5JCOC

Structure and dynamics of single-isoform recombinant neuronal human tubulin
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of Single-isoform Recombinant Neuronal Human Tubulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin beta-3 chain
total genus 142
structure length 426
sequence length 426
chains with identical sequence D, I, J, K, L
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
C PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jcoC03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jcoC02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jcoC01
4TV9A 5CA1A 2VAMA 4X1KB 5CA1B 4TUYB 5GONA 5IJ9B 4EI7A 4FFBA 3R4VA 5EYPB 3JALB 3RYHA 5LA6B 3M8KA 5CB4B 5KMGA 4X1IA 2VAWA 5IYZB 4YJ2B 4I4TB 4O2BA 1SA0A 3HKCB 4O4IB 4WBNA 4TV8B 3HKBB 5JH7B 3ZIDA 5JCOA 5ITZA 5BMVB 3JATA 4I4TA 5EIBC 4B46A 3ZBQA 4O4LB 2RHOA 5IYZA 3ZBPA 5EZYB 5JVDB 5JQGA 2XKAA 1FSZA 4HNAA 2Q1YA 3N2KA 3RYHB 2R751 3VOAA 1W5EA 5FNVA 3UT5B 3C8LA 4FFBB 1Z5VA 5LXTA 4X1KA 1FFXB 4IIJB 5LP6C 4M8IA 5LOVB 4DXDA 2RHJA 3WGNA 4F6RA 4U3JB 4X1YB 3CB2A 5EIBD 3E22A 3VO8A 4I55B 4XCQA 3JARA 5LYJA 5J2TB 5BMVA 5ITZB 1W5FA 3HKDB 4O4JB 5CA0B 1RQ2A 2XKBA 3N2GA 1W581 3N2GB 3JAWB 4YJ2A 4X20A 3HKDA 2R6R1 3RB8A 5KMGB 5MN4A 5JCOC 2VAPA 5IJ0A 3JALA 4B45A 1JFFA 4ZI7B 4EB6B 4X1YA 5IJ9A 3JAKB 1TVKB 1Z5WA 4F6RB 3VPAA 4TUYA 3JASB 5C8YB 1TUBB 4O4HA 3RYCA 3WGLA 3JASA 5C8YA 4E6EA 5LXTB 5M7EA 4ZI7A 1W5AA 3N2KB 3RYIB 4U39A 4HNAB 2BTQB 4ZOLA 3M89A 5MN6A 4ZHQB 4I50B 4O2AA 3RYFA 5CA0A 4WBNB 2BTOA 4ZHQA 4O4IA 5LP6A 4DRXA 3HKCA 1SA0B 2Q1XA 3JARB 4O2BB 5LYJB 5J2TA 1W5BA 4ZOLB 5MN5A 3E22B 2BTQA 4X1IB 5CB4A 4EI8A 5LA6A 1W59A 4IHJB 5LOVA 4IIJA 1FFXA 3WGJA 5GONB 3WGMA 3RYCB 3UT5A 5FNVB 4O4HB 4IHJA 1TUBA 4TV9B 5J2UB 1TVKA 3JAKA 2RHHA 3HKEB 4EB6A 1OFUA 5EZYA 5JQGB 5JVDA 4O4LA 1JFFB 2RHLA 5IJ0B 3JATB 4YJ3A 4DRXB 5LP6B 4LNUA 5KX5A 1RLUA 1RQ7A 3WGKA 4EI9A 4X20B 3HKBA 4TV8A 5JH7A 4I50A 3JAWA 4O2AB 3RYFB 3VOBA 3VO9A 2GVIA 4O4JA 3V3TA 4LNUB 5KX5B 4YJ3B 3RYIA 4KWEA 4I55A 5EYPA 2VXYA 3HKEA 4U3JA 5J2UA
chains in the Genus database with same CATH superfamily
4LG1A 2PJUA 4HZIA 5CHEA 3IVGA 2PGNA 5FYQA 1J2YA 1XDWA 4X1KB 3BFXA 3LYAA 2GX6A 3DBLA 1YS6A 1GXSB 1QYWA 2HNKA 2QY9A 2FEMA 3E3NA 1OVMA 4OHBA 3ZE7A 1P44A 3O82A 4YWHA 4P0PB 3B4SA 2WILA 2CLFB 2C5BA 4IICA 4CS2A 3GDFA 3CQ9A 3VI3B 1VL0A 3CG6A 3KHUA 3PTZA 4FFVA 2G1AA 1CUIA 1F3LA 1T8UA 3GLHB 3LNCA 4RF3A 4FSDA 4RFLA 5ANRB 5TMBA 3W9BA 4BO7A 1M2VB 2WJ4A 1KPGA 1T2VA 2ZSKA 3DBIA 3FGNA 2GN6A 4QG7A 3G3EA 3VZRA 5EJ6A 1KOLA 4OL9A 3HDYA 1NQAO 1Z38A 3QXHA 4HH1A 5B7NA 4H3HB 3P9KA 1Q84A 2A9VA 4MEBA 3JQCA 1PO7A 3EDRA 2R1TA 5LQSA 4IKEA 3PK0A 2FZVA 1ETUA 1WSBA 3PNPA 4O0MA 1DXOA 2F3QA 1KYYA 4YHHB 1FLVA 1WVGA 1ZP6A 4F3NA 4WZBA 4A8TA 4CLOB 1PGJA 2CVLA 1GKIA 2PKYX 1G7SA 1HNXO 1HBJA 3MK31 3ND9A 3LHDA 3QUTA 2IYZA 4ZVUA 5UKDA 4F93B 1EN4A 3U7EB 1WDTA 3ZE6A 2Z5UA 1YI1A 3K0HA 4WXMA 4B7XA 1XHOA 3L74H 2PGLA 4WJKB 5LWHA 1SVNA 3A3YA 2H2GA 1KXJA 2GNPA 2Z1TA 2YIJA 4EKGA 2MW2B 4F4JA 1OI7A 4LCJA 2G9RA 2R6GA 4WECA 1ZIDA 2EF1A 1DUIA 4FB5A 4ZP1A 3IEKA 1T5HX 1EWVA 3I8OA 4XEUA 3SPXA 4BX9A 2W6ID 4RA6A 1NV8A 4AW9A 1ZM2A 2FEXA 3M9XA 3SZGA 3B2EE 4YA6A 3UV6A 1DV2A 1MR3F 1UAAA 2IFTA 3OFSA 3K70C 2VH1A 3L5KA 2A1UB 5BV7A 1Z29A 2ZXWC 3RYCA 2OXRA 3ELUA 3Q9LA 4W5WA 2GKSA 5FUMA 4P3YA 1Q90D 3GQBA 3L7MA 3WADA 3CXUA 3KUCA 2GUZA 2UVQA 3STHA 1NVTA 3WLAA 4AECA 3DKPA 3OE7G 1U28C 2X0IA 2RGCA 4LNHA 4RACA 5BUCA 4M4SA 3D2CA 3JQEA 4IW3B 3BJZA 3ZW7A 1E5TA 3JQPA 4P1ZA 2W2LD 3AW8A 4J43A 1LX6A 1R74A 5JFGA 3HLKA 2ECQA 5B1AB 1FTWA 2Z1MA 4ZCSA 2H4ZA 2K6GA 1XTIA 4N0PA 4IIDA 4L4YA 3HUUA 3BAFA 2Y48A 3ONEA 4M89A 1GTOA 3LYHA 1IL0A 1QBZA 4XE5A 5EWJB 1NVFA 2ZB4A 3IOEA 3KAQA 3MELA 4DBLC 4EARA 3VPDA 1GU0A 4JT4A 2J3DA 1UK8A 4EI2A 4JI3O 3RFUA 1MEEA 4MV9A 1ODLA 2GLXA 1XNQB 1JAIA 1O94D 3LBAA 4YJFA 4RTKA 1BYIA 5KQLA 4AG5A 1VPTA 2DBRA 3A32A 1IYZA 3CCVV 4XARA 2MU1A 4D46A 3EHEA 5F4ZA 3BIJA 3EB9A 1Z4LA 1Z83A 4E6PA 2HS0A 1IZ0A 2MIIA 5EEGA 1S9HA 1WEHA 2Y92A 2ZPTX 3K6JA 3T4XA 3GUHA 1VPVA 3LW7A 5F52A 2LBTA 4TN5A 5AIBA 4ZHVA 3FNFA 2B7LA 3W06A 3EPRA 4D44A 1EBOA 2G4VA 4P4UA 3OLWA 1CJKC 3ANSA 1S5LZ 3NI2A 3U7FB 3N8KA 4AZTA 4ZANA 2GYYA 5ISMA 4EK9A 2AFIE 2J5XA 2R9IA 2PZMA 4LGYA 2QTRA 2WFAA 2CLMB 1OCOB 2VQ6A 1JEOA 1G2OA 4AK9A 1X87A 4HNSA 1WMDA 2J7KA 2XYVA 4JJEA 4TUYB 1OZHA 2YASA 1EN5A 4TVKA 1WU7A 4UDNA 2W22A 1AHPA 2LV8A 1UPUA 4P7JA 4IUYA 3BMNA 4CKBA 5LA6B 3V4FA 5EMMA 3TZLA 3KTFA 1P73A 4K81B 4WA8A 4E32A 1RNLA 1R0YA 1GG5A 1WCV1 2DBQA 3CP1A 5IDJA 1B1AA 2P62A 2IUFA 4G84A 1S3IA 4X7PA 3OT5A 4E5MA 4H9GA 4F8JA 1K9MW 4PGFA 3W6OA 4QBTA 2XIJA 2GTSA 1D6NA 1Y0BA 2FQ1A 3B5JA 1BSMA 2E3CA 3NHZA 4OFXA 1FVHA 4LZOA 3QBVA 3GTZA 2JLSA 1U94A 4YUWA 4IWNA 5K6RA 1XEQA 4DLLA 1FSZA 1VG1A 1W76A 3N7TA 4WGGA 3LPDA 3I9OA 4WUTA 4BJ6A 4YRGA 2EF0A 5JS7A 2JLYA 1TEHA 1DQNA 2XI4A 1LSUA 2R86A 3KT0A 1J97A 2WIAA 2PX8A 3CLSD 3C7DB 2LBPA 3U7RA 1U2GA 3F5DA 5CA0F 2OD9A 1T6BY 5EIEA 1FXSA 2FGJA 1BOOA 3SQOA 1RXCA 1TM3E 5IFLA 3EASA 4FXPA 4XX0A 4S1VA 1OXBB 2PTMA 2WAYA 1E9SA 5HFAA 1K6JA 1HDOA 3M1YA 4FE4A 