5JCOC

Structure and dynamics of single-isoform recombinant neuronal human tubulin
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
426
structure length
426
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin beta-3 chain
publication title Structure and Dynamics of Single-isoform Recombinant Neuronal Human Tubulin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 142
structure length 426
sequence length 426
chains with identical sequence D, I, J, K, L
ec nomenclature
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
C PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jcoC03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5jcoC02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5jcoC01
3JARA 5IJ0A 4B46A 5CA0B 5IYZA 5ITZA 3RYIA 1W5EA 4B45A 5JCOC 1W5FA 5LA6A 2BTOA 3RYCA 4O2BA 3JAKA 5EZYB 5IJ9A 4I4TB 4EB6B 4DXDA 3RYHA 5LP6B 4O4IB 4WBNA 5IJ0B 4E6EA 4O4LA 5M7EA 5IYZB 5ITZB 3RYIB 5BMVA 5LA6B 3RYCB 1W59A 4O2BB 3JAKB 5IJ9B 3JAWA 4YJ2A 4WBNB 4O4JA 3WGLA 4O4LB 4I50A 3WGKA 5BMVB 4M8IA 3JAWB 4YJ2B 1TVKA 4U3JA 4X1KA 4O4JB 2XKAA 3M8KA 3UT5A 1TUBA 1W581 4I50B 2R6R1 4EI9A 5JQGA 3VO9A 3WGNA 3WGMA 5C8YA 4F6RA 5MN5A 5LP6C 2Q1XA 1TVKB 4TV8A 4U3JB 4X1KB 5JH7A 3WGJA 5MN4A 4LNUB 3UT5B 1TUBB 4O4HA 5J2TA 1FFXA 1SA0A 5JQGB 2BTQA 5C8YB 3C8LA 1RQ7A 4F6RB 4X20A 3E22A 5EIBD 4TV8B 5JH7B 3ZIDA 3JALA 4O4HB 4DRXA 5J2TB 1FFXB 1SA0B 2VXYA 3ZBQA 2BTQB 5FNVA 4O2AA 4X20B 3E22B 3VO8A 5LYJA 2VAMA 1JFFA 3HKBA 4LNUA 3JALB 1W5AA 4X1YA 4DRXB 3CB2A 2R751 5FNVB 5LOVA 3V3TA 4O2AB 5J2UA 5LYJB 1JFFB 3HKBB 4ZHQA 1RQ2A 4ZI7A 4X1YB 5KMGA 3VPAA 3JASA 3VOBA 3ZBPA 1FSZA 1RLUA 5LOVB 1Z5WA 2GVIA 2RHJA 4TUYA 4YJ3A 3HKCB 5CA1A 5KX5A 5J2UB 3RYFA 3R4VA 3N2KB 4IIJA 4ZHQB 3N2GA 4ZI7B 4XCQA 3RB8A 5KMGB 4IHJA 3JASB 4ZOLA 5LXTA 3HKDA 4EI8A 3JATA 4HNAA 4TUYB 4YJ3B 5EYPA 5KX5B 4X1IA 5CA1B 5MN6A 1Z5VA 4I55B 2VAWA 4KWEA 3RYFB 2RHHA 4U39A 5EIBC 3N2GB 4IIJB 4IHJB 3JARB 4TV9A 4ZOLB 5LXTB 5CB4A 3HKDB 3VOAA 3JATB 4HNAB 5EYPB 5GONA 5JVDA 3HKEA 3HKCA 4FFBA 4X1IB 1W5BA 2RHLA 2XKBA 3N2KA 1OFUA 3RYHB 4TV9B 2VAPA 5CB4B 5CA0A 4EI7A 5GONB 5JVDB 3HKEB 4FFBB 3M89A 5JCOA 4I55A 2Q1YA 2RHOA 5EZYA 4I4TA 4EB6A 5LP6A 4O4IA
chains in the Genus database with same CATH superfamily
2PV0A 4P5PA 3T7CA 5F7XA 2WE7A 2ZGVA 3EZXA 4DSNA 4HZUA 4EZEA 4RESA 1DJLA 5EJ2A 3MGAA 1EUQA 4C08A 2GTSA 5A9RA 2DYSB 3HYRA 2JH9A 4MHSA 2OO3A 1U0JA 3INTA 3CINA 5BPFA 2Z1DA 5E3JA 1HE1C 1RXUA 5JQGB 2JAWA 3U3ZA 4IV8A 3CW2A 1KEWA 1I36A 5BVGB 1DBVO 1RXSA 5EJGA 2A6PA 2O8EA 3VKGA 5CP8A 1TO6A 4C0JA 2AC7A 3NR2A 2X0KA 1XJ5A 4W5NA 4IJMA 1BA2A 2ZYIA 3O9VA 4BDTA 3BA9A 5LQDA 1HDCA 4KPEC 3D5EA 2JHCA 3X1JA 2HWWA 3T0FA 1I2MA 1OREA 4FWIB 3RRZA 4EQZA 3EUWA 4F6EA 1P4AA 1MO5A 4RSHA 3LO8A 1T0AA 1ZD4A 2I7DA 4C4TA 3B1VA 3QG1A 1S4QA 4B46A 4EQ6A 1ZU5A 3NHBA 3KKEA 1XZMA 4KE9A 4K9MA 4ZC8A 3CZMA 1YJ9F 1ZM4A 1NJ5A 3BT7A 4H7PA 4COKA 1E5TA 2CJWB 4UCSA 1H2BA 1H2WA 2JEUA 5EA2A 3F96A 3AOGA 1ORHA 1IFXA 3KKQA 4JZYA 3DLBA 4KN5A 3RAPR 3IP6A 5G4UC 3MXOA 3CEIA 2Z2ZA 3UG7A 3SEAA 1RFGE 2UZIR 1EH5A 2O19A 1IZZA 2J5KA 3VYTB 2CBGA 3WS7A 5CLHA 4B48A 2O52A 2OA0A 4Q9AA 2ZU0C 4K8OA 3ZWBA 1YS7A 1VA5A 1BXRB 2JGDB 1AF4A 3PUJA 1M8JA 2P7HA 3V00A 3UTCA 2IS1A 4G0QA 3BC1A 1UJCA 1UL1X 5DEIA 2VFAA 3BJZA 3WHPA 4AF6A 3AZPA 4UCUA 5IYDO 1L7DA 3C3PA 1FNBA 5K0BA 4YMIA 5B37A 1XXHE 3EDRA 4ALKA 2A59A 2B0CA 1CY0A 2GVZC 3W5JA 4K2AA 4II7A 1X7GA 4HOYA 3SLRA 4GOKA 3MWGA 4L9SA 4DBLC 1ZU4A 3BQMB 3NZEA 2AJ8A 3OHMA 1SG9A 1N8SA 4OLBA 1ULHA 4G0YA 1QRAA 2BUCA 3RWRD 2QIPA 1X39A 4GYCB 4OL9A 3E8MA 4BNDA 2QI9F 2AK3A 4KO4S 1FSSA 3KB1A 4E5PA 2EFDB 2YICA 3L0BA 5EMJA 1PK7A 4EB3A 1TUEB 1PG0A 4NZPA 2MR5A 1HNWB 2UDPA 4CLXA 3OR6C 5KX5A 3ICOA 4HT3B 2J33A 1K4CC 1X7YB 3Q87B 2CH7A 4KBYA 3G67A 1QZXA 2XD4A 5GAPK 3VOAA 3D7NA 1SWVA 1YJ9V 2H5IA 2YIAA 5FPRA 4GSKA 2ZR3A 1X3LA 4DCVA 4US2R 1QOQB 1I33A 3A06A 4Q9HA 2WZCA 4FZ0A 2VP4A 3ZP7A 4J4BA 3ZY5A 1SXJA 2QZ4A 4PLFA 2BR5A 1EIZA 1QZUA 2QRQA 2K7ZA 5IAOA 2CZGA 4M9RA 3VQVA 1MA3A 4NJOA 2YJ6A 4CG0A 3U6KA 1DF4A 1HFWA 5HJEA 3EGDA 3EXFA 3H5VA 2EXXA 4JR0A 1C2TA 4CKWB 2PD3A 1Q8RA 2Q21A 1BTOA 1SETA 4BX3A 1JEYB 3PF9A 1NRIA 4ETIA 5HIKA 5JWHA 2JW5A 2QW0X 4CDGA 3MPUA 2R8YA 3TL2A 4S1WA 3ETGA 5CM9C 5EP1A 1OV4A 5FOTA 5DYYA 2QNRA 3D59A 2PUHA 1R4AA 4R7ZA 1K8ZB 3PNLA 2HPHA 1XDZA 3RS0A 5B7NA 1CZKA 4F6LA 2G4LA 3WQQA 2Z6AA 3IOYA 4OFZA 1H47A 2PEZA 5BWLA 1G5RA 1MT3A 2AOTA 5JI3E 2GBGA 4UDNA 5J5AA 4OP1A 3RFFA 2YW9A 3DE7X 4G1VA 3NYRA 1GO1A 3FPBA 2GM9A 5L7WA 4CH3A 3CQ9A 1XROA 2QBYB 4UPDA 1QU2A 1KMHB 1HYGA 4LSGA 1GX1A 4LPSA 4RPHA 4JODA 2RCVA 4QQNA 3VYRB 4J7XA 3L6UA 5EJMA 3H5OA 4ZMRA 2AEJA 1WJZA 5L3GA 5KC8A 3OZFA 3IKLA 1F2UA 2BGTA 5DKFA 3CU5A 2DT8A 1R12A 3RAEC 2AXTZ 3LI2A 4R2IA 4QDXA 2V7QA 3MTJA 5LD2B 4OX9B 3OZGA 4GL2A 2VUHB 2JIQA 3EH2A 3HWWA 2B25A 2NX2A 4KPUA 2VT6A 2NLJC 1D09A 4M0LA 4MW6A 3OMLA 3I9FA 5A04A 1G0OA 4MUJA 1FS0G 4GBJA 5BYJA 4NICA 3F0GA 2COKA 1KQOA 1JDZA 2E7ZA 2CGOA 1F48A 1NJ8A 1WRBA 4C6RA 4OQLA 5FI5A 1P0IA 1EHYA 4ZVUA 2QQEA 3GFQA 4H7FA 3CMMA 1HG0A 2OESA 2GPAA 2XADA 4KQMA 5ALUA 4XDGA 3TG8A 3E48A 1F1BA 2JVDA 4QTUB 