WNQA 4E5NA 2C5AA 2HMUA 5DNAA 3F4BA 3E48A 1RM3A 3NGXA 4CM9A 2HCTA 5IDXA 3AWDA 3T4XA 3AUSA 3ZU5A 1TVEA 2RH4A 3K30A 4YB8A 4B8ZA 1H9AA 3I4CA 3K96A 1B8UA 3DZJA 1MUUA 9LDTA 3KB6A 5GMOA 1LU9A 2YV1A 2BKAA 1GADO 5TLSA 5COQA 4ESOA 1I10A 1XWFA 3EUWA 2LDBA 5KVCA 1E92A 2QIOA 2OMEA 4YAKA 4Q9NA 4BNKA 1ZK3A 6LDHA 1CRWG 4FR5A 3LYLA 3ICCA 5HTOA 5J23A 2E49A 4L8VA 1GV0A 2GLXA 2YFQA 2BHLA 2FR0A 5DP1A 3DBLB 3VDQA 3JQFA 3OFSA 2NU7A 2RH8A 3BTOA 1DAPA 1FK8A 1BHSA 3K9QO 4CQMA 1TEHA 2W2KB 2P9GA 4RQTA 3WLEA 1NR7A 1C0LA 2HK9A 3PIIA
chains in the Genus database with same CATH superfamily
1NW8A 2GCGA 2Q9AA 3PX7A 4YQZA 2WU0A 1ZAKA 2X76A 1A9ZA 2XCUA 3BMQA 1HH4A 3EZFA 3V2IA 2WM3A 3CW2A 5TT1A 1G7RA 3UAZA 1EWQA 2OL4A 4CIYA 2DWPA 2DETA 5E2BA 1VCOA 5JXIA 4K88A 4AN1A 3NDJA 1UAAA 1ZU5A 3B9BA 1W0KA 4OHVA 4DLRA 5IXSA 1XTIA 1X3SA 4XUDA 1J70A 1M67A 4FHDA 2C7VA 1BRTA 1KVTA 1CUGA 5T7BA 4B35A 2M98A 1A82A 3D6HA 4RHTA 5IJWA 4P3PA 1JT2A 4OI0A 4BEVA 4MW7A 1QH9A 2BH9A 2RDMA 4QU9A 1OXTA 1DTSA 1XZQA 2DWUA 2KX7A 3C3EA 1BHO1 1WW8A 1JALA 1C7RA 1HC7A 3FNQA 3QNWA 5AKZA 1YB5A 3NBMA 5G4KB 2ZRGA 4MCHA 5GIOE 1GEEA 4NS4A 4LFAB 2OB2A 1ZD9A 2B8WA 3P9RA 3OI7A 5A4MS 3CVVA 4Z86A 2NSDA 3VTKA 3RUCA 2AG0A 3GCDA 2Z8YM 1FP2A 1L5LA 3VPCA 3SX0A 1D0VA 3B8HA 3NU1A 5IFKA 1Z2EA 4MRMB 3BIWA 1B15A 3CT6A 3OJWA 4ZYYA 3JQ9A 1L7EA 1Q0RA 4TXJA 3JCZA 2JGDB 3TLGA 5JAIA 5KJCA 1OZAA 1H9CA 1NI4B 1S2OA 2DM6A 1SKYE 2CFIA 2LGJA 4HDKB 1BMTA 3SC4A 2C5EA 2CXXA 3V7WA 5JH7B 3VZBA 2Y27A 4RXMA 3TLCA 2VWQA 2XA2A 5I51A 1ULSA 4NARA 1CDOA 5DNWA 4TTIA 1SG6A 2FEMA 2Q0SA 3PRHA 4E2ZA 3VNVA 4C4ZA 4QDOA 3K32A 2CLSA 3N6RA 4OQNA 5ALDA 3GDOA 3RVQA 2O23A 5EXSA 3O2NA 3ZH2A 3B1FA 4L78A 1KU6A 2B3DA 4CFZA 2OB1A 1LPAB 4ND2A 1WHSB 4F56A 4Y9TA 4DNQA 2FK7A 4JVSB 4LTDA 4B74A 1QSGA 2G0TA 1N6NA 4QJBA 5LMUB 1BDHA 1H6DA 4UUAA 1T43A 4J0EA 2TSYB 4I55A 2X8WA 2CLLB 1RLMA 1CQIA 3MJRA 1QFMA 4IFBA 3OCUA 3IL2A 4BN5A 3AU8A 1AS0A 1JECA 2OY0A 3COJA 2WMDA 5DYGA 2D3TA 1MB3A 1K7EB 5BNZA 3E8MA 3LVFO 2JIDA 5DIZA 1HR0B 2PHZA 1KI4A 2BGNA 1T9GS 1VRWA 2WMNB 2PH7A 3IIMA 1U5AA 4RH0A 5I8ZA 3V8QA 3G59A 3OTOB 5J2TB 3VZRA 3WNVA 3B6EA 1E7YA 1GGEA 1RW4A 4LC9A 1CP2A 4L15A 1XPRA 1NN0A 3NC4A 1UIMA 5LFAA 3RHZA 2VDOB 4QDZA 3ER9A 1FDTA 5EA2A 2GZHA 2X9GA 2GBLC 2Q1WA 2Z5FA 3MNFA 4ON9A 4Q02A 5CGQB 3TLMA 4CDRA 1NVFA 1DCTA 1BHQ1 1HLFA 3IQXA 2LBPA 4XPIA 3X3HA 1FSSA 4KN8A 3UXMA 4J2OA 2CMGA 4ZXPA 3JQGA 3LT4A 1VE6A 3MILA 4IZIA 4XM0A 4BMPB 2X1VA 3S7TA 3RVDA 1WP4A 2H4JA 2HUNA 4HV4A 