5JCWA

Crystal structure of hgstp1-1 with glutathione adduct of phenethyl isothiocyanate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
b'PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Irreversible Inhibition of Glutathione S-Transferase by Phenethyl Isothiocyanate (PEITC), a Dietary Cancer Chemopreventive Phytochemical.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5jcwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5jcwA01
2OACA 1Q98A 1AXDA 2C0EA 2HFDA 4ZILA 2MBTA 2DC5A 5HFGA 3QDNA 5AIXA 5DAKB 3GHAA 1VGLA 1SK2A 2LRNA 3C7MA 4D73B 4BVYB 1WRYA 1A2LA 4MP4A 4ISDA 3NIVA 4USSA 16GSA 4MF7A 1A8LA 4IQAA 3M1GA 1C72A 1JZWA 3ZMKA 4NHZA 4KCEA 4LLRA 3WD6A 4HEA2 4KB3A 3W6GA 1SKWB 1UVZA 3KGKA 3UL3A 5D9VA 5H5RA 4HU7A 2F8AA 2VLTA 3DEXA 2X64A 2LNSA 1M7TA 2DJKA 2HSMA 1XVQA 2H1GA 3GIXA 3IK7A 4MJAA 4X43A 3Q19A 5DALA 4V2LA 2HE3A 5F8BA 3KH9A 4YQVA 3BOAA 4TXOA 5H5QA 2I4AA 1WIKA 5LD0A 3E3EA 5IMFA 3WGEA 4MCUA 1TKDB 1TTZA 1V2AA 1GSDA 2QC7A 1EZKA 4KSOA 2N5FA 4MLYA 3FEUA 3KP9A 4HJ2A 3EC3A 1FHEA 3L4NA 3VWXA 5CRHA 1RW1A 4L5OA 2ALBA 3UAPA 4Z7XA 3J7Yb 2C0DA 2QSIA 4KDXA 1QFNA 2CT6A 1MDJA 4RQRA 4TW5A 3EMPA 3RPNA 1VF3A 2BMXA 1ZYQB 1XWKA 1K0AA 1T4ZA 4PNFA 3V1WA 3LYKA 2H1DA 3BD2A 2FA8A 1YF0A 2H01A 4TR4A 3IC4A 5A4WA 2GQLA 2VUPA 3TJFA 1S3DA 1K0MA 5HR0A 3O76A 1K0NA 3OR5A 1ILOA 4Q5RA 1G6YA 1AIUA 2CX4A 1OC3A 4Q5NA 3LEFA 3IC8A 4Q5FA 3LJRA 2L6DA 2KUCA 2L57A 1R5AA 7GSSA 4NMUA 3RAZA 1ZGNA 4KDYA 3O6TA 2L4CA 1Z3EA 3AY8A 3TRPA 4V2NA 2VLUA 17GSA 1ZCPA 2HZEB 4AJ7A 2H73A 5IOWA 4ZB8A 1SL2B 2R4VA 2H70A 2TIRA 2DSAA 2H0IA 1UN2A 6GSWA 1ZMAA 1GH2A 2GSTA 5CNWA 4N10A 5F05A 3GX8A 3D5JA 1A0RP 2ZNMA 4ZBAA 2NPBA 1FAAA 2DMMA 1THXA 3I69A 1XWGA 6GSVA 1TRVA 4DEJA 3Q18A 2YOIA 3HKRA 1T8EB 3E0UA 3TDGA 1GWCA 5DQSA 4OO5A 1IYIA 4TR1B 2BTOT 1GSEA 2VD1A 3CSJA 2L4QA 1SYXA 2VM1A 1MTCA 4WKWA 1HQOA 3DWVA 