5L8VA 1F0YA 1N0VC 4CL8A 4GLBA 1J2EA 4RD4A 1FP7A 4F1JA 3B09A 1EU1A 1P1HA 2ZG6A 5EHXA 3CLHA 3B3FA 2BTQB 3G2QA 2GPBA 1ZEMA 3ASOC 2HJRA 2LV8A 5GJBA 4Q1AA 2VJOA 3WJPA 3JCMM 3DFKA 2GKGA 4DBZA 1V9LA 4K9RA 3RHZA 2D5AA 2RH8A 1FRZA 3JQPA 2J0UA 2XWPA 1JJ2U 1CK4A 2VI5A 4ZDKA 1HR0O 3R8CA 3W9UA 3K6JA 4YXWA 1E62A 5TPZD 2QAGB 1ZOIA 2HYIC 1DQYA 4KIGA 1OIXA 5FBVB 2QV7A 4KR0A 5HILA 2BR4A 4AZWA 5EE1A 1UEJA 1QUFA 1VZ2A 1NG9A 3UA4A 3PNMA 1V8BA 4J0IA 3MD9A 5IC6A 4LBEC 4MAMA 4D9BA 1GQOA 4JLNA 5DCUA 3QITA 4DY6A 2TMGA 4QUJA 3MTAA 2B21A 1I4OA 1G1XB 2DERA 4HLUC 3DQPA 4FD2A 4G4JA 4IPTA 3AI1A 5CA3A 2YZGA 2XAQA 3IQIX 1T5SA 2WSLA 1RPRA 3TZEA 3VO1A 1E3WA 4HLDA 5FBQB 3TRHA 5YASA 3JZIA 1BXGA 3WLFA 3A0RB 2PKYX 4ZOLB 5BWOA 1AHNA 2NV0A 3FG9A 4E30A 2JHGA 5JJNB 3RIGA 3KR2A 1V5EA 3DUFB 1NW5A 1AMOA 3QX3A 2W7TA 1X13A 1WXHA 2V58A 2PQMA 5EOVA 3ZTYA 2O23A 5HFLA 1YCHA 5BMVF 4OP2A 3NOVA 2PGAA 2P2ZA 1WUIS 4QXQA 5BN4A 2Q7XA 1Z13A 2IW3A 3F9CA 3IPLA 4HDRA 2BC9A 2HI0A 5CCEA 2HWUA 2P2NA 1BYUA 1BSVA 2PAFA 3SZOA 3NAMA 4H27A 4WDRA 2QX4A 4NV1A 1WB4A 3BD7A 1ZUQA 1JAHA 5HRUA 4P3PA 4J7UA 4DUGD 3RYTC 2K9PA 4RD2A 3GEEA 1HURA 4ZD6A 1CR4A 1FPOA 3KUUA 4GUAA 1JDSA 2KW5A 4G36A 1I32A 3CLUC 4K7JA 5REQA 1NE2A 3GDGA 3P0ZA 3VPFA 2VDQB 1YF3A 2Q8QA 1YI8A 5K0FA 3U62A 3PUHA 1E0AA 3K3WA 1C1HA 5IBRA 3HYLA 1LCIA 5BP7A 3D8BA 3ILHA 3OP1A 1SUAA 5THQA 2QENA 1NQUA 1JEDA 3KUDA 2JLSA 2H7YA 3QA3E 4BKPA 4G81A 4MVCA 1YQWA 3A11A 5KTNA 3THOA 4BQFA 3E2EA 5CNKA 2JKVA 5AW4A 1QS0B 3KYDB 5KVVA 3PJEA 1HLPA 3STUA 5KQPA 2EZ4A 4ZYZA 4QDTA 2JNWA 2XGGA 5KIAA 4K35A 2CJYA 3PKZA 2ZWOA 1RM5A 3SOZA 3FGZA 1D8TA 4PLZA 4MS3A 1R37A 2GKOA 4CT5A 1FVHA 3PD0A 5TF0A 4CMEA 1DIGA 1QTNA 1DT3A 3ND7A 3SHQA 5JNTA 3DB1A 3ASUA 1U80A 4K81B 1F2TA 1TFUA 4MCAA 2YCLA 4HEQA 3NOOA 3R0QA 2P2GA 1KEZA 3LY9A 1PF5A 5J2UA 5HTOA 3AKZA 2LGJA 3AG1C 3MFYA 3W6ZA 2VRZA 3H9BA 2GEVA 3DC2A 2J7PA 4DPKA 3K9HA 2HA6A 3ABZA 2Q0AA 2ZR7A 2WMYA 3T4DA 1GQYA 2P6YA 4E1VA 4PX3A 1GA4A 1XZBA 4ZVQA 4W8GA 1UOQA 1AGYA 1R10A 1K4KA 4R54A 1NXVA 2XB9A 4N5LA 1UT8A 4UTVA 3JD0A 2FPRA 4PYOA 2XHEA 5CH8A 1M10A 2F1RA 2P78A 4QIHA 2UYJA 2PWPA 4WBNA 3X43A 3NYIA 2YV4A 2ZVJA 1QU3A 3AFHA 3PPWA 5FR1A 4CTKA 4G63A 4NJMB 1QTRA 4AUEA 2V5VA 4OI4A 1DL5A 3UKJA 3I62A 4HDMA 4K87A 3Q7QA 5JY1A 5ALTA 5IT9N 1OMOA 2ODTX 2AF3C 2ZIAA 4IDCA 1XFDA 4Z86A 3MT7A 1RRPA 1ROPA 2IZ0A 1AKUA 1WUHS 3HCCA 1JIKA 1RE0A 1BCSB 2N74A 3UXMA 1DJQA 2WAYA 1GQRA 3K9AA 4M60A 1ZGAA 3ETNA 4AHCA 2OLJA 1Z37A 5EE9A 3G8YA 3D3WB 3AF2A 1UBGA 1Y48E 5DIZA 5A62A 2GHIA 5JADA 1TTHA 1RWNA 1EWRA 1U0TA 1YULA 2W2LA 5CCBA 2ADMA 1LDEA 2ZZNA 1URPA 3W7SA 1J7HA 5CBGA 3K2XA 3QH4A 4MKXA 3K8OE 4YJ2B 3NETA 4BE9A 4I50B 3LNTA 3DOOA 2IJHA 3P10A 3AF1A 1QORA 2ZI6A 1USUA 4MP3A 3S44A 4GMDA 4YGYA 5CVUA 2OAGA 3GRUA 4B2LA 3QWHA 1LXCA 3NBXX 1ZNWA 3ZXXA 6LDHA 1IUPA 2Y4NA 5A1TA 5MFPA 2ZJFA 1FQJA 1OXMA 3SU8A 3FYUC 4B08A 1TF7A 2ZT6A 2Y4UA 1HDZA 3PYLA 1DBSA 2YHBA 4H7DA 1MX1A 3A3OA 1Q3TA 1QC5B 2R7LA 5GONA 5LQMA 3OUSA 1ADGA 1CYEA 1Y63A 2ZB2A 3SBDA 3OURA 4IYRA 1ZPDA 3SQMA 5IJ0A 5KVCA 4J1QA 3D8UA 3A58B 4HNUA 4YP7A 5KYYA 1K8XB 4WKNA 4G9BA 5BRJA 2QL9A 4N8EA 2YFYA 1TYBE 2AR9A 2EZ9A 3PX7A 1IN6A 4LF6O 1NNLA 1QKIA 5DW3A 1V9PA 3GQBB 1YZTA 3IELA 1WKVA 3FD6A 4C0HA 1KYXA 1SNYA 1H5QA 3RK0A 1PT7A 2GD1O 4EGAA 2C78A 2QX7A 2Y9PB 3NK6A 2I4TA 2FEMA 3DZGA 1NASA 3OQ6A 2MSLA 4DR4B 4BJ6A 1FYDA 1KPHA 4JYAO 5F7OA 1ZCBA 3SPHA 3C7TA 1EGAA 3BGIA 3Q8WA 4QJFB 4NL4H 4CEHA 2BFBA 4W1SA 4DV3O 2XYPA 3H4MA 3SGIA 1BJKA 4Q1FA 4TYQA 5AVOA 1JDUA 2P5UA 3I1FA 2BP7B 1JU3A 2IPOA 1UQUA 2XH8A 2ZRIA 4KO2S 4FKBA 2IZOA 3K0KA 1EUYA 1KOGA 1XDUA 2FWRA 4KIJA 1D2NA 3F3MA 4EFBA 4MWZA 1V48A 3J80M 1Q0QA 3L43A 2NU8A 1SBZA 1ZOLA 3WISA 3DE1X 4ZYUA 3ASOB 5LJLA 1TRHA 5ECWA 3RV3A 2QQ0A 2JFPA 3CRVA 3I09A 4PSDA 1E5DA 4MKRA 2H54A 1AGNA 3L71H 4IJ6A 5BQXA 3NP9A 1U65A 3ICPA 4UHCA 4EDHA 4E51A 2AX3A 2W58A 3WLQA 1M1YB 1E2EA 1MMFB 4YAGA 2CLEB 4ASUG 4R8CA 2CUZA 2CW5A 4WXEA 2XLCA 3F3YA 3TD9A 2I6SA 1WP7A 2CXUA 1L7QA 3VUFA 5JC8A 3DWFA 4CI0B 2R8PA 4EY5A 5CYOA 2V1XA 3BRQA 3F6PA 1QFXA 3MILA 5ADUS 3CUVA 2IYZA 3AJEA 3M3HA 3GDFA 3NTRA 4NDNE 4IDDA 5FWXA 5HXZA 3OZAA 4MQEB 4MO9A 3RS4A 1BDJA 1DQPA 1A5AB 1GPAA 2YKGA 3K3PA 1EP2B 2IYQA 1SZJG 2C4WA 4RETA 3E3LA 3CVOA 2YWEA 3D5TA 1H2FA 2PAAA 4Q4AA 3DTYA 4MIKA 2FEKA 3FW1A 2JDID 2A0KA 5LYJB 1RHQA 4J3FA 2GDJA 1K4MA 4KLRA 5L3FA 4YJGA 3IJ4A 1V6CA 2WD7A 3CPQA 2DQKA 1TK2A 1Q2XA 2PJUA 1JHVA 1J1UA 2WIDA 3SX4A 2HV8A 3VX4A 4R0MA 4D5GA 3PNOA 4KIFA 5AK5A 3VVMA 3KR1A 2RHOA 3CONA 1AC5A 2ZYGA 3PUWA 1F4NA 4UTXA 4DJTA 3WRXA 5ULLA 3PLAE 1EUCB 1PYOA 2P6OA 1RM3A 3UJHA 3A9SA 3ME5A 2VNHA 3AHHA 4EX6A 2V59A 3R0IA 2A5FA 3C3CA 1EBUA 2HG5C 2AMFA 2FN4A 4TVSA 1PWYE 3D1JA 3FYDA 5HMLA 1Y8AA 1D5NA 1XMXA 3OW2F 2Y0IA 4DB2A 3QTTA 3DAGA 4NEHB 4RIHA 1S5LZ 4O4HB 3GFVA 5HY1A 2UYOA 3PDIA 5AKIA 4FZJA 2RIRA 4FX2A 5ENZA 2IJGX 3SF8A 5CB6A 4WK4B 2BF4A 5I9NA 1T5EA 1M33A 3IDSA 2GUZA 1CF2O 3UGJA 1GJRA 2XMSA 2COUA 4FEYA 4HGQA 1S0VA 3I6YA 3CE2A 4LHYA 1N2CB 3PFKA 2OC4A 4GE3A 2ZANA 1LJLA 3NDPA 4DGSA 5HBGA 1HSOA 4TSKA 1V2GA 2BEVB 3K6RA 3WLTA 1IG3A 4TZKA 1JEQB 3TNLA 4M0KA 1I24A 3C3MA 5FL7D 4CL3A 