1ZRNA 1ZVQA 1A4RA 3FX2A 4Q18A 4WKCA 2I2FA 1PJLA 1XNRB 2X22A 5K0CA 1EYZA 4DLYA 4N82A 1G21E 3IJPA 3ZE7A 4KC0A 3ZHXA 3RS5A 3O91A 2C2HA 4I7EA 1L5ZA 5IN5A 3RK4A 4BVFA 2DFVA 2Q2WA 3GT0A 5ESXA 1OU4A 5A2QA 1CYEA 4LGMA 1AQIA 3N75A 4RK0A 4KQJA 4YNBA 4O4LA 2WMYA 2WZCA 4R2XA 4F46A 1Z4NA 1JAHA 1J0AA 1XF1A 2I6QA 1XTRA 2RB5A 1XTQA 2VNSA 2EU8A 3QLVC 1AMUA 2F1RA 4QUBA 3WXMA 4KXQA 2IYUA 2FWNA 2RHLA 4RIHA 5A02A 2XQVA 2PJDA 3NKVA 4UBNA 3N86A 3EXFB 4C20A 5JFTA 3QMWA 4Q1DA 4EYOA 4N54A 2ZCUA 1XLTC 1WM1A 3VPSA 2A1TS 1TUGA 1WOYA 2ID4A 4G8CA 2NO5A 1Y7LA 1SD1A 3ES9A 3H13A 2YV3A 3KJXA 3MMZA 5H82A 4E5DA 4GWKA 1IHOA 4S05A 2OXEA 5HR5A 1XJ5A 3U44A 5D84A 4YP6A 2Y1LA 2WW8A 3IUMA 5CCDA 4UHHA 4UDNA 1H85A 1E8MA 1Z88A 5BXQC 5EJFA 5BUSA 2F62A 1FNBA 4S35A 3OPYA 4URHA 3RWOA 3ETNA 2C4UA 1W9HA 3WK7A 1H0SA 4R69A 2XUIA 4HDMB 3T0FA 2JZNA 5EZQA 2VNAA 3PFKA 3QQ5A 3KDAA 1AJEA 5GZ3A 4OA5A 1VHDA 2Z3ZA 4RTOA 5AW2A 3C48A 2GN6A 3K71B 2J5BA 3U81A 4FI3F 3MJVA 4P3KA 1CIVA 1N2SA 5E7JA 3SC6A 3D4NA 1U1IA 4LZPA 1VBFA 4OKIA 4D0RA 3IEKA 4JQOA 3WQQA 5KNDH 1U5BB 3LBYA 4URWR 5D6OA 5HQ3B 4D26A 4KUGA 2FPUA 2F64A 2C1XA 3UM9A 4RPLA 4EFKA 2P77A 1Z6QA 2YOHA 2PMKA 3U5ZB 1DC4A 2ORIA 3F6YA 1ENOA 2X42A 2CCGA 1RLJA 3E03A 3H6HA 1Y63A 4RTRA 2WUVA 1WJGA 3EODA 3EVNA 3TMAA 3R5FA 1ZRHA 2DE0X 2GZSA 3CX8A 1KRHA 1XD9A 4I50F 5D5QA 3ZDRA 2DWCA 3IUSA 2A78A 4PVDA 3OQMA 1RPTA 3SF0A 1J8VA 3U7GA 1DIAA 4O0LA 1SVUA 3V3KA 4G6ZA 1QYVA 2FU5C 1B76A 1A72A 2GNPA 3NBFA 2ORWA 1NVWQ 1XZCA 4ITUA 1ORRA 2JGMA 5E7MA 4DF3A 4JVLA 2VN8A 2ATVA 3R3HA 4B6EA 4ECEA 2IEAA 5T67A 3RT1A 2QN6A 5D3MA 1UFKA 1VLMA 4B3HA 2E5FA 3JZIA 4DT1A 2OV2A 1T3TA 1D1QA 1XL0A 2RI0A 3COSA 1KO1A 4QARA 4KXLA 1ZNXA 1QBGA 3EGWA 4RD4A 3WGYA 4X65B 1YZUA 3KAQA 3D3KA 4MITA 3GBPA 2DQZA 3PFIA 2QU8A 2VSOA 1U3FA 2H17A 2GARA 2O2GA 1WXQA 2CUZA 3P71T 1GITA 1XF9A 2HFKA 4FMDF 3AJ9A 4Q4DA 2JCSA 5HIMA 2D7JA 4D3DA 5I7WA 3UMYA 1SBHA 4WOCA 4IUDS 4FMBB 3BM5A 4OHBA 3KU4A 5B1HA 3C15C 1E99A 3WQSB 4CUZA 4GPEA 4D46A 1DLJA 5B5SA 1EHCA 2EJCA 4UMVA 3W2HA 1PVVA 3GLIB 1UBFA 4JL5A 2JFOA 4P0QB 4NZOA 1U1CA 3I3OA 1PW7A 4U2CA 4CBVA 3RV4A 3C3BA 2F3TA 2R6FA 1GAJA 1PGNA 3U3JA 2VWGA 3IVCA 4FZVA 4HAIA 1DBVO 1BJTA 1I1NA 4ERNA 2WKPA 3SICE 4V0QA 4DV5B 4XE5A 4FJ2A 3C7DB 5JS8A 4B32A 1BS1A 1TYEB 1HZZC 3A1VA 5LP6B 2PUBA 1VHLA 2WJWA 3SLKA 4C4XA 2XRFA 1WE2A 3D1LA 3M49A 4L22A 2PKYX 3DEKA 3VYTB 2ZREA 1AS2A 3O3MB 1U8TA 3SXUB 3P52A 3O4IA 4KQWA 3ST7A 4ZQIA 4QYXA 4BO3A 3KSZO 5BW4A 1OLUA 2QJOA 2WPDA 4FYMA 