1YEXA 1PMTA 5FHIA 3GTUA 3H93A 5G30A 2VD0A 5BMUA 4GSSA 4E8HA 4POKA 1HNAA 1T1VA 2V41A 2HYXA 3DVWA 3GKXA 3TKSA 1K3LA 1SK1A 4RQXA 3D0ZA 1V98A 5JWOB 3G7IA 1V40A 5J9BA 2OE1A 3PH9A 3ERGA 2B5YA 1XW9A 1HYUA 3HVSA 3G7JA 3GFKA 3LXZA 1U88A 3F6FA 3F4RA 3WYWA 3HVXA 2IMEA 3TOTA 3CMIA 2H1AA 2XPDA 1H75A 1FG4A 4TN8A 3RBTA 1FB6A 3WGXA 1GUHA 1GSUA 2H76A 2H6YA 6GSXA 1YJ6A 2FA4A 1U3IA 2PWJA 3UEMA 3N9JA 2GVPA 1FVJA 3UBLA 1SYRA 1JZRA 5J4UA 5DVBA 4AJ8A 4QQ7A 1JZOA 1OC8A 2EIRA 1R7HA 1SL0B 1GLPA 3UMAA 1SJIA 3K8NA 2EC4A 5GSSA 2YV9A 4TR3A 3TJJA 3IPZA 4TKYA 2LNTA 1BQ7A 1F9MA 2EIOA 1TRSA 4HI7A 3NOFA 3EINA 1GUKA 4OFNA 5E59A 3ZIVA 2H6XA 3H1NA 4OO4A 4ECBA 3F63A 2V6OA 1OE7A 2C80A 1EEMA 4DSQA 2HZFA 3FW2A 2GZZA 4ILFA 4AF2A 4OFTA 5ECSA 3PR8A 1ERVA 4HQZA 2A4VA 5IO2A 3UVHA 2DJ2A 5DJMA 1JFUA 4IP6A 2VLVA 5CAXA 2E0QA 1PX7A 1XCCA 18GSA 2VM2A 3LWAA 1AQVA 3GKKA 1DBYA 2HRAA 3ZFLA 1SU9A 2JL4A 19GSA 1H4OA 3GNJA 4K9ZA 2AV4A 1GTBA 1WMJA 1GUMA 4ZB6A 3ZTLA 2KP1A 3KTLA 4GSTA 4IJ3A 2PBJA 4F03A 5COHA 4MZBA 1B9XC 14GSA 4AJ6A 4MK3A 3WT1A 1XIYA 1MD4A 1Z7RA 4MPGA 2J23A 3VLNA 4ECJA 3QFAC 2LQOA 2F3MA 5INYA 1F37A 1Y6EA 3HD5A 5G2ZA 1G7OA 2VL2C 2V1MA 5GZZB 2C3QA 1O7UA 5HR2A 4ML1A 3DIEA 1OYJA 1OKDA 2M46A 3FYGA 4RI7A 4GWRA 1PX6A 5DDLA 2WGRA 3LG6A 1XOBA 3HJPA 3HZ8A 4WF4A 2YJHA 2DJJA 4MJEA 1DUGA 2FLSA 4J57E 4IGJA 1Z7PA 4L0UA 4PGTA 2PVQA 4WBRD 1Z5YE 2C3TA 3WT2A 4LL1B 3TRQA 5IPHA 2PMTA 3IOSA 4DSSB 5G1KA 1GSYA 3RHBA 5B6NA 2LKUA 1GNWA 4BVXA 3GL3A 5IQYA 5CRDA 2DIZA 2VCTA 1A8YA 3KZQA 2HRNA 2R37A 3GSSA 3CTFA 1M2DA 2LUSA 2OBKA 2IPAA 5ECOB 3FRCA 4ID0A 4G10A 1TRUA 4PQ1A 3FR6A 5CP1A 5KEJA 3D4MA 2ON5A 2FWFA 5DJLA 3G7YA 4GF0A 4IS0A 1BYEA 2CAIA 3ISOA 3CSHA 4GLTA 3QAWA 3CRUA 2C3NA 2LJAA 3HDCA 1U87A 3IRAA 3TJKA 1I9DA 1B4QA 2RM5A 1THOA 4F0BA 1VRSD 2IFQB 2UZ8A 3EWLA 3QAGA 1GTAA 1JLWA 2H66A 3VFIA 1K3YA 1W4VA 3CYNA 4PUAA 9GSSA 4RUVA 