4K28A 1X2EA 4OFWA 1EUDB 3GD7A 4KJZA 1EESA 2JANA 2ZRLA 2PY5A 4Q18A 2WI8A 3I61A 1KEVA 2VJLA 5HKLA 4B7UA 2VYCA 3R9XB 5A4KA 3B1KA 3LUBA 1RXIA 3BFPA 3OZRA 1QHGA 1YTFB 1JKXA 1RQGA 2QYHA 1H0SA 1B6GA 1ECJA 4MYDA 3H1BA 4G4ZA 1PDWA 3WLSA 1G5FA 3ZIUA 4KVFA 5KVAA 2WT8A 3EDOA 3X1MA 1HEYA 3L92A 5F52A 2DMRA 4S3MA 1SFRA 1BE6A 1DAGA 4KX5A 3I0MA 4KE6A 4DNXA 3TCUA 5EKUA 3SQLA 2AOXA 1B8NA 1O6FA 3OA2A 3RJ9A 1A32A 4G0OA 4RNCA 1KMIZ 4XH9B 3CNLA 4ENWA 1P1CA 1YQGA 2R7KA 1KAGA 1R16A 2VP2A 2NN3C 3U80A 2WJJA 5TVKA 2H4XA 3WB9A 3CVXA 2ATVA 3ENNA 3G8AA 3BL8A 2A0FA 3VYVA 2Q7EA 2W83A 3W90A 4AQDA 2AFVA 2EIJC 4J6FA 3M1YA 3VO2A 3IPCA 3V7EA 1XZ8A 2HCFA 2ZB3A 1GZ7A 5CPBA 5FPQA 2XJ9A 5JCZA 2PN1A 1EGMB 1NNSA 1ZXBA 4F4CA 4G24A 5TQ2A 5JFTA 2VPQA 4G07A 4P84A 3C7KA 2GRAA 5BUSA 3FYCA 1QSGA 3L74H 3BCSA 2BE9A 3M9WA 3NTVA 3UV3A 4RTNA 4CBVA 3AF0A 3D6JA 3GGOA 1P80A 3RUHA 2X40A 4MYHA 5LXTB 1N7GA 4Q1VA 2EIKC 1T0KB 5DWDA 1QAHA 5G3YA 2ON6A 1H4QA 2CHGA 1K97A 1KFKB 1YL7A 1W5EA 4UREA 3U1VA 3DEKA 5LQJA 4MR8B 3IHTA 3N8HA 2BOBC 4DEXA 4FK5C 1W52X 1LK5A 4XB1A 5B1SA 5CG1A 2C1EA 1E1RG 5A6SA 1GTVA 5I7OA 2JGEA 5HW0A 1Z6PA 4GKVA 5FTMA 4F2GA 3ORRA 3BPZA 1D04A 1TPZA 3DJYA 2B1RA 3HXOA 3FYUB 3K9BA 3AINA 1YK1A 4RKWA 4HYYA 3EISA 2BUBA 2VUSA 3BABA 4LN1A 1U2RA 3F46A 5GIPE 1TEZA 1HYEA 3CLSD 2FMUA 3GBSA 3ABOB 1LS1A 4XGRA 3C14C 3RB8A 2DPYA 1U2PA 3MWEA 3OE5A 2NUPA 3DOHA 2WA4A 2EJUA 4L74A 5C3MA 4TT8A 3L72H 3WLAA 2UUAB 3TAHA 2PKEA 1M1ZA 4NU8X 1Z9BA 4Z4CA 1Y0BA 3LWOC 1Z62A 4O4IB 3TLXA 1KP9A 3VJKA 4ZOBA 3PQ2A 2AX4A 1NVPB 3FX7A 5HY2A 3EGOA 3WL7A 3WE7A 4C6TA 1CNFA 4IDOA 1W88A 2D3TA 3ZQJA 2FL4A 4WFJA 4FNMA 3I04A 2FRDC 5FWAA 5CW1A 2Q4PA 1C1YA 1EG2A 3SIXA 3EORA 1Q0UA 2B6NA 5SZIA 3QMVA 4ZKIA 3F3SA 4EO9A 1H0KA 1TYCA 4LV5B 2DQ3A 2WWFA 3ONVA 3EHEA 3E9MA 5LMUB 4PWYA 3Q4GA 2OK8A 2IYSA 3VR5H 1XRGA 4DR5B 2D1FA 1XNRB 3P2OA 1VB5A 4FCVA 1HL7A 4B3MB 1Z6YA 1K3FA 2RONA 5F2OA 1ZW1A 4MQ4A 1YQ9A 2Q73A 3CYFA 5EP3A 2AEMA 1SHUX 1TGYA 1L4LA 3RS2A 1FFGA 5FLXM 2VNIA 4M9QA 3LBHA 2I2XB 4UTZA 4ZJYA 4V0KA 5B4UA 1VI6A 2FY8A 4RFSB 5JO0A 4NCAA 2KG7B 4I9HA 3RRNA 4JI6B 3WFVA 3KKMA 5FUYA 4H9GA 3WYDA 3FZYA 3T7EA 1X1BA 4ECEA 4QOSA 2I7TA 3INYA 2XA1A 3PE6A 3AKYA 1SVIA 4MVJA 3NFRA 4U7PB 3P0EA 3E1YA 1H6BA 4DV6O 2YWFA 1Z2EA 2NSDA 2FOLA 4TOIA 1GTZA 3LQRA 5DT9A 4YXFA 5B7QA 2RFLA 5CDHA 3WLKX 2RGGA 1CFJA 2GBCA 2AMJA 5DXAA 3RROA 5IVPA 3V1LA 3DF7A 3HNPA 5ENVA 1NY5A 4IHKA 1R0RE 1L1QA 5C7IO 1CVLA 2WLIB 1S72F 1NVXQ 1IU9A 2QAJA 1SJ9A 3LWDA 4RAIA 1TRKA 1MOSA 3HHEA 3R3JA 4JBHA 2QP9X 3U9LA 4YJKA 3FY4A 2L17A 1IBMB 1GR1A 5SICE 4KLNA 3V33A 4EUHA 2CLLB 2IUYA 3CX5F 4HC4A 3R7FA 1IZ3A 5IT9A 1PJQA 3QPVA 1UMDA 2PTGA 4YAIA 3NC4A 1U2DC 1R3IC 3H01A 4F06A 1XNQO 2X5JO 1Q7BA 2YW2A 4R6WA 4A1OA 4MI6A 1IZ0A 2PJDA 2F90A 2WUFA 3K0CA 3ERNA 1ORTA 1JSRA 1RLOA 3OFND 4MXDA 4TLAA 2BH2A 2YYAA 4A0HA 3N2GB 3AJAA 4YHBA 5EWLB 2IGTA 2PA0A 4GMKA 4R9VA 1JP7A 2FYUH 4FSXA 4RH1A 5ESRA 1Z6QA 4EI7A 4OHKA 3KDAA 2JLZA 1Y42X 2BE7A 1IVNA 1RAAA 1O54A 3RYCA 3AC0A 2GXAA 2OHJA 4B71A 1U7DA 2LRHA 4Q1BA 2P2LA 1GLVA 1Z68A 3Q85A 4IW3B 4WF9V 3HRHA 3IQHX 2DKNA 3W8DA 4M9ZA 3OJLA 2HU5A 4Y2HA 1D6MA 5DK4A 5EHNA 1PZEA 3BK1A 2QM7A 1A9XB 2WUVA 3ONDA 2DPXA 2AFIB 2FR8A 3SR3A 2VKQA 2OBMA 4JBYA 4H6VA 2J0QA 4FM9A 3QUBA 4LDZA 3CRW1 4RL6A 4H0LB 5E7JA 4XCQA 1BC5A 1WVIA 2A14A 3DW1X 3RUEA 2ZJ5A 3VHXB 2HRRA 1S72V 2G76A 3QLVA 3R5KA 2ZTUA 2D0IA 1XDDA 3OGCC 4G4WA 5LB2A 1E77A 3TZQA 3NYWA 2I2DA 1NQXA 4J9ZB 2LO1A 2Q6AA 2XMPA 2D5BA 1RNLA 5DBHX 4ZAVA 3EFOA 4X8AA 1YFKA 4MINA 1E2KA 4FN5A 3GRPA 1XMSA 1XQ9A 2B37A 3AM5A 2NPOA 1GRNA 4DLSA 1OVMA 2IY7A 3NTUA 2QD3A 3KE9A 4RIGA 1US6A 1D6JA 4QUDA 4LQ4A 3ZV7A 1V1MB 2FWJA 1MZVA 4RXMA 5B4VA 2AKEA 2QRVA 3U4MA 2X9VA 5EIFA 2HGSA 4RK4A 4RM3A 1N6KA 1N5RA 1S2NA 1XTBA 1RSOB 2C5HA 2ZI5A 4FWBA 1RVDA 1XMQO 4Q03A 3AB8A 2ZF8A 3QBEA 3FPGA 3CMEF 2G9NA 1ZFNA 1EXDA 4IUDS 2EIJB 3FRJA 3G2JA 3M6XA 2IH2A 4HQNA 4BO2A 1QHEA 1K6JA 3IP1A 2A5JA 1KJWA 3LXMA 2CYBA 3O85A 5G1NA 3BYQA 4GU5A 3W5AA 3SX2A 3NIDB 4TTAA 4LVCA 2GLXA 4Z49A 1RKBA 2A2ZA 4PWTA 3CN9A 1CQIB 1WXWA 3C90A 2H1IA 1Q2UA 3GT0A 5EAZA 4QYXA 3ZCSA 4JI7B 3QELA 3IIEA 1S2GA 1EDOA 3PXGA 2DN9A 4NSNA 4NZZA 2EIKB 4DR2O 4K3VA 1G20B 3UAWA 3HKCB 1QIJA 5IC5A 3QVNA 2NO7A 3MERA 1ZDMA 5G0SA 3ACCA 1O97C 1ODLA 2KKWA 2XAAA 1JAIA 5TE9A 1XFAA 5JYBA 3LUDA 2Y1KA 4QLOA 4HJXA 4AJ1A 3S5UA 2D06A 1A9QA 2PX8A 5HFAA 3GEPA 4BGUA 4ZK2A 3OPVA 1BX3A 4DDMA 3E8BA 4RYDA 4AI8A 2F1OA 4JP3A 3FDFA 1UMKA 3RIEA 4BXOA 5UKDA 1FUIA 1UMCB 5TMPA 1CBUA 4MGHA 4Y2RA 3QW4B 1ZAUA 4EKGA 3ESAA 1LPOA 3FJOA 2QVZX 2R6JA 2WZQA 3MINA 5G1PA 4QOHA 1TT7A 4N47A 3L7AA 2BFCA 1HOXA 3KSRA 5ALFA 3QJYA 3GEBA 1EP9A 3CMEV 2B5UA 3GN1A 4CKYA 1E58A 4MI1A 3LO5A 1RZUA 3FKQA 2VZ8A 3I6BA 1Z26A 5F9HA 5LGTA 5K6AC 4DUPA 1W25A 4AXXA 5KLVH 4AY3A 1DJMA 3WL3A 4UKDA 3OMXA 5CX1B 4PFJA 5L53A 1SRYA 2JBAA 4P31A 1GNQA 1ULTA 5I9BA 1KDRA 1W9MA 3SC2B 3F0EA 4J11A 5HQ3A 4LGCA 1PUIA 5ELXA 3B6EA 2VSQA 4Q21A 2Z5FA 4HYQA 2XEDA 3N8NA 4CIBA 1JPVA 2FVXA 4WXRA 4N3NA 4CS3A 5EUCA 5LBQA 3DMDA 1R9JA 2EIMC 1VLZA 3GG9A 2I8CA 3DXFA 4EKWA 3OLYA 5A2QM 3KEMA 2O8CB 3T8YA 4D7AA 3K16A 2CHVA 4UU1A 3A3NA 4YBRA 