1ESNA 4M8NE 2P7IA 3LXRA 4NEQA 4RF5A 4UAUA 3ZZ0A 5A4AA 5JAPA 2ZAYA 4PG7A 2HSGA 3KSUA 3KIPA 3MT7A 1BXRB 4NCXA 5ALPA 3BHJA 4JU9A 4WCDA 3MWDB 2B61A 5KQLA 3HCWA 1JHZA 3NHKA 3I3SR 3T7IA 1VXRA 1UEXC 4B6OA 3S44A 1L7BA 4ZYVA 1DRUA 5AOAA 1BE0A 2QR3A 1LDEA 1TGYA 1W0JA 1PZXA 1P31A 2BFWA 4IDCA 4D4LA 1OV4A 3ROMA 4E09A 1SKAA 1S2LA 2B1IA 2GXSA 1Y9JA 2VWHA 1KYQA 3JZDA 3EVAA 4JFAA 4W7HA 4PZAA 1X8KA 4BNFA 3PUHA 3DV0B 4Z2AA 3SE7A 3KKKA 2P11A 2XE4A 3I6MA 4HDOB 4WXPA 3UW3A 1F1BA 1XU4A 3PI7A 1SC9A 2WTUA 1KO4A 2HPVA 3R9KA 3PJDA 1CYDA 3H5NA 4CTOA 4US0R 1VRVA 2ZYAA 3GPDG 4M7RA 3FPGA 4TOIA 3RWMB 2B1JA 1V2HE 2ZFUA 4FDLA 4DG9A 1SHTX 2ZJFA 1IHPA 4L8FA 1KOGA 2G09A 2C8VA 2JFVA 4ZVUA 1SVOA 3L6OO 1P2FA 2GF0A 4I1IA 4M22A 3WYBA 3LT1A 4ZV7A 4QA9A 3G8BA 2LR0A 1Z6AA 3WIOA 2VJMB 1U7PA 4O4JA 3CLTC 2JS7A 1NSYA 3SDSA 3F6SA 5D3KA 1OV6A 3KB2A 4ZARA 4Z4IA 3LQQA 3IHKA 1PJAA 5AO9A 3I1JA 1PW5A 3DWFA 3OLYA 4KYTA 1JR6A 5C5IA 4IWXA 3TZBA 2AI2A 1SHLA 3VM6A 4DWJA 3IAEA 5EJ7A 1WY7A 4YA6A 4AYTA 3K5PA 5L45A 1VIYA 2VDVE 3EBLA 3K94A 4Q4HB 5ALWA 2IV3A 1JJIA 1CZUA 1MTOA 3I6QA 4UHKA 1VLVA 5JXGA 1URPA 2P2LA 3EW7A 3FTPA 3FRJA 1M33A 4S1TA 5CDFA 5LZ4A 2OXFA 3YASA 4A1FA 1FFCA 2OO3A 1KVRA 2RHGB 4TYPA 1XK6A 4YAUA 2ZLBA 5C5DA 2Y93A 3FLMA 4N40A 1KEZA 1KYTA 1ZL2A 2ZVDA 5FLEX 3LX6A 3OBIA 2JIQA 1FTGA 3VO8A 2CL5A 3PPYA 3T3PB 2HPAA 1T8PA 2BLNA 1R9NA 2GCOA 1UAYA 4HOYA 2Z58A 3LA6A 1J5PA 5TJHA 1KJQA 2VYQA 1FFAA 1KVQA 3RS3A 3RTAA 1ANKA 2PLNA 1KAGA 3QF4B 5BQPA 4EPVA 3B6MA 3VBEA 4B2LA 4FFNA 1U04A 3LBAA 4BFSA 3F1KA 5P8WA 5C1DA 9LDBA 5BSGA 5FWNA 1I6LA 1TKRA 2RGYA 3OE5A 4NZYA 2QX9A 1G2OA 1N2EA 4DY6A 4BVAA 4EF4A 5CB4A 3BIFA 3L4BC 4AUKA 4AM8A 1LPPA 3KZKA 2QK4A 1G6KA 3REFA 1DWPA 2XRMA 3U3OA 5M34A 4FE7A 3LPLA 3BE5A 3ZIDA 2O1SA 3OSUA 3QMVA 5EQJB 1IQ0A 1NDHA 1Q7BA 2H57A 3NTQA 4MJLA 4G2NA 3T5TA 3VYUB 4OQYA 4ZO9A 4E2WA 1VJTA 4NH0A 5JNWA 1XCJA 4G1UC 1K86A 5JADA 4CEIB 3X2SA 4GKAA 4BVEA 8ADHA 2NW6A 3GLHA 1G1MA 2FW1A 2GZAA 4HBZA 2JD1A 3QEOA 4UEQA 3H84A 3I09A 1EFPA 3DE5X 1VLQA 4V0MA 2PR2A 2AWOA 3EA5A 5KX5B 4AVYA 4O1HA 1ZQ1A 2HQOA 2V3VA 2ZT5A 3OZIA 3FNBA 4OOEA 1IJEA 3WLJA 2D06A 3H05A 4KQ9A 5F3DA 5JASA 4CMEA 3BIXA 2ZSJA 5JNSA 3PDHA 3F5DA 4D0NA 4LSMA 3QEAZ 1GKKA 2QENA 1WQ1R 3KPJA 1SOVA 2CYAA 3LLUA 4MCJA 1ACLA 4N6OA 4DEXA 3OFKA 5LN1A 3H1GA 2Q6VA 4Y6GB 4QJ4A 1LV8A 5GWXA 1GCGA 1EFCA 2VP4A 2XI4A 1U94A 2OAGA 2ZVQX 4NU5A 4PINA 3Q9LA 1GSHA 4MR7B 3F5QA 2YL2A 1YOVB 2GEUA 5TQ2A 5LMCA 4LNUB 3GMSA 2GWRA 5IF9A 3FF4A 2PANA 