1BE8A 4NCBA 2DECA 1XP5A 2GMWA 1YRQA 2PSFA 4W4TA 4ZZ2A 2PZSA 2DERA 2YIBD 4OHPA 3HM2A 4W8HA 2YV1A 4WNIA 4XOIA 1DBRA 2R00A 3DFFA 2DWPA 5BRNA 3OX2A 4W9MC 1YR6A 4DREA 1V8BA 2HK8A 4LZWA 4RJTA 5JZOA 4B3HA 4FHCA 3FOZA 2Q8QA 2RI6A 3SBEA 1PZNA 4IOKA 1SZDA 5K3EA 2R68A 3RC3A 4CF6A 4DZZA 1A9YA 2G72A 4EMTA 3EH1A 3MWGA 3Q6MA 5ENVA 4A6XA 2UYQA 5GAJA 4WOPA 4QQKA 4XGNA 3FSGD 1A27A 1J0CA 4F2DA 2JIDA 4HNAB 2JS3A 3TPZA 4OAQA 1ZRSA 7ABPA 2B4AA 5E7IA 1OTYA 1SXJA 1ZMOA 4JA2A 1JKMA 2NYRA 3HBJA 3NRJA 5IBRA 2IL1A 1GG2A 1ZCZA 3R3HA 2XOXA 2JFXA 4H6VA 4AN4A 3OOWA 5A5GA 1DAIA 3LMKA 1BXGB 4FMCB 3WDLA 1SKUA 3SR4A 3UJHA 1W5BA 3JYCA 1UMBB 2H59A 3MINA 4FWIB 5G0UA 2XA1A 3GLUA 1C1DB 4CM4B 4CT4B 3GEMA 2OHVA 1NXQA 1REQB 3ZMVA 1BKSB 4CLEA 1R1BA 1Q0TA 1SXIA 5SYMA 2AJBA 1P49A 4G28B 4IMRA 2GPNA 4ZEXA 1Z13A 3T0GA 1TDJA 3ZI7A 4MVJP 1OR8A 1WB6A 3PQDA 2X5KO 1N7HA 5LQAA 1PR4A 4O4HB 4X3LA 1P3JA 1U3DA 2CTQA 5H6RA 5KPDA 5FA8A 4FLUA 3OUUA 3CMAF 1NXXA 5C18A 4TKMA 3RTDA 1YITV 1XDDA 5K0CA 1WB9A 3IHLA 3QITA 3K0FB 1Z26A 4G4XA 3HVKA 1EVLA 5DN6G 1TO6A 4K6CA 4PO3X 3BYZA 4YFVA 1MMFB 5E7QA 2WG1A 2EHJA 2R5FA 2CLDX 4N49A 5CDGA 4QXAA 4YJHA 1LBTA 1JV2B 3PPWA 2OQIA 4HGOA 4DPMA 1BXRB 2CLKB 5KTPA 3EPLA 2I5PO 5LGNA 2FN9A 5EHZA 3LTNC 3T3EA 2NLJC 4EUFA 5DWVA 5CYPA 1SC5B 9LDTA 3CH4B 1UDWA 1CHDA 2PWPA 3ICPA 3JVDA 5AHOA 2R8RA 3OMLA 2QMHA 3DD5A 3X1YA 1ZD8A 1Z2CA 5JASA 4YREA 1R3IC 1ESEA 2IELA 3ISTA 4FNMA 1KZ6A 4Z7JA 3ADCA 2JLQA 1D2GA 1K3EA 1UMDA 3GJ3A 3QTTA 1BZKA 1G4AE 1ZK4A 1IMOA 4EYQA 1EX9A 4YIPA 1OB5A 2P27A 3T0FA 1C4KA 3KQOA 2EFJA 3BXZA 4BX2A 1ONOA 2AMTA 3FSRA 3W6PA 2IHNA 3KDAA 1RDFA 2WSIA 2GDJA 3EVCA 5T64A 4JNKA 5DM70 1AKWA 3LXMA 2VUSA 1YKGA 3EFOA 4GI3A 2FRDC 4AF8A 2VHWA 4QATA 2YRWA 4EL5A 4AF6A 3NCHA 4MTGA 1MUUA 4C05A 3UPUA 1GTRA 3DZBA 3TAHA 4AC9A 3O2NA 3K0SA 4QGBA 2GEUA 5JY1A 1OE0A 3HCAA 1QFZA 5LQJA 2I6FA 2ZYIA 2ZR7A 3E15A 4WK4B 2QRJA 3SAJA 4AY6A 1GLGA 2QVCA 1WE2A 1KEVA 3AF3A 1E20A 4PDMA 2O4UX 1JJVA 4NICA 1WXQA 5COQA 4BX3A 2W6JG 4RQTA 1YB4A 5I5GA 4G1BA 4KUHA 3WWDA 4B3IA 1N6KA 1YR1A 3AF1A 3D0OA 2H9AA 4UBJA 2HJFC 3PE6A 3EX7C 2W8BB 3ZXSA 1RQ2A 3R7LA 2C82A 5FTWA 5ETJA 2E5LO 2Q5CA 4KPUB 4R6ZA 3DOHA 4ECAA 3E20B 4HX5A 4G86A 2EKBA 5LJIA 4BLWA 3H1BA 3FNGA 2ZBGA 1F0PA 2V9PA 3MZ0A 1VSVA 1QVZA 5EXPA 3ZIUA 1QRRA 4B3TB 3CLTC 4ND6A 4DA9A 4QYSA 4R8CA 2FFRA 2Q6LA 2KM1A 4U1RA 5EJ5A 2D3OW 4DXHA 5JNTA 2XDYA 5B5EZ 5AVXA 3PDHA 3GWOA 1MQSA 2OILA 2V5VA 2YJNA 2NNUA 5C1OA 1QKKA 3HB1A 3ZVKA 4FQ5A 4LF4O 2Y2UA 1COWG 3QA9A 1GGNA 4N18A 4LFBB 4P4GA 4YT8A 2OBYA 1I3MA 1KH3A 1M0TA 5A9RA 1H8EG 1JIVA 2WY2D 5K4HA 1DRJA 1N5KA 3FAVA 1SQSA 2I6TA 3IBFA 3PFBA 2YEVA 4ZYWA 5J59A 1E61A 3RSOA 9GPBA 2OPBA 1XJQA 3A1VA 4II3A 2ZCVA 1T5EA 1QQ5A 2G6TA 2I4TA 1RMYA 2I78A 4QPZA 3G85A 1R4MB 2FPMA 3PQ8A 3RUDA 3MVEA 4ZJPA 5FWXB 2OV1A 2D74A 3COVA 1UJBA 4KUEA 4EHNA 4JWKA 1LRKA 4XWTA 4YXWD 1Y33E 2JANA 2P9QA 3N8HA 3QF4B 1QRSA 2C4WA 5E2IA 3M6XA 1VHAA 3V7EA 4E2YA 3UC5A 3R0ZA 4A1OA 1BMFA 3OTHA 2ZYWX 1MC5A 4CGYA 4I8IA 1XMOO 4EZIA 4BBZA 1RWNA 3N27A 3IA7A 4CV0A 3IVRA 4Q3OA 2AXNA 2YJGA 4UMFA 1EFHA 1LS6A 2ZIUB 3W5JA 1M1KW 5F7XA 3EBPA 1T0JB 3LO8A 2YZGA 4BFZA 1RLUA 2JS7A 2ZJOA 4LOLA 2PL5A 1BQ3A 1E2DA 2GF0A 4AXBA 4ZCIA 3G80A 1E62A 3R66A 3E9RA 4ZVOA 3DEAA 2IZ5A 5C8ZA 2XWBF 1KMQA 2ANBA 3R44A 2XZTA 4ZAXA 2AC2A 2JGJA 3L82B 2QRVA 2FY8A 2FPIB 1V71A 2R7MA 1SCUA 1GYPA 4J2TA 4QYIA 1R6AA 1DZ3A 2HVKC 5NLLA 5JS1A 2OTJV 1NRWA 4PCVA 2VSFA 2YQ5A 2ZP1A 3EUEA 2FK8A 3LH5A 3EGVA 2WLNA 1DBQA 4FDMA 4GEKA 1IMJA 4EA6A 1APBA 4Q9DA 1DXYA 3PUIA 4CI0B 4EYGA 5DU2A 3FPEA 1JA1A 2GTAA 2PLNA 3M2PA 4EFNA 2ZJ4A 2BRUC 5DNVA 3D0RA 1ACLA 1JSRA 4DW1A 4E33A 2L18A 3UGJA 3W1VA 1FDVA 5CBFA 4N12A 2A86A 5JI3E 1Q1EA 3FH0A 3CPSA 2V4UA 3OZDA 3JYNA 2B82A 3A58B 4ASUA 2OV6A 3MHHC 1RCTE 3HCBA 4AWBA 1UWVA 3LT2A 4DB2A 4J2OA 3NWEA 1PHPA 2ATCA 2ST1A 4MROA 4HH3C 2HRQA 1YQTA 2Q68A 1MQ8B 3QVMA 3B2EA 4CF5A 4EYOA 1SVMA 5IAKA 2OT5A 1GDHA 1ZMTA 3C3AA 5KOYA 4X1YB 2CSXA 4XDKA 4MR8A 2GN2A 2UZHA 3HJCA 1W5FA 1XCLA 2E6UX 2IM9A 3F0DA 1WSWA 3PB3A 3LQ1A 2BW0A 1M2VA 3ZTTA 2PVPA 2QEXV 1S5HC 3G8BA 2AOUB 3T9BA 3MMSA 3GLIB 1T9DA 4NK5A 4HZ3A 3O8DA 4LW8A 3TSZA 4OV6B 2DJIA 3IAFA 3IT1A 5EWLA 4JP3A 3ZRXA 1TZBA 2O0HA 3U4QB 3QKSA 2GEVA 4BLUA 2FOLA 4AZ3B 3F1LA 4JQSA 3W6NA 3DBLB 2J7PD 1JXAA 4WNAA 5E1MA 3T1YO 3D6TB 5JG7A 3UQZA 3JVHA 1EXDA 3VU3A 2O5RA 1KWGA 2RDMA 1X94A 3KJKA 3KEMA 4BO3A 4V0SA 2J67A 3CVWA 1NS1A 5LMNB 3BWDD 1KEEA 2HJ9A 1UZLA 1XE3A 1IHOA 2PVCA 1F1BA 1NF8A 2H65A 1RM3A 2WUEA 2YVKA 1H8ED 3EHDA 3OKFA 4NR0A 4NV1A 2QD3A 3N0RA 5FOQA 3RAFC 1BCCH 3I56V 5E4JA 5LQUA 3LVQE 1Y5LA 4TRJA 2PAAA 1JHDA 1ULZA 3EIFA 1Z22A 1Z4QA 1ONIA 1GP2A 2GD6A 1E2PA 3O91A 3MWEA 3V1YA 1E6MA 2NXNA 3DFZA 3ZUPA 4C0WA 1NGSA 4KN9S 3ZX5A 3DVAA 2VP6A 4UPDA 5CEEA 1SBIA 5A2QN 2P2GA 4IFTA 4NQZA 1D1PA 5FLXN 3L8ZA 2UXBO 1NPYA 4CHGA 1VG9B 2BGUA 4FFSA 4TRMA 1ZJJA 5K51A 4DJAA 3H4TA 2QGNA 4YLGA 1R6NA 3HY3A 4X61A 5K8UA 2XWJI 3AR9A 4KL8S 4BTLA 4CQNA 4DR6B 2VP4A 5EWMB 3WBFA 4B8ZA 1YDGA 2GBCA 3A9VA 4Y6OA 5TVGA 3RT3C 3HDGA 3VJLA 5LP6F 4HEHA 1XNQO 1LRLA 4DIEA 4ZEMA 1NKTA 2A4MA 4P81A 3T3OA 2W7TA 