4MULA 4DA7A 4B35A 4RF4A 3ND5A 4JFRA 4FDTA 5CPFA 5L51A 3MCZA 2WICA 4C0KA 1PL7A 2O2GA 5DNUA 4HZ3A 4LOLA 4AZ0A 1P9OA 3RM3A 3PD1A 4C5AA 5B1HA 1JAYA 2VP5A 4Q3DA 4E7OA 3TIXB 2WUDA 1FTGA 3W3AH 3SPGA 4GXQA 1MO6A 3H75A 2I2BA 3KAPA 1O95D 1L5ZA 3FLBA 4H17A 5EINA 4C7KA 4ZT7A 2D59A 1HTWA 2HBZA 3L4BA 1AI6A 4EEXA 3LUKA 3PTAA 1AP5A 3U31A 1YI2F 3QPWA 1QHFA 4Y1EA 2AKAB 1GV0A 1NKDA 3L1VA 2DHQA 4JAUA 2NG1A 5JYEA 4DJEC 4O4JB 3FKSA 1QBZA 5K1ZA 1FSGA 4EHHA 4FI3F 1Z34A 4UXJA 4IXTA 3CKKA 1BGYH 4HLNA 5DP1A 1CERA 1QR6A 4DAOA 4JAAA 3FZNA 1ISRA 1I0LA 4JITA 2L19A 5L45A 4D45A 2GZ1A 1LC0A 2XSZA 4NBSA 3AFIA 3TGLA 3ORSA 1FSZA 1K5PA 4TUYA 2UYQA 1CY6A 2NU7B 4D57A 2YIBA 1C8VB 3S1SA 5U4QA 3Q2KA 1OX4B 1JIJA 4HX5A 1MG1A 4LZAA 2XDQB 2BBOA 4O59O 4Z5XA 4MW2A 4P7KA 4UAUA 1A7KA 3MCAA 3DG9A 4DA9A 5AQEA 1EIWA 3BD6A 3NB0A 3R41A 4BMOB 4REQB 4RPIA 5TEVA 2PT7A 1YZ3A 1HH4A 1QB7A 3CPWF 2G04A 5C8XA 3BPSA 5FKJA 4M8IA 1K7FB 5DTJA 3GRFA 4BO6A 4QYWA 1UWVA 5JI2E 3HNRA 2C2ZA 1SQFA 5DB4A 1Y7IA 3STVA 3BRCA 4LHSA 2BSKA 1I51A 4FPPA 1VJDA 1XL4A 5H70A 2P9BA 3P26A 4JYBA 1FP2A 2VHQA 5SZJA 3E4CA 4F4IA 5TVGA 3MRTA 3DKRA 4N8DA 3QV2A 5K8IA 2YFKA 5KREA 5LQKA 2GVIA 1VGQA 1QVWA 2M6YA 3V4ZA 3HDTA 1U5CA 4JYYA 3H2ZA 5TGDA 4GI5A 3V4LA 3KPJA 2A9HA 1XA3A 1YI2V 4I3GA 3AR6A 2M6KA 4FFBB 5BUQA 4GO1A 2B7BA 1KKMA 1N25A 3H04A 3ON5A 4IV0A 3CS3A 5ALWA 4BWFB 2OC9A 4HDKA 5FI1B 3PXEA 3KIZA 1C80A 2JAUA 4EF6A 1YNSA 3BZUA 3J7TA 1NVVR 4GAEA 2YBEA 3ZO8A 3K1ZA 1G21E 1Z6GA 2HZ7A 3EIOA 2NADA 2Q3BA 1RT9A 1GPDG 4DIBA 1KU0A 4DQXA 1CUVA 5FHRA 3CEAA 2FQ1A 1E9BA 3EG9A 5JDIC 4PNZA 4JYMA 3JASA 1CKEA 4KODA 3K5HA 1NI8A 4L8FA 5K3SA 2CFTA 1I1HA 2YNMD 1A1SA 2YQ4A 2IHBA 3S7TA 4PTZA 2EBWA 5JNSA 4P38A 2I8LA 2QQGA 1U2ZA 5IP5A 3AY0A 2XD9A 3GJ7A 4RFLA 2AUMA 2W6QA 5AK6A 3RSCA 5DM70 4MJ3A 1LW6E 5L3CA 2PTMA 4AMUA 3V4SA 3MHHC 2NOAA 2Y67A 5KNBA 1IHUA 1UC4B 4PVCA 2NSHA 1SC1A 2X2OA 3EMBA 1XRMA 1YS6A 4G37A 3WGUA 4DIUA 1FJGB 4F92B 1V71A 4ZEOA 4R05A 3K0SA 3R9WA 2AFRA 3ETDA 4A0RA 2XY4A 1AIPA 5JH7A 2VP9A 3ABIA 4DV2B 3M99B 5C7LO 4GW3A 3DS8A 4H77A 1X59A 2HEPA 5ALZA 3SHVA 1N9GB 3HFGA 4PSVA 1YIDA 1G4HA 3F7OA 3O75A 2WPDD 6YASA 1RQPA 2CC2A 2WJ3A 3NDJA 4TRJA 4U2BA 5KHOC 4CLOB 1SH7A 4UM9D 5IPFA 2NT4A 5G0VA 2DR0A 3T9AA 3I8XA 1GLGA 3NVAA 4K6HA 3DP7A 1RYDA 4C0XA 3RC8A 4BB6A 5JANA 3VHLB 1L9KA 1R6VA 3IQWA 2QN7A 4R40A 1PP4A 2CNWD 4DAEA 3D54A 1Y8RA 4B81A 2XNHA 1GZHB 2GFIA 2HO5A 5IARA 1L8LA 3QM1A 3B51X 5LGNA 1Q7EA 2X76A 3MM4A 5LA6B 4F56A 4O6VA 5BUZA 3I5XA 2BGIA 4CUKA 1M8KA 3IMEA 4QRHA 4UVDA 2PDAA 4LX8A 5DLQC 4YT8A 5CVEA 3U81A 5EWJA 2LTAA 4F5ZA 2R79A 4ZCQA 3UNXA 1QQCA 1UKYA 3LRTA 5M5BA 1X9HA 3VNVA 1UBCA 4WNIA 5JATA 1J2RA 3ONWA 4FEGA 2VF5X 1G8KA 4DSTA 2PRKA 4TWRA 5EMKA 2OVBA 1N2BA 3LCUA 2VTEA 3UXEA 3QXSA 2RHLA 4QM7A 2QEXF 2UYKA 2F3PA 4MPDA 1ECPA 3HBAA 3SY8A 2ISCA 2PH1A 3L1IA 2ZVQX 5B1AB 1OJ7A 4FKZA 4DSAA 1FFBA 3V1YA 1XDSA 2FMKA 2QTMA 1ELOA 1Y81A 4QD3A 2V6MA 1V47A 3FNFA 5BW6B 2PEYA 4UDXX 2P1ZA 4IIYA 1GPH1 4D2IA 3GJSA 2UZ3A 3BMOB 4Y6GB 1Q6HA 3ZW9A 3EBOA 1ODEA 1Y9AA 3OCUA 3ISJA 1UWCA 1JHZA 3OJFA 3H3XA 3Q5DA 1H7MA 5DSZA 4Y2YA 1YE5A 1XZEA 1CRZA 2IH3C 3TLEA 4CN9A 3B38A 2QRPA 5T4FA 5M2QA 3D6AA 3EW9A 3TR6A 1OW3B 1ZCJA 4GR9A 2P65A 4GKJB 1BGVA 2JGJA 2PGXA 2I87A 3L7KA 2QPLA 5A0FA 4N8SA 1XBTA 5CJPA 2BM8A 2GPSA 4CL2A 3QVXA 4RJIA 2YIMA 3QTLA 4DDHA 3NR7A 4G2KA 5FUVA 2XBMA 1W2GA 3HM2A 4HAVA 3V6LA 4JUFA 4GUDA 5FOUA 3IGFA 3WHKA 4IMRA 4ZRMA 3K5WA 1JRLA 1XLUA 1PFGA 4CETA 4KXLA 2EIMB 1MDBA 5ARDA 1HKUA 1LPSA 2B6HA 1M0SA 3MXTA 3KQMA 5H7XA 1UXKA 5JNVA 4NYKA 3WKEA 2WLLA 1ZIPA 5ITWA 1VZ3A 2EULA 5KS2A 2HVKC 1Q81W 3ZNQA 4Q4JA 3UN1A 1TCAA 1G16A 4LH7A 1G2PA 4ZYYA 1N77A 3CR3C 4JJZA 4UDOA 1F17A 1XTQA 1OV9A 4DNFA 5IH3A 4FIPC 4E2FA 4G5FA 1E2JA 1YFJA 4AG5A 3VR5D 4YQYA 3MBIA 5LQCA 1A76A 2QEXV 1SG6A 1C7ZA 3KOMA 4AUNA 3UO2A 5HUQA 5ES4B 3C8MA 5DFAA 3IB6A 4PZUA 3S29A 1JTEA 1DPFA 2QEQA 5JCJD 3KJGA 3LYLA 3M6UA 2ECOA 2OTMA 4M1EA 1IXZA 4E4YA 4ATNA 4LFCB 4MKZA 3K04A 4I4NA 4ZZ1A 4QTZA 3IEWA 2IZ1A 3BXEA 5MFZA 1XF1A 3NS7A 3QW2A 1P73A 1ZMTA 1RCTE 1S3JA 3NIFB 4LTMA 1Y4ZA 4M36A 3GJQA 5B3LA 1J99A 5B6JA 3DTNA 2Q5JA 3SYMA 3IP9A 4OHYA 1YQNA 2FK7A 1XRNA 3ZP4A 2R8OA 3E5HA 1Q1AA 3N7TA 4LUCA 3K30A 3E8HA 2ZIVB 1CJCA 3KWJA 4JBLA 1TM3E 4LYJA 3HKDA 1PT9A 5IVIA 5CFZA 3RA6A 2F3UA 4XD7A 4V1CB 3WFIA 3P5SA 1I7PA 2W6JD 3HSYA 3NDRA 4P8RA 4NXMB 4UHHA 1U3GA 1QMGA 3OJCA 3D0RA 1UKBA 2RI6A 2H9IA 1XMPA 1NQ3A 2H94A 4WCDA 1DQSA 3JZFA 3NM6B 5IJZA 3E9RA 4ZOQI 4BMZA 2O8VA 1QCCA 2RGWA 3UB3A 1W76A 5F3DA 3VC1A 2FQYA 3P1JA 3B82A 3VAAA 1IY9A 1K9MW 5ALSA 5LMNB 2WC1A 4B09A 2F43A 1F5SA 4DLTA 1JQ0A 5BY2A 5L6LB 5CDFE 2HA2A 4WKPA 3K0HA 2X0EA 2A0UA 1R0ZA 3GA5A 4R98A 5CVJA 1YDWA 1VPDA 4D46A 2GPTA 5JWPA 2DJIA 4XWTA 4WW0A 4LYAA 4U7FA 4C4ZA 1NKVA 3NHYA 3UAOA 3EBPA 1PJ8A 3G2NA 2QD5A 4FSDA 4P3KA 3D36C 1PRYA 1VLLA 3KZXA 1QNFA 1RJDA 1CZUA 1CR1A 3K5PA 3O26A 4KPFC 3PC7A 1LUVA 5EZYF 2ZIEA 2HHAA 4P5DA 3JVEA 3BKXA 3ZMTA 4CMGA 2RG7A 421PA 1V9CA 1KMCA 1ZN7A 3JQ8B 2I6TA 2NU9A 2V1DA 2E1RA 1YR3A 1WAZA 2P11A 3GT3A 2MU1A 1K68A 3ZG6A 5CK5A 3U3JA 1H6CA 2BCJQ 5J2TA 3C8DA 4ALMA 1JKIA 1U8AA 1VBMA 3UAXA 