1BEEA 4QDUA 3MG9A 2ADMA 1Z12A 3K8QA 3OG9A 3VU3A 2GJKA 2KPOA 4N8EA 4JC8A 5JJKA 1A04A 3X44A 1UPTA 3IQEA 3JAKB 4BKQA 1RMTA 1UKYA 2QP4A 3IOYA 3D7MA 1XZNA 4HGOA 4FHCA 4N5DA 4JMLA 1W0CA 4N9WA 1YZLA 5LP1A 4J9UE 4RDHA 4WZBB 4F60A 2IUTA 2W7TA 1X70A 2AYXA 3E58A 3NUQA 3HLKA 4R2IA 2NWQA 4GAEA 1E4EB 2YN4A 3A9CA 1GQ2A 3HSKA 3OQPA 2R4UA 3QP9A 3KQMA 1V8PA 4LHWA 4GL4A 4D8YA 4BRZA 1NNSA 3UAOA 5EZSA 5C46F 5KQSA 1FNMA 3JQRA 2AN4A 4KFSA 4FDVA 4UZFA 4F5ZA 2VJCA 2EIXA 4RETA 4MW6A 1W46A 1Z5VA 1DXOA 2AIRA 1CUCA 2IPMA 3CUUA 4YV2A 1TAHA 3R3XA 1W581 2OFWA 2GPYA 1JXAA 3C3YA 1J2YA 3L4KA 1GOTA 3AUXA 1S2NA 4YJGB 4MUFA 2NVUB 1ULTA 3AFGA 3T7JA 3PFHA 1TIBA 3UN1A 4EUSA 4Q7QA 2GCPA 3COPA 3R5XA 4N6NA 4RDIA 4Z9BA 3SJ7A 4L8YA 5LXTF 3IFSA 1LZKA 2GYVA 1BQ3A 2QXYA 2O3RA 2W37A 2YZKA 1DC8A 3BK1A 1SIWA 3FBWA 4X7PA 5KTMA 3O9ZA 3DMPA 5KYUB 3UJNA 2I6GA 2E7ZA 3HR4A 4JYPA 2XIJA 1BCSA 3AM3A 1B0PA 4LOAA 5EEGA 4NDNE 5SY6A 1GAEO 1Q12A 3SXJA 1Z35A 4FJ0A 4ZRDA 1TCCA 3MVEA 3JXEA 1JA9A 3CPEA 4E7PA 4AJPA 4UM9B 4GNRA 4G5YA 4EABA 3RRYA 2AFVA 3UWSA 1ADGA 1CUHA 1O0BA 2EYQA 2W2MA 4K1XA 4IWNA 3L0YA 5JTUA 3H97A 1TO6A 4ARAA 1K5DA 2HCBA 3HVUA 1QYWA 3PLRA 3QX7A 1OWOA 4WMLA 1YL7A 1FBTA 1DVRA 3SMVA 3D7LA 4OK5A 4M1SA 2IWHA 1E1YA 3IQHX 1GFWA 1UMKA 2BMVA 2DBZA 2Y0DA 2YHIA 1GU7A 1EXWA 1Q44A 2EJVA 2JAWA 2VYNA 3DBIA 1YR6A 3HL0A 3IIJA 4JLAA 4E2YA 4EHLA 3B51X 5ICSA 1JHOA 1KFEB 4WNAA 3IPCA 5DFAA 3JQFC 1K89A 4DG5A 1QVZA 4ZVPA 1LLCA 4DLZA 4W1QA 2EZ8A 3IIEA 3DMNA 2H52A 1K6XA 4GC9A 3WL4A 3GGJA 4OV6B 3OT4A 4C4TA 4PPNA 1XDSA 4J8PA 5EHZA 2VHQA 2VDUE 3I0ZA 5BN3B 4JDUA 4W5HA 1JMYA 2YFKA 2FQ1A 3C3XA 1BMFA 4IO1A 5IJZA 2PR7A 3R9IA 3H99A 2HEIA 3RVSA 1GJRA 4EPXA 3IQFA 4URYR 3SF8A 3H5RA 4MS4B 4WNCA 1QWSA 1PZFA 4J3NA 1OH8A 5H4HA 1O6CA 2BISA 4XFKA 1P7ZA 1TYCA 2QMYA 4BP8A 1PEAA 2QRQA 3K9CA 2QEQA 1E20A 5DJ5A 5TQVA 3MIZA 1HDEA 2TECE 2ZKLA 2CDRA 4AK9A 3FWYA 4X95A 5E3JA 1OF1A 3ZUGA 4XVCA 4YJ2B 3KM0A 3ZYZA 3WC4A 4MPDA 3LUBA 1K8YB 2DBRA 2E9SA 1MAUA 1I32A 4P38A 3H8VA 4EY8A 2VYCA 3M81A 4C0WA 4HUJA 3OFJA 1T5IA 4IGAA 4B09A 1NMXA 4JZYA 4UNIA 1K08A 2P5TB 1WQ3A 2JD0A 3RIHA 2WT8A 2V45A 3PZRA 5IBCA 1AN0A 2VRCD 4I4TB 4ZO7A 4MV3A 5DXAA 2VZ0A 3C4VA 4PBSA 3SVZA 1A50B 3FR7A 3U4QB 1UXKA 2HZBA 3PR1A 4QT4A 1CY4A 5EL0A 3ROXA 5BSTA 5BVHA 3ZY4A 4BMNA 3LO5A 2BFDB 5LQCA 1TT5B 3EDOA 1MD9A 2V6BA 3A9TA 3R44A 4WHMA 4PZYA 3IODA 2QT0A 4HAOA 5EUMA 3RCBA 1Q83A 5SY4A 3N0WA 5AM2A 1GAXA 4Z53A 1K06A 4OHRA 5H02A 1UK9A 2J3MA 3GJ3A 1TA0A 2LUOA 2P6MA 