5JCOC

Structure and dynamics of single-isoform recombinant neuronal human tubulin
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin beta-3 chain
publication title Structure and Dynamics of Single-isoform Recombinant Neuronal Human Tubulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 142
structure length 426
sequence length 426
chains with identical sequence D, I, J, K, L
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
C PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jcoC03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jcoC02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jcoC01
5LP6B 1FSZA 4DRXA 3N2KA 4I50B 4X20B 5IYZA 4YJ3A 3HKBA 5JQGA 4WBNB 1W5FA 4IHJB 3HKCA 4O2BA 5CA0B 2GVIA 4F6RB 3VPAA 4I55A 4YJ2B 4TUYB 4O2AB 1TVKA 5KMGB 5J2TA 4IIJA 3UT5B 5CA1B 4ZI7B 4X1YA 1SA0A 5LXTA 4X1IB 3R4VA 3RYCA 3RYFB 3HKDA 3JARB 4EB6A 2RHHA 3RYIB 4EI9A 4U3JB 2VAPA 3JASB 1W5AA 5IJ9A 3JATA 3M8KA 4O4HA 3N2GB 5CB4A 5J2UB 2VXYA 5BMVB 4X1KB 1FFXB 3WGJA 5EZYB 2RHLA 3RYHA 4O4IB 3C8LA 3VOAA 3M89A 4EI7A 4XCQA 1TUBB 4DXDA 4ZOLA 4TV8B 5KX5B 5JVDA 3RB8A 2BTQA 5EIBD 5ITZA 1W581 3ZBQA 4DRXB 4KWEA 5IYZB 5JH7A 4YJ3B 5IJ0A 2Q1YA 3HKEA 5M7EA 4E6EA 5EYPA 4O4LA 5FNVA 1W5BA 3HKCB 4HNAA 2VAWA 4FFBA 4O2BB 3JAKA 1JFFA 3JAWA 4I55B 5MN4A 4IIJB 3VO8A 4IHJA 5LA6B 5LYJA 3JALA 4X1YB 1SA0B 5MN5A 3E22B 5MN6A 4TUYA 3RYCB 3HKDB 4I4TA 4TV9A 4ZHQA 5LOVA 4O4JA 4ZI7A 2VAMA 5IJ9B 3JATB 5C8YA 4O4HB 5GONA 5CB4B 4LNUA 2RHJA 3VOBA 1W59A 3RYHB 3N2KB 4ZOLB 3HKBB 5JQGB 2BTOA 3VO9A 5JVDB 5LP6C 5LP6A 2BTQB 1FFXA 5ITZB 3ZBPA 3WGNA 4I50A 5JH7B 4X20A 5IJ0B 5J2TB 1TVKB 2Q1XA 3HKEB 5EYPB 5KX5A 4O4LB 5FNVB 4WBNA 1OFUA 2R6R1 4B45A 4HNAB 3V3TA 4FFBB 4EI8A 5LXTB 2R751 5CA0A 3JAKB 1JFFB 4F6RA 5EIBC 3JAWB 4YJ2A 4O2AA 1W5EA 5KMGA 5JCOC 4EB6B 3UT5A 5CA1A 3WGMA 5LYJB 3JALB 4X1IA 3WGKA 2XKAA 3RYFA 4I4TB 4TV9B 3CB2A 4ZHQB 2XKBA 3JARA 5LOVB 4O4JB 5LA6A 4U3JA 3RYIA 2RHOA 1RLUA 3JASA 3E22A 1RQ7A 5C8YB 5GONB 3N2GA 1Z5VA 4LNUB 5J2UA 4U39A 5BMVA 4X1KA 3WGLA 1RQ2A 4B46A 5EZYA 3ZIDA 4O4IA 1Z5WA 4M8IA 1TUBA 4TV8A 5JCOA
chains in the Genus database with same CATH superfamily
3CKMA 5IY5C 5KHAA 2EKZA 1FW6A 3OLCX 1F3OA 3ZVRA 4JIMA 4TKZA 1NTZH 4RVNA 1W93A 1BX0A 5DLYA 1II8A 2AK2A 1VQPF 4TUYB 1Z82A 3SYTA 1U9JA 4JYBA 3JQDA 2GN0A 4DDKA 4B3FX 1ZAYA 1IHYA 1PP9H 2RBKA 4KR0A 5L4SA 1R6KA 1SU7A 1O5IA 1E2MA 2Y77A 2ILTA 5CBPB 5GJBA 1ZZEA 3I52A 3WXMA 3BIOA 3QQ5A 3LQQA 2HIMA 2QVLA 1GWNA 3SHFA 3NLLA 3FM9A 3HSKA 3T1OA 1D1PA 1N6HA 9LDTA 4NH0A 3NV7A 2UKDA 2NXEA 4H1VA 3R2JA 2PPLA 2D4AA 3CURA 1RPJA 1FXWF 3CJRA 3OHPA 4UUQA 5AVRA 1QZZA 1TAQA 3S55A 3WB0A 3CMCO 2CLLB 2BSKB 1H2FA 2RAPA 3N0VA 4LPSA 2ZUFA 5L3QB 3VZDA 1RM1C 1R18A 4YRKA 3K70C 2Z01A 2V98A 4A8JB 1GQSA 2JLSA 4JP1A 3R6TA 1GUAA 1JILA 1CLEA 3I64A 3TG8A 1S3FA 3UJDA 4LF9B 4P81A 5GWXA 1Y3DE 2Q3DA 3WL5A 3JPWA 2G0TA 3SYLA 3JY6A 4B3XA 1IPAA 3WMFA 721PA 1NKTA 1KOGA 3E22B 4BKOA 1TAHA 5JT1A 4YT8A 2J9ZB 4K2AA 3GP8A 4IGEA 1XBLA 1JU9A 4JUIA 4QAJA 1CS0B 2GLTA 4ID3A 4HNAB 5CLJA 3VPDA 4ASUD 5FKJA 4KXFB 3TK1A 4RELA 2V74B 3OC0A 3FFAA 2B8EA 1Z08A 3F46A 2VL7A 3BMQA 4C4XA 2YC4C 2LE0A 1KYZA 1QP8A 4ZEOA 5HJ7A 3DMRA 4KVAA 4QULA 2ORIA 3IP8A 3ZCUA 2Q0AA 1JHOA 3KG2A 4HQ6A 2VDRB 3NEJA 2PGXA 1GRJA 3AR4A 4R51A 3Q2IA 3ZQJA 4EITA 4DXWA 1F23A 3UATA 4YCSA 3CINA 1UWCA 3ON5A 2FRDC 2VATA 2QP9X 2ZYSA 3TH5A 3UFXB 5J2UF 1URFA 4JLAA 2ZJ2A 2P4VA 5J59A 2QHXA 4D8YA 2CVOA 3LBIA 5TF4A 4M1TA 4D79A 4IRUB 2X3YA 2EQAA 4EB8A 2RGRA 1NN1A 4DXHA 2OTLF 3REFA 3D7SA 5LHIA 4NB5A 1QIGA 1R0WA 2DR3A 2H4WA 3NTUA 2K2WA 4QQNA 1EUCA 3OE4A 5HZHA 3HAXD 1DC7A 1G18A 2EFHB 4XD7D 5I7RA 1G6Q1 1T9BA 4DLBA 1SVSA 3BGSA 1E9FA 3DQQA 3G2JA 2CLHB 3LGSA 2NV2B 2RHHA 3BWXA 4E6PA 1YCGA 5JAZA 3MHTA 2XYPA 2GJ4A 3EG9B 1XQ9A 3O0TA 4UU0A 5D01A 4NZOA 1ZJWA 2IYUA 4CLRA 3HP7A 4ZZIA 4GKKO 1EVLA 2VN8A 4BO4A 1NBIA 5IC5A 1QH1A 3ZD7A 2OO3A 2HMUA 3WSTA 4EBBA 3F67A 1A8IA 4PG8A 3CD6V 1SBTA 1J07A 3P10A 2OFPA 4D4IA 5ALKA 3MSCA 3QFFA 5BW5A 1M8JA 4W8HA 2KLHA 4FLZA 4OGQB 4M0KA 4GOMD 2NAFA 2NSHA 2L42A 3FIUA 2OAGA 4M1WA 3REOA 3UAWA 1HDGO 4RMGA 1YZHA 3K08A 2Q4BA 3T5GA 4MTCA 4YV7A 2V7BA 1RFYA 3HLTA 4DV6B 4CIBA 4PZCA 2H5IA 4ATNA 3C90A 2XNJA 2RFLA 3G9XA 2RB4A 1ENYA 5CB4A 4GDMA 1N32B 2QTBA 3F6PA 5F5XA 4QELA 2B8TA 4X62O 3PK0A 1KGSA 2OTJF 4V39A 3DLIA 5F21A 1QRDA 1I7QB 1Y80A 5E9WA 3T1CA 1VQ1A 3B2EE 4TQ9A 1VQ7V 2IH3C 4DCUA 5F3DA 5IDVA 1MB0A 4YYEA 3EEFA 1YDGA 2P78A 5LA6F 3AR8A 1BD3A 4LE0A 1W5EA 4JS0A 4DCPA 1NTMH 1VLHA 4ARVA 4JI3O 3P4YA 1CP3A 3E5NA 4KUHA 2D5IA 4JI0O 1X7XB 1CIVA 3UANA 5DIFA 4IICA 3OZIA 2XF8A 2EIXA 3KT6A 4M1MA 2GS9A 3VPAA 1VIBA 4EAAA 2CFRA 2LR0A 1CN7A 2W4IA 5B4VA 3WZ2A 4JC5A 4RVCA 1Q50A 1RRVA 4RV5A 2ACWA 1NMSA 4GZ3A 1LBTA 2BKLA 2GEFA 4JITA 4L8VA 3EC7A 1EK1A 4YNBA 5AVYA 3K5LA 2A7WA 1Y66A 1I3OA 3TAUA 4Z7QB 3K20A 5C53B 3VJMA 4E11A 3PXAA 1EH5A 3CX5F 5LP6A 5CD9A 4G0WA 2X2PA 2RHRA 2JGJA 2I6DA 2MR6A 3OAAD 1NRJB 3OJWA 4CF6A 1C9DB 2D74A 3O8DA 2PRIA 1V71A 4JJIA 3C6XA 4O4JB 1EFCA 2H5JA 3L73H 1T3GA 1VFNA 3RIGA 2I4TA 4XIJA 3KT3A 1DQPA 2ZI4A 4EX6A 4D4HA 4B09A 2IKQA 1Y42X 