4LFAB 2FRDA 4M88A 5JQGF 3ICEA 5EXSA 4X65O 1JQDA 1J2UA 4FFOA 3LZ6A 4U7PB 5TQVA 1UK9A 3WE7A 3JSLA 2V0NA 4M37A 5ALXA 1Z8FA 2IV3A 3K8ZA 4CM8A 1II9A 2JFVA 2IDMA 1K5PA 2JAHA 4YO8A 4UARA 4EZBA 1ZITA 4U8HA 3O95A 3WPXA 2EIKC 3JXEA 1L0NH 3Q4HB 1BDMA 2CWWA 4GCZA 1VDMA 2F93B 2FZ5A 2NUPA 4JWTA 4BB9A 5A4DA 4MVWA 4PA6A 1DKMA 4L4SA 2Z95A 4C4OA 4KIFA 3G1UA 3A1DA 3BD8A 4BV8A 4HVTA 3CIOA 4TLMB 5G02A 4NZMA 3QJGA 3ICCA 4U7JA 4BZPA 1MOFA 1LC3A 2ALJA 3ANYB 1D6MA 5EYPB 4OYRA 4Z2AA 1PR9A 3K0AA 5B57C 1W6UA 2HK7A 3SS7X 1CR4A 1FNMA 5FOSA 1JA0A 1X7WA 2QAIA 2X2OA 1V7QA 4XSGA 1W85B 4OQXA 4QSHA 1GGFA 2DVMA 3G9ZA 3IOYA 5GVSA 5AOAA 2X9GA 4LJ6A 1NONA 2E89A 1U0LA 2EQAA 2HQ1A 1WHSB 2WAOA 3IAYA 1L1RA 5BMVB 5EIWA 4EITA 4M76B 2A7WA 4WKPA 4BMNA 2WFLB 1HWYA 2RGDA 2BMFA 1D1SA 1BO6A 1IK6A 3DP9A 4P9NA 1W2HA 1A5SB 3GDWA 3KQPA 2ITDC 1M4UA 3QYJA 4JT8A 5CVUA 1WMSA 3W7SA 3EY9A 3OA0A 4EYKA 3ZE9A 3ESQA 4KRXA 1P4HA 3FCXA 3H3FA 2WWVD 3U3JA 3U37A 5BRAA 5LKAA 5KNLA 3MCZA 3E84A 3PC2A 4ZQEA 2KBFA 3HXMA 2RK3A 1XK6A 3FWZA 1OPXA 3LUPA 3L0DA 4UTVA 3RUIA 2XHZA 4R1LA 4B48A 4EJ6A 4G4VA 1C1HA 1U1FA 4IX1A 4YP1A 1QAMA 2JBHA 3DMGA 2RAFA 4P3PA 5JI2E 4H0NA 4U6SA 4YCJA 4WL0A 5IRCD 1H05A 2Q0XA 1QHEA 3RRZA 1H3FA 2FW6A 2PA0A 3K9CA 4L5YA 1A2OA 1C9DB 4FONA 4K9DA 2WQZA 1E1RG 5IW8A 3SHTA 1XEXB 2P35A 2WHPB 1FVOA 1QR9A 4B6JA 4MO2A 1YR2A 1X86B 4MMXB 1E66A 1ODJA 4WEQA 3NO4A 3K4QA 1E3EA 2OENG 1HG0A 2X8JA 3CEMA 4GBJA 2XAHA 3R5FA 4NZNA 5ESRA 5BSUA 1DVRA 1CNEA 4RF4A 2FMTA 2HBYA 4MS3B 1G0OA 4ND4A 1U96A 4D8XA 4W5RA 3OZIA 2PAFA 5L3BA 1U0SY 2QX6A 3NANA 5LXTB 4RY9A 5TMEA 3TGWA 3G2PA 3FYCA 4INOA 1XYVA 2XQGA 1G42A 3OTOO 1PV1A 3RW0A 4CVNA 5KNCH 3OZRA 5AW2A 4PLPA 2VUUA 1X7ZA 1LS1A 1MO4A 1W4RA 3GL9A 3HY6A 3LDAA 2HJDA 1VQNV 2GCEA 1YIOA 3MERA 4JBIA 4C22A 1KGDA 2PWZA 4AP6A 2FQQA 1P0FA 5CNJA 1MRNA 1RRFA 1UBSB 1I6LA 3USZA 4B3JA 2BTOA 3OM3B 5I8ZA 1VQOV 1Q1AA 3AM4A 3AK3A 5EGNA 1Z4MA 4R98A 5EJAA 1LV7A 3K04A 3R0PA 2G9UA 4BU1A 1XQXA 4DLNA 3EUWA 5HWEA 2OO5C 4PX9A 1L1FA 3Q11A 1Y9ZA 4GLOA 3G9UA 4I3HA 3VJRA 1IG3A 4DVJA 4CU5A 2FEWB 4MLPA 2VKQA 4OLFA 1XELA 5L3CA 3T3NA 4BLOA 1CUDA 1FL9A 3L07A 1P4SA 3SIVA 4G5GA 1JDUA 3T5CA 2XW6A 2GA9A 5FLXM 3DXZA 1AMOA 1GZSA 2PT9A 4JSRA 4I4IA 2IEBA 2QPAA 2BGGA 1C3VA 4Z4FA 1W88A 3TMAA 1QYDA 1K98A 1SBNE 3TRJA 2B4QA 4HDKB 1XN4A 5FAXA 3ZLJA 3WGKA 4QGFA 4CLDA 2V3VA 4NXNB 3TOXA 2AXTZ 4TV8A 4TYYA 3G6KA 1E2JA 1Z45A 2HIAA 2P8SA 1E3QA 2D8AA 3NTOA 1UBTS 2H5LA 3RVQA 2Z6QA 5M3BA 1F5SA 3HM9A 3KQVA 1VQ1A 2QR4A 4G1UC 3SVZA 3FDJA 2FPGB 4HMQA 1B0AA 3HCPA 3TL6A 2JNBA 4PZ0A 3HJNA 3QENA 4D3SA 5JR3A 1NMQA 4IVQA 4MH0R 5A4IS 1EX7A 1OYYA 5BYAA 1BGYH 2RGAA 4OBWA 3M6FA 3ZVNA 2FJ0A 2DCUA 2R4TA 3T95A 3DPIA 3ZRWA 3FM9A 1NQ3A 3THYB 1DX6A 2CNWA 2R3SA 1Y3DE 3BRWD 3CFYA 4IJVA 4TZ6A 3SQDA 3BERA 1EFDN 3OKAA 1M67A 5CU7A 4LYJA 1FDUA 1YJWF 1LPMA 3M4SA 1M1YE 2D0OB 3H6GA 4QQ8A 1NQTA 2A67A 2CFCA 1XEXA 1L7RA 2Q9UA 3GT3A 3AUFA 3QWHA 5ULLA 5AVSA 3MTBA 1W9HA 2QDXA 2NUAA 3GFBA 3PT9A 4QSMA 5AVWA 3SSOA 2C7RA 1SZJG 1W93A 1ZW1A 2I65A 3F5QA 5F4BA 1S9DA 4UZSA 1Z8HA 1AJEA 4TXNA 2HS4A 3GFOA 3H9CA 3QO5A 1EB9A 2QPOA 2XNDD 4CTNA 2DCMA 1UPGA 1XB2A 2VPQA 4N3BA 2LGWA 3I9FA 2XVZA 3ZP4A 2GD2A 4Q7MB 1UJ6A 1HH4A 2BFEA 2C1ZA 4K6HA 5FQOA 3Q41A 4ARZA 4CM9D 5LYYA 3CE6A 2X8BA 3SDSA 5F9MA 3WHIA 2IDKA 3ELBA 1J1IA 3LNMB 3K1ZA 3NPMA 2DAPA 3PDJA 4Q48A 2FFAA 2I54A 3ZU5A 1P5FA 3W8RA 3T5AA 2FE4A 3WLLA 3B6IA 1GIAA 5DXJA 3J81k 1D09A 3RWRD 1NF2A 3PNKA 4GRAA 4OHVA 3KXLA 4ARBA 2FSVA 3KDSE 4UVBA 1FPOA 3EDYA 4BLSA 4FNOA 4IDOA 4E2FA 4Y2QA 1II8A 3GPIA 2QUHA 2AKAB 1CDZA 3UO3A 1PR0A 2VZEA 4IH1A 4O29A 3IFXA 3E35A 3E86A 2IY7A 2LGQA 2ZR8A 3UKMA 5H7XA 1ZGAA 4EB6B 4Z3OA 2ORED 1BVHA 4LX8A 4PX2A 4X1OA 4ZYUA 5KTMA 3CZAA 4EG1A 3OQBA 2X2FA 4IYHA 2GR9A 4CMCA 1KYOF 3BMQB 5F21A 1UC9A 9ATCA 4OMDA 3GZNB 2C7PA 3F0TA 2VJDA 3K1AB 1XPOA 2CMHA 2ZSFA 4NS4A 4LF4B 3ZX6A 1WD7A 4TMFA 2PBRA 3F1KA 4OFWA 1QH1B 4F46A 2N3ZA 1COWA 3OPVA 3QLJA 4YRZA 3BWYA 3D6VA 4Y7DA 1YVRA 2BUBA 3LP5A 3QLUC 4N03A 4HHEA 3A11A 1QS0B 1L7AA 1SC4A 1SC1A 3A1TA 1UDXA 3I37X 3RW9A 1R6XA 1YK1A 1I4EB 2W2PA 4C9BA 2WLLB 3NU1A 1DSSG 4IV0A 3E4CA 4BNMA 2QOEA 3R3XA 3F97A 3SM9A 2QKCA 3DWEX 3BB1A 3OCXA 1M34A 3BMCA 2EW1A 3RAJA 3GQBB 4UNQA 1XR3A 4BU0A 5JJLA 2IYVA 4MRSA 1SCIA 2MSDB 1OYVA 3BMOA 5B1YA 4B6PA 2IZ1A 1AH2A 2QUZA 1FP1D 3K96A 2PSSA 2PX3A 3MCAA 4G0VA 2J08A 5J3JA 4JV5B 1DDOA 1I4OA 4OQDA 5B4VA 1Z36A 4JK3A 3FRJA 5ILOA 1OHHD 5EN4A 2NN4A 3DVLA 1PJLA 5LQKA 2XOEA 4NMLA 4K7JA 2BE9A 4XIJA 3PE4A 4EWLA 1BQ0A 1GNLA 3H3XA 3SHOA 5AR1A 5IANA 5IZ4A 5EZ6B 1JU3A 4G5SA 4L2IA 4A0QA 1SBZA 5KNDA 3MXOA 3P0FA 1EG2A 3LQQA 3MUEA 3RV4A 2C2AA 4M21A 2WHQA 3PRYA 3F2VA 3C3XA 4DV3O 2W2MA 3IB3A 2A0LA 1XKQA 2ZTVA 3KTAB 4PQRA 3SE0A 4OFBA 4KXQA 4LXHA 2Z2XA 2Z58A 2PYZA 5LMUO 1BEUB 1BH6A 2HL6A 1E2EA 2WLSA 4JUAA 1DFIA 4XB6B 3JQAA 4Z1MG 3HN7A 2ZBUA 3TL3A 5SICE 1HDXA 1ORWA 1WEKA 4EFBA 3NAMA 2H1WA 3I05A 5EUMA 4G0WA 3FMPB 4UM5A 1F8UA 3R2JA 2PVSA 3VTAA 3K8QA 3PQ2A 3UBMA 4NF2A 3UKOA 1XMJA 4HRYA 3NHMA 2R1TB 4YP7A 4MVZA 4L16A 4HQFA 3TLAA 1JEQB 4C4SA 5EWMA 4GI5A 1WZIA 1I7PA 2QLFA 3EZYA 3R0XA 9MHTA 3ZE2B 