2B7JA 1TDIA 1TXXA 5EPFA 3KIJA 4GQCA 3VURA 5ENUA 1USBA 2MYGA 1AAZA 5ECQB 2X99A 4WETA 3UIWA 3F3QA 2GT5A 2LJRA 5DALB 2C0FA 3L0HA 2WJUA 1XBSA 2MMOA 2CVKA 3HVVA 5D8IA 5LCZA 2GSSA 4YAPA 3U5RE 2VCQA 2IMIA 2DJ0A 2O89A 1ZOFA 2A2RA 4G0KA 2KLXA 4NHWA 4EF0A 1TW9A 2RUEA 5IMAA 2YNXA 2GT6A 4IJIA 1T4YA 3VWUA 2WB9A 4LMVA 5G5EA 3WGDA 5GSTA 4POMA 2YWMA 3BBYA 5EL8A 2E2GA 4XRAA 5FT3A 1DE2A 2YN1A 3GX0A 4ZIJA 3Q74A 2FY6A 4KF9A 2OE0A 4PTSA 2MZCA 3C1RA 1W89A 3JCML 2CX3A 1GSSA 2DBCA 1YDKA 3MWHA 4RI6A 1OAZA 4ULXA 4G19A 4ECCA 1FW1A 2K8SA 3TGZA 5A4UA 1WE0A 2F8FA 3GV1A 5IMCA 1BX9A 2HRKA 2RM6A 1G7EA 5GAND 1SKSB 5ID2A 1SJZA 4OFMA 3I43A 1OC9A 2JZRA 1M9AA 3LYPA 2AUVA 4K0NA 2DMLA 4YAVA 3A2WA 5D9XA 1HNCA 2NDOA 3KP8A 5ECNB 2GZPA 1K0BA 2DIYA 3CSIA 2R2JA 1CQHA 3A2XA 3HXSA 2LSTA 1V9WA 4BWQA 2JU5A 2X8GA 2GZYA 2H30A 5CYYA 4OMVA 1PKWA 4F82A 1R4WA 4BPYA 2HRFA 1XFLA 4ZL8A 2L5OA 1QQ2A 2PVOC 5AIVA 1OE8A 1TU8A 4I8BA 2WRTA 4XS4A 6GSSA 3RPPA 2CVBA 2H71A 1GSQA 3IV4A 4OWYA 1B9YC 1MDIA 1U3AA 4LA1A 4ZBBA 2VOCA 6GSYA 4WR5A 2A2SA 4PNGA 5D96A 2LEGA 4EUYA 4PURA 3MNGA 3ZL5A 5F06A 2IMDA 4HZ2A 4YH2A 1T3BA 2YANA 4YQMA 4KGIA 3LSZA 4HDEA 1YKCA 2F51A 5G1LA 3ZREA 1F2EA 2AAWA 1ERTA 3D4TA 1B4PA 5KN3A 4IVFA 5DQYA 4GTUA 3CXGA 3KXOA 1F3AA 1XW6A 3RDWA 5HR1A 2VCZA 2XPEA 3MDKA 2HSYA 4XIHA 4I2TA 2YZUA 5H5SA 5J9CA 2YZHA 4X1UA 5ECRB 2GSQA 1HD2A 1TK0B 2ON7A 2G0FA 1BJXA 1AUCA 5IO0A 1SJ6A 3TKPA 3H4KA 3DMLA 3MSZA 3P2AA 4PQHA 3ME7A 1SD9A 1JZDA 4HZ4A 2VCWA 3QAVA 1A23A 1ZYEA 2TRCP 2L59A 3D22A 4PUFC 3M0FA 3VK9A 2MMZA 4F0CA 2GQMA 4KE3A 4GCIA 1EGOA 2QKEA 3TB2A 1NSWA 5CO3A 4N0ZA 3TKQA 2NTOA 5EVOA 5IMDA 3FZ4A 3ERWA 3F4SA 4G0LA 1S3AA 4FYCA 1FB0A 3ERFA 4EO3A 3IDVA 4L5LA 1MEKA 2VCXA 4FQUA 2CAQA 1T7PB 2VL2A 2B7KA 1K0CA 2O85A 2CZ2A 1GNEA 2GDRA 4O92A 3IE3A 4JE1A 3KEBA 4MA9A 1XVWA 3R3EA 1ML6A 4BL7B 4XHMA 2X8CA 4ZB9A 4XS6A 3VPTA 2VL3A 3DXBA 2I3YA 