4LK2A 3K6SA 2FFQA 2VNSA 2FSSA 3MM4A 5GJVC 1ANKA 1N8RH 3I1FA 2BMDA 2BE9A 1OFGA 4ZTBA 4BVGA 3CRZA 4MWCA 3GFVA 2JHCA 3L4EA 1NW4A 5K1ZA 3A0RA 4L76A 2MCFA 2YVKA 5ER6A 4PBRA 5KNCD 4JLBA 3FTFA 5AKXA 3RVSA 2IU6A 3T06B 1PKEA 2P3SA 2GVDC 3O21A 3IUJA 1WB8A 4MVUA 1ZN7A 4NCAA 3ZQKA 2ZIXA 4V0KA 1VKZA 2QV7A 3KVRA 4EPRA 3FMIA 5DYIA 3DPIA 2WF7A 1CR1A 2BM8A 1IBMB 1G2QA 4KQ1A 1E3TA 4I2VA 5KTRA 2PNJA 3GNLA 4IZ6A 3K0TA 5D3KA 1OI4A 3J7TA 4CKCA 3OLQA 3UTDA 4QXMA 4M0FA 1W40A 1YQQA 4TLAA 4Z4IA 1Q8RA 1I14A 3QHDA 3L7YA 4GP7A 5DXFA 4YRDA 1C7RA 1WPXA 1KJQA 3PC4A 3WLEA 4M54A 4UMEA 1RPOA 2Y1DA 3JQQA 5L6MB 3C3SA 2VUHB 3QU4A 3LV8A 3PCRB 4I4CA 4NV3A 5ALHA 4DR3O 4X9XA 3RIMA 3TQOA 5CPFA 4RJIA 4EM6A 4Y9UA 3RVDA 3WK5A 1GAXA 2VTBA 2RJ3A 1A4UA 3OF2A 1T2DA 4C89A 5IYZB 3PI7A 3ASUA 1QRRA 5B1YA 1W4CA 2ZS9A 3F2VA 4ARZA 2G09A 4MW0A 5ALNA 3GP3A 3DDCA 3OF3A 2GXUA 3OFSA 2BJVA 1KVQA 3VPCA 3UMRA 3QE2A 4B3MO 2FKNA 2NXJA 2EV9A 3TTVA 3H9BA 9GPBA 5KYWB 1BVYF 3T5TA 1QPBA 5JS8A 1IUKA 1CJMA 4JAVA 3BFKA 3OE5A 5IVPA 3CF0A 1RYBA 3CUYA 3C87A 1U8XX 4PR3A 4MPRA 3ZUPA 2F95B 3MAQA 2XDQA 1GFZA 5LYYA 1NRXA 2CUKA 5F1YA 4NJMB 4RHYA 4YRBA 1T24A 3KOMA 3ME5A 1PX2A 1T6YA 1YZFA 6ABPA 2R4QA 1T4MA 3M33A 4EHDA 1N6KA 3BRCA 4HATA 2HA5A 2A1TS 4IJQA 3WI7A 1CETA 3OTHA 4RABA 4KYTA 2ST1A 2DQZA 1EDZA 1M74A 2EZ9A 1J39A 4CC5A 4X88A 1EK5A 5B1BB 3U60B 2EIKB 2A58A 1V3QE 2GEVA 1A8PA 4DQUA 4JB3A 2W0FC 3CXUA 1OB2A 2CTPA 4JBWA 4MVYA 1ZM4A 5BZBA 2G8LA 4ZV9A 2PFSA 3WDMA 4KHPB 4OK3A 3JAWB 3SS9X 4R1PA 5JAOA 1YA4A 3CZ5A 2PDAA 1WIWA 3EPLA 3WIUA 4B79A 4QYWA 5JSQA 1ZKMA 3OTGA 1LSSA 1F7VA 4BT7A 2B21A 1E3SA 1E1DA 4RIEA 3HU2A 5G40A 3A6HA 2Q41A 3E4DA 1PL4A 2OXCA 3LP5A 2OCCB 3I8OA 4B62A 4CG3A 4IIJA 2VWHA 3D3EA 3CVXA 3DZCA 2AQHA 2MYTA 5D3MB 2AWOA 3DEZA 1GKYA 3HUEA 2ACKA 3NATA 3H86A 4PYJA 3LTNC 4KOAA 4LVNA 3LZDA 2PH7A 4OUDA 3QX8A 1YEWA 3MDSA 2Y1EA 3GFBA 1KAEA 4KBFA 3NP7A 2XMCA 1XOIA 2W2VA 4J0KA 5B7PA 1F9EA 5JQGB 4LN1A 4WFJA 1FDVA 1HQDA 3FGPA 2N47A 2OCBA 3KKZA 3G5AA 4GS5A 2C5EA 1HNXO 3ZNPA 1R0BA 3JQ9C 1U0TA 5ALSA 4JPRA 3DTUB 1PJSA 1V16A 3DBHA 1W0JA 4RV4A 1FFEA 1GNTA 3EIEA 1N4AA 4GPZA 4CNBA 1ZICA 5JC1A 4ZHQF 3TX6A 1DO2A 5FX2A 3VNAA 3PWTA 3HCBA 1JG7A 1JLMA 1DZ3A 4R3NA 2PS0A 4JP8A 3CWBH 1H0RA 5LJIA 2FFBA 4GXNA 1M75A 4EECA 4H7PA 3E3MA 1DWPA 1U04A 2PNFA 1HYEA 3QY9A 4NWIA 2Z2XA 3OR7C 1PQYA 2B7BA 4K6FA 4D4KA 1DX9A 1KI2A 1Q57A 3HJGA 4IIUA 4CODB 4RL6A 2VZ9A 4WK0B 1T9HA 5EL0A 3GO4A 4H18A 3FPIA 2GPAA 3PVZA 2PMDA 4EMBA 1XMJA 1LLQA 4FJ2A 4OHYA 5BRAA 4GX2A 1QH9A 3ESZA 4DQDA 4JI7O 3GJTA 1Q7YW 2WG1A 2CXHA 5AICA 1RC8A 5EHZA 3UHOA 5H4GA 4LFCO 1B06A 3KC2A 2PMBA 2EIMC 5GAPK 3M6AA 1FXHA 2OLEA 1ZI9A 3WP1B 2QP3A 1PNRA 2P2DA 3AIMA 4LDNA 4ER6A 1R4NA 4J8PA 2HJ9A 4BFCA 1ETHA 1QYRA 1AK9A 3WRVA 3ASNB 5KQMA 2M6KA 1U3VA 3N8NA 1S72V 2DFKB 4YMSA 3NW9A 4OX9O 1YZTA 3ABIA 2Y05A 1K27A 3ZW8A 1SPBS 1JCHA 3HZZA 4PLVA 3LQYA 4C14A 4MVJD 1WEKA 1CDOA 5HCIA 4RX1A 4Y2YA 1Z7GA 3Q87B 4FYPA 1R0XA 5FTJA 5KDLA 4YRQA 2OY0A 3G4SF 2MQEA 1EJ6A 1WS6A 3WHPA 1X9IA 4UFZA 2OGSA 4FR5A 3H1KH 2QMUA 4LJ5A 2EULA 4A0SA 3VO2A 3WA6A 2KI5A 1CZUA 1GQRA 2WIAA 3AUXA 2R1ZA 5JRJA 2Q6AA 2IZ1A 1IWOA 2IYFA 3LX6A 4FZRA 1APBA 3QEMB 4HQ0A 5DM6V 4MLDA 2EGHA 4UCUA 2MTBA 3BB4A 3W8NA 2CDCA 5AM0A 4EI2A 1GPAA 2A5LA 2QMZA 1PGJA 2JHGA 4KR6A 3FOEC 4UEWA 1TM4E 3BDAA 3SCZA 2ZI3A 1OLSB 4IF6A 3EZ9A 3AR5A 3W6NA 3PD0A 3JVIA 4TKUA 3DZIA 4KN8A 2Q8PA 2C4HA 4A0FA 1YL6A 3ZU3A 2PX5A 2IUYA 4QGAA 3QVXA 4LZPA 4CEIB 1GU7A 2ZE5A 4MWTA 4P6VF 4KL8S 3P19A 1J1UA 3GL9A 2GNAA 1XLTA 2ZJ5A 4WFGA 2FUKA 2GB4A 1QZXA 5IASA 4X71A 3F7MA 3WMGA 1XJCA 3EEQA 1NOIA 2R6DA 5FP0A 4KDCA 2XNDA 2Y1CA 3OM0A 1JI3A 1PTJA 3EQ9A 3W1WA 1VZ2A 3BXZA 2H29A 2IEGA 5AW9A 1TYDE 4EHLA 3HN6A 4ZAFA 1XRMA 5EN4A 2HZBA 4CUKA 4LHVA 3R3YA 4XX1A 1WB7A 2OD9A 4UU1A 5ECGC 3OCJA 2O59A 3X2QC 3ADBA 1XL0A 2MYUA 4MWZA 4S35A 2RDCA 2ZYIA 1U94A 3C8MA 1IN6A 2O2GA 4J0FA 1BS3A 3SZ3A 3QNMA 2VJKA 4G9EA 5U4XA 3N4YA 4ZCSA 1J0DA 1MCZA 1H2GA 3I0MA 3K1JA 4HB4A 3VGJA 1SBNE 1USWA 4UJ5A 3IURA 1ECCA 3H2GA 5GINC 3WGVA 2HTEA 2HK9A 1Q81H 5FA5A 1BHO1 2PBLA 3TFWA 2FQ1A 5JPDA 2WT9A 3ABLB 3MERA 2XB6A 2X7RB 3K6KA 4KQ6A 1ZNQO 4RCYA 1XU9A 1SK9A 4NS4A 4Y2PA 1SQGA 3D1VA 5DGTA 4MVJF 1SC6A 3SJBC 2C8VA 1XTQA 4L28A 3RYFB 4YP6A 3VQTA 1IWBB 4NFHA 3TNLA 4WLOA 3QWFA 1H22A 1RJEA 5AP9A 2VSYA 4CBCA 2KQUA 2W7TA 1ZM2A 3ABQB 5B4UA 4D4LA 3HMQA 3KJZA 1HKHA 1KZYC 4WEOA 5AJVB 4DQLA 2UXCO 1IURA 2FSGA 2OECA 3HFRA 3UC5A 5L3CA 3G8YA 4JJEA 1E79G 3DO8A 3OPYA 3WK7A 1JEYA 3TETA 2QPTA 1DDOA 3KO8A 2VPZA 2JHPA 3TFOA 1V95A 2GPJA 4PA4A 5JU6A 5FDFA 3U44B 2H4ZA 4JEIA 4WGGA 3OKCA 1Y8QA 2HNKA 1CQIA 1XDSA 3RF7A 4PR0A 4W5HA 3M1XA 5GM2A 5KPJA 1KQNA 1NVAA 3TKYA 4M38A 1GRRA 1MB3A 3G02A 5A4MS 5IKXA 3GJ5A 1P5FA 3SFTA 1GCIA 1RHMA 5H7XA 2I2FA 2HSGA 1Z4OA 3BERA 3QE3A 1T4CA 5B6JA 3R5JA 4DJ5X 3ZYCA 2WE7A 4C2UA 1EE9A 4C2TA 2QB5A 1MB4A 3AVPA 4MGEA 4TRRA 4QJBA 2FSFA 4FCTA 2FFJA 4UHDA 5JDCC 4CLXA 3K58A 1H2BA 3WP0A 3GBPA 2XRZA 4CL2A 1C3XA 4E2XA 2YWBA 1CC1S 5C8VA 3FYUC 5KA5A 1Q7YH 3AUTA 3K0KA 2VPPA 1M6HA 4ZDJA 2DWCA 2YV2A 1BQ4A 4X9QA 5FWNA 1CPYA 4B9AA 3ZC3A 3OT1B 2V0GA 5ESXA 4CI9A 