5C8VA 1Q6IA 5BO5A 2YY5A 3NETA 4HZGA 5DLYA 3RVSA 2A0WA 3LT1A 2GSDA 2O2CA 4HRXA 1R5OA 2C5SA 2JIPA 2PS0A 3MT7A 5SY6A 4ER5A 2O52A 4FZ5A 1QLEB 4RFSB 2FLVA 4RYDA 2O3SA 3N2ZB 3U0OA 4Q3DA 1MZFA 3CCSF 2GBOA 3RGBA 4UQLA 5H82A 2P77A 3OF2A 4PR3A 4QDXA 4X1KA 4Q9IA 1V0JA 2R72A 5HIMA 4DLWA 3ABUA 2H4WA 1SETA 4F6RA 1B16A 4QTZA 1GAJA 1Q50A 2KTUA 2EINB 1KH2A 2GO1A 2NVUB 3S5JA 4EVSA 5KI6A 2WFZA 3W5VA 4A5SA 3UJ8A 5FPHA 2WZCA 4MWTA 4N5LA 5LCXA 3Q9NA 2XA2A 4FE3A 3HXPA 4DOMA 4WESA 4ILEA 3PIDA 3KSZO 2VQFO 3V6MA 4YJ2A 5AXCA 1BKDR 1ZRMA 3JQRA 2AN9A 3CXCF 4MVOA 1T13A 5ERYA 3UIEA 4YAUA 3ILVA 3QZUA 5TRTA 1G59A 1XHXA 3HXTA 2GTPA 3M1IA 3OZAA 2OORC 3G7UA 1RM1B 1DADA 1VRVA 2RGNC 2XITA 4BKRA 3LU1A 1KO1A 1CNFA 3ETGA 3QE3A 4UM7A 4BYGA 2P5OA 5B55A 1M74A 2TMYA 1HSOA 4EO9A 1B04A 4KSCA 3SLRA 3BABA 4UQPA 1RRMA 4I6GA 4XGIA 1R9GA 3IUQA 1ZIXA 1KK1A 2OCLA 3GH3A 4QELA 3ULKA 3TN7A 5IAEA 3ZK8A 1C50A 2ILTA 2Q0OC 4GKBA 1SB9A 1HT1E 4DLYA 1N8RW 4ER7A 3R75A 3GG9A 1N2OA 4RTNA 3ORSA 2R65A 4AWAA 3NMUF 2XCUA 2F1RA 2OBLA 3P9QA 1V3VA 2ZRLA 4C0AC 3MCWA 1JHXA 3RFXA 3TQRA 1H1LB 3G2NA 3GMIA 4Z1VA 1GZ4A 4JYBA 2PLWA 3ENNA 3P9SA 1T1IA 4X8HA 4AROA 4P2GA 4CMAA 2P90A 2I9KA 4B7UA 3C3CA 3QPUA 2WBLC 4P38A 4R5HA 1Y6XA 1KJQA 3JQ7A 4K03A 1KTIA 3H5AA 4B3MO 5HKLA 3U3MA 4KQ6A 3K14A 3AFNA 1ICEA 3R23A 4NS1A 1UQRA 1N8SA 3JU3A 2OZKA 4DJDC 4DR6O 2RHHA 1VC2A 4GEGA 4QHTA 3IPRA 4U2CA 1QCZA 2RHLA 2M9MA 3DV0A 4IRUB 4QBIA 3GVHA 3T5MA 3FZGA 1ZVVA 4XPIA 1OIWA 3HS3A 4RAIA 1RZVA 2ZYRA 3D8BA 4MS4B 1IONA 3G2QA 3QGMA 1D5WA 2BISA 1B41A 1RPOA 2YXEA 3LTEA 1UBJS 2FEPA 3HXLA 3NOQA 4Y9DA 4Y8VA 2LDXA 4YMTA 3KQNA 2P4EA 2HHAA 5LZ4A 2MMGA 4E4TA 3QYFA 2HP8A 2OGUA 2W2QA 1KIAA 1KVSA 3WHLA 2ZRGA 1Z28A 3HVRA 1A8SA 5I5EA 1QIIA 1WM1A 1U0FA 2Q7GA 3Q0TA 4O2BF 5DLQC 5DSZA 1BT8A 1RAAA 2QJFA 4QL3A 4B5KA 4MDEA 5KKNB 1QLNA 3LOPA 4V0ME 1DRKA 3NBQA 2EQ5A 3I8SA 4MTLA 4ZHQF 1LI4A 3TBFA 3REFA 2EG5A 4PA7A 1F7VA 3VVBA 4O5AA 4UATA 2ZJ1A 1VMAA 2V4ZA 4HGRA 3QA3E 2KLBA 3UV3A 3QXCA 2W6ZA 1QG2A 4R40A 4KQ9A 1CQIB 1PL8A 1J0EA 1O7JA 1L5MA 2ODPA 2PWYA 2ZJYA 1YDFA 4P34A 3REQA 1K7EB 3K8OE 1JMVA 1N75A 1G9XA 1P4AA 1E32A 1QV6A 1IRXA 3OIDA 3DMRA 3CCMV 2P9TA 5BSRA 3PD0A 4E30A 2ACWA 4B46A 2D1TA 4XGRA 1A97A 1QANA 3Q7QA 3EIWA 2UAGA 4QNNA 3NEAA 1LCIA 4JAUA 3QE2A 1LBEA 4UHEA 2VCEA 5C0OE 3RQIA 3V1UA 4B4OA 2D2IA 3HYCA 2WT9A 4RKFA 1KQOA 5EE9A 1WKCA 3PC4A 3T38A 1B8PA 3ZHRA 4EHKA 4H4DA 2ZRIA 5BSGA 4DR4O 1Q21A 3OIUA 2G06A 4PZAA 5LB2A 4YAIA 4BNUA 1J99A 3FOFC 1XZ8A 3ZOZA 2YVLA 1T4MA 1FW8A 2W6JD 1PE0A 1E2NA 2Q9CA 2ZAYA 4NU8X 4QARA 3ABMC 1OAOC 5ESXA 5ADUS 5AM0A 3E22A 1YB6A 3FSJX 1FYVA 1N0IA 3NHKA 3WMXA 4JY7A 3W2TA 2AB0A 2ZTUA 1GGJA 3GGGA 3LUHA 4KFSA 4LHYA 3SX0A 2WWRA 3ITNA 5KNCD 2CWDA 1YRLA 2YH2A 2I2DA 1WCXA 1E99A 4BIZA 2GF2A 2WE8A 4HLQB 1Z62A 1KZ7B 4Y0VA 2O0MA 4A73A 1U7PA 2P1ZA 3CXRA 3DUWA 3ML0A 5DN9A 1KU0A 3CLVA 3QG1A 2HIGA 1I7DA 4MJXA 2VRZA 3D8TA 2JH3A 1SWWA 3R9XB 4LMPA 1F0KA 1K7XB 4UHHA 2CEKA 4ZO4A 5AJHA 1NJSA 1S4QA 4Q03A 3OHMA 4EKYA 4A82A 2HM7A 3GXBA 3NEYA 4MPJA 1U0NA 1EZVH 4R2XA 5J5AA 1FNNA 3ZWMA 4I4TF 3NH9A 2WSYB 4DA6A 1GY8A 4J8PA 3OE7A 4HJXA 2ZGVA 4RHCA 1LRJA 5B1BB 2YIBA 2ET6A 3D7KA 3JTEA 3C24A 3SJBC 1QLEC 4LWSB 4C7XA 1YJ9V 3L0PA 1IVYA 4FZVA 5I7EA 4EHBA 2PMPA 1G66A 1X9GA 3JQQA 3OQPA 4UEOA 5TS2A 4RHAA 4EAQA 3HJFA 1Z2EA 3PRHA 3HO1A 3B3QA 1IN4A 1X1EA 4DNOA 1C3JA 2LCQA 4DMKA 2BEVB 4D81A 4KQKA 5LA6A 5EJIA 4DCCA 2BYTA 3AHGA 3CG0A 1W30A 3BWBA 1CJBA 3MTGA 3P97A 2EBWA 4IJ5A 5EIOA 1L4KA 4OX9B 1CERA 1HXHA 3VBEA 2CT8A 9ABPA 1ZHHA 1GZUA 1C9JA 1R15A 2QSZA 2RG7A 4N5HX 4X95A 3VR6A 5L7TA 3QNUA 2W6PA 4Q7JB 2WWXA 3O03A 4MUHA 1RHQA 3OZXA 3AHCA 3TINA 4HVLA 4JJZA 2Z09A 5KNBH 1EXVA 1ZA1A 4WACA 4E5PA 5CB0A 2PEZA 2ROQA 5HY4A 3OVMA 1GPMA 3H5IA 3LX5A 4W5QA 2XX3A 3OUZA 521PA 4R9UC 1L5QA 1YJNF 1G5RA 2D7CA 3LW8A 1Y8QA 1ZH8A 3GY0A 4S1PA 4AM8A 4DT1B 4RZ2A 2EJCA 5L8VA 1VKJA 2BWJA 4UVDA 3U2QA 5BVHA 1N2XA 5ABPA 2ZS7A 5EIXA 1VLVA 4HLNA 1W75A 3CSDA 1QFJA 3OJOA 4RPHA 3TOZA 1WD5A 4EY6A 4HVCA 3RSZA 4HY3A 2QTLA 4NHEA 2O07A 2Y2VA 4J7CA 2FOXA 4Q1DA 2WDPA 1OFGA 1I0IA 1YS7A 3PVZA 5EVJA 1TZCA 4E1VA 4X6YA 5TQ0A 1M2FA 1YFJA 1AF4A 1CRZA 2MSWA 1UPBA 2PXCA 2H3OA 3ABZA 1GNQA 2WUFA 1YZBA 3EDCA 3FLMA 3KU1A 4TM8A 3WLJA 2ADQB 3H84A 1JEEA 3ORQA 4HDSA 1XXLA 4F9TA 3KTOA 3O4VA 4I4TB 4JLVA 2XOKG 1NW6A 5JH7B 3QBEA 1Y5NA 1O58A 2YW2A 3B2QA 2KHZA 3HFSA 1MQ9A 3NAZA 1Z5NA 2VI5A 3PFKA 5BMOA 2OOKA 1TZJA 1U9ZA 3N75A 5AKJA 3WQHA 2HYDA 4TTPA 8ABPA 3A0HZ 4FEYA 3Q0EA 1Z8DA 4R05A 4QBHA 1Y8RB 2QPLA 3STUA 1HPLA 2HZBA 4ESEA 2F4VB 1PFQA 1R66A 2QZ9A 1N34O 1CUXA 1KWKA 5EQJB 1L5ZA 5T8KC 1F8XA 4FT2A 5G40A 1XZGA 4KX5A 1AE1A 2GB4A 4G67A 2VK8A 4FYVA 1GKFA 1WVMA 1BYUA 1YOVB 2XBUA 1PXWA 2VWPA 3T54A 2G82A 3DC5A 1BFUA 1SBHA 2X0FA 1T3GA 4QVGA 4AMVA 1GTJ1 1I13A 1NMSA 2CXNA 3CT6A 3GJTA 2AZXA 4A27A 1E1LA 4BEWA 4I1OA 1EFRA 1C29B 2AEEA 3IBYA 4B87A 3SR2C 1WMBA 2CXOA 4DIOA 1WMAA 3QX8A 1EJBA 3TW4A 3CPWU 4L8WB 3WI7A 3EDQA 2HCTA 3KYDB 5K8VA 3D8NA 3C15C 1IXKA 1L9XA 2GZ2A 1AKVA 2Z01A 2QA5A 2PR2A 1QHSA 3GLQA 1KHHA 3WNDA 3CCEV 5L3RA 2DPYA 3TRDA 3JWIA 4AY3A 4Y18A 4DF3A 4DG5A 1W6RA 