2GQKA 1QK8A 4MABA 2VCVA 1Z6MA 2D2ZA 2C8UA 1G0TA 2YP6A 3P90A 3TUEA 2V6KA 4K6XA 2B5XA 2LQQA 3TRXA 4N30A 3R2QA 1EV9A 2E7PA 2K8VA 5CREA 2XBIA 2CA8A 3CTGA 3W8JA 2LV3A 2WS2A 4JRRA 1SK0A 4I2UA 2JSYA 2R5GA 5G31A 2ZCTA 3KTBA 2HSNB 3LGCA 2XC2A 1VF2A 2B6MA 2F9SA 2PGTA 2YWOA 3DGQA 3FR9A 2H19A 1F6MC 2EIQA 2JZSA 5AN1A 5A5KA 1PSQA 4OCFA 5E4WA 3DYRA 2FD3A 1SD8A 1DSBA 4O5RA 3ED3A 4KDUA 2WFCA 2OJLA 2CVDA 1LU4A 2KP2A 5D9TA 4HJMA 2H75A 3QD9A 4GXZA 3RHCA 2C1YA 4EKZA 3M9JA 1KEBA 2PU9C 3IAS2 2AYTA 3US3A 4ACSA 5LNKe 2DJ1A 4J2FA 1KTEA 1TI3A 5JWQB 3FZ9A 2OBIA 5D9WA 2YPMA 3U6VA 1Q4JA 3G9BA 4YQUA 2HT9A 3EURA 2YWNA 1O81A 1WOUA 3IXRA 1RK4A 4I97A 3IK9A 2Z9SA 4IKHA 6GSTA 5HFIA 2PN8A 3IHQA 1O73A 1GULA 1QXHA 5IPGA 5DCHA 1B8XA 1NM3A 4K7OA 1ZZYA 2LRCA 1PKZA 2DJ3A 1TJDA 3W8SA 1XWBA 3GRXA 4WBJA 4GSNA 1XW5A 2GS3A 3GYKA 4FO5A 2O7KA 2OADA 4K7NA 1GRXA 4EE0A 1YZXA 2B5EA 1FVKA 2WZ9A 3J7Yk 4IN0A 2YV7A 2ES7A 1BG5A 3KH7A 1A24A 3LORA 1A2JA 5IMVA 1PL1A 4FH8A 2AJQB 1EOHA 3IA1A 4FYBA 1U6TA 5ECPB 2IMKA 4LL4B 1R5PA 4POBA 3HCZA 3BJ5A 3KMNA 5IM9A 2AHEA 3HJOA 5B6MA 2N5AA 2I1UA 1M9BA 3E9JB 1QUWA 2B1LA 3S9FA 2N5BA 4PQIA 3CRTA 4K1FA 2L6CA 3QR6A 4NV2A 2P0GA 13GSA 4GQFA 1V58A 3FZAA 4ZBDA 4PX1A 3IR4A 1GL8A 4G0IA 4V1Ap 4ECIA 5A4VA 2B3SA 2IJYA 3ZRDA 2HNLA 1RQMA 3EU3A 1X9WB 3I6AA 2NVLA 3APSA 4MJCA 10GSA 4MDCA 2HSMB 3A3TA 2FWGA 3ZLPA 4JU5A 1PRXA 2H1BA 3IBHA 4MF6A 2ZUPA 3BCIA 4EL1A 1EP7A 4TXOB 3H8QA 4KA0A 4TRXA 2IIYA 3HZ4A 1KNGA 2VO4A 2IFQA 1AW9A 2FHEA 2E2MA 1UA5A 2YWIA 4HU9A 4G9HA 1WJKA 5C00A 1ABAA 4MZCA 2JACA 2HRKB 2RLIA 3QCPA 1GTIA 5F0GA 5DAKA 5ID2B 5DCGA 1Z9HA 1OC9B 1EV4A 2HLSA 4XCSA 2C0GA 4CDOA 2NBSA 4BVYA 1S3CA 4D73A 1A0FA 1Y25A 2PPTA 1NW2A 1K0DA 1VF4A 4Q5QA 3C8EA 4NXIA 3HA9A 4BA7A 5JCWA 2VL9A 4CHSA 5IIZA 4K2DA 3EVIA 3NZNA 2JZTA 1SL1B 5D93A 2IMFA 2M72A 3BCKA 3C73A 4FIWA 3L9VA 2I9HA 1YKAA 1FOVA 3A5WA 5J5NA 