3QMVA 5HMMA 5HDBB 5K3SA 4D6TH 4WJLA 1WUIS 1ZY2A 2R751 2E18A 4LJAA 1UADA 2EYQA 1LU9A 3UWSA 1S7CA 4WJKB 4CW7A 3PDCA 4HMOA 4Z2WA 4B46A 4EEQA 2I6GA 4LWSA 1EQ2A 4EWLA 1CR6A 4Y0AA 5ED4A 3KZCA 1IDOA 3LC0A 1W96A 2YIJA 3V1MA 1NYLA 1V1RB 3FSJX 4MI6A 3RHZA 5JDIA 2L35A 5DCYA 2Y69B 1Y9ZA 1N25A 1IBKB 3KPWA 4K28A 4OHBA 4REMA 3KSZO 1CDDA 4RPJA 4IIHA 3LBFA 3VI3B 5DEOA 2IS4A 1T9DA 1LEHA 4D25A 1PD1A 3MRVA 1XQ6A 1US8A 2PE5A 4F2DA 4G5FA 5A6SA 5I7FA 4YHHB 3K8QA 4KQIA 2PH1A 1EWRA 4ZQIA 4TM7A 1IQRA 2IXGA 3AKYA 1NQVA 3E5HA 1UZUA 4HNUA 1EGQA 1VF6C 2QE7A 4EQ6A 2QXUA 4AJEA 1D2DA 4DY6A 1FQOA 2PQMA 3EZNA 4EAQA 4N39A 4HPWA 2O50A 2QG6A 8ABPA 1ADFA 1QHEA 4XLLA 2RBGA 1NASA 2BEKA 2JFZA 3UT6A 2CSLA 1Y8RA 1VJCA 4H16A 2AW3A 1N6RA 1LI7A 3D02A 2I3AA 2VOJA 3VMMA 1DIBA 4L3WA 3RSZA 4D02A 2QMQA 5CLLA 1YZVA 3L1HA 4IYRA 3JQAA 1V37A 4QUEA 4Y1EA 4JI1O 4Q3CA 4FQ5A 3AMVA 4OYRA 2PZSA 4BYMA 1E89A 1R0LA 1GTSA 4JU9A 4BWYA 3TXXA 3L7NA 4B6SA 2AOVA 3EDRA 4PO3X 4II7A 4BNMA 2WMNB 2C7RA 2ZTHA 4ZZ1A 1KR2A 4ZVKA 4ZYLA 1MIOB 3GVMA 1AA9A 2ZU6A 5DZSA 4TZTA 1W1WA 5AJUA 4Q34A 4QOFA 3PGXA 4OIFA 1MORA 1SQBH 4MQFB 5GIPE 2EGGA 1RSOB 2D3TA 1NI4B 2FW7A 4M21A 3I34X 1U99A 3OX4A 4HC4A 4L5AA 3RJZA 1XZDA 5J2UA 1NVWQ 2R9RB 3LGAA 4FMDF 4BQSA 4K26A 1ZUNB 1Q5PA 3PFCA 5HBRA 4F4FA 2PWPA 5KKNB 1OWOA 3EXHA 1ZLXA 2W2PA 1S0UA 1L5VA 1JU3A 3P0IA 4DUPA 1D2NA 1JSCA 4N5NA 4G8JA 2X3UA 3LTEA 5DDIP 3OT5A 4KN5A 3HYLA 1QVRA 4EW6A 5AKGA 3MMPA 3G82C 4ZAGA 2HJSA 4WLNA 2NU7B 3G6EF 3W2GA 1AHIA 3LZ6A 2O8EA 3FGOA 3PHHA 4D82A 3DXZA 4N18A 4NICA 2B1QA 4LG1A 4II2A 5HK8A 3K2IA 5JZMA 4GBGA 3TLGA 1ZOPA 1SUEA 1M1YE 1FUKA 3H1PA 1UBGA 3L3BA 1QJCA 3VZCA 1R16A 4GMHA 3B3FA 3JTEA 1EVJA 1QGED 5JMTA 3TLZA 4MUAA 2W11A 3MOIA 4BDTA 3MCAA 2AG6A 3OQNA 1HG0A 1Z83A 7REQB 1K33A 3KUUA 3AJEA 1RM3A 4HX9A 2R44A 3CRNA 1ZU4A 4E2ZA 5FULA 5ARDA 3RU3A 3MC1A 3BCCH 1CULC 4M86A 4G23A 3HDJA 2G4CA 5AVTA 1LPAB 4EKYA 4HUJA 1L5LA 2XMRA 3PGLA 4BEWA 3PHGA 3H01A 1PR0A 1QQ6A 4F93B 4ZRDA 1LXCA 4OL0A 4MPPA 4QRIA 3WICA 1V4BA 2X5XA 1EFVA 4GUAA 1D6JA 1KJ9A 3WGYA 1GILA 2EINC 1UMBA 3P2JA 3LBYA 1ZRNA 1V7ZA 1C0IA 1FDWA 3RVYA 5A0FA 2IIVA 1ZOOA 2EKPA 3N7AA 1NMQA 5LUAA 5EIFA 4EKDA 4UEQA 1DTEA 1TTTA 2AX3A 2Z1MA 5FOWA 1PW7A 4RZQA 1P31A 1E63A 4PBTA 1XDBA 2UZ3A 3HB9A 3C70A 2ZWPA 2CGNA 3UMVA 3DMTC 1BE1A 3A1NA 1HT0A 4ASUA 5AUQA 4DYVA 1OC4A 3KLOA 1K8YB 1N33B 3QVWA 2HRBA 2C84A 3N74A 2NYAA 4I36A 2AN4A 1TJYA 4DV1B 4YDQA 3AI1A 2YWRA 4GQAA 2ZJOA 4N8SA 5AKIA 4NC9A 2J4CA 5SICE 3T2MA 1Q7GA 2ZTUA 2X9QA 3FWPA 5KTSA 3UKJA 3VISA 2IGBA 5L7YA 1KZHA 2FQQA 1EN5A 3TE7A 3DL4A 4P38A 4M87A 1OT5A 4EA9A 1CQPA 3G5LA 2DSTA 1REQA 3QELB 5BN5A 3SHVA 3CUEF 4J7CA 3R8FA 1VL5A 5MGNA 2QDOA 5LKAA 1DLBA 4U9IS 5F3WB 1FYFA 4X64O 3ZIUA 4AZWA 5HNKA 3TM4A 3GA5A 3C7TA 4KQHA 3EVBA 2EEPA 3T7JA 2LCFA 4GUDA 1YVWA 2R7LA 2CLCX 2HDNB 1AG9A 2CWDA 1HKUA 3L9WA 5AVWA 4JYYA 2HDWA 1IK4A 2AN5A 3TW4A 1DAMA 1VCOA 4B2IA 1DTWB 3GLVA 4YP7A 2P9JA 3EUWA 3KBOA 1V55C 5A03A 1GNQA 2PSHA 1ZJ6A 4XD7A 3CE6A 4F6RB 4YJ2B 4YRSA 2GHTA 1P45A 4F8JA 1YTLA 3FB1A 3CRVA 4UVBA 4G0YA 3AINA 1FNNA 4PZLA 4PZPA 4TLEA 1VXRA 2ZUWA 3KSAC 1MNGA 1OX4A 2G76A 4ZCLA 4MWGA 1M90H 5CFOA 1KNJA 2JJ2D 1HQCA 3IEUA 4I4IA 3U6BA 4O25A 3STYA 1I5RA 5IUNC 3UGQA 2PRJA 3ABSB 2GPBA 3K0AA 1JFRA 5KNDD 3MLEA 4P4TA 1AI4A 2RI0A 3FIJA 3CLTC 1JG2A 3VC1A 2EHDA 2IE8A 2WLSA 4EUHA 4H4DA 3K9SA 1WVGA 2HB6A 1RPZA 4EEXA 1BXZA 1LJUA 3NVIB 2PT5A 2FWBA 4D74A 3A1VA 3C74A 1ZC3A 4FOOA 4TZZA 2Q6LA 5HF6A 1ZGZA 2E2WA 1N2HA 4ZBMA 2P5OA 3S68A 1EI9A 1Z18A 3K9BA 4DSNA 4YQYA 4WRRA 4DF3A 5EE1A 3K1YA 2ZBGA 5HQJA 4CCYA 1PJBA 2N9UA 4MUHA 4OFWA 4URYR 2EKQA 4CL8A 4TWBA 1U0SY 1JXAA 3CZRA 3NBMA 1LJLA 1CEQA 3ORSA 5DM4A 1NZJA 4TXJA 2LDBA 4TQGA 2X7XA 1VQMF 3VAAA 2YBDA 5EHIA 3K06A 3N2NA 4OXKA 5K0GA 2QRGA 3AY0A 3W5DA 1BWSA 2K87A 1JHXA 5ALXA 3IOYA 1E5VA 3VX3A 1IOWA 3ER6A 4E2YA 1JB9A 1YDFA 4UBLA 4BHTA 3RSSA 4KL1A 3EORA 4FP9A 3BXPA 4BJ3A 1X1QA 3BE6A 2WLNA 3NHMA 4S0XA 4NCJA 3BCRA 5BV1A 3DONA 3DHWC 1ZP6A 1AZLA 5AKKA 3JSLA 1NKSA 4L4YA 3W34A 1H2WA 4U7JA 2OGTA 2J31A 4HZGA 1DRJA 4BO2A 3KQOA 4CJXA 2I2BA 2XYQA 1YFKA 2F1JA 1NKVA 5BT8A 3S44A 1O5OA 4ML3A 1ENZA 4XPIA 4QHTA 3PNLA 3UJCA 1YZLA 3IEVA 1FNSA 1UBTS 3MD9A 1QLJA 3C3MA 1RAHA 3OD1A 1I4WA 3NVKE 1RU3A 4JUFA 4LJYA 3TDKA 3EULA 3O4VA 3E2IA 1QF6A 2GM3A 3W6PA 2H11A 4HAOA 1TO1E 1N7JA 3D8TA 4KJXA 4U3FH 4KN9S 1FQWA 4FIDA 4DSTA 2ZE6A 3H2IA 1H8HG 3L8GA 3N75A 2H92A 5JYDA 3TZ6A 5AH0A 1NLZA 4NFYA 2QU7A 1F2UA 2JJ1G 4IMJB 1L4KA 5IAGA 5DM60 4OX9Y 1YR9A 2ZUUA 1PSWA 5DP2A 2UXNA 2I67A 1H2SB 1KVUA 2JKVA 4E51A 3OQIA 5DWDA 1V0JA 5A5DA 4OAPA 2ZRIA 3ABZA 3EQ8A 3G80A 4EHBA 1OI2A 2HCRA 2XBMA 2EFCB 5K2OA 1KDPA 1TRHA 4N0PA 1DB3A 5K6AA 4BFUA 1M2JA 2UZHA 4OH7A 5B3JA 1QWOA 1GOTA 2CKMA 2GEBA 4I1OA 3VR3D 2WWFA 1DGQA 3DR3A 4UOEA 1QC5B 1Y8AA 3AVWA 4QYIB 4O4JF 4X65B 3EJWA 1I5EA 4FWBA 1GPMA 4AHCA 2CB0A 2EILB 1JLSA 5KNCA 4RHCA 1IH8A 4I9UA 5KEIA 2QRNA 2ZM6B 3IPXA 5KVQA 2RHBA 5KTTA 3A9TA 1KEEA 1Y9EA 3IMPA 2QSUA 4TTVA 2UUBO 3IVAA 1XTBA 4UC0A 3HXOA 3NBFA 2W6CX 2OPBA 1TFUA 1MV5A 3BE5A 2X2EA 3WYFA 1YS2X 3WYDA 3PE6A 4FBGA 4UUJC 4ZPJA 5CU7A 2BEVA 