1QE3A 5ED0A 4LXXA 1CS0A 3GRVA 4MPTA 4GPIB 4KMSA 3KZ1E 2JRCA 3RE1A 3DNFA 1XZFA 4FZRA 5FUXA 5AVQA 2WPNA 2C2GA 2ZI6A 3VOSA 1XTUA 4R1TA 5HFMA 3NB0A 4UCQA 4UFNA 3K9SA 1JZTA 1MP0A 2ONYA 3RBXA 2L26A 2VWHA 5K7SA 4ZHQB 1H2LA 2JLXA 1M76A 2LGJA 1CKEA 3CKMA 3E3OA 4OAPA 3K09C 2Z6VA 1HE8B 7YASA 1NW7A 5CDSA 5LYJB 4O2BB 4DXWA 3KUDA 2E18A 1G64A 2QD2A 1YTFB 2Q3JA 3R3SA 5DNAA 5JLAA 3SYOA 1LBQA 3V9PA 3ZY3A 4CG1A 1GV1A 4ZVTA 1YWGO 3P2YA 3P9CA 4CTKA 1TKBA 1F2VA 3SVLA 3ADKA 4ALKA 1NVDA 3QVWA 3F4LA 5THKA 4BP8A 3GPLA 3EVGA 1RWPA 3E9NA 3AUUA 3VYUB 1JJIA 4FCTA 1ULUA 1IY8A 4CQLB 4F86A 5GIOE 1HL3A 2PY5A 3M6LA 1E6LA 4ABYA 5CCEA 4PWYA 1H48A 5C53B 5EFZA 5A2QA 4D4LA 3DPSA 1NV9A 1QKJA 3GT4A 4EENA 1ISRA 3B9BA 1JHUA 3DE4X 1FFCA 3KJGA 5EIHA 1YL6A 4ZVNA 4PW0A 3BCHA 5A0FA 2R96A 2WINI 4BEVA 2IP4A 3KWJA 3LM8A 3FPHA 3MN1A 4ND2A 3FYDA 4MVRA 4O1IA 5E6RB 2FB5A 1TEVA 4RUKA 1YVDA 3TIFA 5J5VA 1X7YA 4M0CA 5H9CA 4QIWF 1HYGA 1TM4E 3G1WA 4U7GA 3SI7A 1NG9A 2ZF8A 2XODA 2WPDG 2Z2ZA 3QKUA 4U7HA 2CUKA 1NUAA 4R2KA 3EXHB 3OPYB 3PV0A 2CMGA 3U1BA 3D1VA 4R7TA 3W2GA 2BCGY 3KQMA 2J5BA 1K6XA 1H9CA 1RA4A 1O9BA 3NJ8A 1PT5A 4KR7A 3JALB 4ZK7A 2P0YA 3SQLA 5HQ3A 2O3RA 1ZVKA 2PH7A 4DR5O 1S72V 2WIBA 2WU1A 4QTUB 5FYDA 1AK2A 1IQ0A 1LGYA 1VQVA 1HQKA 5D1NA 2NU7B 2UVPA 1A2BA 2NO9A 4WBNA 1NU6A 3DQQA 2H31A 2FN3A 3QIAA 4P84A 4URZR 3A9TA 3BG5A 3UJDA 1GU1A 4ALMA 4ZI7F 2XKAA 2RB9A 4OHYA 4OJKA 2DMRA 1P2VA 3H99A 3T1OA 3VOAA 2ARKA 1W5EA 1DDGA 1VI5A 1VJTA 3K1AA 4XFJA 4QRDA 3WIOA 1U9IA 4WZBB 2GFQA 1EZZA 3KV1A 4GYCB 2A88A 3QHQA 1G5PA 1RXUA 4IFIA 1E3LA 4JJGA 4DLXA 2D5CA 2WJ6A 3C1AA 3JR7A 5EHQA 3WGNA 4CLRB 4GMKA 4TKVA 3FWKA 1FRVA 4PHFA 5FHRA 1P1HA 4PCUA 2ZQMA 1YB2A 2P6OA 3AM5A 4JB3A 4TZKA 4X62B 5CVEA 1Z6QA 3NKVA 6ADHA 3ZGYA 4O3MA 4RPKA 4BX0A 2JJ2D 4D57A 1SH7A 3AVUA 3M3PA 4V0QA 2EZTA 1Z39A 5B3LA 5TPWB 3AR7A 3EBLA 5JSKA 5BY1A 5KDOA 1OV9A 1SHUX 1GZ5A 3H75A 3PT5A 4QFDA 1SUCA 1FVXA 5HUHA 2F8LA 3IEWA 3RUHA 2OM6A 4AHCA 3B1YA 2CCGA 1QPZA 1OLXB 2TRSB 2QJWA 4DRYA 3LLSA 2VJOA 3MCTA 4JCOA 4XB1A 2F9LA 1OUMA 5HXZA 2P06A 3LF1A 3CUEF 5DHUA 1KI2A 1GM7A 1XLVA 4FYKA 4WFBV 2OHHA 5FA5A 1XBIA 2DLNA 5JDCC 4EBFA 2GZHA 1M7HA 3D8RA 2OYRA 1P2SA 3BTSA 1XI2A 4WD3A 4ED9A 1O0SA 2C5HA 2KB0A 2YVQA 3F6EX 1PDWA 1TTQB 2HEGA 3MYRA 4QUHA 3SE7A 1YDEA 2DFDA 5F23A 1SZQA 4DJFC 2F1JA 3ZDBA 2AEFA 2YHSA 3DZJA 4FR0A 4M60A 1OH8A 1A7KA 2PNFA 3J7AU 2RARA 3DBVO 3MCVA 3O3NB 1R6VA 1F6WA 1E3IA 3NBMA 3ND5A 4KAAA 4RF5A 4TQ9A 4TX1A 7MDHA 4MUNA 1IN6A 2ABWA 3EXAA 1XMIA 1P5ZB 2WV7A 3CV3A 4DQLA 4J7JA 1A8QA 2BP7B 2L69A 4JELA 4OHOA 3KXPA 3DJYA 1OCCB 2H5JA 4UE3S 1TM7E 1ZM9A 4R8SA 2OPHA 1L8DA 2R6DA 2HDNB 1PJ8A 1PFWA 3FD6A 1IE3A 3LA6A 1JT2A 1CZUA 3FB8C 1U8XX 2Q3FA 5E2BA 4JI0B 3BILA 3HADA 5GY7A 2DQ4A 4ZV7A 5HP8A 1KRXA 3HK2A 3V8EA 3MAAC 1L2TA 2FUNB 4FILA 2ZVQX 2ZI9A 2WP8J 4X93A 1EUZA 1KFEB 2A5YB 2JHPA 4ZREA 4ENVA 3VO9A 1LW6E 4UDYX 4LXUA 3P26A 3D64A 3EG9A 4FI3C 4IRMA 3RSLA 5H9WA 2GDSA 1QH1A 3WKAA 2GO7A 3I4LA 5EZ5A 2D62A 4ZD6A 3D6JA 4N82A 5ALQA 1Y63A 3JVIA 4DADA 5IWAB 2V0CA 3I2YX 2IHTA 3CRW1 5TGDA 2W2KB 7REQA 3TRFA 2C4UA 3TD6A 2ZYUX 5FHQA 1ESMA 4QFBA 3D36A 2QN2A 2TMKA 2IOHA 2JVJA 4BTVA 2HQBA 3FCSB 1J07A 3GFPA 3SLKA 2G07A 2YRFA 4RV9A 4MRRA 1EFPA 1M6NA 2HJVA 2IZ0A 4K9KA 2I55A 3R7NA 2YR0A 3L79A 3GRCA 3ZZMA 2P6NA 4AMZA 1TCVA 3U0BA 3BEHA 3CW9A 5I7VA 3UPDA 3P27A 5TIIA 4QGPA 3PGXA 3FHJA 3U40A 4GM1A 3KZMA 1RD4A 1YRAA 4NV3A 1YZKA 1OFIA 1T3HA 2IA5A 3WIUA 4CPDA 1KFJB 3PYMA 3BHIA 3QI7A 3WO1A 1FTGA 4R4JA 7GPBA 3MJ4A 4MZDA 5A7GA 3ZBPA 2Q4EA 1SBQA 3PTLA 1IK4A 1O94C 3AUKA 3BTVA 3RAEC 2UUCO 2PWBA 2E9SA 3DE0X 5AOCA 1NH2D 3QPDA 4DUZO 4LRWA 4OHXA 4D02A 2AWOA 2VPYA 3L70H 1HOXA 2QLMA 1Z4PX 4FBGA 1M2GA 1KMHB 1JTFA 2FX3A 4BHTA 3QX3A 1QR8A 4CMKA 3BFRA 5KVVA 4OP3A 3W5CA 1WTCA 4DR4B 1RQRA 2V1XA 4PPYA 3VTKA 4GR5A 5IVPA 4JI5B 4F5ZA 2W83A 2J31A 4B35A 2QI9C 4NNJA 4N8EA 3ZI0A 1MLDA 4B85A 3UHAA 5IG2A 1S6YA 2BBTA 4HQ6A 4HWTA 1MFZA 3RVNA 5KQSA 1JDVA 3T3MB 2QXUA 3AEUB 1ATIA 2TYSB 3PD7A 4WN9B 5MF6A 5BN5B 3IUSA 1QOZA 2O1SA 3G6EF 1WXFA 3ME5A 2XKKA 1XMQB 4DB4A 3K0KA 5KMGB 2AZ2A 2CB0A 2PCLA 4I1UA 4ZKEA 2O1EA 2V8BA 3TR6A 2DGDA 4DDUA 4ARAA 1PWXA 1JA8A 1QOPB 4MEAA 4NBTA 4IIUA 2WQ6A 1NMUB 1E1DA 4INJA 3F6PA 1YTFD 2JIZD 2WYOA 4WASA 1LLDA 4J76A 1IN8A 1UDBA 1PKXA 4BZXA 2EULA 1SIBE 3D54D 4O0LA 3BQNB 3T3IA 2D0PB 3Q7EA 5BVGA 4LDPA 1FP2A 2FP4A 4RYLA 2I6QA 4BFXA 1KQPA 3WNBA 3QPBA 3AOEA 3KFXA 3O84A 5CYFA 5E6SA 2DWDC 4JYAB 1Z0AA 3LGXA 4OA5A 1AQJA 3K30A 1ST3A 3AR2A 4RKQA 4NFLA 4BNLA 5LUAA 4KPFC 3BAZA 1E60A 1C7JA 1HF3A 4FHGA 1NE2A 5FFNA 1QLWA 3DL4A 1CRWG 3M4XA 3MF4A 4NAVA 3ZIAD 2AOXA 2CEAA 4DYHA 1ZJYA 2FLWA 4UUPA 5KHGA 4DUYB 1T36A 1YJ8A 3GLTA 5DRTA 3QSYA 5KZMB 2HP3A 1T5DX 2II6A 1HE2A 4JTDB 1XZMA 1SD2A 2PBFA 4AILC 3D7SA 4FDLA 3ITKA 4JGIA 3ZNOA 5D3MB 4BRWA 5CDTA 5IXJA 3DF9A 1EVJA 4EHHA 1RI5A 1BD3A 2J5KA 4JLJA 4B4VA 3CRQA 1DIOB 1WB7A 2EDCA 3ABIA 2O3QA 3HFRA 1UL1X 2VK1A 3RGWS 4I4LA 4AZVA 1JG6A 1I01A 1XHLA 3FXAA 3UHJA 4BUZA 2OHIA 3GA7A 3GNSA 1J39A 3H13A 4X7BA 5TQ2A 2WLKA 1VQ6V 5KAMA 2J59A 5D51S 4AF7A 1Q1ZA 3USCS 1OYWA 1TM1E 4KU4A 2CL0X 5EE0A 2DX7A 