1DKUA 3LF2A 3KUKA 2AJBA 1XFAA 2H1VA 3VSEA 5BVGA 1FX0A 1QAMA 4P81A 3EVDA 3TI7A 1NIPA 2J3HA 4NCHA 2C3UA 1HLGA 5SYMA 1ZWKA 1MVOA 2UZ1A 3AR3A 3IJEB 4YCCA 4RABA 4EG6A 2VHYA 1XAIA 1WCIA 1SUSA 3DFIA 2WHQA 5ER9A 4EA7A 4XVUA 4FT4A 1ZM9A 4U2FA 2Z6AA 3DYIA 2IYEA 1THGA 1YQUA 1FFGA 4DLWA 3HY4A 4OQQA 1G3UA 1ZSNA 1GGFA 1LWOA 4J4TA 3OIFA 4NYJQ 5DYIA 5B3AA 5E4YA 3SR0A 1FUYB 2EJUA 5KQMA 1N2XA 4EVRA 2BZ0A 3PC7A 5ICMA 3O7WA 4G85A 1ADFA 2HX1A 3RRMA 1M1NB 3AFHA 1QO9A 1AZSC 3DXZA 1ZJ5A 3N07A 2IZ0A 3PCTA 3R4CA 4RZQA 4EHFA 2OGSA 3NHAA 3G82C 3P2JA 4FWIB 4I4IA 1RFLA 3ZY2A 2R85A 4BX9A 4E31A 4ER6A 1XFDA 4YMWA 4CM4A 1GTZA 2P9JA 3PL1A 4LYJA 5AVOA 3DFMA 3ONFA 3BWCA 3B8EA 4LJ6A 3NBKA 3RJ5A 5AK5A 3DD1A 1M2VB 4YAFA 1D7AA 3DH0A 4LJ9A 3MWEB 1XMPA 4WY5A 3RS9A 3F6EX 2B69A 2VT2A 1TZKA 4INPA 3KYCB 3E6AA 4MUAA 5EESA 4CHGA 4MVJD 1Z7WA 2VNHA 1RRPA 3ETJA 3I01M 4PYKA 3ND8A 4Q1CA 5DSXA 3SD7A 3U5TA 2QW0X 4EQZA 3KAPA 4DCVA 2QLJA 1KU0A 1Q6YA 3WWZA 5D6NA 2DBVO 2H5IA 2WJVA 2FDCA 4RK1A 2ONKA 2W0SA 2W4MA 3HBNA 4K6OA 4P54A 5B30A 4FHEA 4KLAA 4CIWA 1XRPA 2QBYA 2I4MA 4K6KA 1CJKC 2AQIA 2IXFA 3D3JA 4NV0A 3H5VA 4O4IB 5ITSA 1BKSB 3JTEA 4EGSA 4EVQA 1SH7A 2D7CA 3AU9A 4G26A 3L79A 4KNWA 4MQ6A 4TWBA 3RASA 2PUWA 2VPZA 1JHRA 1V6SA 5BYBA 1EU1A 1LV7A 3ZGNA 2EVWX 1TF7A 1YRHA 3SZGA 4YT8A 1P4HA 5FEUA 2P6PA 2ZIWB 1JIQA 3GNLA 4KXMA 4TWRA 4MUNA 3N53A 1XVUA 2FA9A 2CEKA 5TJ9A 4BRSA 4LJLA 4N3CA 1SVNA 4NLLA 1QKJA 3Q85A 4Q9LA 2UZ3A 5DBHX 2D5BA 3MTIA 3SZOA 4MGKR 1K27A 2B83A 5A7GA 3VR4D 3IAS6 1AKTA 4HFNA 2W5UA 3RVPA 4E33A 5HPYB 2W2TA 4QOFA 4TTSA 1B73A 3VYVA 2OCYC 1T4CA 4KE8A 3ZWCA 5L3QA 4NJOA 2P40A 2WP8J 3BL6A 1PSDA 3NBAA 2JAPA 3PWZA 2IPLA 1TKAA 4N5IX 4OYHA 4MJ7A 5HKKD 5IUJC 2A58A 4YJFB 1ODSA 1HX7A 5I7RA 2B20A 2WJGA 4PLGA 2WE7A 3NHRA 1SNYA 3L82B 3WK6A 2GN0A 2I87A 4WGGA 3WL3A 3GROA 4KPYA 2QD4A 4O29A 1N25A 2G9QA 5TMEA 3LY5A 3SEAA 3KV1A 2HDNB 1C0KA 3ADKA 2EKDA 2W2KA 3ND5A 2H1LA 4KPUA 3SC2B 2C97A 4HC4A 4BB0A 1ILEA 2I2DA 2H4HA 5FBLB 3HEBA 5GONF 2XCSB 1JHMA 3H0CA 1EKXA 2OCXA 4WDQA 2ONJA 1Z0DA 1G8MA 1GLVA 2H31A 1PR9A 3K70C 4UM7A 3L9XA 3P94A 1OH5A 4QUGA 4FMCB 1JEEA 1I3KA 2B5WA 4BO7A 4G8JA 1DPFA 1DTWB 1YJ8A 2W58A 5FI3A 4AF8A 4CCYB 4GNKA 1H0HA 4IYJA 3RSQA 5HGXA 1I5RA 1WABA 1BC5A 5KX5F 2H08A 1BU8A 2G25A 4KLNA 4Q6BA 4Y8VA 3HO8A 1ADCA 3I83A 5EUQB 5A1TA 3GLQA 5DVZA 2Y6UA 5DRTA 1N4AA 4DWWA 3NCTA 2DJIA 2RGWA 3C2QA 1GTVA 3D59A 1ULHA 3LOPA 2VNKA 5I6DA 1IOWA 1W4LA 4GVPA 2H1HA 1TMKA 3OUZA 3L7YA 2IYNA 4G0NA 2C7RA 