3SC3A 3OLXA 3I4FA 2ZXWC 9ATCA 3OONA 4LI0A 4DG9A 4MUBA 1ROPA 2PHZA 1E1CA 3MWDA 1IVSA 3D7KA 1VLMA 1Y6QA 5FQNA 5B58T 2ZB3A 1UPBA 4XR9A 1N6PA 4YRLA 2VBIA 2B1RA 4ESVA 4B0PA 3D3NA 3CCJF 2GSMB 2FKAA 3HQ4O 3WL7A 1U3LA 1FDIA 1R15A 2H5LA 4E5KA 4G4SP 2Q1YA 4ODIA 4ZAZA 4O2LA 4N3GA 3TD9A 4CTJA 1V8DA 2HU2A 3DW1X 2X9LA 1KO1A 2G6TA 4YTEA 3AEQB 3D43A 3OT7A 4DPKA 4ZHQA 4LYAA 1GU0A 3SS7X 2R2GA 1FSGA 2IBZH 1Z4JA 2DOSA 4XFKA 1D4FA 5DSZA 4XSGA 2OTCA 1WRBA 1ZH0A 3T34A 3BHIA 1ULAA 2HQ1A 4PFQA 4FGJA 1Q6UA 1QZUA 2VEOA 3NHBA 4I08A 4XJVA 1GK9A 5G1OA 4Q4AA 2WSMA 2AQIA 2FQXA 4Q16A 7AT1A 5FPHA 2CUGA 1BXRA 1K9VF 4RTRA 4XRRA 1ODTC 1IJEA 2PY5A 4B4UA 5A1JA 1RQLA 2PRYA 1XJWA 3WAKA 1G5IA 3AI2A 4UREA 3GLGE 5I9SA 3OMAB 4FZ5A 2UVPA 1NBMG 1FRFS 1WL8A 2I76A 1L7EA 1T2AA 5JARA 4Q02A 5AOBA 2J5RA 2FW9A 1XIVA 1ZBQA 1WZ2A 4UEOA 3I6ZA 3F9RA 1T0UA 4I0XB 3PD7A 1CUIA 1Q77A 3PTLA 3HPLC 2B6HA 2C5AA 4P93A 4XIFA 4JFRA 4TLCA 3SEAA 4H1WA 3QJGA 1EIWA 3IJPA 4GG1A 2RB5A 4Q1EA 3DGFC 3FVTA 3VDNB 4ZQFA 3APOA 3TQQA 1GTVA 5T57A 3OEED 4JV5B 4JBXA 3GX1A 3MWEA 3SXUA 1ZWKA 2HWXA 2O0KA 4RKFA 1EHCA 1ABFA 2GO1A 4NKRA 2R8RA 1NF2A 3VSCA 1W1UA 1RE1A 4DV3B 1BSMA 4P36A 1E2IA 1C8BA 2HS3A 3F0DA 2H4FA 2A9HA 3V1NA 1PN3A 4RPIA 3D7NA 4E2WA 1ZPDA 2ARHA 1J9ZA 3ZWOA 2OOSA 2QQFA 1XBIA 4NMWA 4KGZA 4EHAA 4G5RA 1KH2A 4HNVA 3KPJA 3JQ6A 2W9XA 3JQBC 3V1YA 4N82A 3VI4B 3IHWA 2BKEA 5A3JA 3WLHA 3CXHF 3P2YA 4RIHA 3LW8A 1U6KA 2CWWA 5F3RA 5F64A 1OXKB 4OXSA 1HNWO 4PDMA 3DZHA 3Q15C 5ALOA 1DCMA 2Q4RA 1JEAA 3TTTA 3A0UA 4R7ZA 1CW2B 1BS1A 1E98A 1RJ9B 1R6UA 3OX2A 4PYIA 4E09A 4WKCA 4ND7A 2JLAA 1SBCA 1OB5A 2DFPA 2FGYA 2BE3A 1M1UA 3EF0A 2BFOA 4M8KA 4RQOA 1KF0A 4PAOA 2PZMA 3ITEA 4C3OB 1V8OA 2CVZA 2W2XA 4E08A 2OWEA 4WCFB 4WCEV 5KHIA 1Q1GA 3A3YA 4G27B 2FG6C 4Q4CA 1G8GA 1BWQA 5BXQC 4V1CA 2ATXA 3UT0A 1KMHA 3UUEA 1Q84A 2VA9A 2D0PB 1GSAA 3USZA 1WTCA 5JO9A 2D1FA 1OBVA 4OGWA 1FS5A 2DAPA 5INTA 1C1XB 4EYGA 5HZMA 1SBYA 4M9SA 4YXWD 4DQKA 1E60A 2PMPA 3OLWA 1XMIA 3CYOA 4DFDA 1NW9B 4OV6B 4NYJR 3ZGZA 3ZJUA 4N8DA 5KVAA 5EFZA 4CT0A 3IBGA 1WHSA 1EFTA 2DMXA 1QRAA 3I39X 3NWEA 4EG1A 3LRXA 2HUPA 1TE2A 1KWKA 1UK7A 4FFDA 1VL1A 2LBXA 1Y7PA 2IZ7A 2AR0A 4TZ6A 3IQDB 3OPYI 2Y27A 1NP3A 4PC2A 3FY4A 4MS2A 4PSVA 2ZIMA 3RLFA 2YN2A 3CCUV 4CR6A 1VJTA 2OAQ1 4UDOA 3I32A 2GLZA 2OC9A 4DBLE 1DOZA 4BJHB 2VDUE 2WP8J 1UT5A 1X70A 5JCPA 5AUOB 1DXQA 5CMLA 4WE3A 2PK3A 3IAUA 3DLBA 1QLWA 5EBWC 3TZEA 1FYEA 2GFIA 1GN6A 1DLJA 4HN9A 4RAOA 4MVJA 3I55V 5A2QN 5DNUA 4Y6LA 4KMOA 3WL6A 1DUIA 1PM9A 2Z9CA 2BP7B 3TL3A 2FZKA 2YUAA 2UUOA 2FV8A 3U3ZA 2XUFA 5A4IS 3PJSK 4OKSA 4QPCA 2P0EA 4GR9A 3VX4A 1UR5A 5GTIZ 1LRKA 4G4JA 3N3AC 3CMAF 3VU3A 5KYVA 2FHPA 2WWTA 3LSTA 3KQQA 3L70H 3WIVA 4OPAA 2AT1A 1KQGA 1T25A 1ZNXA 4KMRA 1AE1A 2NR5A 1SU4A 5DT2A 3ROKA 5DBIA 1T0IA 1YNOA 3SM3A 1JPVA 2RCNA 3B1KA 3SFZA 3MIIA 5FPSA 1F5SA 4IUYA 3JQCA 4EGAA 4KSBA 1T5TA 4UVEA 2QPAA 2HU5A 2VK8A 4Y6QA 3JQGA 2NQ8A 4DWVA 1SH7A 1E9CA 4IVQA 2PGLA 4GKBA 1LTQA 1MPTA 3G2MA 4PYMA 1YQTA 4EELA 3Q3CA 4UVGA 1P3Y1 3X2FA 4BQEA 4DR6B 1R12A 1DELA 2G06A 5AIAA 4GBJA 1XHOA 4U63A 1VM6A 4BY9E 2EC5A 3SJAC 3P9XA 1ZXBA 3LNTA 5A5FA 4O08A 5JS1A 2O2ZA 3DOFA 2UYGA 3NCHA 2Z2ZA 1SD2A 4EGJA 5JLJA 3U17A 4P2BA 1U7OA 4GYKA 2Y4TA 2AXQA 4TL9A 4L9SA 4GECA 2QV0A 4PGFA 2N75A 3K0HA 4ZAYA 3VYRB 3RYCA 1VI2A 3FDZB 4BV9A 1KEZA 1OXVA 4ESOA 3SK0A 4AY5A 1RJWA 3SDBA 4E21A 5JCZA 1PYDA 4JASB 4C0KA 4PFJA 3P0RA 4Z7JA 1ESEA 2K7ZA 1DCTA 3DNPA 1WXDA 1USIA 1HE4A 1EBOA 1DI0A 3KEGA 2BEUB 1NLFA 4JI4B 2X5NA 3GR6A 4CM4A 1XUQA 5AVQA 3QOYA 2Z4RA 3EDYA 3LNNA 3UMMA 3GRPA 1K7YA 2W2LD 2LW7A 1TQ6A 4C6TA 2NAPA 3WGNA 1OREA 4Z0PA 1K73W 2C2ZA 3KETA 3MYRA 4G0PA 3FPBA 4BNXA 4CLDA 2O05A 3NV9A 3CLSC 5EZSA 5K3EA 2H18A 4TT3D 4R40A 5K4GA 3HCEA 3UPTA 2GFQA 4G1MB 1SU6A 3NC4A 1FRZA 4ZGGA 1AY0A 2BD0A 4V2UA 3QYAA 2FWNA 3BABA 5FLXN 2UZIR 1IMOA 1S8AA 3BORA 3SQLA 3ETHA 1MN6A 3R20A 3UHAA 4BATA 1YB5A 3IDFA 4FLUA 1GTZA 2AUTA 4CKBB 2ZRNA 1IB0A 2HK7A 1Z5ZA 2BWJA 2HT1A 3GVIA 3AG2C 4H7HA 1R37A 2WTUA 3MS7A 1UUFA 1T5EA 2ZYWX 4GR4A 3LJKA 4PGMA 4LKOA 4CIWA 3SZLA 1JDPA 1SHKA 2XE7A 2PN1A 2H8KA 3FDFA 5EE0A 3UIEA 1G5QA 4X1IA 4A6PA 1Z0DA 4AIIA 2VDVE 3LFUA 1JN1A 4L50A 1A9XA 3IRUA 3GA7A 3I8SA 1FSZA 4UZFA 2LTAA 1J7KA 3ZI4A 2IU4A 4AJPA 3T8YA 4E13A 2IHTA 1YR2A 2FUCA 2ZYHA 1Z0KA 2EBUA 4HRYA 4L8WB 1PS0A 4Y1GA 2UZ0A 5H1YA 5G1NA 4Y8VA 2A9RA 2IYRA 3NJ8A 5CDFA 1SO8A 4ZP1A 5A3QA 1DEAA 5H5JA 3AR6A 3BZWA 2XITA 4AL4A 4GWLA 5LZ4A 3BQMB 1A50B 1UXIA 2I55A 2XBLA 3I62A 3LNMB 3VHRA 2KG7B 2FGJA 3PJDA 3KKEA 1K6JA 2E75B 2J30A 1P1RA 5JO0A 2KWIA 1XDZA 4IDCA 3GDFA 5FUYA 4BU0A 2ZR7A 3PC8C 1NATA 2O8FB 3CTMA 1WDKA 2XCOA 3BHJA 2PSDA 2BGMA 3D7MA 1UBKS 1XD9A 1RQ7A 2WSBA 1E62A 4CM1A 1VMAA 3AHDA 3PVCA 3SLKA 1DAPA 4PC7A 1YHYA 3KEFA 4XIIA 2BMAA 4I0WB 2HRQA 3IBTA 4O2BA 4R1LA 4RA9B 5JHHB 3FNGA 4K2HA 2V5AA 1Q3TA 3Q5DA 3FWNA 2ZRMA 4FFSA 1RHQA 4PHGA 2D2VA 3H4VA 4EG0A 1FRQA 4HH1A 3A6EA 1DX4A 1TFRA 1JOYA 2HJFC 4UEJA 1Y48E 2GK6A 3FF4A 1MJFA 4Y6RA 2BFEB 5TNXA 2LBPA 1QMPA 1ADYA 3VNSA 4C0HA 3ROQA 2JGKA 2CNNA 3H4IA 3OWHA 4WY2A 3UO3A 4ILKA 1MW8X 3N3BC 1F2VA 1Q1EA 3TZKA 4IFTA 4K3AA 5AHXA 