2YYSA 1JJ7A 4O8ZA 4UMVA 3OE7A 2DUNA 2EYQA 4INZA 1YGPA 3OWOA 2JEZA 1Q82H 3WWYA 3P0JA 3W6UA 2AFHE 1XP8A 1VP3A 2XW6A 2OLKA 3AR7A 4ME6A 1J2UA 3EA0A 2CGNA 5L3DA 1E2FA 5CMLA 3RDPA 4DLVA 3FYTA 4N0EA 4E7PA 1Q1NA 3QBTA 2YINC 4CC5A 5KEIA 1SN7A 2OMKA 2ZNJA 4WK2B 5DYGA 1TAUA 5KYTA 1E3IA 3VR2A 5CYPA 5I9TA 3TFOA 4BIMA 2XRZA 3RBXA 1W0CA 1I6LA 4JA0A 2OP1A 1M5UA 1TZMA 1HNNA 1HNXO 3EQ7A 4EKEA 1PJSA 5BY1A 2YMQA 3BB4A 2IVZA 1A9TA 1TCUA 1UFIA 3F6CA 4CH5A 2IELA 1FAFA 2GHTA 4BNMA 4GOJA 3TRKA 1JWAB 2QRUA 3ZHQA 3GNTA 4E1AA 5G41A 3I5YA 3IUNA 4J29A 4ZQIA 1LPPA 3AY7A 2ZI4A 4F8JA 4L16A 3U16A 3EXEA 2WB2A 2P35A 4RMNA 4AO7A 4BO3A 1YDGA 3DZFA 1E6KA 3NWEA 2GBLA 4PS0A 2NZJA 3G6WA 3QHDA 1IXSB 4TLDA 5GMOA 3I2IA 4WY2A 2XE7A 3W7XA 5I8PA 1N1EA 5FQOA 2I1WA 1MC1A 3B4SA 4ED9A 5DISB 1G19A 1QF7A 1GGMA 4O4LF 5CHEA 4KLAA 3NM4A 1ZA1A 4MSUA 2NUTA 5PGMA 3R7WB 2KE5A 1XVLA 2EU8A 3IEQA 2XVMA 1Z29A 3M4XA 3OOJA 4YUAA 2Z8YM 3DV0A 4QJ4A 1GA6A 4FOSA 2RBKA 1W96A 3I9NA 2FPGA 1WD7A 3RVBA 3QUSA 2G63A 3DAYA 4P54A 5K51A 1EFRD 3P7MA 4GX0A 2JIPA 1O6BA 4IKEA 4BRUA 1T6YA 1OCZC 1OWMA 2NSLA 2XZLA 1P7PA 4UUOA 4XDLA 3FBWA 3AVTA 2XAJA 3PF8A 1SMKA 5A2GA 4R16A 5A02A 4PLHA 1XLTA 4HS4A 4O5OA 1M2KA 2VDOB 5BQFA 3GZTB 2R8ZA 3JWEA 2C8KA 4I8XA 5EIOA 4L9AA 2HU2A 3H2GA 2XDAA 4INAA 4BE7B 1PWXA 2D4HA 4I4TA 2EX3A 3TNJA 4YWHA 3J81k 1CQJA 3V2GA 4BCCA 1SULA 2VDWA 1TOAA 4X3MA 4FNOA 3CF2A 4HLQB 3QIVA 2VZLA 2YFHA 4LTNA 3F7MA 3U49A 1OYOA 2XQGA 3AEUA 2CHSA 5L6MB 5FPOA 3NTLA 2FZ4A 1K66A 4GZLA 3EGEA 1VQLF 5FV4A 3I9KA 2PIAA 2MTBA 5LIPA 3IJRA 1QGUA 2ABWA 3IR6A 4LK2A 2PUFA 2AUTA 5E1AC 1IV4A 4KQHA 1M76A 1JLSA 3SYAA 3THWA 5FADA 1QMPA 3UQZA 4RPKA 4CFZA 1BD4A 2OG2A 1XBLA 4LC0A 4QLAA 5FWNA 3SSMA 4KAFA 1Q1ZA 4MQFB 1ISMA 3MHTA 4YH1A 3EZ2A 1XK7A 4UCWA 4YJ3F 1R0BA 4IZHA 2FHSA 4TLEA 4O2LA 2NV6A 4ZOEA 1FNDA 4P6VF 4I8DA 4IFBA 5TARA 1FSFA 3MPOA 5CB4F 4JPRA 2NP6A 3N2IA 2DOKA 4OCZA 1I3NA 1ZTEA 3UK2A 2YWCA 1MJGA 4ZO6A 4EZIA 1OLUA 3UEOA 1P9WA 3OMWA 1PVVA 4F8EA 4BW9A 1ZWIC 3DBHA 3FMFA 1ACJA 5JBIA 5FO1A 3ZWAA 5IEBA 2VTBB 3G0DA 4HAMA 1KHHA 1MORA 4DR6B 2FG7C 4GSYA 2OCKA 1E5XA 1DRUA 5F9FA 3H42B 4ITRC 1F6WA 1P0PA 5IKPA 2PH7A 3WAKA 3PFHA 1C7FA 2UUCO 1LDNA 4IJVA 2ZE7A 3A1VA 4HLCA 4DQ0A 2GCPA 3FE2A 5CURA 1HV8A 4X97A 4XVQA 3NRJA 4ZI7F 3WZ2A 2VNJA 5C32A 1WA8A 4LFAO 3W3AD 3O4VA 4D92A 3LRXA 1IM8A 1O0CA 4URZR 2Z09A 2ORYA 3S8EA 2NU6A 4D0RA 3WRYA 1H2AS 2R11A 2ZD9A 4KG7A 3TJTA 4MICA 3PR3A 4TTJA 4HWPA 3SVLA 1OTYA 2NW6A 3CUEF 3UMGA 2LIPA 4WOPA 3UFBA 4D9FA 5J4LA 2F8LA 1X7WA 3O92A 1VQLV 2FZVA 1ULZA 1JYFA 1ZGZA 1IL0A 1WPQA 2OO5C 1KJZA 4HD8A 1NLFA 2Z01A 2X7JA 4MI9A 5CYGA 4Z2YA 3SFTA 2BISA 1BW9A 2YXHA 1CP3A 1KORA 3A4MA 4KQGA 5T8KA 1NFRA 3RW0A 4L4UA 1JQAA 4C22A 1OC2A 1GFZA 3DLAA 1NBEA 5CCDA 3S1AB 3RLIA 3OBBA 5DGCA 4X1YA 3B40A 1UDWA 4GBMA 4RQUA 4ALLA 2B2CA 4K88A 4BO8A 2GN9A 1XJ0A 3LDTA 4CKBA 3RC7A 4ZAWA 4A6XA 2BWJA 4FMCF 1JWLA 2QKSA 2ZWVA 2D2XA 5IF9A 2O59A 1RYHA 2OOKA 4E33A 3K31A 4YRLA 2X1MA 1SVSA 4BDSA 2ZRKA 4D96A 3GWKC 4W8HA 1H05A 4H16A 1PG2A 4UBMA 1RZRA 4G0VA 4NAUA 4ACBA 4NWOB 1VHLA 4TKUB 4OHXA 1VQKF 4NTYA 1NJSA 3ZK8A 4RKYA 4G25A 4B6QA 3QI7A 4K2HA 2IRWA 3KQTA 2GV9A 1ESCA 2QD2A 5BO5A 4BPBA 4J7AA 1W2BF 4YCBA 1MV8A 4P58A 4B3HA 1XCPA 3RGGA 4D3DA 1Y8CA 1X7ZB 4LJ9A 5I7HA 1CJKC 4HRAA 5DEOA 4Q7KA 2HOQA 1AOXA 3B6NA 2ZB7A 4IUYA 1L1FA 1XWIA 2YVKA 5A7HA 1S76D 2YV1A 4KXVA 2R00A 1NSYA 5CFRA 3LRPA 1X8JA 1WVMA 3N1UA 1ST3A 1NXOA 4W6QA 1ZYUA 1H2EA 3ORFA 3HPQA 1ZM2A 1ZK4A 3PHJA 4O0MA 2G38A 3TLKA 4AD8A 2FEPA 2IP1A 2EW2A 3EVNA 1M6EX 4Q3LA 1NYLA 2YEVB 4M1MA 3NWOA 1M8PA 1DOAA 2B92A 1ZESA 1G7SA 1B2LA 3JCZA 2AG8A 2I3DA 2HX1A 4UAVA 1N2GA 3AEKB 2ZZKA 4LZJA 1XP5A 3ITKA 1CS4C 1PFVA 4Z1MA 2ZIXA 2CXTA 4F3CA 4W5RA 5HKOA 3FYEB 3M70A 4AJKA 3K6KA 5JS6A 5GAJA 1R3KC 3DQZA 4OJKA 2Y1FA 2R2GA 5ESWA 3CKYA 4YDRA 5AM2A 3WIEA 1XALA 4B4UA 4W9RA 1BL8A 4X3PA 3C16C 3AWIA 4B4WA 3BCHA 1KC8H 2AIZP 1D8AA 1E79D 4YI5A 2V0GA 3L6BA 1HXHA 2VKTA 2DFLA 4MGEA 1NU1H 3ZWPA 3JWHA 4BLQA 2A1IA 1ZH8A 3B2EA 4M87A 3CEMA 1DUVG 4LHZA 3PTZA 1ZUD1 1KD1W 1OAOC 2IU0A 4YMVA 1QJCA 1VQKV 1NW8A 3OT5A 1UFOA 4R6XA 5C7YA 1NBIA 3AERB 4OHRA 1IEXA 3D6VA 1XTRA 1GSAA 2PKWA 3NONA 3CH7A 3M6AA 3KOZA 2QSAA 3OEHG 2O8FA 3LSQA 3A1EA 3H5TA 4WXHA 2EJ7A 1XZLA 1OVGA 3H2YA 2KBFA 2IBMA 3NHFA 5CDSA 1ONBA 2PZFA 5E7QA 2F9ZC 3P97A 3M6WA 3K73O 4RFVA 2FJUA 1NQVA 1US8B 4I5FA 1V8PA 3AV3A 5AKEA 5F98A 1U11A 3URKA 1W55A 1R73A 2R6FA 1USVA 2G0AA 2WZDA 1Q6UA 3A6LA 4RF5A 3GC6A 1O87A 1UJBA 1WB9A 3G2OA 3A6PC 1SAYA 2P62A 1XHXA 3IB3A 2I67A 3UXYA 4CI9A 3CXHF 1ZUIA 1JA1A 4TN5A 3HACA 2HK6A 2P1RA 1NPTO 4D42A 4V0SA 3VSBA 3NHJA 2EIXA 3ZZTA 2G9IA 1ODKA 4CQNA 5JCOC 4EGFA 3NI2A 2QM8A 4MJXA 2C5LA 2ODNA 4IH4A 5K2MA 2OD2A 3QOYA 2FNAA 3OE4A 3IUMA 3OM8A 2C57A 3KJFA 3NVKI 4LF8O 4DSOA 1O89A 1SEVA 1N34O 5DTRA 2BJHA 3PFWO 1D6NA 2CHUA 3W6OA 3I1IA 4Y0AA 4OB6A 1PWHA 3S0HA 2W90A 1OCZB 3UB4A 1KR2A 3VMFA 1K3UB 1Z16A 1DEOA 2PS3A 4JJ4A 4BJ1A 1WU8A 3I0ZA 4I5EA 3K09A 2HV9A 4R8SA 4DBVO 2PRSA 2NO1A 3CZ9A 4YJDA 4ZGGA 3LVFO 4K8RB 2BUAA 4P3OA 3RANA 4C29A 6GPBA 4UEQA 4UCXA 4DJAA 5FA6A 1DC5A 4DLLA 1J8DA 3T3DA 4HZIA 1SWWA 3ROFA 