3DQPA 4K26A 3WL4A 1ZBQA 3TD5A 1K3FA 2CNOA 2IK8A 4WKCA 2I6UA 2CNDA 3GWGA 4UOQA 1BGWA 3NRCA 2I80A 3ZE0B 1BDIA 3PAFA 5LL6Y 2ID4A 1F1JA 3DXRA 1U4SA 2ECKA 2MT9A 4C3UA 1QGED 5KHJA 2PUDA 2JKYA 4QOGA 1L4FA 3IUYA 4Z9BA 2YUIA 2DWCA 2JEOA 2X3UA 2V65A 3JSNA 2I29A 1CE8A 3CJTA 3LDDA 4ZRNA 1WXWA 3N2LA 3INRA 5HUQA 4JJ7A 1VSUA 4R51A 1M2EA 5LXTF 3TM4A 2LD4A 1PT9A 3IA2A 5ALLA 4RVUA 5E9AA 4MGZR 1FXVA 1NYQA 2Z2KA 3NUZA 4BMPB 1N2CB 4IRXA 1R1DA 2QTWB 1QNMA 1FEZA 3EEBA 3VR4A 3W90A 3CHXA 4LE0A 4D26A 5J23A 3P96A 4NP6A 2BHSA 4DR7B 2B21A 3RR2A 1D2CA 5F73A 2ZS9A 3DDWA 1L7XA 2VDKB 1C3LA 2ZUUA 3THRA 4LP8A 2GCIA 3EW9A 1M73E 4DLUA 4J49A 4RTRA 2VSXA 3AV0B 1RACA 1YC5A 1SBCA 2P4VA 1J23A 4MTXA 3DDOA 3OZSA 2RGGA 1S3GA 1VE3A 3S4YA 3MHPA 4AJ2A 5CLIA 1CY4A 2KMLA 5FI5A 3GB7C 1GQ2A 1JJ2U 5D84A 2P40A 5BV2P 3EORA 2H8KA 3BH0A 4K9RA 5BMVA 2OTLV 3H9JA 4NTZA 3GFTA 3AXSA 3C2QA 5HS6A 3KXIA 2IPAB 4X7RA 3AL2A 5KAPA 4B71A 1JR2A 3PFGA 5TPWA 1RAGA 2ZKLA 4A2QA 1GA4A 3E9YA 3FAZA 5LVAA 4S1TA 4P82A 1HMPA 2OTLF 3UB3A 4MTFA 1OH5A 4RTPA 1W40A 2H6EA 1QGDA 4BIMA 3X2QC 4RK6A 5FUVA 2CL5A 1NTZH 3NIWA 4NBWA 3KOMA 5CAEA 2VHQA 1WIWA 3FUCA 3R6TA 3KPJA 3D0KA 3TZ6A 4IO1A 2OM2A 2B20A 2BFWA 1VH8A 3FN4A 3GLSA 3T2MA 3O47A 4UMEA 1ZESA 3WNVA 5KU7A 2ZRKA 2FCRA 3BE5A 3VSDA 4CS3A 4UEJA 5DM6V 3NBXX 4NEQA 2A57A 5HCUA 2APJA 4LJRA 1DP4A 2ZUVA 1DINA 3C8ZA 3HYTA 1I1NA 5BPHA 4WBNB 2XUHA 5A6SB 2ZK7A 1CW2B 2PKQP 3DZFA 3H2ZA 3GJ5A 4PTZA 5HIKA 4YBZA 1VFNA 4PI0A 3BGSA 5B7QA 1Q8IA 2HQSC 4KDCA 5F9FA 2ZSIA 4FCCA 3HV0A 4D4KA 1GZ0A 3IEXA 3PPVA 3TB6A 1YI2V 1H47A 3LKVA 1K5SA 4ZCMA 2B98A 5JAOA 2YN0A 1GN2A 2A35A 3TJZA 4DGSA 1E6UA 5CAEB 1GRRA 4L76A 3IOBA 2XCIA 5CYOA 4BB5A 2VF7A 3QWAA 5FEMA 3N28A 3NOXA 1RPZA 3AYXB 4ZXFA 1NVGA 5H59A 2VYVD 1YT5A 4ZI3A 2Z0MA 1Z08A 3PC8C 1BE0A 5DZSA 4Z7OB 4CF7A 5HM6A 2GUGA 1VMGA 4AI6A 5LR6A 2NZXA 4XH9B 5K3AA 3A14A 1B6TA 2P3SA 3IEIA 1TA8A 3ZWBA 4WTOA 4G5OA 1AS3A 1DRWA 1U2ZA 2PANA 3B12A 2AJ8A 4KITB 2QX8A 3FZEA 3EK2A 1BZYA 3W1WA 2UYHA 5KWVA 3LNTA 1RPAA 1TJYA 2FPLA 4XDJA 3CWQA 1SIWA 3PWSA 3HCNA 1TM2A 1NWHA 4V02A 3ZCTA 2ZJAA 4MRPA 1WXHA 5IASA 1Y66A 1LNSA 3Q3VA 4LZPA 5KOJA 1U3LA 4IZ6A 4C30A 5KHIA 2VKTA 4LISA 1GAWA 3IQEA 5IJ9B 5FBLB 3TVDA 2NZUG 1CJVC 4TTJA 5AVYA 1J7KA 2N48A 2VJKA 3G1TA 3R6GA 2PN1A 3K0BA 4IIGA 1XQ6A 3KHKA 2Q3BA 3MSCA 1ZD3A 1LNQA 4QPKA 3DV2A 2V7UA 2HNAA 3I72A 3RSCA 2C97A 1NXOA 1R4MA 3X43A 2JDID 1PFKA 3KJIA 3W34A 2A0KA 5BWCA 4CH4A 2YDYA 4NEHB 3ZD7A 2A9OA 4G0UA 2YYEA 1L0BA 1G5FA 3E9DA 1GFZA 2JRLA 3DZIA 4BMZA 2GM9A 4GI1A 4RKYA 5KHLB 4E7OA 4JASB 4LVOA 1YA8A 2ESRA 1BDJA 1S3SA 4HX2A 4MITA 2W2OA 4UDXX 2EBUA 5CCXA 2IOFA 4IQGA 2F4NA 2GN9A 3P2EA 4M7PA 1E2QA 2NO6A 4PYNA 2WKPA 4TLEA 4UTOA 5DNDA 4OQMA 1J70A 5TEWA 2R70A 1TU0A 2GK6A 3WL7A 4LF5O 1VBFA 2ZOVA 2OC4A 2FKXA 2AH5A 2QLJA 3HHPA 5EG5A 2EYQA 3TW8B 4DTCA 4MGYR 4OK5A 3ZCXA 3IJEB 5T3UA 3E5NA 1QMPA 1ZW6A 5AW1A 3R7AA 1AUOA 1T9ZA 2O54A 1Z25A 2X23A 3OBWA 3CVYA 3S29A 3EA0A 4TWBA 4CGZA 1M66A 3BK2A 3NHYA 4KJZA 4AMYA 2JDIG 5FBZA 5AJTA 3WXMA 1SHZA 2W98A 2LQTA 1NMXA 4J11A 1AS0A 3EHBB 3ZO8A 1ZKMA 1W1UA 4FYHA 4HUTA 2RI1A 4JLPA 5IJ0A 2VDWA 1BJTA 2W6QA 4ND5A 4CKEA 2P6UA 2QXTA 3AC0A 4IIFA 3H86A 2Y4TA 3JD4A 4HH4A 4JLBA 4ODIA 4OQYA 3N8IA 2QS9A 2BH2A 4BNVA 3N5CA 5HK8A 3W8DA 3TTYA 1A96A 2IXAA 2O3UA 2CTPA 3P9XA 3EXFB 4LHVA 5JROA 3GLFA 4BRSA 3HDJA 3K2XA 2A0FA 2WA1A 4TRNA 4WPGA 4ZT2A 4B62A 1QVFF 2NSDA 5ECGC 3RVBA 2ZU0C 1I08A 2KB1A 1EINA 1VLMA 4MW8A 1XZAA 2N46A 3KD2A 3AQIA 3VU8A 1JR6A 1E7MA 3KKQA 2SKDA 3JSAA 4W7IA 1D8TA 4GHWA 2X7HA 2JK0A 3OM0A 1VQKF 1Z17A 4OK3A 1WX1A 1BIFA 3KZKA 2ZR3A 4H4CA 3PI6A 4PRKA 3ET5A 3GIWA 1PRYA 4Q20A 1N3LA 2B36A 3H1JH 1J06A 1UIMA 3JQGB 1TCUA 3U4GA 2O2SA 4R68A 2L82A 1R5BA 4RZXA 5DHRA 4O2LA 3L1VA 4D56A 3WJAA 3PDIA 3KHNA 3F2IA 3LUFA 3TSWA 2TMDA 1O0CA 2BM1A 4M38A 3G0GA 3GJ8A 5ALRA 1FXUA 1ZNXA 2J0UB 2V45A 4PAMA 1FAFA 3HPQA 3U09A 4H6PA 3JQAD 4UXJA 2YYSA 3S28A 2CKMA 1F8YA 5ALWA 3OR7C 2EDAA 1IEXA 1FBTA 4DRXB 1UFVA 1FFTB 4TVBA 3GH1A 5DK4A 3V55A 4LDZA 2H52A 4P0QB 5DM0A 4LQLA 4ZPJA 1UJMA 3YASA 1GO3F 4PM4A 1ITZA 5DLDA 1QQ7A 2RONA 1FXWF 1OZ0A 1CR1A 1WLSA 3AHIA 1NR5A 5B66Z 1P19A 2VSQA 2XASA 4HDCA 3ZIAA 4DILA 3FYSA 1SXJC 1OXUA 2B99A 3IC9A 3CC7V 4FZ3A 4V2UA 5ALJA 5LYJF 6NULA 5ER6A 1R37A 1WHTA 1BW9B 5BR8O 1ISIA 2JD2A 1P7WA 4YS6A 5AJUA 4M83A 1KMHA 3N9IA 4EF5A 4DJTA 3W04A 1P91A 3NBAA 5L3SB 2PNJA 2NTVA 3MS7A 5KDDA 2JC3A 4V39A 4KP4A 3RRYA 4EFDA 1H0SA 1NVWQ 1Q2UA 1T8TA 4GGOA 4Z4QA 1ORRA 3DEHA 4ZDWA 2H17A 4EHJA 3S0YA 3BYQA 2D2EA 2GCPA 4EGAA 2QRUA 3UY4A 2VHJA 1ORIA 1J0DA 1TZKA 4HNQA 4P5PA 1KK0A 3F7NA 2B1QA 4K0KO 1QWOA 2MSNA 1PSWA 3OJWA 1I94O 4MGKR 1M1YA 2B7BA 3GRYA 1Y4ZA 2BSXA 5JRDS 1U8AA 4KXXA 4PTLA 4IJQA 2JI4A 2ATXA 2VUTA 5ECWA 1N33O 4H27A 4N40A 1SC6A 2ZZKA 4YRLA 2MJLA 5EE1A 1LJUA 3RFTA 1R0LA 1JH8A 1PIWA 4LYYA 1E58A 1H2HA 4PZYA 4IVRA 2AW9A 2CHSA 3ZOPA 2N1BA 1Q6HA 2P9BA 3CMEV 2XXBA 3Q2IA 5KWEA 5LP1A 3THXA 2WU0A 1VE1A 1QO9A 3LHKA 5KBYA 1SHTX 3K1TA 4DR2B 3BSSA 4O8CA 5TMDA 1EUYA 2RE8A 1VE6A 3N2GA 4D0RA 2I1VB 2HFJA 4G9EA 4H1UA 3V3KA 4EY7A 1LDGA 4L0DA 5SZJA 4M1TA 5DDIP 1SCQA 