5BR7A 1N9KA 2Z56A 1KKUA 1IOZA 2ON6A 3MMZA 4RORA 3B6IA 3RS4A 3M1YA 3C2QA 3L1IA 3L49A 2F4NA 4HO1X 2ONKA 2YZMA 3MWJA 4YRRA 1KJYA 1KYVA 2VXCA 4UDNA 4ALMA 5TMEA 2Q2WA 1S5JA 3WRXC 2P9ZA 4B73A 3EWIA 1JA0A 4J7UA 5CM2Z 2E82A 4EG4A 2ROQA 3SIRA 3TDMA 1E2UA 3TQCA 3N0TA 3D6NB 1NW8A 2WUVA 4UM9D 3DV2A 2JGDB 4DDMA 4DSOA 1M1NB 4HFNA 2I33A 4EGQA 4JQZA 4JJ6A 3HN7A 5F7JA 3RANA 4ZOBA 3TFQA 3X2EA 1M57C 4YGYA 2OLJA 4IDDA 3VR4D 1MIHA 4X00A 1WY5A 4DV7B 3BREA 3MLAA 4NULA 1T2CA 4H6WA 2IDJA 1BEZA 4M60A 2R86A 2HV9A 1N0JA 3AP3A 3ZW9A 4TKLA 3SDZA 1LY1A 4QTUB 1QVFU 3ABKC 2F9ZC 1OXXK 3K0CC 4HRVA 5BSEA 4G88A 3U7HB 4M76B 4DE5A 3FMOB 3S1LA 1NXQA 1OMOA 4Q01A 5GY7A 2PUJA 1E20A 4D6YA 1ZL2A 4AJ2A 3BA9A 5JZVA 5IWAB 3AW9A 1A72A 4EMUA 1O96A 2LZ0A 4H35A 1RLUA 1DCFA 1VKNA 1VPEA 2W42A 3QU7A 2ZCUA 3JYOA 3AHHA 2ID8A 1AP6A 1WZUA 1WUYA 1CUZA 2HQSC 1IXMA 2D2XA 3QI7A 2VHZA 2R4TA 2EX4A 1YFJA 2BFDB 4XA8A 3L9DA 4F06A 2CVLA 1NPYA 3ZGLA 1X4TA 1K73H 1CUHA 3RRZA 1RLJA 1E8MA 4W7IA 4ZI7F 2FPSA 3EDOA 2ZJ1A 1RYMA 4RS3A 1F51A 4PONA 1W48A 2WMDA 5AKYA 3DNMA 2PWBA 1QIDA 5JYEA 4YIOA 2EZTA 2XX3A 3S7TA 1DVRA 1WMAA 1W59A 5FOUA 3JTMA 2BTOA 3NAMA 2VZ0A 3GDHA 2O7QA 1CJCA 2AR9A 3LY8A 4GP9A 4UE6A 1XZJA 5FWYB 3CPSA 1L4YA 5LYJB 4G0MA 1Y7IA 1XMSA 3EG5A 2NZVG 4Z7NB 4ZVQA 3CX7A 3A8TA 5CA3A 1QNFA 3VKWA 4BNZA 1QNLA 1IV4A 4UXJA 4PPQA 3GEDA 2O8CB 2HR1A 1XMQB 3WYNA 3CQ9A 4BO1A 5TJHA 3WXBA 4TWJA 3IEMA 1DIRA 4OA5A 4HEJA 2CF6A 2BELA 4L9AA 2AJ8A 5BW6B 2OE2A 4HL6A 3ZS8C 2DECA 4PE5B 3PYLA 3CNNA 5G4KA 4RK7A 4QPJC 4CEHB 1Z2OX 1BZKA 4E7PA 3DCYA 4PNZA 3D4PA 3QG5A 1A4XA 3CUKA 3PQ2A 4LZZA 5LOVA 3DLAA 4HN2A 1KDZA 1G8MA 4KGXA 1E9VA 1L5HA 3TVTA 4DJFC 3NYIA 1LRJA 2YWXA 2ZUVA 1NBWB 1P4AA 4R54A 1B93A 5EKDA 3CLRC 2JA1A 4AKTA 5K6TA 2ZE7A 1KJIA 2VDWB 4GC5A 3DOIA 1V48A 3ICVA 1E32A 3IUEA 1EVKA 1NTKH 1IN1A 3OOJA 1E0SA 3QVMA 3PXUA 2I7DA 1D7OA 4ZXPA 3V7YA 2JFFA 5DM0A 2Z9BA 3W2EA 3GMDA 4H77A 1VQ5V 2HO4A 2SNIE 1XWIA 1JSLA 4XJTA 2PXAA 4D41A 4LYJA 1RAFA 1RRFA 3A9WA 1KXZA 4P0TA 3LUFA 2HADA 1Z68A 1IXYA 1P3JA 3PDWA 3EFOA 2E1RA 5BR8O 1WKVA 1FBTA 2PUWA 1FTNA 4XGQA 4JT2A 4N03A 2Q7GA 4KTTE 4F9FA 1VMIA 4M36A 3CR3C 3WSVA 5A3VA 5EBLC 1NVTA 4LF5O 1FC0A 4QGSA 3SYRA 3ZRVA 3BQNB 3PYMA 1OWPA 3HK2A 1VCHA 1UJWB 3CCEV 1HX7A 1HI9A 4HB0A 4Z9YA 4B7UA 3I6QA 5LHHA 3Q98A 1UIMA 1MSDA 3T1HO 2IT1A 3CP1A 4P0PB 4AO7A 2ZZKA 3EPKA 1P6XA 3N2GA 5DECA 4HKTA 2HMSA 4HQOA 2NO4A 1UBUS 3BY6A 1Q43A 3M6LA 2O1SA 4FOLA 1G63A 1VG8A 2FCAA 3PUZA 4R5HA 4A7PA 2W58A 4L02A 4NHOA 1G66A 5BN1A 4B3HA 2IPXA 2B69A 4R31A 1S0VA 2XUQA 1Y76B 2J59A 2W8ZA 3VOAA 2QROA 3GZNB 5CA1F 1KD1W 1P7YA 4RVOA 3AFHA 2GKSA 5EO3A 1A95A 3GYGA 1CXZA 3L9XA 1VBMA 1L7VC 1RLIA 1ORRA 4LDRA 4PLGA 4PXYA 4G67A 2JJ2A 1XRQA 5HOEA 1D6SA 2WDPA 5K8LA 3AK4A 1I01A 3CNBA 3B1XA 2GJAA 5KNDA 1WXHA 3CR7A 1QHHA 3HWX1 3KQSA 3Q8HA 1PDOA 5DKFA 3HJHA 1VQVA 1ST3A 4HAWA 4MARA 5KOHB 4CTOA 3LQ4A 4RMIA 4B3RB 3SHTA 5BV8A 2UU9B 3TSZA 1TUBA 3ABRB 1Q0QA 2W93A 1EFRD 1LD3A 4MWSA 5IAOA 1ZZGA 2EATA 2W6PA 4K1XA 4TYPA 3LUKA 2GJ9A 1GAQA 3MJCA 3B8NA 2R9VA 1AGRA 1RI2A 4M9QA 5SZJA 3SMQA 3N2LA 3L6DA 2ZF8A 5FTWA 1V6SA 4J2OA 2IXFA 4KBGA 1FXKA 1AC5A 4TQDA 4YT4A 1EFLA 1S8FA 3V7NA 4MOWA 3CHXA 4UQLA 4Z99A 2C1EA 1ECPA 2NT3A 4D5GA 5TLSA 3CH7A 4G0VA 4Z86A 3WZLA 2FFHA 3C48A 4XLTA 1TEZA 3HZOA 1YJWV 1Q3KA 3BWMA 4J91A 3BFPA 5HY1A 1Y1LA 4LIPD 4F56A 1XXHA 1GA4A 1H0KA 1GTJ1 3PR3A 1TJ5A 1KQSF 3AVTA 4ZOEA 2P2GA 3LPDA 5D5PA 1ICIA 3U80A 4UU7A 3RGGA 1ZKDA 3PD1A 1ECLA 1D07A 3CMEF 3FVQA 2AOUB 4Q9DA 3HABA 3GJ8A 3SJCA 4XSVA 1TU0A 4FSXA 1A88A 2J4DA 2X15A 3HBNA 2QEQA 2ZRAA 1Q0SA 2QRLA 1E0AA 1NVBA 3GC6A 4QDKA 2YXLA 1HDZA 3M4YA 4GD3Q 4KP4A 4FN5A 3AG3B 4LQDA 2YBEA 4X92A 3VDRA 5EZ5A 3TOZA 3QXXA 4DIBA 3IO3A 4BT6A 4L08A 4KR3A 2Z5VA 4RMJA 3ETEA 1IPEA 3EY9A 1I0HA 3AYZB 3GLQA 1FMLA 1XRPA 5A3SA 4D9MA 3Q1KA 1PFUA 1BJKA 4OD0A 2W6NA 2XVMA 4RF3A 1KE2A 1JEJA 5ALIA 5BXZA 3RPEA 4OLBA 4G0QA 1XZGA 5K0CA 2EF0A 3S3TA 5C4MA 3DE1X 1M34B 2HJRA 2JVIA 3WV4A 2FN9A 1ZA1A 3CMMA 3OJ0A 2X8JA 1OFVA 3FWZA 2IJJA 2JASA 2WJJA 3LOPA 1DAGA 3K32A 2YOHA 5E38A 4UBIA 3OW2F 2W83A 5EQFA 1QHGA 1G3QA 1I6WA 3GJ4A 3VR3A 5F33A 2VAVA 3BKXA 3U37A 4FLTA 4N1AA 3SXJA 2X41A 5DCWA 3H1AA 2WYVA 2HEPA 3K0GA 1L7XA 2RAVA 1PNOA 5ALDA 2XUGA 3ZN0A 1W19A 2IC5A 1BMDA 1IN7A 3OOYA 4TWRA 1JPUA 3QX3A 4CMEC 2Z3YA 2AFIB 4OP2A 1JKJA 2IBSA 2XTJA 3K5PA 3C6BA 1T1EA 3SKXA 1FXWA 4LYHA 3FOFC 1U7DA 4OQ4A 3NJ4A 3JR7A 2RG7A 3DDUA 3TRIA 1NTOA 4LE1A 5HIIA 2ZE8A 1HDCA 3COPA 4DW1A 3O8QB 3ETDA 1Y7LA 5BNTA 5KREA 5ANRB 2YUIA 5J4VA 5I9TA 2PI5A 2N48A 2F64A 1UPAA 1USVA 3OX1A 3WWDA 3CEJA 5TC4A 2PGIA 4KLNA 3C5WP 2PVSA 4J29A 4JROA 1I6KA 2XNCA 3HCDA 4XYLA 4BWGA 1UBFA 5KWEA 2GSDA 4K9QA 5ADWA 2PX6A 1FU8A 1UT8A 2VLIA 1OZGA 3C4QA 5I3ZA 5ADHA 5CCEA 3ZR4B 3I72A 8ATCA 2VDPB 4K81B 4Z4FA 1QQAA 1NBOA 5IKPA 2XCUA 3DUFA 4CWAA 1OA1A 2F1MA 3SR0A 1ZGBA 2R2AA 3A7DA 5BPHA 4RE6A 3GV0A 3L8CA 1KD1H 4RIGA 1L5YA 1UMDA 4LFBO 4P4SA 2FN3A 3OP1A 2DT4A 1E4EB 1WSDA 3SVLA 2OHOA 3LSQA 3PJFA 5WRFA 2G83A 4BAZA 1FXSA 4XDZA 1HDEA 1SUBA 2H8GA 4UVHA 4A5UB 3JD0A 5HIJA 5GV8A 4CMKA 1SKVA 4NZZA 4XEUA 3JAKA 4GE0A 3V2HA 2NMUA 4G1CA 