2R5WA 4PC2A 1VJ0A 2VZ0A 4HH0A 1E99A 3UJ6A 4MR9A 4QUAA 4RO0A 3PVZA 2MYNA 5DM6V 1Y7TA 3KBBA 3DBIA 3OQIB 1X3SA 1TKBA 4E14A 5HOEA 3UB2A 5B5SA 4Q7LA 3B70A 4KACA 3H97A 1PSZA 2AW5A 4I1VA 2OVFA 5C4MA 5HJ5A 2ZJOA 2PKRA 1T6BY 5IK2A 2KYRA 4PONA 3WGYA 4JI8O 1NTKH 3HDJA 4QBFA 2AEEA 3O73A 2Q45A 5AXCA 4IFIA 2YRWA 1OYVA 2IYNA 2V03A 3SVZA 4YCNA 3ZZ1A 3CT6A 4LDJA 1U8CB 1QVGF 5E6RA 5AKXA 5KTSA 2VPXA 3ER6A 2EQAA 4WKCA 5CU7A 5DECA 4J80A 5F21A 5A03A 5IUKC 2VO1A 3Q4HA 3GLGB 2R5FA 3EPRA 2RAFA 4Z9FA 5ECDA 3ASVA 2PSFA 1IBKO 1KBHA 1AK1A 4GHWA 3D4PA 1HR0B 4KQ1A 4EDFA 2WWYA 3ZI0A 4RJLA 3SQOA 2WLHA 3KJEA 4Q0MA 1V16A 1M74A 1V7QA 5A5FA 4AJPA 4ON9A 3A9WA 3FOWA 7ADHA 1DDOA 4CCSA 4MQUA 4MR7B 4EJSC 4AIIA 4QU5A 3KTAB 4LJ5A 1ULAA 4X1OA 5DLYA 3GFRA 3HWRA 4CHGA 1FXKB 1YC2A 4JAVC 2R751 2VK2A 1YRQA 4HG2A 4IJUA 1K3TA 1AURA 4NQRA 4U7TB 3ED1A 5ILQA 1DKUA 3WGOA 3TTUA 2GDSA 3O9OA 3KELA 4CKEB 4WZAA 3V7UA 1SBQA 3PNPA 3RU9A 2RGNC 4EP1A 5ITVA 621PA 3WSVA 4F04A 1TIKA 4JL8A 3HKEB 4XUEA 5IANA 1MG5A 4QXRA 2XRFA 1E8NA 2IDMA 4GOMD 4IMPA 2AB0A 9MHTA 3OPYB 1XD9A 3A3PA 2P4UA 2HREA 2E4WA 5AUQA 1Y6GA 1CUUA 3ORHA 5THXA 1YE3A 4GP6A 1VQNF 2HR1A 2HH9A 4LTDA 2ZT5A 1WNSA 3K72B 1RACA 2JFNA 3X2SA 1KYIA 2C9BA 5IFLA 2ACEA 3GVHA 1Q14A 3QTBA 2WVJA 3OBYA 4IQ0A 2PT9A 3IAEA 3QBVA 1PR1A 2A67A 3H65A 5KUTA 4WXYB 3U7JA 4QGAA 4XDKA 2J0SA 2GLZA 4FC7A 4AUMA 3NNDA 3D7LA 2OIGA 3N70A 2IW5A 1V96A 2FUEA 1ZW6A 3FF1A 1ICIA 3FFQA 4LWZA 5HCNA 1G64A 5BW4A 1OLOA 3L7LA 3D6NB 2QE7D 3VCZA 4R1LA 2AE1A 4L85A 2XDWA 4JWTA 2Q1TA 4I1RA 1K4YA 4WE3A 5B1NA 4QEKA 3GMDA 4Q20A 1RJEA 3VR1A 1SQ6A 4Q9IA 5JWOA 2RK6A 2JJ8A 4RD6A 3IYLW 4KUEA 3HUFA 2AMLA 5LC1A 3AKCA 3QYPA 4JEMA 4AKEA 4ZEXA 2QJFA 3WXMB 1T3ZA 4Y6OA 2H1HA 2Q2VA 2I7VA 3BE5A 1MABB 4IEEA 2QXUA 2X4DA 5EXEA 3ZNNA 3FDZB 3MGCA 2CEKA 3ESJA 3BGDA 3TI7A 1ANKA 5AXDA 1X8KA 1H94A 5FL3A 2HMTA 1KI6A 3LMKA 2C8LA 3LKDA 5L3SB 5JSZA 4RDIA 5EY5B 1R3DA 1Y4MA 2V4MA 2RE8A 6REQB 2QMQA 2UZAA 3KVNA 3D8SA 1QO0D 4KFSA 4YV7A 1LNSA 5JLJA 5KQGA 4UM5A 2YXDA 1NYTA 5BNTA 1VQNV 1ZHFA 5L3ZA 4GKAA 1F0KA 1FXHA 3KNZA 5H02A 3FBTA 5ILOA 1JWBB 3LS2A 2VT2A 4CM8A 1J2TA 2ILTA 2B5OA 2VUIB 1C41A 1TVKA 1L5WA 1SY7A 1W4ZA 2F8SA 2C4UA 4K86A 2OCXA 1G1MA 3UYKA 4JGIA 1FFAA 1BS2A 4POOA 3VTZA 4RIIA 2QSYA 3CTMA 4P98A 1XLWA 1R18A 2VYVA 3DMNA 1NUSA 1KHTA 2I29A 2V7BA 4OB8A 3B1WA 3CYPB 4W5QA 4X7PA 1N92A 4X7MA 3NOQA 4HB4A 3E70C 1JOYA 2IZ6A 3I9MA 1WMBA 4GVLA 1SUPA 3WNZA 5KSWB 3DTUB 4LW8A 1GPLA 3B48A 5CA1B 2FQXA 4HN2A 2WINI 2ZJBA 3VGPA 4PZDA 1CY2A 1JE1A 3LLSA 2I6UA 4X93A 3WJAA 5KNDA 1ZIDA 1O5OA 4MRMB 1JG6A 2XXBA 4FLVA 4PA4A 3B8MA 2WUWE 4KZPA 1WMAA 3T3HA 4CQMD 3BXPA 5TS3A 4MQ6A 4YLGA 4D7TA 1CR0A 4LXGA 4LRQA 4IG4A 4S1TA 3R7BA 3RVJA 1U8UA 3G2MA 2A1UB 3AHFA 4GWGA 1XXHB 4XQ9A 3NVMB 4JEUA 5C1OA 5EC1C 3ZX5A 1VBKA 3F6BX 2ZVZA 3U17A 4ZBMA 3FB7C 1ZUNB 2HP0B 3I55F 3LT4A 4OI1A 4NBTA 1I13A 4ZDIA 1CUAA 2V9CA 2ZJAA 1A96A 4V03A 4CE6A 3GUVA 4UZEA 5B1AC 2OZPA 4U9IS 4I36A 1JEEA 3DMHA 1ZHOA 3V9PA 1NXWA 3L0OA 3M3DA 3I37X 3A6GA 4C5CA 4LF6B 3QXXA 3CF0A 2Q3MA 5ICSA 3I1JA 4QO8A 1Q83A 1NNEA 4QSHA 1C0EA 3FPFA 3QPDA 2I1QA 2PSJA 3K4QA 3O8OA 3V46A 3U44B 3CRQA 4J16C 4O2AF 1HEUA 4RVCA 2RMKA 1DT9A 3W7WA 1WW3A 4PC7A 4RKEA 4BNNA 1AHPA 4JYAB 3CMAF 1TUGA 5EZQA 1LDYA 2IUSA 4MS1B 1EFHA 5CLFA 3VPAA 4L28A 2PRYA 3DT9A 3X44A 4DV3B 2FU5C 2GJ9A 2E4UA 5IKEA 4WFFA 1BRMA 2IE8A 3A9CA 3COZA 4Y6RA 5CFNA 1I0ZA 1Z6ZA 2VHXA 5EE0A 3QMMA 4KITB 4FILA 2Q1WA 4M8NE 2JIZG 3DHWC 3DKPA 1JSZA 1FRQA 2GRUA 1XG5A 1Y4DE 1DXQA 1P5ZB 5I4CA 3NT2A 1OCEA 2GCOB 3UH1A 2YC4C 1O94C 3G5TA 4PAMA 1Y1TA 1CUSA 3QWFA 1PJBA 1H6DA 2A9QA 1LPBB 3L6CA 4JYCA 3GF4A 2B36A 4WY5A 3I42A 3C3AA 4IIBA 4LBZA 7GPBA 1XEXA 4P08A 3VU9B 1SXJE 1E96A 4BWAA 1JTVA 2GEFA 3M4NA 3CWBH 1H3NA 3CC8A 1G3MA 3I55V 2VJDA 2VXOA 3RHFA 4WJKB 1HOTA 1DWPA 3E15A 3ILYA 3MBOA 1FJHA 3CRRA 5ANRB 3DO8A 4JIMA 3CX7A 2OB2A 4IIJB 1D03A 4OQFA 1LZLA 2ZXUA 2HRDA 1EVLA 3E1KA 3HJFA 4EJSB 2O8BA 1VRVA 3LP6A 4DXDA 1NOIA 2X6RA 1Q7YH 3Q7PA 1NATA 4LXXA 3UGQA 4MIOA 1RM1C 4XARA 1ZEJA 4MW0A 1KY3A 3K9NA 3E7PA 2F64A 3FHTA 3SM9A 3HL4A 4F12A 3ETLA 1JD1A 3W78A 3DXRA 2EWWA 3ZLJA 4BEVA 2D1TA 1JE0A 1P5HA 3U37A 3CMAV 1T13A 2V74B 1DGSA 4XM0A 2BMVA 5B3SC 3SKXA 2XGSA 1XDCA 3U4HA 1VJGA 1DDIA 4XASA 1UPGA 1BMFA 1DIAA 3BRWA 5FYQA 3NH6A 5GOTA 3U4QB 4C06A 5CTJA 3L8DA 2WF6A 4IYJA 1J7KA 4KH1A 5AVTA 3QVOA 1MB3A 2C9YA 1CUYA 2FX2A 3ZZUA 1VG1A 3QKRA 1LEHA 4UTNA 2ZUWA 3LWBA 3U7RA 4HGNA 2NUAB 1GPWB 3E3NA 1PQUA 4LY6A 5IM5A 1XILA 4UBIA 4AKHA 3AL2A 4LF5O 4D7SA 3QU2A 3CLSC 3EE6A 3NV7A 4BP9A 3C5HA 2QP3A 2FPPB 4IIDA 3ZNOA 3DWEX 5ER6A 2J87A 4GR5A 3FPKA 1UJ6A 1UZLA 1D2MA 1KEEA 4RHCA 3JAWB 2OXEA 3OF5A 2SBTA 3ND9A 5JPDA 3RK1A 1JQEA 4PZYA 2BFNA 3KQKA 3MJRA 3AOEC 1E1QG 3VNQA 7MDHA 2ZQYA 3E5MA 5F2NA 2FMHA 5H2FZ 3JVIA 1N8TA 1DV1A 1E2PA 1DO8A 3KQHA 4RY0A 3I12A 1KQSF 2ZRPA 1VHWA 2HL6A 5DO9A 4KFUA 4R83A 3T94A 5A3SA 4KEAA 2OQ2A 2BEJA 3FCCA 1TLFA 5EERA 5EE5B 3L05A 4JCOA 2H0AA 3TZLA 5TR9A 3PIDA 5DN6G 1UFYA 3OOWA 4MW9A 2QMHA 2DLDA 1JT9A 4WFQA 5TV2A 1BJTA 4IDNA 3CS5A 2IOQA 1M2JA 3AG7A 4H13B 2YMLA 3HEBA 5EWMB 1QNLA 2AD5A 4YAWA 1S1MA 2WABA 1ZH4A 2JEYA 