3D4OA 3EZYA 3WGQA 4Q82A 1Z4MA 4ER0A 2X0IA 1TB4A 2C42A 2ZYWX 3PENA 1X77A 4D9GA 5G1NA 1ULAA 2ZJ1A 2JEYA 2IYZA 4CRWB 2Y0BA 2WKQA 1GR0A 1VJRA 3AHEA 4IXNA 4F5WA 4NBWA 3MERA 1JIVA 3RF6A 5IX8A 2Z3VA 2PBZA 3IE0A 4QGBA 4ZU1X 1QVWA 3RUDA 4P82A 4EZBA 2R1VA 4UTZA 3PR3A 4OGFA 2J9XB 5JI2E 1ZW6A 3THOA 1OZGA 4K3UA 1K0FA 4L85A 5KPDA 2C83A 1NU8A 2NU8B 5DN6D 5SV2A 4QQNA 1PDWA 5I8PA 2JGAA 1OCEA 3WI7A 3THYA 3LUHA 2HQSA 5K8CA 3RS4A 3K72B 2W2LD 4F93B 3BFXA 4KV9A 2PVPA 1WB5A 1FVFA 2QX7A 2VYFA 3OZVA 4LRQA 1NM5C 4OK6A 5FL7A 4MUJA 3KJIA 3TZ6A 1PIWA 3DZDA 3PYXA 1BE1A 5CLLA 2PQMA 3K9FC 2ZIGA 4CUKA 2GK3A 4W6QA 4I3HA 5CK4A 2JB9A 3DUFA 1K6IA 1E0SA 4LZLA 5HKBA 1H69A 1ML4A 3EH1A 4G86A 1EUDB 2P9QA 4RJIA 3SWWA 4NK4A 3ZPXA 4PWZA 5EIBC 2X1MA 4RLFA 4FZJA 3SZ3A 1P4SA 2NZ2A 2PLAA 3GU3A 3PYLA 4URUR 4WBSA 4LRSB 1E77A 2I7CA 1FRNA 2I4NA 1H65A 1XVAA 4G01B 4KN5A 1IM2A 3U4DA 4A2QA 2XAUA 4QEZA 3DZFA 4AMUA 4UEOA 5EXDA 1P5ZB 1OB2A 2ZZNA 3B3FA 3MCTA 4YMUA 5EGNA 3ZG6A 1IOZA 5G0SA 5B58C 1I7PA 1OFVA 2KSQA 1O77A 4PZ9A 4GVLA 3KKZA 2IHUA 3PRYA 2PN1A 3JY6A 1Y5IA 3SOPA 1R0YA 3L6DA 1EXVA 1KXJA 1GCAA 4MA0A 5DU2A 1C1DB 1NPYA 1I2DA 4LE0A 3DVRX 3G85A 4C4SA 4F71A 1GUDA 4G63A 2HU2A 3IUQA 5DOVA 2SNIE 3HLTA 2H9YA 5EHIA 3T3NA 1FS6A 1ZIOA 4MA4A 5K8IA 3WRWA 2VT6A 1A7KA 5LDDC 4Q39A 1QGDA 2E82A 3M6LA 2C4HA 5CNIA 1EEHA 3BDIA 4NIMA 4WXHA 5NULA 3M5PA 1F9EA 1PWYE 3JAWA 1Z3CA 4HX5A 4E1VA 2I66A 1NBAA 4J4BA 4ER3A 2L42A 3WP0A 3EVTA 2C4VA 3KB1A 3MJFA 5A6SA 5AVQA 2WWHA 2V0NA 3OPMA 3W3AA 1XEFA 2WSBA 1RKQA 5IJ0B 2WDPA 4J4HA 4IIHA 1WZ2A 3R0XA 1ZAYA 5JS7A 5CA1B 1G20E 1ESDA 5IYZB 1BROA 1TW3A 2YY7A 5HOQA 1QIGA 3KQPA 3R6GA 3ZNQA 1VPWA 1RXUA 2MSKA 1QKIA 4PFSA 1F4VA 4KR7A 4I1OA 1UH5A 1ZGCA 3WBKA 5LJIA 2WAYA 5JDIC 1KC1A 4DA4A 1V7CA 2BGJA 1T5SA 4BZPA 3BTUA 1HPLA 1RYNA 2CZCA 4JROA 1V1RA 4I5DA 1JE1A 5G53C 1AV6A 1HA3A 2BKVA 1Y6GA 2AWNA 3QX8A 4ZHQA 4M46A 3WYEA 5KSOA 3GLVA 1E6LA 1NYRA 4KHZA 4N1AA 3WY9A 1IQUA 5A0TA 1VL6A 4GE3A 3HACA 1IXZA 1C8BA 3VKHA 1NKVA 2C2OA 1MX9A 1E2EA 4L4SA 3KZMA 3WRVA 2AQKA 1KPGA 1S5PA 3JQ9C 1WG8A 4OLFA 2ZBPA 2J5RA 3RHFA 2I1VB 4DSOA 3EZ2A 2YVUA 1N5DA 2WJ4A 4FC6A 1P1BA 4K5QA 2PMEA 2ZRAA 4DIBA 3F73A 1TAUA 1ODJA 3DONA 1BS9A 5JT1A 2I5PO 1Z39A 4H0FA 4RV4A 1OQAA 4UCWA 4WBXC 4OAQA 2CVFA 1O95D 4YIKA 4TVOA 3CU5A 4WUVA 4DV3B 5AJHA 3WJAA 2YZNA 3ANSA 5D00A 5KNCA 1FE8A 3G0BA 1EE2A 1WZIA 3P0JA 2HV9A 4DSZA 3CPJB 2C2ZA 4B83A 1SXPA 1N7IA 2D59A 4PCAA 1YJXA 3QRWA 2Z6VA 5IVKA 4ZU6X 1CDZA 3M5WA 3ORYA 1U2PA 3D8UA 