1FP7A 5BSFA 1BG6A 1GYRA 1AV7A 2XMPA 1XYVA 5H68A 1JJ2U 2FFAA 1XKXA 3AUSA 3FUUA 2Y4OA 4Q1DA 2EFJA 2HQRA 1PK8A 5LUBA 1USKA 2EFYA 1AB6A 3CRQA 5BV2P 1U1GA 2O4UX 4O3FA 3I30X 4YCMA 4B3TO 1N5IA 2WVAA 4PQYA 4P7FA 5JJEB 2WHRA 2XB4A 1OTYA 3NK6A 4MVJM 5TR9A 4M7OA 4F6LA 3KB8A 2ZUBA 3ZDZB 1UJ4A 4X1KB 4OXYA 4TUYF 4ZYTA 2J3DA 3T35A 2ZG6A 3E7FA 2WOOA 4DYLA 1NMEA 1E2PA 1D5NA 4RJKA 3THOA 5LDHA 3SI7A 2B1JA 3ZCRA 4KAAA 1YJXA 1GCAA 5B12A 5THKA 3F4LA 2OD7A 1AROP 4N3BA 5ALEA 3DDWA 4G86A 1UF9A 1E2HA 1R5BA 1CF4A 3I6IA 4WUTA 4YY3B 4MKHA 3ZDYB 1UKVY 5IN5A 3ESXA 2X86A 4ZJUA 1NVXQ 1AI7A 3M6XA 2NUTB 2LWIA 1XPOA 1ESMA 4J7KA 4AFNA 2WOJA 3MJHA 3V1TC 4JI5O 1GZ5A 1PQPA 4Q3KA 2OVFA 3IEWA 4HZUB 1D2CA 3PUHA 2EZUA 2HF7A 4D5EA 2QN1A 4J03A 2ZWAA 3KT8A 2PWZA 4KQ2A 1JTFA 3V4FA 3FAVB 4OSPA 1TW3A 2NX2A 3URKA 1B2LA 1TKBA 2QNRA 5EZ6B 3NETA 1WXWA 2PWAA 5ENZA 5F12A 3IAFA 4LJSA 2XE6A 4JK3A 3MNFA 1SUWA 1UC4B 4L4UA 4QQ8A 2GLUA 5A4AA 4GSLA 2PVCA 2IX3A 3DGEC 1EA5A 3UKDA 2JFWA 5CR9A 1D04A 5JJBA 1ODSA 2DFVA 5JAUA 2H0QA 1P73A 4YXWA 4FEGA 3KZXA 1S8OA 2ZRPA 5BW8A 4OU4A 3MBKA 4CS4A 1J9GA 3RSGA 5LA6A 3LKVA 2FPOA 2XMGA 1GV1A 2I7CA 1YOVA 5CX1B 1IUNA 1IX9A 4B84A 2XOKD 2WWXA 3RVZA 2WG0A 3NH9A 4H7DA 3DKRA 1NY5A 5CEJA 3GYQA 2H07A 1VSQA 1MTOA 2VEDA 2CW5A 4DCNA 4G5XA 1XZEA 1N36O 4QUKA 1ZISA 4J1TC 3ENWA 1H2LA 2NVOA 4CN8A 1C30A 2ALEA 4NFLA 4DDWA 4C4TA 3I9LA 4M1ZA 3H2BA 5I8ZA 5LU8A 3GGGA 5E6RA 2AIRA 2Y67A 1HFJA 4J9VA 4FZ0A 2P8SA 1GPYA 1JHZA 3ORYA 3UMYA 1SQ6A 5A71A 4AKIA 3OQJA 2PS3A 4TS4A 2PUHA 1JW9B 3SQDA 4JNCA 2PXHA 3RIYA 1E3QA 4JVMA 2WJHA 3WGMA 5A9TA 2C3UA 1OCRB 3EEIA 4EUSA 2WRZA 1VJGA 3G17A 1HTWA 3LQ2A 3EB9A 1JHVA 3B89A 2ZAOA 1SURA 5C1PA 2PI4A 1PEYA 1T8PA 4WOBA 1RZVA 3L6UA 1JIIA 2IA5A 3QENA 3E03A 3LX4A 2YTZA 1FNDA 2PD3A 3L6OO 4DWWA 3P20A 3K1ZA 4BVJA 2VWKA 4IF4A 3TE6A 1DP4A 3GVXA 4EJSA 3FPSA 1ETUA 3EXEB 4XR4A 3M3DA 3OKFA 4Y2RA 5JI3E 2GZAA 2SKDA 5HIMA 1JGTA 4D9NA 1GZVA 5H70A 2ODPA 3PGMA 5CFRA 3EIQA 3KSRA 4A4DA 3KUDA 1E9AA 2E5FA 2R25B 3I12A 3MBIA 1GDTA 1OXMA 4W1PA 5CXUA 1J56A 1FFGA 1BGVA 4DV0B 4JLVA 1FEZA 4E5VA 3RVQA 2LGWA 5DISB 1XCGB 5EJ6A 4ZVRA 1DBWA 5IKOA 2A7QA 5LQNA 4F2HA 5JXWA 4LC0A 3W9BA 3OM3B 1GTRA 4AJHA 3LKDA 2ZJAA 3UJ9A 1CRQA 4BNDA 1V3TA 3EA4A 1C1DA 1H0SA 1YFZA 1ECJA 2Y93A 4UNPA 4Z5XA 2ZNJA 2O8NA 1SQ5A 2GN9A 5GINE 3QMWA 4MR9B 1GTOA 2DUWA 1XQWA 1IHPA 1R6TA 1U3WA 4UUBA 3CW8X 2GUZB 3NC1C 4EG3A 5E4TA 2XGGA 3MJ4A 5C2JB 1M2GA 1KZ6A 1OYYA 1T0KB 4GL4A 1MGPA 2HR3A 4XX0B 2PWYA 2AKAB 1OYVA 1OH7A 2ZCEA 1AS0A 2FG5A 2W2LA 4Y1RA 1G6KA 3VHLB 3AETA 1M2VB 3IXQA 1NV9A 1U98A 4HEHA 5K45A 4F38A 2HJGA 3A2KA 3TN7A 4IDPA 2ZIFA 3IOMA 1K66A 3CIFA 4TT3A 3SHWA 4N48A 1QFZA 3FDXA 1U8AA 2G5PA 4L22A 1DSSG 1N5RA 3ZWQA 4DQ0A 1ZJ5A 1U8TA 3QKIA 3ZCPA 3E20B 3KQKA 4CFYA 3RSOA 2C9CA 3SEQA 4NOMA 1AS3A 4K6GA 4KQFA 3K9FC 2XMDA 4L15A 2VYVD 2H9YA 4LRTB 2RHTA 4NVPA 4QRHA 4M46A 4U2FA 1DKNA 2JIDA 1OHHD 3HU1A 1SVWA 1B0UA 1Q19A 3KHSA 1GN8A 3OAAA 3BFJA 1YS1X 4EO9A 1QX4A 4GM0A 4IWXA 2HF2A 1BN7A 3U0ZA 4WOKA 4YECA 4CLOA 1J8MF 2PMKA 4LV5B 4JJKA 2HRRA 2Z2IA 5C1OA 1I5XA 1FMTA 3DWEX 5A62A 3ZZUA 1CNEA 4GVPA 4BX9A 4LWOA 3I2FA 2BGTA 4IDAA 2AI3A 4PHTA 4W1RA 3JQFA 2FN4A 1O08A 4BO7A 1XUOA 1KK1A 4Y7CA 4OQLA 4GSKA 5LQJA 4WV3A 4AULA 3F78A 2WP0A 4I9HA 1Y3IA 4YB8A 1KY5A 4QT0A 4X7BA 2A5FA 4UE3S 3IRVA 4Z8YA 1HT1E 2G7ZA 4I6EA 1TB4A 1SVOA 2ZSAA 1RM5A 2WR8A 1PT5A 3D3WB 2Q28A 3FZYA 3CE2A 3LUAA 4KLZA 4P86A 2C2YA 2QLBA 2V4UA 1CUEA 3LT5A 2DJIA 2XNDG 3H2ZA 3U1BA 1VIDA 2Q8VA 1KMIZ 1XQVA 4IHKA 2H1HA 1RYYA 4RK0A 3E84A 4A36A 3GEGA 4BVKA 5EC1C 5CGZA 3RE1A 2KPOA 4EUNA 1OZ0A 1CE8B 1TU4A 4FJCC 1R10A 3GH1A 4Z4CA 2JAUA 2YL2A 4RNCA 2BIFA 3PG5A 2CL0X 3B85A 2AF3C 2PGJA 4AN1A 5GQSA 1R6XA 2A3QA 4WZAE 4F9GA 1NQXA 4XE5A 4K88A 5HJ5A 2IEDA 1HE1C 3SF0A 1Y4SA 3EISA 3V8QA 2QMYA 1TC1A 1RAGA 3HKEA 2IF0A 4XUCA 3HKCB 2DZDA 4KVZA 4RWUA 3K35A 1KIMA 4EHJA 3CRAA 4NF2A 4M7RA 3OKAA 2YNMD 4IAOA 4DPMA 4QARA 5JTTA 5IYZF 1PFVA 2WLIA 4LNUA 4J1NA 3QJ5A 5LDGA 3CC2F 2VXBA 3USES 5IXJA 2C9BA 3DWIA 1B14A 1G1AA 1VP7A 2QRQA 2OSBA 4ZO7A 1KYTA 3L0CA 1Z16A 3UGJA 4PZ0A 3V7UA 2AOTA 3QUSA 1Q6ZA 3GDGA 3O2JA 2O3SA 1K0UA 2XD4A 1KEWA 3RD5A 5AI0A 3QVVA 1NWCA 4OM7A 2DERA 4KQKA 3DD1A 3C1AA 3FSGD 4LC9A 3LDEA 2Y48A 1TQ4A 3P0JA 2ERYA 4JYMA 4ZICA 3E9ZA 1XVVA 2I2AA 1A69A 1V7QA 4EYSA 1GZ0A 1E5XA 1JYFA 5FJ4C 3KV3O 1U7PA 1VLVA 1IK6A 4QBKA 5ALMA 3SBDA 1XEAA 3EWNA 1E96A 4LJKA 3NHLA 4JJ7A 4J90A 4G5YA 4D46A 2O2EA 2XAAA 2OR3A 3DG9A 2A86A 2I2DA 1FX0B 2GBLC 2BEWB 3NTLA 4ZU6X 3WLTA 2CJYA 1KZ4A 2V6BA 3WQRA 4PZDA 1BRTA 3VR4A 5TMPA 1FFYA 3C5HA 4H37A 3CH5A 4XQ9A 5LBUA 3ONVA 4N7BA 4AJ9A 4D0NA 1AT1A 3P2KA 2I8CA 4KUGA 4LZOA 3DOOA 2H1VA 3LK7A 4IEFB 3RCBA 3DOUA 4GRDA 4P7BA 3PRJA 1Z4LA 4MW1A 4DG5A 5G4LA 5JMOA 1Z5UA 4LRSB 4KFUA 1FVOA 1WHTB 1M6YA 2BM0A 2H59A 5JQWA 2MW2B 2P4EA 3EXG2 1PGOA 5IYBO 1GCOA 1HRKA 1EFKA 3FROA 1SZTA 1DF5A 2HVYD 1P1BA 4P9OA 3TDNA 5AKLA 1DAEA 3ZCQA 1WZNA 1FX1A 1NSFA 3TO5A 1HQKA 4F3TA 2J9FB 3BULA 3IKMB 3M89A 2B8NA 3UG6A 2ODNA 1CTQA 4CGYA 3QO8A 2V3VA 3GPBA 5FADA 4H3SA 2B1IA 2OHVA 3U3OA 2J3KA 3WLSA 3FPAA 1IEQA 4AWAA 3LUPA 5BXYA 3UK0A 