3DCIA 4JJFA 4K46A 5GM2A 3ZHZA 3T94A 2QZ4A 2PUSA 2HP0B 1X8XA 2BC9A 2YZ2A 3K2BA 1L7BA 1M7GA 3JASB 3N6XA 1U3GA 4RL4A 2VJPA 4ZVRA 2VJQA 3UTDA 4EJ0A 3ST7A 4HB3A 5B3KA 1UKEA 3G23A 4QU5A 3JQ6A 1CYDA 2YUTA 4CN9A 4LH6A 2Y1DA 3D43A 3RM3A 3IPLA 3U1VA 1HNZB 3Q8HA 4GG1A 2LIVA 1BX1A 3ZDAA 3EULA 4HDRB 3FTEA 2Y27A 2WNSA 3G8AA 1NYTA 1ZLYA 3TLZA 5GV7A 1Q1BA 2GPTA 3DF7A 4I5DA 4JEUA 4MAMA 2F3PA 2C5FA 1KO7A 1N32B 1J8VA 4E13A 5CFQA 5PGMA 1I9CA 3D3JA 3GEHA 4FLMA 4EIWA 3FFBA 2VUIB 3P94A 1NQOA 3O38A 3Q7SA 1TLLA 3BULA 3AILA 5CK4A 3WYDA 3OM9A 1MB4A 5AICA 4K1LA 3ZN0A 3UFXB 4RD1A 4C82A 2NN3C 1XTPA 1DV1A 4C87A 3V7QA 3G8CA 3OMNB 1BNCA 1EAMA 3F71A 3GV0A 4H7PA 4WH0A 5F7ZA 5FLEX 4I9WA 5FTJA 4E94A 5C3MA 5C5IA 3ADOA 3K79A 3W9YA 2F43A 1G2QA 1TT5B 1TAHA 4M0UA 4DUYO 3PNQA 2GAFA 1FTNA 1UR5A 1F0YA 1K8QA 3QIVA 1H23A 4XQ9A 2I2CA 2R8BA 1BG6A 3O8BA 3T15A 4O4HF 1MD9A 4N6NA 3MB8A 4P4TA 4JBWA 3P20A 2QL7A 3T7AA 3T5GA 3U81A 4DQXA 1SCNE 4CR7A 5ARBA 2K7ZA 2UZ4A 3NWPA 3IEVA 1TCCA 2OLKA 4LI0A 4QOIA 4EF4A 3HKEA 4TT3D 1ODEA 4E3ZA 5CJPA 5EUCA 1PWHA 2YCLA 4ADSG 4OXRA 4PV1B 3GZTB 1V1MA 4ZYTA 2DOSA 1E8DA 1ABEA 1QQTA 3VI6A 1ORQC 4MCAA 3CD6V 3AETB 1KVTA 4XR9A 3NS7A 1PDOA 1NUQA 3EG9B 3OZVA 4IIEA 3ZI4A 2CNNA 5G3ZA 3SHQA 3RKRA 4LOAA 2Z3YA 3GNTA 3ZQ4A 2D8MA 1CP3A 2L42A 4MUYA 3H9VA 1E92A 1Q83A 2RKWA 5BY2A 1JVBA 4XX0B 5BSHA 1YS2X 2QJRA 2R0QC 3TD2A 1TXGA 3I12A 4F5WA 5K0FA 1P5HA 4KMRA 5JMPA 1GRVA 4G4YA 5KTOA 1LB1B 3G6EV 2QLNA 2P8JA 2R66A 4HNTA 1VJ0A 1P7YA 4DR7O 1T1RA 2Q7DA 5JQWA 3NVKE 1W73A 1T0HB 4G3XA 3ZG6A 2QGZA 1PR1A 3AI2A 1O89A 3BREA 4Q39A 4RPLA 2HA5A 2HV9A 3E70C 1PUIA 5K0TA 3VV3A 2JCYA 2QRQA 1DLIA 1GQQA 2TS1A 3T1CA 4YP6A 4CR6A 3OD1A 2XNDA 2EWCA 3M8AA 1YXBA 3C1UA 3FUWA 4H3VA 1TOAA 5LL6P 2I4NA 2JIMA 4TQDA 4Y0AA 3MS4A 4J9YB 5IZCC 4CEHB 4W1SA 1NJ8A 1YRYE 4CH6A 1E1QA 2O8NA 4F4FA 1W3EX 3BF8A 4BGVA 4ZVKA 2CVPA 1T2NA 3C14C 1KEEB 3KOXA 1YSCA 1TEZA 5ERGB 4BQIA 4F6RB 1Z5WA 2PE5A 2V58A 3PQFA 4OLJA 4QPDA 3KYCA 4HH0A 4BS9A 2HTFA 4MT8A 3GRPA 3VISA 5FAKA 4GUDA 3ZP7A 3P0IA 2ZTSA 4QODA 4CLOA 4K05A 1QFSA 4UNRA 1XZBA 3WLRA 4OGLA 3BFJA 4U0KA 1M34E 1OLXA 2DR3A 3ETQA 3PGKA 4H77A 1ZXLA 3VOTA 4M54A 3E2MA 1Y1SA 4BVLA 1MAAA 2GCGA 4WKNA 2ODAA 1G8YA 3LVRE 3H8WA 2I99A 3RS9A 3M5CA 2Q9BA 1RI2A 1KAMA 1SNYA 4N48A 5EJEA 3KIZA 1YQ9A 4L6CA 1BDHA 2O8CB 2P2CA 2ZBVA 3FFQA 3LRTA 3FYUA 3PJGA 1PUXA 1WXGA 1GQRA 3B9PA 5G4VC 2CJPA 4UUAA 3EZLA 3WLHA 3R8CA 3UA3A 4CFZA 1Z6YA 5IJXA 3MWFA 4XVUA 2JJ2G 5FLYA 2AG1A 4R3UC 2QKAA 3V4RA 2Q6KA 4LY0A 3RRMA 2E0IA 5CDHA 5JPIA 2RKBA 1G8FA 1UUFA 3NLLA 2K1EA 1YE5A 4ZBMA 3F6CA 4K6GA 5JZBA 1MORA 4JJ6A 5B2ZA 1M57C 4PO9A 3HDQA 4YAFA 4JAAA 5CA3A 1NT2A 1NX9A 1V1JA 3B51X 2JZNA 4FGSA 4H2DA 4X54A 1NUHA 2EJVA 1P9WA 1T8YA 2DBZA 2GBLA 1DELA 1JYEA 2H08A 1UBMS 2HK6A 4KV7A 5E4YA 1MPTA 2P91A 4WIAA 1AM4D 2PXXA 4Y2RA 1KI3A 5CIYA 3T8YA 3P0ZA 5L40A 3T9CA 4J4TA 1Y3CE 3U1TA 5B4UA 2O8DA 4FZ1A 4NPAA 3NOVA 3MJHA 1E94E 2QMEA 1MO5A 3IOMA 4A8JA 1O97C 2NAFA 1CUBA 3AMVA 2HQOA 3EXHA 4FKMA 4RJKA 4V0NA 4BUJA 1O03A 2CFRA 4IVNA 5HIAA 2AKEA 1DL5A 1H6AA 5AI4A 3WDKA 3VXKA 4IMJB 5JCZA 1TRHA 3INYA 1XXHE 4XD7D 1HZZA 4ZARA 2QDKA 4E15A 4GP9A 2ZWMA 3ZXYA 1WP8A 2QP9X 1ULBA 2H8CA 3KWLA 1E1MA 2GA8A 1GAXA 4KTTE 4UOZA 5BWNA 5BR4A 2A1IA 4G1MB 3RA5A 4MP8A 4JBGA 4WFGA 5ERXA 1GSHA 3K0GA 4B82A 3L4EA 1I3CA 4HPWA 4DGQA 2LFRA 3N2KA 4R2LA 4YCDA 1T25A 3I53A 4MUBA 4EG8A 2BGNA 5JRJA 5KYKA 4JL6A 2VQEO 3JTMA 2QP3A 3JQ8A 3V4DA 3NP7A 1H9AA 1OWMA 1PI3A 3T4EA 4D3ZA 2YQZA 4HG2A 2Q8NA 3BK7A 3AT1A 3IIKA 1JTVA 5HEKA 1AGNA 3VNVA 2B5OA 2X7XA 1QJCA 3TSOA 1TKAA 2J3IA 2Q3HA 3UQ8A 4EUHA 3BF7A 4DRZA 5FXMA 1YONA 2ZJZA 4TTSA 4IH4A 4K9MA 4YIHA 1EDZA 5AG2A 4TZTA 3WX0A 2HPZA 3L8GA 1COWD 5DYYA 4R0VA 4J0GA 4R71A 3EVEA 3JYQA 1SFRA 3LDEA 3VOUA 1NNSA 2BGTA 4WKOA 3WJPA 1XRRA 4L87A 3L8YA 1JE0A 2VWKA 1MNQA 1V39A 3U0ZA 2JIRA 2AVNA 2YHBA 3BL6A 2IBZH 2ZBPA 2AV6A 4IAOA 2I3DA 3NOOA 2QVGA 3ZLTA 3OZTA 2KLHA 4A26A 3D6HA 3RU7A 5EMKA 3PA8A 4KIWA 4A6PA 5HKAA 3S8YA 1QQAA 2QX7A 5AWFC 3BXGA 3OI7A 2IHUA 2DQSA 1GO0A 3OD5A 1GWNA 4JB8A 3UXHA 1QZXA 1RWMA 2JCVA 2QW0X 3MEQA 2I3AA 3W5BA 2VC2B 5IMSA 3E82A 4RLHA 5IVIA 2BTQB 4H6WA 4B08A 3MMXA 2RIPA 3RIEA 3VQWA 3AIIA 2REQA 3HZOA 3HWRA 5BNWA 2QUAA 1ZX1A 3M3DA 4EMUA 5JWRA 3QBTA 1IY1A 3PLRA 1LUAA 4MQBA 1IZ9A 2FN8A 5IM4F 4U2KA 4YHHO 5EE5B 5LC1A 3VH4A 2IPOA 1KEUA 5DYWA 2QN1A 3GARA 4LRUA 5LBTA 1UXHA 2HMVA 5IH7A 1DEXA 2QE7G 1L7DA 2Q0AA 3I3OA 4LDJA 7ADHA 3K58A 4PO8A 1THTA 3TYXA 2R8ZA 5JAHA 5KX5F 5FWYA 1W59A 3K0DA 5LOVA 4YQZA 5AI9A 3BHNA 5DI9A 2E4WA 1Y1PA 2WLMA 1K7SN 4IBOA 5HF6A 4XQEA 5JXWA 1A8PA 2OIEA 2BIFA 2QRKA 4NU6A 4DV7O 1LDYA 2GLUA 2IHJA 1WS6A 2WM8A 2YMLA 4ZKIA 1AV7A 3M4YA 3MWDB 4A6EA 3JAMM 3WQQA 3M6IA 3IYLW 5IKMA 3A3OA 5DYTA 3JVVA 2FSFA 4GPEA 3J80A 1MCZA 3RQSA 2DPGA 2HKIA 2C9DA 4QDKA 3SX2A 3SP1A 2OQRA 3KIPA 5KX5B 2LXNA 1OW3B 1XL6A 1UBNA 2AD1A 3EISA 4ZTBA 1DJPA 3ITEA 3UH1A 4YJDA 3ND6A 1VRCA 4ZOLF 2PEYA 4UBMA 4LXYA 5TQ0B 2QYSA 2HMYB 4JHXA 3VBCA 3AB7A 3WLPA 4CW7A 1IXRC 4M9SA 1A5AB 2CHUA 2I4MA 2Z83A 4AJ1A 2PTHA 2NV0A 3CX7A 4NZZA 2AXQA 1CC1S 1BGVA 5GINE 2ZD9A 5IFKA 2V7WA 3BDIA 