4UCXA 5AVUA 2XZTA 1XNJA 2FMIA 3WGGA 1B16A 4EY6A 1A27A 3AIKA 4V0OA 3MK31 1KSGA 1O03A 1OAOA 4B0OA 3E4CA 2Z98A 2F43A 3FWKA 1HK7A 3ZVNA 4IKOA 3ORHA 1I7DA 4NK5A 2A4KA 3NJ4A 5FEMA 2JRLA 5C31A 5CB6A 3PCXA 5FOSA 5FJIA 2HMTA 4X0EA 3MGGA 1YBAA 3CLTD 5E6RB 1X7HA 4ES6A 2ST1A 4AMVA 2X8BA 3FFTA 4O2RA 3OHMA 4G0YA 1JSRA 5IRCD 1KO5A 2PO7A 3GR6A 5D51S 4NE9A 3HNRA 5BPFA 3K2QA 3LX4A 1BWSA 5BR1A 2FAXA 5ULLA 4IKPA 3LLVA 1UXOA 2GBLA 3RS0A 1Q1GA 4XFDA 4RKEA 1EDZA 3FDJA 3Q41A 1ZYUA 4KFRA 2W9XA 1OTYA 4B47A 4DDWA 4NONA 5F21A 4J49A 1M6NA 2FY8A 2WYWA 2BMWA 2O20A 1JHQA 1QYRA 3B1KA 4UEJA 4ARZB 3D3EA 2AZMA 1VE5A 3QPWA 3CPSA 4Y0AA 5K8LA 1YVUA 4Q6WA 4KIWA 4W5NA 3IGFA 1YZVA 2X9VA 1JYSA 4G89A 4JNCA 2AKAB 4H1UA 5K3SA 3AR2A 5CM8B 4YCJA 3Q3EA 5A5DA 5JQWA 2IEYA 1MC1A 2Z8YA 3FFWA 2XJ4A 3CUYA 5JWOA 1Y5NA 1Y48E 2HCFA 4QEDA 5ECDA 4YJHB 1DCMA 2CCKA 1G6Q1 5J63A 4EYQA 4MVXA 4C4AA 4EEZA 1GARA 2QYHA 4UW9A 5CJ2A 1ZDMA 2QPTA 1LNSA 3PEUA 3IV9A 3ZDFA 4E15A 2JIZA 2VTEA 3N2EA 1MABA 2W2NA 2DB3A 3RUFA 1NBMD 4RYLA 3AXTA 1AUPA 1N0VC 2A9KA 5EMLA 3RIEA 1RC0A 4BGDA 1PSWA 4DIDA 1MAHA 5E6UA 2HSJA 2AKEA 2W8BB 3AQIA 2VPQA 3IKJA 2BFCA 4TTPA 1MN6A 3AF2A 1OKKA 1LJLA 3LPNA 2I6SA 1XLTA 4FYHA 1DQZA 2IHBA 4XARA 3OQ6A 3VH2A 4DTCA 2JA2A 1IXKA 2ZUBA 2P2CA 3DBRB 3M9LA 4FMDB 2C88A 4QTTB 4CLXA 4LDAA 2BR4A 4G23A 4D9KA 5C9ZA 5JCXA 2HTEA 2YHAA 1I3LA 3IAHA 2Y92A 3KC2A 2H11A 5EQTA 1M2NA 1G60A 5AJYA 2AC2A 2BSXA 3SX2A 4CWAA 1BXRA 2C94A 3BMXA 5H70A 4XDGA 3C6XA 2FJPA 4H18A 4NTZA 5EQFA 3SEQA 1Y5RA 1KQFA 4LEIA 4C7MA 1STOA 2NUPB 5A7HA 1TQ2A 1UXGA 3UBMA 2F4NA 1X1SA 1SY7A 4HNGA 2C8LA 1PUJA 1ZESA 5KTPA 1KOJA 5JH7F 3GUYA 3H2IA 1W9MA 1Z74A 3OPVA 2G7MC 4Z51A 4MDEA 8MHTA 3L7OA 3UV7A 4K9KA 5A03A 1T10A 1QUEA 1TIPA 1V71A 2VJLA 5JRDS 4RTJA 1E1QA 2YV2A 3DZIA 3JYLA 4CQNA 2ZJBA 3UXHA 2ANBA 4RE6A 1PQPA 1RXWA 1U0SY 1ZVMA 4ABTA 4P8RA 4EPYA 4WJLA 3K7EA 5DKFA 1SCKA 4LISA 4R8RA 4HBGA 5LOVB 3TR6A 5AK0A 5L4LA 4UM8B 3WLTA 2Q8NA 5HVNA 2W83A 3LBIA 1E1KA 2MYUA 1OROA 4QDJA 5BWMA 2OCKA 1N1MA 2D5IA 3LCVB 4I4TF 3VR5A 1YDHA 2V7PA 2QTGA 4PU0A 1PFWA 4L1KA 1SGWA 3K1AB 3UGKA 1X86B 1DIHA 3DO8A 3BQ9A 3H86A 2H4XA 4ASUD 1KK1A 3N0XA 3OLZA 4K46A 1NPDA 2VXCA 4EO4A 3VDNB 1EFHA 4D6YA 3UB3A 2FF5A 1FUIA 3H2ZA 1RAAA 2Q1YA 4GPZA 3QEMB 1Y7PA 1Z4IA 2V4MA 1NI3A 3TK1A 2R0QC 4TL9A 4WFJA 4W5WA 4P93A 5CLHA 3W4KA 2BJWA 2IZOA 4EL0A 4EMUA 1GV1A 3ESBA 4WESA 4MRSA 1OXMA 3SSAA 2ZYVX 4BMSA 3HFGA 4LVUA 3G0GA 1FLDA 4KR0A 2OM2A 1GPLA 3WAGA 4I8IA 1DC7A 2QPLA 4MQEA 