2XKJE 3Q3IA 1SXJB 3MT8A 4OQDA 3KJNA 3L6RA 3WLQA 5M2QA 5CA1A 4M4SA 5AKHA 4PA7A 1AUXA 4QGFA 5JQGF 2HJWA 4G0OA 2FPWA 1LDGA 3STTA 4AAYA 2O5EA 3P9CA 2QVXX 3DFIA 5LWQA 1UXOA 5IPFA 2V5VA 1KEPA 4DO2A 4LA4A 1EVQA 1K7CA 3VQYA 4EFLA 1OH6A 3JD2A 2WY2D 1GN4A 3SYQA 1J5EO 3AHIA 3DMFA 3ZBUA 4TLBA 2BM9A 3R9XB 5LYJF 8GPBA 5FAXA 1NL3A 3OD4A 3V48A 1JNYA 1L4BA 5DXAA 5B64A 3SSMA 3D5TA 4I55B 1EZ4A 3AVOA 1QFXA 3AF4A 4YP9A 4GSYA 1RM4A 2OZKA 4LR3A 3F0FA 2H4HA 4E33A 4MJ7A 2C8JA 3CEPB 1LNSA 4CFZA 1F4MA 4US1R 5CIQA 4DR2B 3MVEA 1RHKA 4NBLA 2HIHA 2JNBA 4RFLA 4YUXA 2WSIA 1CR0A 4CMGA 2WFLB 5LGNA 3T7KA 3L72H 1CLUA 1RMTA 3D6UA 2HP0A 3RGWS 5A5GA 2ZXFA 4KODA 5A4KA 4JBYA 4FB5A 2Q3MA 4A2CA 1M3SA 1VBNA 2WNIA 4I5EA 3QF4B 4UCVA 1VQ8F 1AMOA 1VSBA 4EVQA 2I71A 1I7PA 2HG5C 5L3SA 4NXMO 2V55B 2FEOA 3GLHE 2CT8A 3WWOA 2NO9A 5E95A 3RR2A 2XJ9A 1JIUA 5LZ2A 1TCAA 2IVZA 4D8TA 2BGJA 1C4OA 1Y1PA 4ECAA 2PBZA 3DD5A 3NKLA 3SQOA 4J07A 3AEZA 2JFVA 4BO9A 4WFBV 1UQUA 2B4RO 1LDYA 5KHLB 1EM8B 1YQGA 4NJOA 1KJZA 1IV1A 5IDQA 4MWDA 4PLYA 4N49A 1OU4A 2J45A 3S7ZA 3WPWA 3KSBC 1XTSA 3IKEA 1J7JA 3TW8A 2E6KA 1S5LZ 4W82A 1TYBE 4AQYB 5BMOA 1TECE 1MOQA 1TVKA 5IANA 3MJSA 3BFXA 1XBTA 2IYSA 3MN1A 4YCLA 1PR1A 3KQYA 1ATIA 3VRHA 2ZPUA 1N3BA 5C8DA 3X43A 1JHYA 4HAXA 2OD2A 4L2IB 2VUUA 3PUYA 3AM1A 1I1QB 2XVZA 1N2CE 3G2OA 3G71V 3CCCA 1JLRA 1D0SA 4CIYA 2OFFA 2FOLA 3QNUA 4RA6B 2QM7A 2H85A 4OEHA 1QVAA 1ODJA 4U2EA 4U6SA 1OXTA 2QN8A 4DG8A 5KU1A 1OQAA 2RE8A 4ESHA 5AK5A 3VJKA 1Z29A 1E3WB 5AI8A 2Z1FA 2AHYA 4AYTA 3LQKA 6REQA 2FVYA 4K1LA 4H31A 3BM5A 2Z1TA 2AR7A 4KZKA 3L4SO 2WJZB 1ID8A 4U8HA 4IRMA 1KL7A 1TD1A 1VPDA 4DV2O 1AJNA 3C9UA 2IUEA 4JZYA 2O2IA 4DR5O 3V33A 3FMPB 1A96A 4EA7A 2WHPA 4ZV7A 4MWEA 4NOLA 3OU2A 5D00A 4BEBA 3CVYA 4RULA 1TCCA 1U2RA 4JIGA 2PJDA 4JX8A 1EFRA 2WLLA 3C45A 2X4LA 3KU4A 1EDDA 2AD5A 1X8LA 1F8YA 4RF5A 3FNFA 2ZQMA 4DADA 4MQ4A 4FLWA 2ZVZA 3TVYA 3PEVA 4KOEC 1G21A 1R6NA 2Q1SA 4M0CA 4Y9RA 3TLEA 3E8HA 4B48A 3U11A 4W1QA 3GRCA 2Z4SA 3OU6A 2CLEB 2OM6A 2Q5HA 5DHSA 2FW1A 1L5QA 1Z13A 1J4AA 1KUQA 3VKUA 5SYMA 2HIGA 1QQCA 3KSDO 1AK2A 5L3VA 4QBFA 4MA5A 2OZLB 3FD9A 1Q8IA 2QXTA 2DTXA 4HBGA 3W6OA 3LHSA 1RYZA 2XWSA 4MV7A 3RNOA 2RHGB 4TV9B 3ACDA 1V2GA 4G89A 3JWPA 3HVIA 2IP2A 1JX9A 1MZEA 5JCOC 3URMA 4UCOA 5HWEA 2RN9A 1SFRA 2G9QA 1RABA 4J0EA 1D4ZA 1JI0A 1SETA 1P0FA 3Q4HA 4CM8B 4J6FA 1HZZA 3PHJA 3TAXA 1LPMA 3LBAA 5DU2A 3UPUA 2ODAA 4AILC 3MCVA 3CEHA 3R6GA 2CNKA 4DIMA 1H47A 3E53A 4JLJA 1EZVH 4JJAA 3D4BA 4ND1A 3E8BA 3NDIA 1LDEA 3WQQA 4Z6KA 2HYIC 1Q2XA 2ZPAA 2JBHA 1FPMA 4RXTA 3QQPA 1DKQA 4CV3A 3ETJA 3OGIB 4TMFA 3M9WA 1ZX3A 1R3JC 3T9EA 2OXIA 4LK3A 1TEHA 3KAQA 1SCUA 4C7UA 3W8FA 1ISMA 1B04A 1PW5A 3U6KA 4PXAA 4HBNA 1M9NA 4HVLA 5T8KC 5KHGA 3WGIA 4Q6BA 5K3CA 1K8XB 2RH4A 3JASA 5FV7A 1JEEA 3T4UA 2AK3A 1LPOA 5JATA 5DBOA 1TGVA 3WJ2A 4EY8A 4C82A 1T0AA 3HDYA 5IYDO 2ZJ6A 4B35A 2C94A 4FDMA 3WVNA 3BJEA 1PJ4A 2CXUA 1FFCA 3CCVF 1EP2B 3W06A 2KB1A 1CJVC 4P34A 2Z43A 3CHYA 1W0KG 1FDOA 5F2EA 3RB8A 1CNMA 2BM1A 5LDDC 1N3IA 3HA7A 3E1GA 3NYQA 1DIAA 3WJAA 4F7DA 1PJRA 5AI4A 1MMMA 3U7IA 5U9CA 1UIRA 2WJYA 4JP2A 2WLTA 4CEJB 3ZV6A 1QCEA 4CMJA 1XZLA 4B08A 1Y5RA 4KUEA 1ZRHA 2DM6A 5ULLA 4F7WA 3WGTA 4XJXA 1AI5A 3HA2A 3JALB 1D6MA 2GTHA 5E2IA 1HNNA 2CYBA 3PHLA 2X6QA 4DIEA 5CUQA 3IQGX 3W3AH 3UH0A 3DS8A 4UBNA 1VHTA 1ZLZA 1ZSPA 3VR1A 2C0PA 1KNQA 3EW7A 3ILHA 1RA4A 2BFBB 2R8OA 4X8AA 5CHYA 1JYSA 3OIYA 4RETA 4IV0A 1YFLA 3LW7A 4FHCA 2AMLA 3ZLBA 4AKSA 3TXYA 3JD3A 1ESZA 3RKRA 5CAEB 4MEAA 5I5GA 2GK3A 3AHCA 4FMBB 1SWVA 1WETA 5CB6A 4JUAA 3T3NA 2MINB 3K6RA 1HT3A 2V4DA 1YH3A 2OHHA 3IVMA 4M88A 2PZAA 1RXEA 2ZYRA 2BSKA 2E49A 4IH1A 4BZPA 4RKEA 5L3QA 4OK6A 3IMGA 1NR5A 2HWYA 4YCBA 3ZBPA 4EPTA 5JNWA 3JPYA 2AMVA 3R3HA 1WCWA 3AFNA 4KGDA 2GXSA 4Q4LA 5IBPA 1PE0A 5EIHA 1IDN1 5JIBA 2OV6A 2FN7A 3EK2A 1QH8B 2Q5JA 2VDOB 1W55A 2Q07A 4JC8A 1DAIA 3P71T 3PAFA 2IY9A 3LDCA 4NMXB 2ZTLA 1KB9F 2GN6A 3SPJA 2IG8A 4PINA 2ZR8A 2JGIA 2ZLBA 3FYEB 4ZT2A 3DC7A 1YXBA 4G6ZA 3G1UA 3ZIAD 2QWOB 2OWDA 2IJIA 4LZLA 4Y9TA 2BFCB 4FNAA 4L8GA 3ZLUA 5LBQA 4HNAA 3R8CA 5JWPA 3LWPC 2J08A 3H8WA 3OI7A 4P35A 1YJCA 3JXEA 421PA 1AKEA 4BQOA 2J3HA 2WHEA 1TGOA 4QE3A 2LCQA 2V1UA 3KLPX 1F1BA 1U0LA 2VHJA 1B15A 4HUQA 3W0LB 1PNMA 4HFRA 3EA5A 4IXMA 4PYNA 2G77B 4YAUA 3R3UA 5BSGA 2F55A 4ZV4A 4MTOA 4QFBA 4W4LA 1N5LA 2X42A 3TQIA 4ZMBA 1RMYA 3QUWA 3LWRC 3RRJA 1XTJA 1U2QA 2IX9A 1Y3BE 3UFXA 4Q1FA 1SOWA 2R7MA 4JEMA 4PAMA 3WBKA 2GYYA 2GZ3A 1VGQA 4AY2A 3A9UA 1Z62A 3OO1A 1WV1A 3ON1A 3ISJA 5CNKA 2WJAA 3E7DA 2IIBA 4GPTA 3HYCA 3L8FA 4YJ3B 5L51A 2FSHA 5CM8B 1XDGA 2DY0A 5IH3A 3K3WA 3QM1A 4RL4A 3OUUA 2XUHA 4LF6B 4KYVA 2PIAA 3RRYA 4JCOA 3MILA 3SVZA 1FSFA 5HTOA 3AT1A 4I5IA 1FS0G 2F3PA 4XVCA 2R3SA 3CF4A 2IDMA 3O1LA 3CCFA 4YAOA 3H0KA 1KU6A 4L6CA 1KAHA 4L3VA 3HB1A 1LVHA 1VJ5A 4Y98A 3EG9A 1ZX1A 4RPGA 3MTGA 3QNWA 3K31A 4LQLA 1E4VA 3O2NA 4MKFA 2MSWA 5EMNA 3UY4A 3WYGA 3FYSA 1Y89A 4HDRB 3HRHA 1GRVA 2GQ0A 3QLTA 3WK4A 5KQLA 3LHKA 2VJMB 3NHRA 3BZUA 2P2LA 3IQXA 1MKYA 4GVXA 3H9CA 3ACCA 3KWMA 2EZPA 1CZNA 3ZDFA 4WFFA 2V9ZA 3TQFA 3HDHA 2J5QA 3WJQA 1ADBA 3PC7A 1DXHA 3ZVNA 1V6AA 4M1KA 