5KYGA 1C2YA 3MTEA 5KPJA 4G85A 1AXGA 1T3ZA 1N1EA 2P3OA 2X6AA 1XEWX 4WCDA 1MSWD 4EX6A 1Z0SA 1GARA 1TQ4A 1PT8A 1NW9B 5J9PC 1TFRA 2CF5A 3OAAD 1NXWA 3BWCA 4TTVA 3L1IA 5DVZA 1AHNA 1GQFA 2RJNA 2XLCA 1Y8CA 5D7NA 4ALJA 4C0HA 1SF9A 1OCRC 1RRPA 1X7GA 3OFVA 4BX8A 4WHMA 2A2ZA 4G97A 4CM6A 4CKCA 1NLMA 5A0VA 5BXZA 1KAEA 2W0SA 1RJWA 5ALHA 3WZMA 2NP6A 1IWOA 5IYDO 3JWGA 4RM2A 4UJ5A 4POAA 3PYLA 1IRIA 2O2DA 3BBLA 5J1TB 3KP1A 4PYQA 4I36A 2E21A 4B3CA 4BZZA 3KYJB 5KYYB 3DLBA 1EB8A 1VLHA 1L8AA 1TYCA 2BFAA 3DM9B 1H2ZA 2F9FA 2FQXA 2N47A 3E8XA 3FHOA 3GAFA 1IXBA 3VO2A 1YU6A 3AR6A 5HFLA 1USGA 3WRYC 5A05A 4O8ZA 1KVQA 1UMBA 1X1CA 5EBMC 2DFLA 3JQ9C 4GBMA 4YPFA 1ZONA 4J29A 1R3JC 1N36O 2CDNA 2ZRAA 3M4ZA 2KQXA 1CVIA 1YACA 3QEKA 3R5HA 1NRXA 4XUGB 5G0WA 2O06A 2QPTA 2CLLB 2FF7A 1Q91A 1G8JA 4BFYA 7AT1A 1YZYA 2DLDA 1XEWY 3DBRA 4I8XA 4Y7CA 3LDCA 3IV7A 4ML3A 4DPLA 3WBJA 2ZSAA 1W36D 1YI2F 3SBOA 1BA3A 1GL7A 3UJ7A 3IILA 4K3VA 3A31A 4NOJA 4D9NA 5EJ7A 1TCBA 1Z33A 3J7AR 2Q1SA 2WFMA 4M1EA 5KQGA 1YQXA 4HQNA 1FRQA 2C9OA 1N0UA 3LFUA 1BQZA 3AVQA 3I5DA 3K9QO 4OI2A 4RELA 4N47A 3RK1A 1RYZA 3JASA 4RSRA 3WAJA 2HR3A 1RJ9B 3PC7A 3PDIB 3DFUA 1F2UA 3R9XA 2NUBA 1YDXA 1CVRA 1DG9A 1NFFA 1S8OA 4EKDA 1N2GA 2YX1A 3PR2B 2ATEA 3H2HA 3NWBA 3LC1O 3VVCA 3QVSA 1HNZO 1Q86W 1EGAA 2G08A 3I9V6 3LZCA 5KYNA 1JRLA 3HEAA 3LV8A 3PPXA 4KVZA 3DT8A 4O2AA 4UHCA 3V8PA 3S81A 2XCSB 4RHXA 2W70A 4V0MA 4L6IA 2H4HA 1IBCA 3DOIA 4TKLA 4FLWA 1GPJA 1VJRA 4G41A 1F23A 2AFHB 3L8CA 1Y8ZA 4TN1A 3W0LB 5HQTA 3VNQA 3L4BA 1E77A 1R8XA 1RLTA 1AUQA 2B3DA 2YOHA 3O1HB 5IEBA 2R87A 3WLTA 4D99A 4CETA 1VGRA 3BKXA 4C01A 4CIBA 1I7SB 2IHZA 2GT1A 1BEEA 4J6FA 2A30A 5A2QM 2CMKA 1KQSU 2GEBA 4GD3Q 4MICA 3TLEA 4X60A 2PZKA 3ABQB 4FFLA 4QUDA 2QMOA 4P58A 2VDRB 4J2HA 1QBGA 3WA6A 2B1GA 4MYTA 4A0SA 3D31A 1M1YB 3WGVA 3R6LA 3WG7C 2Q3EA 1FNJA 2P4QA 3IP1A 3X2QB 5FPRA 1QJ4A 4RY0A 4W8GA 1KDZA 4CF3A 1S01A 2H7VA 1ZH6A 3OFND 3UJAA 3CCJV 2FH5B 3IGFA 3UJNA 2HFKA 5A71A 5TARA 1T8WA 1LI5A 1I7NA 1N9GA 3CTPA 2OHFA 4L9AA 3ROMA 1QZZA 4CT0A 4YIKA 1IBKB 4PO1A 3LY9A 1PYOA 1ZSYA 3DA8A 2SCUB 3SIWA 3PNLA 4PPGA 1MRZA 1F4PA 2WZDA 5JCXA 3MMNA 3RVPA 1CUVA 3TQIA 3L73H 1MA0A 2DQ3A 3C43A 3QEMA 4GKAA 4K8OA 4Q15A 1YS1X 3QTCA 1T3SA 3ZDXB 4CLXA 3G0HA 2WMDA 2EILC 3CH7A 3GHYA 3PXBA 3RPEA 1CJSA 2QTHA 5D85A 5LSAA 1HT2E 1U0OC 2HADA 4WXEA 2VTBA 1RKBA 2ZUBA 3PKJA 1S5JA 2FUG6 4D3YA 4JXXA 4HB0A 4L4XA 2R47A 1EFTA 4PAWA 3OLYA 2AGVA 1Q44A 3OWXA 1XDGA 4DW0A 3T3PB 4C3ZA 4GLLA 3AY6A 2Q7EA 1Z4OA 1G21E 2NTJA 5FV4A 1QCYA 4X91A 3V8QA 4A2CA 2Q73A 2NQ2C 2XAAA 4HWKA 2J0UA 5H1YA 5JV5A 1SQGA 4FP9A 3PN1A 3HO8A 1EA5A 3GP3A 3M5DA 1SKBA 2XUQA 2P75A 3H18A 4DMMA 5DP1A 2ZSEA 3ESDA 5EVCA 1TJPB 2J45A 4HN4B 1R00A 1XU9A 3FB1A 3WLEA 2NXWA 1F5NA 1WUJS 5MHTA 3D7NA 4KQGA 2FWNA 1VL8A 2L0XA 4XA8A 3APOA 1TIPA 1VMDA 1HZZC 3D3QA 4FOTA 5EBLC 4DNPA 1PPJH 2JPDA 1OFVA 3R5XA 3CJHA 4Q4JB 2HVYD 2DUWA 3EGDA 4WV3A 2FK7A 4D98A 4QJ4A 4DA4A 4JGSA 1I80A 1E59A 1Y7IA 3DM5A 1G38A 2BAGA 2J3LA 5CURA 4C14A 4JSYA 5L53A 1JFFA 3D00A 1G8HA 1QFXA 1YR8A 4E2ZA 3D59A 3F7OA 4RK0A 2GZRA 5D1HA 3WBBA 4Z7NB 3QE9Y 5BMVF 3NVDA 4GZ3A 2G38A 2D0IA 2A1UA 3AJRA 3L9XA 5KTRA 4DVGA 4DC1A 1ZL2A 3LUKA 1N5MA 4PIVA 4P8RA 4LHSA 4U2EA 3WA7A 2OZPA 1ML3A 4MUJA 2PUAA 1P4JA 4BKMA 5K3DA 4GL4A 2W6OA 1AUXA 1ZDMA 3LYBA 1F2DA 2PLFA 2JCSA 1QO7A 5LWQA 4OD0A 4BO9A 2CW5A 2XUIA 1AZWA 1SN7A 3DTVA 3JY6A 2CFTA 1M1KH 2XA9A 3FAKA 4N3CA 4B3GA 1LUVA 3GMSA 2CV0A 4RFVA 3NTVA 1GCUA 1LPSA 3OP4A 5CVVA 2CLOB 2H4JA 3RIHA 4CDRA 3OIFA 3DTVB 3H1EA 4KPGA 2X7RB 2JD0A 1QGAA 2MSCB 3A1FA 2HF7A 1Z37A 3WB1A 1AZSC 2J32A 3AWDA 4M98A 1VM6A 1J25A 2YJ3A 4RHEA 3WGJA 4J1NA 2H2HA 2OGZA 1E5QA 3CF6R 3L3BA 1JNYA 4IMPA 4QHYA 4LBZA 4F38A 5EWRA 3C97A 3M99B 4OI1A 4DUPA 5CD9A 3A6LA 5TQJA 1CUUA 1R0BA 1J0AA 4AULA 2FPWA 4FYMA 1TYAE 1C1XB 1ZD9A 3SDZA 4KHPO 5JQGB 1DBVO 4QGGA 3NM4A 5JCPA 2QU7A 2I3GA 2Q46A 5LP6B 2PGIA 1PU2A 3UG6A 4PAGA 2OA0A 5K0BA 1KNJA 1KGSA 1XLTC 3EGDB 3FNBA 4XM0A 5ALIA 1GZ7A 3UN1A 3PSAA 4FLVA 4J42A 1BROA 1JJ7A 1NASA 1PQPA 1SCBA 2IDJA 2PA3A 3H5RA 1MT0A 5FL7D 1AI5A 2Y1LA 4GXRA 3TCNA 3ESCA 1JFLA 1ZGGA 1JPXA 4KWEA 1IEWA 4RXMA 3VAYA 3TGPA 4OB7A 3L7IA 3OZ7A 1VCIA 3UAZA 3KKZA 4J7ZA 2GPJA 2IIQA 2NUTB 2HNBA 4G26A 5CA1B 4TKUA 2AIFA 1WXXA 2F6RA 1URFA 1FQWA 2WHYA 4C6HA 4Q7LA 5J5CA 2X9LA 2I2FA 4JVMA 2IG8A 3O5AA 2X0KA 2UU9O 4JFAA 2ZXUA 3HP4A 3QTLA 5HF9A 1N4AA 5DWDA 3RT1A 2W6JA 4DIFA 4MJLA 1L0LH 1CR6A 2BN4A 1D2HA 1XYGA 2ZXEA 3CC4F 3OJLA 3NJ4A 3CSSA 4A91A 4B74A 1FD9A 1BWPA 4N23A 2DPXA 2WU4A 3E5MA 3LDHA 1V48A 2AN5A 2YMMA 5P8WA 3UWSA 4ZTZB 3N76A 3QELB 4C06A 1XMOB 4OM8A 1QAQA 1TJNA 2Y93A 3D1JA 4QM7A 4MI9A 2IP2A 3HJRA 3ZV4A 4GKJO 1OBVA 1SXGA 4B34A 4C3OB 1Q77A 3Q5DA 1B14A 4H08A 4JUFA 4PU0A 4OPHA 2ZRNA 3RLIA 1EM6A 4KMOA 1DE0A 1FTQA 1M33A 4G0ZA 2VJMB 4KI7A 4KSBA 2RMKB 2YXZA 2F7SA 3L8HA 2H1IA 2AMLA 3RHSA 2AMVA 4BGIA 1USIA 2O1XA 4I55F 3WMEA 4H13B 1RXWA 4M1ZA 5ICEA 4ER0A 4KUGA 4IJWA 3ROGA 2BFBB 4GVXA 1DTWA 2FPRA 2ISCA 3C1OA 4LYDA 3SSAA 1KA9H 1BCRA 1T10A 2RHWA 3BCSA 3LA8A 5HDBB 4G6ZA 2WWGA 5JHHB 3ANNA 4RDCA 1THMA 2BFDA 3QYAA 1PZMA 1M6VB 5TNXA 1YHQV