1G4UR 2GPNA 1GPYA 2O8NA 2OESA 4I9FA 3HC7A 1ZM4A 4WN3A 5TGDA 5K05A 4BKOA 4OQPA 2WIAA 3Q10A 2BC9A 4YJ3B 3OKAA 3UG7A 3G6WA 1KMQA 1DINA 3A1TA 4XGQA 2VLBA 3VR6H 5HGJA 1RZRA 4MHTA 3IEIA 3D4IA 1WQ4A 5DOZA 3B89A 2HLDA 4NG5A 1UBKS 4PO9A 4Z4CA 1CBUA 1RQNA 1V8BA 4Z9YA 5EMJA 4Q03A 1FZTA 5DBIA 2BMDA 2JGRA 3CF0A 1WR8A 2Q62A 3PJGA 1A96A 5G40A 2QTMA 4FOLA 4DDMA 5K3FB 1KJ9A 5AW4A 3L7NA 5LDHA 5K5EA 2WICA 1I9CA 1RYDA 3G0OA 2WWFA 4Q4AA 3IVAA 1O5TA 3T1QA 4IEFB 1VLLA 2ZJ3A 3M9XA 3FVRA 4MVYA 1DXHA 4YALA 5B6JA 1YRWA 3U7IA 3PKJA 1GZ3A 3OZGA 1Z56C 1ZOLA 2QYTA 2XF2A 3DZGA 2QVLA 3BN3A 4ID3A 4K6FA 1YV9A 1LF0A 1HZZA 2EGUA 1J56A 1OILA 3AJDA 5EUCA 4HO1X 4X63A 1UKVY 1X1TA 1KZGB 2HBRA 3W5SA 5FTJA 3RSFA 3KYDB 1U0JA 3K6JA 4Q4CA 3I5UA 1H1DA 4BB6A 4C0LA 4OXQA 3MTEA 5KREA 2O2SA 4IQGA 4UMEA 2HUPA 4MZXA 4JI0B 3D5TA 4C30A 3MBOA 5TPZD 1IHYA 5FLKA 3ZC3A 1YQXA 1HL7A 1NVGA 5AVZA 1FW6A 5B2FA 1AQJA 1VG0B 3UG6A 4RF3A 3HB4X 3QU7A 4WWHA 5JBQA 4I6JA 4LAFA 2R1UA 3VOSA 1JI0A 5ABPA 5KTRA 2D1FA 2GA9A 4WLOA 3DNPA 3N2ZB 4OBBA 3E5HA 4NESA 3QM1A 2KHZA 4ZDJA 1PD1A 3HRIA 3L6CA 3UATA 2PVCA 4EB6A 3SBXA 5BT8A 1B74A 5KNLA 3H7IA 4ETNA 3ZHTA 3B12A 2HPZA 4MYHA 3VR4A 4C07A 2IPXA 4EJSC 4RCYA 4DSNA 3W6OA 3WNDA 3C3DA 4G5RA 5CFNA 1T91A 5IWAB 2ZETA 4MRNA 2CV2A 4R9NA 1OFHA 1MR3F 3ETEA 1IY0A 4UUQA 1YDMA 4AXBA 4DLTA 4WZBA 3GGPA 2EGHA 2RJ3A 4YBZA 1YRAA 3EA0A 3NX4A 4W99A 3SFVA 1IBSA 5EKSA 4UAVA 4NEGA 2CDBA 1V35A 1JKJB 1COZA 2AR0A 4GL2A 3ZHQA 4MVJP 3LCJA 4K05A 4FC7A 2H3HA 1GGMA 1KFKB 3M6FA 4OQ4A 1XCBA 4JSTA 4KMRA 4PXAA 1LBHA 3HXPA 3Q1LA 4O4HB 5F51A 3T5MA 2BGMA 2GCEA 4MUHA 4NQZA 1JEYB 2G3YA 4U7FA 4EY3A 5EP3A 1RI1A 1QU2A 1VA4A 4HAXA 2FQQA 2ZQZA 5CFZA 5LLDA 2CBGA 1AV7A 3EMBA 1IY8A 4MO2A 4ZO6A 1A95A 4DLLA 3UEOA 5J1TB 1DBWA 5IYZF 5CDYA 2AYYA 3UMMA 5AJZA 3HN6A 1NE7A 1QYCA 1W75A 5F2KA 4ERXA 2O8EB 2B0JA 2ILVA 3LMKA 1NV8A 3N8HA 4QTXA 7REQB 4AQYB 5ALQA 1E8DA 5FDFA 2TYSB 4GR9A 2XNHA 3AGQA 1JI3A 5D2CA 4RH1A 4TV8F 1RC8A 1JR3A 1VLZA 1G63A 2JFHA 3C4QA 4GX2A 3AR5A 4F3YA 4K3VA 2F3SA 2HNAA 2OCPA 4QLAA 4Z0NA 3W8FA 5FHRA 2YHUA 2PQ0A 2I78A 3DEFA 3TTUA 3C3PA 3HO6A 3MS2A 4C78A 2LCIA 2Q7XA 1JT9A 1C1XB 1TM7E 2IYAA 5L8VA 4L95C 1N5KA 3O26A 4LN1A 1ISRA 1CERA 1JDNA 1ULBA 4B33A 1IC6A 2PMDA 2QA5A 2QP9X 1X1RA 1BFDA 1N2JA 4V3CA 3W9YA 3D6MA 1SMKA 1W5SA 2XMRA 4U8GA 5H68A 3ERCA 2QNBA 3FOWA 1DIBA 3PWKA 4IJ6A 4QO7A 2Y1XA 1QGYA 3DW1X 3PXDA 4GRIA 4X71A 5FA6A 3B60A 4D82A 4P35A 5C52B 4ND6A 1JFVA 4DQVA 4KWHA 4CKEA 4FIZA 5JVDB 3OQ1A