1USGA 2HXGA 1PL6A 3VR6D 2Y1XA 1Z5NA 3NYWA 2R6R1 5U4QA 4P4UA 4YQFA 4R81A 3I2YX 1KVRA 2CLSA 4C22A 2DPMA 2G88A 1OILA 1XDCA 3QVTA 3DXXA 5FFFA 1RJGA 1YGYA 3A28A 1SN7A 2NYRA 4U2DA 2IK8A 3QU9A 1I94B 2ZTVA 3DHYA 4PIVA 4C5BA 4KK4A 2GBOA 2XOKA 4LDAA 1Q16A 2C2BA 4LSWA 1AP5A 5ALQA 5A02A 4PM4A 1MH9A 2IYEA 1ZK0A 3T3MB 1ECBA 2G9VA 3UXHA 3LKZA 1HV8A 2F4VB 4YCJA 4IIGA 2YOGA 1CJUC 4JR0A 3WDLA 1VMEA 3KKNA 4PHCA 2VP3A 5DTRA 3KSMA 2XUDA 1HDOA 2COKA 5I9MA 4O2RA 3IAEA 3A25A 4U7FA 4FMTA 4K3UA 1TIKA 4RKYA 1RWMA 2QMEA 4U7TB 1X7XA 3F6RA 4F46A 1QR9A 3WU2Z 3X2SA 3A1UA 4AURA 2ZRJA 4ISCA 3KXDA 4CKEB 4CR8A 4IH9A 4WFEA 3SR2C 5CDSA 2OYSA 2HLNA 3P2MA 4WESB 4WXYB 1MJGM 3RTDA 1VC2A 3BD6A 1I5YA 2HT6A 2KBFA 4YYZA 4UPVA 2C2MA 4YBRA 4LRQA 4M7PA 2E21A 4M9ZA 1GAEO 4FHZA 1K6EA 5J58A 3NT2A 4EI9A 3NDBB 4QYXA 5JZOA 2G9ZA 1QB7A 2HIAA 2D00A 1ZUQA 5ELMA 1JLHA 3RUIA 1L8XA 3EXFB 1DBPA 3G68A 4YJ2F 2A67A 4B4VA 3J80N 1DNPA 3NRBA 2VP5A 5B55A 3P4XA 4R0VA 1M33A 1W2HA 1W36C 1J6UA 2OO5C 2G63A 4MP3A 1R8YA 1QLEB 3ENZA 4TRNA 3ETGA 4O4JA 3GDOA 3PRYA 4I1PA 5FPQA 2IIPA 3KWFA 4YDHB 3NBAA 4G56A 1JZTA 3NOXA 3NT5A 3E9QA 3UMGA 1Z34A 3PEEA 2IOFA 1Z8FA 3IKJA 2FWJA 3FD6A 1EBUA 3W9SA 3IT2A 2CHVA 2XBUA 1YR7A 3G8DA 1E3IA 1GDHA 4DMKA 5KNBD 3L07A 2MJLA 1WN7A 5TRTA 1RXCA 1R0ZA 1I08A 3RVKA 1JXQA 4YX9A 3JVHA 4RK6A 3RW0A 4YV2A 2HA0A 4XSHA 2GZDA 4BMCA 4ZAVA 1XO1A 4NG5A 5KMGB 4S24A 5H3LA 3BH0A 4QL3A 4P2GA 5FJIA 3MELA 4IY1A 1QR8A 3AHGA 3NIGB 4QTZA 3RU9A 1IDSA 2JARA 3DKPA 4P82A 3BYZA 4JKIA 5HFAA 2OV2A 4ZQBA 1C8KA 2XWPA 3ZJZA 2ZR2A 2GCEA 3X1KA 2DQ4A 4TMYA 1CU1A 5IVKA 4RQTA 3C8HA 3JD1A 5LQCA 2PYIA 4GKVA 1NN3A 4DA8A 1TT7A 1E2BA 3X44A 3F8SA 2O3UA 3M3HA 1J0CA 3OCZA 2H6EA 1JPNA 5E6UA 4NU5A 3WQHA 3ANTA 2QU8A 1N8SA 4H33A 3FTPA 4IJKA 1EFUA 1U2DC 2MYPA 2VIIA 4KH1A 3VHQA 1K3TA 2AJDA 3SYKA 2WPDD 2KLBA 4L16A 3HDQA 1X42A 3EQ2A 5C81A 3ZE9A 5C8ZA 4QWMA 5IYZA 3ELBA 1D2GA 3O83A 1MAHA 4B3SB 4FI3F 1FJGB 1LQTA 3JYLA 5DX1A 2A0WA 4FYMA 3ZXSA 3ZUGA 3VNVA 4UVDA 4AJKA 4X24A 1YBFA 4KLAA 3SSOA 2AZTA 1VE7A 1EAYA 5KYWA 2JS3A 1DAFA 3H0CA 5IDXA 3L8YA 2DYRB 1G9XA 4AG3A 1EESA 4PPGA 1ZITA 6NULA 4OSOA 1UC8A 2VYVA 1FUEA 3D8UA 3U2QA 3KR9A 1NF3A 1B8PA 1VCMA 3I53A 4PSDA 4NBNA 3OQBA 2PVPA 1THZA 1QAHA 3CGGA 2HX1A 4H08A 4BB0A 3DVAB 1Y6GA 1OHHA 3UCSC 3EDMA 2AD1A 3A05A 4CT4B 4NJMA 4D3ZA 4KN6A 1JIJA 4J1SA 5CH5A 2YV3A 4IO0A 3M81A 2RK6A 1CP2A 2NSJA 4DSUA 2JZCA 2V54A 1DQYA 3RRMA 3PQ5A 4EFDA 4RYDA 1NXVA 4MH0R 4KQEA 1GNVA 5IULC 4MS4A 2XRFA 2QEXF 1TMKA 1XP8A 3SOZA 1I9GA 1XF1A 5KJEA 3UJ3X 1J2UA 1C2YA 5M29A 4JI6O 2ZKOA 1MC8A 5CNIA 2WVHA 3JAWA 2C82A 4AG6A 3THXA 1RKXA 3ILSA 3JSXA 4RVFA 4EFMA 2MSDB 3MT0A 3NHZA 5LVAA 2CFIA 4V1CI 5KCMA 3WZMA 1CUJA 4UNIA 1KAGA 3F6BX 2RGWA 1L3IA 3WB1A 1ZOSA 1PLLA 5AW1A 4FKMA 5L95A 1YACA 2NQTA 2QVBA 4RKWA 1BIFA 4QPKA 3T1QA 1WXEA 4MS3B 4F72A 3AB7A 2EVWX 4M3NA 5D85A 1R0KA 2D5BA 3GLFE 3AF0A 3AR7A 5HMLA 1GTG1 1U1CA 1QIKA 1J23A 5SYNA 2GF0A 4OGFA 2V7VA 1H8ED 3GG9A 5A7GA 4QLAA 4CG2A 3JCMM 3U1VA 3RTCA 2IYQA 3RIEA 3W5BA 2YZ7A 3QFHA 1Q5OA 2CLMB 1YIJF 3A3NA 2YVUA 3EHBB 1S2MA 2FZGA 1AGNA 1JG3A 2R70A 4OJKA 4RLFA 4RK1A 2M98A 2Z1DA 2IVFA 1LGYA 3SZMA 1ZESA 2QLMA 3FJ1A 4IQFA 2ZI5A 2GJKA 1E6LA 221PA 2CNLA 4UPEA 1S2NA 8LDHA 1XDUA 1G5PA 5DBGA 5JXGA 3E8FA 1B8UA 3B1WA 3RKUA 1CZHA 3W2HA 3PDUA 3ZBHA 4Q15A 4L51A 4O1IA 2YNMA 4L8LA 3TUJC 1Y4UA 4N41A 4B2YA 2BFMA 4D80A 3GRVA 1FTYA 4OBWA 4HLQB 3BKWA 4MVJI 4UU8A 2BMFA 3ZY5A 3KLNA 5EMKA 5SV2A 1JDJA 1GUYA 2EJCA 4UZEA 1K5GA 4ALLA 4MW9A 4AZ0B 1YOBA 3AG7A 3ERNA 2W22A 1RRKA 2V7UA 3AJAA 5MGBA 4CG1A 1UMCB 3RVMA 4M0LA 1G6OA 2QN9A 2OXRA 1X80B 4P3NA 4XB2A 3FSGA 4KPGA 1VE1A 2C7VA 2VK2A 3G23A 3GARA 3C14C 2JFBA 5BQXA 4DABA 3SJZA 3ASOB 4EA6A 2GAFA 5JRZA 2V7PA 4MVJP 1ZU5A 4NZYA 2Q6KA 3W2FA 3T3EA 3A2NA 1FZTA 3TLBA 4K9MA 2EGUA 5ITZB 3OEEA 3ZX5A 1NX9A 5C32A 3O95A 1KU9A 2DLDA 3WIBA 4MVSA 3LQFA 3KOUA 5FHQA 3HJRA 2IHBA 1YJQA 2NWQA 4BMZA 3AIOA 4URUR 1XNRO 1BFKA 4PGAA 4F6EA 5DI3B 5DASA 2IZ0A 1R6AA 2V1XA 4BB6A 4LXTA 4C88A 3GTZA 3M0EA 3U48A 4BCBA 5FWAA 3CLHA 4JA2A 1I1HA 5J3JA 4BQFA 1PK9A 1JKFA 4BNHA 2QLFA 3AG1B 2QVZX 4YMWA 1PU2A 4D9KA 5K1XA 3A04A 3GNTA 2C5GA 1G20E 3ET5A 4RZXA 2QD4A 1HWYA 2YJZA 4LW8A 4Q1AA 4K0KO 1SA0B 3GG2A 5JJNB 1H1LB 1OFTA 1W52X 2VR1A 2NZUG 2P2SA 4I81A 2OV3A 2R11A 3GEEA 1CJTC 1RJFA 3L7OA 3GRYA 2AZ2A 1XREA 3QEMA 1UDBA 3LYLA 2H3EA 4U5XA 3CLKA 2Z6UA 4F4IA 1KO7A 3I5DA 2HF8A 5DYNA 3VR5H 1FJXA 1U0BB 3FMFA 1V45E 3PXBA 2QLLA 1ZBDA 1NU1H 1JECA 4RLSA 3LDFA 4IDGA 5J9FA 4HLCA 1NRWA 1YVEI 3EVCA 1U5BB 4LUCA 1LVGA 4CMIB 3DJFA 4A8TA 1OLSA 1Y3CE 1YMQA 4ZT3A 1E2QA 1JYEA 1JJIA 2CF5A 1BEEA 3QYFA 2RH5A 1SJ9A 4I9NA 1G8SA 1ZWLA 5EXPA 3DDHA 3IOEA 3U5TA 2QD2A 4UUAA 2C4MA 4PLFA 4CEIA 4IXNA 2QAGB 1N34B 5C5EA 2W90A 1J90A 4MZDA 5DWVA 3GPLA 1DKLA 1K7DA 3O1JC 1V5EA 1VP3A 3FLMA 1QQ5A 5KINB 3RK0A 5E7QA 4DUZB 4DA0A 3MS2A 4M1OA 1XR3A 3VOBA 2CHUA 2ORWA 4XEHA 5JC8A 1VE3A 2JI9A 4QICA 1LF5A 4ZDIA 3WQSB 1BC5A 4ZOQI 2FDRA 4C0JA 4UOQA 1LCIA 2Q2QA 4KREA 2EKDA 1JUDA 1ZUIA 1YU9A 4I55F 3W5UA 2D6FA 5FJJA 4DLTA 4F2WA 3CC4F 1H9BA 1V7PC 1U0RA 1CF9A 3F3KA 3ORRA 1WMSA 2Z5LA 3KZKA 4QYS