3S40A 1W4RA 3BMQA 5LP6A 2CUNA 2IC5A 4CIDA 5AW5A 1WXXA 5AUNB 2QRLA 2J09A 1T5DX 4Z0PA 1U2GC 2DVMA 4G4VA 4B31A 4QUHA 3C8ZA 5AVUA 1XHLA 3KQVA 3D01A 1L5OA 3BMCA 4ZO8A 4E5YA 2H51A 4HV4A 2OQIA 4EBBA 3MDOA 3LZ6A 1DCMA 3MOIA 4NR1A 3L1KA 4ZU6X 3U13A 4RPLA 2JAPA 5TQJA 1U6KA 2E74B 2AQ8A 3BHMA 1CJBA 3UTDA 1H1DA 4O02B 3MS2A 1WNFA 3RVRA 3JALA 3B13B 3SYQA 3LG2A 3VZDA 2J3DA 4AMBA 2EW1A 1DJOA 5KCZA 3IBCA 1KIAA 1VL5A 5A1JA 1Z2OX 1D07A 3ZDDA 2HMVA 4MJLA 5JC1A 2GR9A 1Q3EA 4J1TA 2ZAYA 2VIIA 5TS2A 4LBVA 3RSGA 3DBLB 2L18A 4AN4A 5DNWA 1Z83A 3FUWA 3C1TA 3ZKAA 3PLAC 1T1JA 3QUWA 4QAJA 1DAMA 3I5DA 4A8JA 1CZLA 5DF1A 3KRTA 4XGQA 4KDCA 3FWNA 5IS2A 5ELLA 4H4EA 4Z1VA 1C0IA 5FUQA 4X94A 4MPRA 3OG9A 4ZIRA 3NC0C 4DANA 3AG2C 1C9DB 2BGMA 1TQ4A 2VHCA 1T4CA 2G06A 3WO0A 1R4NA 1JR2A 5CT5A 3NVIB 4AJJA 1R1DA 2G72A 1HQYE 3ZDCA 1FFXB 1IAVA 2X4IA 3GIDA 4B3RO 3E27A 1S01A 4NBNA 3FMVA 2IODA 5FNVB 1R5OA 2CXQA 5DHAA 3HKBB 1SCUB 3WMFA 4CUJA 1FQWA 1VIMA 3L9DA 4KUGA 2PQ6A 1SHZA 4KTVE 4JBXA 2KPOA 2XOKG 5BMOA 5G1OA 1WDTA 1A8UA 4H18A 1KARA 4MUHA 1JIXA 1PQWA 4HDSB 1UEIA 3K71B 4CMKA 1T1SA 2WTXA 4U0JA 2EFCB 2QOEA 4DNOA 1AZLA 2ASEA 4NZ9A 3LFUA 2WJ4A 3KL4A 1G17A 5D00A 1R6XA 1V25A 2A88A 1GUFA 3I6MA 1VSTA 3BQNB 3I05A 3K9FC 4K1XA 5IYBO 4P4GA 1NAHA 3HB9A 1WXIA 4NATA 3CPSA 2CVPA 5DK6A 13PKA 1CFZA 4YP6A 2ECQA 5I45A 1A82A 2I78A 2DW4A 3IR7A 3ZHUA 1KNKA 2X77A 2CVLA 1K6MA 1P5RA 1D3AA 1QR2A 5DM0A 3GHYA 3L8FA 1A4RA 4PYLA 3OT1A 4F4UA 1K06A 5ALIA 4B4KA 1E6LA 1OU4A 2H4JA 2VSNA 4ZOCA 1EZZA 4MA4A 2W8ZA 1NY6A 3T35A 4I55B 4G97A 4RVFA 3KZMA 3I6QA 4Q9KA 3UMYA 1EFUA 4YRJA 4IIHA 1SURA 1WCYA 5H83A 1OH7A 4KQIA 4V0QA 2IL1A 4Z9XA 1V55C 1ZLZA 2GILA 2PR2A 5C93A 5TRTA 3D3QA 1WXDA 2OD7A 2X8AA 1SXJD 3UK7A 4PHCA 4XIIA 2QB5A 1A2OA 4L6AA 3KVRA 4RL4A 1QE0A 2EOAA 4KPGA 4DV4O 1RXVA 2AUNA 1EYZA 2OYCA 3IPAA 4LI3X 2R6R1 2R7NA 3MLEA 5J1TB 2Q3FA 4BAGA 3B5EA 4C0SA 3KJHA 2EVWX 1OBCA 3QGMA 1E60A 2GPJA 2VDMB 1FL9A 4MJ7A 1Q11A 5B12A 4PZZA 4G85A 4K8XA 3FVTA 1K5HA 5FR2A 2X14A 4L15A 2QUKA 2CNDA 1U2SA 4UXNA 5JTTA 1NONA 5BT8A 4E4TA 1U5AA 1PKEA 2BMFA 3E9NA 2J59A 4NZNA 4BJ3A 1QIHA 2MJLA 1LLCA 4KU4A 1GCAA 4NXNO 1GO2A 2LGQA 3PDJA 4MITA 3FSJX 1PKXA 2C9MA 1OGJA 3GZNB 4FXPA 2GZRA 2X5XA 2Q7HA 2NTNA 2W9XA 5BW8A 2JAHA 2GLUA 3CCRF 5JD5A 4FJ1A 3UAYA 2WU4A 2QMYA 2H2AA 1LI7A 1XCMA 1E92A 3ZHBA 4U2EA 4HEHA 3D8CA 5JYDA 1WIWA 4MVYA 1HP8A 3WIBA 2EFEB 2NO5A 2H1OA 4BO0A 4AS2A 5IABA 1PS9A 3MBKA 5GIPC 2WSYB 2V7QD 2B7LA 3IUPA 4DV6B 1IYZA 1GAEO 5T64A 1MIOA 2N46A 2Z5UA 1M66A 1NT2A 3DNMA 4LHVA 3GARA 1ZOOA 1RM1B 3GLKA 5J59A 5H3LA 3CCUF 5JXGA 2W8BA 3QA9A 3LOQA 2RHWA 1TDJA 1NZDA 4J7JA 1BCRB 4CLEA 2QX8A 2NZ8A 4H0CA 2UYCA 3JAKB 5AKYA 1E1CB 3VI6A 3QVSA 5B3SB 3KAJA 1M83A 1N3BA 4K9NA 5AHXA 1RABA 3F0TA 4IAOA 4W63A 3E2MA 1PNLA 4HQFA 3MZ0A 1IHXA 1JF8A 1KO4A 4P34A 3WJRA 2A7QA 2PZKA 3KSAC 3F0DA 1VLHA 1RRCA 1XNQB 1YB6A 1TKRA 2ERXA 4XDHA 3UKMA 1G6Q1 1V4BA 2YHUA 2JEXA 4A6EA 2GTHA 4PRLA 2JF0A 1AZTA 1SKMA 1A8QA 1SS3A 4MVJH 3HDQA 1GU7A 1DLJA 2ZBRA 2ZI7A 4RKRA 3KPVA 1S8AA 4BX0A 3S99A 1YTUA 3TL3A 2OMEA 5C1BA 2I3ZA 1SDSA 2OZBA 3H5RA 4YXWD 4YCAA 3ZRXA 3CCRV 3D4NA 3BVOA 3H2IA 2Y77A 4Q7QA 3GRAA 3W3ZB 5ICCA 5JSKA 4EX7A 4ZI3A 3EZLA 4P82A 3W4IA 3T4UA 4IGEA 2PX4A 3PEEA 1T2NA 3VU3A 3X2FA 3AZOA 5DNCA 4ZEVA 3LY7A 2HA3A 2X15A 3APOA 3U3RA 1CLUA 2WIBA 1HE4A 1KU9A 3E0QA 4ZU1X 5FTJA 2JG3A 1Y9EA 2BH9A 4KQWA 4PA3A 3TKLA 2OSBA 4LMAA 2IX9A 2AMVA 2XLBA 1MQSA 1QH0A 1GUBA 2JVKA 4HGYA 2VJPA 3I3OA 3K0AB 2VAVA 3C5WP 4TKVA 1XA0A 5F12A 3OVMA 4UNIA 4BT6A 3SPIA 5HPYB 4ZAZA 4ZMSA 3CCUV 3E7DA 2EX1A 6PFKA 2E5LO 1AUXA 1NMUB 2WTEA 1NULA 2WJ6A 2DG2A 3MWDB 4R1SA 2ZR9A 4RCZA 3NAZA 1NRJB 2Z8XA 1UOEA 1J0DA 3HE3A 3L7BA 4FLXA 1YS9A 4H60A 5H3HA 3GLFA 2WP8J 4YY3O 3F73A 1MZFA 3H05A 3AEZA 1KJIA 4BVAA 4NYJR 4B32A 2F93B 3QXHA 1CHNA 2IYAA 2IXAA 10MHA 1DJPA 1O95C 2AOWA 3RADC 1CULC 2VYNA 3V8MA 1CY1A 1Z4IA 4WCFA 3ELWA 4X71A 3AL0C 1ZM7A 4MVJI 5P21A 1FP4B 4FB4A 2WF9A 5IDXA 3H8SA 3HXKA 3TLGA 2H1LA 4BTVA 1CJTC 1L3IA 3B7WA 2XQVA 4KYIB 5D2CA 1MG0A 3IQDB 3AR2A 4ZGBA 3IAHA 1XMQB 5GZ6A 1E7KA 3ENQA 4ZZ0A 3ML1A 1FDUA 4TV9B 2V3WA 4JXXA 1LUAA 4JOCA 3SP1A 1ESDA 1XD2B 3TUZC 1PV0A 5JU6A 2UXCB 4HWOA 4U8GA 3AG2B 5AQ1A 2GI4A 2BY4A 4EHDA 4G9GA 3B52X 2CE4A 1J9EA 3P27A 1WLEA 2OWDA 5U1PA 2H65A 4B4OA 1OHHD 4UE3S 3WLIA 2EKPA 3AUAA 3LSTA 1ZH6A 3TMYA 2DYKA 4IIXA 4NBKA 1ZN8A 3QUQA 3MCQA 3G6EF 2HS4A 3FGNA 3MSXA 1ZX3A 1SA0B 3DUWA 3ZW7A 5K0TA 3AGQA 4MLZA 4DIKA 4CMIA 4NYIR 1SUIA 2GSMB 3WYEA 2HD4A 4ZVSA 5D3MA 2YJ5A 3OESA 4DR2B 2J7PD 1U31A 2QLMA 3KEQA 8ABPA 4L50A 3U2QA 3GUUA 4RDXA 3W8EA 2LBTA 2IPLA 2QD1A 1B3BA 2HS0A 3DD1A 2OBYA 4H0FA 3A25A 4CLRB 4LC9A 1QH8B 5DLDA 1QYCA 4OBBA 4OB7A 4B34A 4FMPA 5IH7A 3WV4A 4IOMA 3OONA 3NHMA 4P3XA 1OIVA 1PWEA 1GARA 2WD9A 4DYVA 3GCDA 3P9QA 4BMPB 4QPJC 4D97A 1MGOA 2HSEA 1CD5A 1Z07A 4DNQA 1SKQA 2HF8A 3HDVA 2VRNA 1YQEA 3V4RA 3HVIA 3F9IA 3HB0A 4Q05A 1MB0A 4XVUA 4HPJB 1E3SA 4EY7A 1SVUA 5BN5A 3V2HA 4BT4A 5JAQA 1MABG 1YZNA 3OI7A 3EGWA 1C3OA 5KNDH 1Z6AA 5LOVA 3ZWOA 1X9GA 3GP3A 3AXSA 5BSKA 3K94A 3U26A 3I83A 3WFZA 1S7GA 2X13A 5IEJA 2F8TA 5EQJB 1V55B 1X9IA 4UU8A 2W00A 4R50A 1NW4A 3UMBA 3DDNA 2REQA 4YRMA 5ER9A 3LPMA 4ZVTA 4IF6A 3O4JA 1L5GB 2RKOA 4LV6A 5IT4A 3LM8A 4J03A 3GAMA 4N7BA 3AKDA 2Z0MA 1QF9A 4KZKA 2W2LD 2YNMC 2QT0A 3T34A 1IXMA 3BZBA 3H1LH 3DYIA 1M90W 3G6EV 4WTOA 1V4NA 2XVYA 2GZLA 3LFHA 3PEWA 5BR7A 4HQ0A 2ODQA 5K8UA 3D5QA 1JKJB 4MOWA 5E2IA 5AWFC 1SOMA 2J46A 2OHIA 2B78A 2FW1A 1YJ5A 3U61B 3ZK9A 1F12A 3V8EA 2B2NA 3FB8C 1I7DA 4HH4A 1CB7A 4M8KA 1NP3A 2OXFA 4B4VA 1GL9B 5BOSB 4JENA 1UKCA 3V5NA 4YECA 1T5TA 4OA5A 1XU4A 3AILA 3BIJA 3EVBA 4DIEA 4HQLA 2WWIA 1MVLA 3D7SA 2HQBA 2VL7A 2H8GA 1LK7A 4JT9A 1I08A 3OJXA 1L1RA 1XOUA 4E08A 4M54A 3IA7A 4RJJA 4YRCA 2CY0A 3BB1A 2PUWA 3Q40A 4GZ5A 3E1GA 4UHEA 2A9FA 1F7UA 4MW8A 5JS7A 3RARA 2PHZA 2G6TA 2P67A 2VATA 2CMFA 3A7EA 3MRSA 4B82A 1L4UA 3AK4A 5IJ9B 2QSZA 3VH2A 3NBUA 4MV5A 5G4KA 3GJRA 2E6UX 1Z39A 1GZUA 2CF5A 4B1FA 1L7OA 4RZSA 4INOA 3AW8A 2YJZA 3KEGA 3G79A 4TSRA 4DFDA 2QR5A 3IBTA 4ND8A 1NSFA 5HZMA 2C2BA 1ZD3A 1FXKC 5LJIA 1AQYA 2F59A 1V41E 4X6UA 1EQAA 4WK6A 1S5HC 4QASA 4CQMB 4UUAA 4PIVA 2CXSA 4AKIA 1E1MA 5JPCA 2JD0A 1IXRC 3OZDA 5BSMA 3RG2A 4Y2PA 4BNHA 1JPJA 3CE9A 5TB5A 5FRDA 5DTQA 3ZMUA 1TD9A 3H4VA 3V4OA 5BN3B 3CN7A 1SESA 5KNCA 3IE0A 2BI4A 5LLDA 3PUVA 5AG2A 1Z2GA 4DO2A 5L4LA 2R8RA 2VDUE 1NBMA 3OCJA 2ZODA 2AKYA 2G70A 3UH0A 3ELBA 2Q4RA 3ID6C 4F7DA 4E46A 1LLUA 4IF4A 3TPZA 5C18A 3JQAA 5CVCA 2WW8A 5E2BA 3N0TA 3V4PB 1IEWA 4MUBA 3GFGA 3QVTA 2FSVA 1JN1A 4XYGA 2R7MA 4PYJA 1JHOA 3RRBA 3I9JA 1CUGA 3GPBA 4K6OA 1SIUA 4QYMA 3CUSA 4E15A 1AQIA 4QM6A 3ZU6A 1UMBB 1E9AA 5LP1A 1X70A 4M7RA 4YPVA 4LJKA 1L3BA 4C2AA 2A94A 5PNTA 3N2KB 2QPAA 4RYLA 1AKQA 1WB5A 2UXBO 3NAGA 3IE1A 2GAJA 2E0IA 2BRUC 1ECGA 5CIQA 2N1BA 3LT5A 3BWXA 4OEHA 2JASA 4CH6A 5KAPA 3OQJA 4MLDA 2CMKA 3SDSA 1AJPA 3PJSK 5C8ZA 2PRJA 5D5PA 4OU5A 2AOUB 5KWEA 4ZYWA 5JQGF 4BU1A 3N59A 3LKVA 4CS2A 3ZCRA 4YO7A 2I6GA 1GOTA 3A1TA 1PSDA 2QSUA 3GUZA 3RU3A 4RHXA 3F97A 3PC3A 3I9V6 4KO8A 2D0PB 5KOJB 2H1SA 4J0CA 1UBTS 2Q68A 1ZGBA 3MJDA 5KQMA 3FAVA 3ZE7A 2FUNB 4J91A 5DYTA 2A06H 4OJTA 1IM5A 2BBWA 4XBFA 3QU7A 2ZROA 3W04A 5IN4A 3KUCA 1NVGA 3H1FA 1M3SA 4MVJE 3VX3A 5K6RA 4OM8A 1SUDA 5LLSA 2PH5A 3CEHA 2HJDA 2QKAA 3UAZA 5K99A 1SXPA 1OE0A 4GLLA 4RKFA 4EUSA 3L06A 1B41A 3MGGA 2AW3A 4BO4A 2QY9A 3LXRA 2GCGA 1OFIA 4BJ5A 4RQOA 1WMEA 3C6QA 5G2OA 4FYJA 4E3ZA 3IAS6 2I9KA 1WABA 2YVLA 3JVHA 3UC5A 3RV4A 4NFLA 4J2OA 4POAA 4CNQA 4WN9B 3WA7A 1N7HA 1DRKA 4KB5A 2I0FA 3KR9A 4ECAA 4YIHA 3JWIA 1ZGHA 4MDHA 2DM6A 4UTOA 1J0BA 3W7AA 3AB3A 1TVCA 1LBHA 1INLA 3JARB 1NI4B 5SV2A 1NJ1A 3U7IA 3I5AA 3MG9A 1YVUA 2VDLB 2ZRNA 4GOLD 1NC3A 3F1KA 2E5FA 1XVUA 1HT2E 2QN1A 5LNK6 4QWMA 1CEYA 3BREA 4CCWA 3B6KA 3K9LA 3I2HA 1DU4A 2W4IA 1YAHA 1E8MA 2PZ8A 5KNBH 1MO2A 2H06A 4MHOA 4RHUA 5F64A 4L0QA 2PPLA 3KJKA 3R0PA 1BE0A 3BE8A 4I5GA 1TTTA 1WPBA 2F1HA 3EC7A 4OHMA 4TT3A 3DE5X 1JR6A 5IJWA 2VJNA 4PQYA 1MQAA 1UJ2A 3CE6A 2PMBA 2CTPA 3FOEC 2C5FA 4PM4A 3RAJA 3RE3A 5M29A 3L6DA 4B76A 3AMVA 3TK1A 4DXAA 2N47A 3SBOA 5FJ4C 1UPTA 2VDRB 4WMLA 1B0PA 2FXVA 4MMYB 4AMZA 2XI4A 4CV3A 1FX0A 1DP4A 1TMYA 1H4VB 1C7EA 3PEVA 2IHZA 4NZOA 4KXFB 4F1KA 1YXBA 4X9XA 3H2HA 4KXWA 2JPDA 2GUWA 1EFVA 4EPXA 2GBOA 4PHHA 1DZ3A 3EGVA 4LMPA 2CHFA 4Z2AA 4Q9DA 1B26A 1T8RA 4HAXA 4FM2A 1TQHA 1JCHA 4O2BB 3IEMA 5SY9A 2A9JA 5AXAA 1IOZA 4BVEA 1CUZA 3BTOA 3LDFA 3TB6A 2HHCA 5CW2A 3KPUA 1EK6A 4EARA 3RIHA 4BP8A 3VTKA 4S1OA 1U5BB 3RSHA 2JCGA 2C99A 4G4XA 1JI3A 1NVTA 4AZ3A 4IIVA 1V5FA 3HTNA 4J7KA 3DZJA 4DXHA 4EA7A 4DCJA 5K4GA 4M86A 3NT5A 2I4OA 1RPOA 3DPIA 1EWVA 3AFNA 4ZZIA 1MB2A 5JO9A 3AETB 4MQ5A 4EFLA 4IQ8A 1WDKA 4MRAA 3LU1A 2WVAA 1SPXA 3BDAA 1AUQA 3TDKA 2VYQA 3MCTA 1UBNA 4LWPA 1NMZA 2VF7A 1UC5B 1Y8QA 2HF2A 4XLZA 5HX7A 2CE2X 1DZIA 2B69A 2GESA 4CW7A 9LDBA 5FPSA 5J4VA 1S9DA 3I9V1 3BA8A 2OORA 3D6TB 1YVWA 1G7RA 3EXAA 2QMZA 1MEOA 1U7HA 2RCYA 2ETVA 4C4XA 2GZDA 3UUEA 3AEQA 3TFQA 1IJKA 2VG8A 4ADSG 2X0FA 5D6OA 4OATA 5BSRA 3VDQA 3VO8A 3PHGA 1YCGA 2EJCA 3Q7IA 3FTPA 3ZHVA 3GA0A 2JDIG 5HG0A 4KXXA 5LLTA 5CNJA 3IT0A 1X38A 2JIMA 3TG2A 5TPWA 1HDXA 1EJ2A 4S0ZA 2V4ZA 4WX2B 4RQEA 5BNWA 4HKTA 3PSHA 3MCVA 4G0NA 3TUIC 3EODA 2M2IA 4UM9B 5DYWA 3NPMA 1W0JA 2D3WA 3DFZA 4LHEA 5AVJA 5BRAA 3E9QA 1U0BB 4JJ8A 2QM4A 5EZSA 2WDZA 1V6AA 3OZSA 3KE1A 1MDFA 4AG3A 4R3WA 2WLSA 3TNDA 3V34A 2QZZA 4OGWA 3Q7EA 4PAQA 3IAS1 3KKPA 5CR9A 1JV2B 2X9NA 1UJ4A 3SI7A 3ZDYB 3ICQB 4FM0A 3PL1A 2J67A 5JZBA 2OE2A 2RDCA 3Q3IA 5D5QA 3PXDA 1O9HA 5FTWA 2XA2A 9ABPA 2VRBA 3KETA 3TXAA 4LZNA 4RVNA 4QU9A 4Q39A 1PNRA 2C4TA 5H9WA 4ND5A 5JR3A 1ISPA 4XEUA 1DBPA 1UR5A 4HNTA 4GXNA 2C8JA 4Z3DA 5AT1A 1XDBA 4OBEA 4UCVA 3BMNA 1BX1A 1GN3A 1GGKA 1LVHA 3RH0A 4N23A 5LNK1 3PC8C 3ZWVA 4URUR 3C15C 1DB3A 4EB8A 1NUHA 4PI0A 1E61A 4Y2GA 5IWCA 3WI7A 1JT2A 3LECA 4HNAB 1URFA 4BKQA 1K5QA 2UZ1A 4ZGWA 4FGJA 4LJ7A 1DHTA 4K3AA 3AI3A 1KOJA 3SHTA 5DSXA 2PGGA 2W2NA 3DMGA 2PKQO 1XYVA 3W5UA 5FL7G 5DCLA 3E03A 1MH9A 1ZVKA 1K8RA 4FHGA 4YV0A 3KXKA 3UFXA 1V3TA 4F21A 3EZYA 3ZIAA 3H5IA 4AQ7A 1FU7A 2QUJA 2GO1A 1X7OA 5DHTA 2WSMA 3BERA 2BKUA 1WB8A 3CUWA 2R1VA 2XGMA 1TMOA 1OSNA 4MVJD 1V11B 5KC9A 3BGVA 3CSSA 3OTOO 4JLPA 4C78A 1WF3A 1YDEA 3RVKA 4BV8A 3IMCA 3DDWA 1EB8A 4JLUA 1FLVA 3QPU