1KBNA 3FZ5A 4CW9A 1XPVA 2G2QA 1XZOA 2K6VA 3C71A 5D73A 4XS4B 4O32A 2CV4A 2WDUA 1ERUA 3SBCA 2OE3A 1J0FA 1J9BA 3P7XA 2HXKA 1NHYA 4IELA 3TOUA 3GUSA 3C1SA 3QFBC 2GLRA 3GMFA 1YEPA 2VIMA 3DVXA 1PL2A 5KN2A 1F3BA 1JLVA 3F4TA 2TRXA 5HFKA 1QMVA 4ML6A 1X9MB 5L71A 1VF1A 1K3OA 3FY7A 4J56E 3ZMLA 1TRWA 4WEYA 3TJBA 3P8WA 2PUKC 3F6DA 1E2YA 3ZVJD 1FO5A 5AGYA 1HNBA 1TU7A 4KUNA 2R3XA 5ECIB 3TKRA 4I5QA 4L0WA 3GTUB 3N5OA 3LQ7A 4V2MA 3ZYWA 1O8XA 2FWEA 4LMWA 2O8VB 4QL9A 4OCEA 3KD0A 2PERA 1X5DA 3APOA 4DSRA 2H0HA 3GL5A 1TOFA 4MZWA 20GSA 1X0RA 1JHBA 2OKAA 3QPMA 3GN3A 4KNDA 1K0OA 4IW9A 1X5EA 1M2AA 3UJ1A 4IHUA 4MJBA 3ZITA 4X0XA 2MBSA 1B48A 1TK5B 2XBQA 5JWRB 5ECHB 2GGTA 4HOJA 4K0GA 4F9ZA 4O7HA 2K18A 5IMZA 1GTUA 3GH9A 11GSA 1ON4A 2HZEA 1IYHA 1TI1A 3L9SA 1SKRB 2CQ9A 3O3TA 5CRWA 4NPBA 3A2VA 3ZVJA 5KN1A 3Q6OA 3UARA 1TK8B 5ELGA 3KM6A 2QGVA 3GH6A 3D21A 3GURA 4OD7A 12GSA 1N2AA 3PGTA 4P3YB 3M8NA 1EEJA 2O87A 1V57A 4FYUA 4JR4A 3UOMA 3ME8A 4TR1A 1PQNA 2KHPA 4EDYA 1DE1A 5ECMB 2IWTA 4MH3A 4EVMA 1UC7A 1O8WA 4IP1A 2DLXA 2P5QA 2P5RA 3VPQA 4N11A 1AQWA 4JBBA 8GSSA 5F07A 3EU4A 1ACVA 3ZZXA 4PXOA 4KAEA 5G5FA 4KH7A 1GSFA 3PPUA 3F9UA 5CRGA 2GTUA 1M0UA 1OVNA 2MMAA 1YQ1A 2H0GA 5J3RA 3L9UA 3QOUA 1MDKA 2IN3A 1O6JA 5DBQA 3EMXA 2LTKA 4KX4A 5KN0A 2WCIA 5JCUA 2FCHA 1EWXA 3GKNA 4MPFA 4WF5A 1XWAA 3H79A 2H6ZA 2YJ7A 2V32A 3DRNA 1A2MA 4EXJA 4DVCA 4N0VA 4IQ1A 5AISA 2B1KA 4MF5A 1PN9A 4XS1A 3M9KA 2RUFA 4KSMA 2I81A 3TKSE 1O85A 2FUG2 4TOPA 2J9HA 4L8EA 4E8EA 3CBUA 4G2EA 1URMA 2H8LA 3TKSC 3M3MA 1XWCA 2HSHA 1E6BA 5EY6A 1SENA 3EYTA 1PA3A 2GSRA 2RIIA 1ZL9A 2KOKA 3HY2A 1GLQA 2C4JA 3UBKA 1YY7A 1J08A 1LJRA 4XTSA 3F3RA 2JSZA 3DKSA 3APQA 4JZQA 3LFLA 1WWJA 5C04A 3ZIJA 3GSTA 4XRDA 4BL7A 4EC0A 1I5GA 5ECLB 3GA4A 1YF1A 3HYPA 3VI5A 5B8BA 5JCGA 1NHOA 2R6KA 3VI7A 4K7IA 3KMOA 4MMMA 3FK8A 4GRFA 2REMA 2L5LA 1TP9A 3QMXA 3HHVA 3VWVA 2H72A 1PGTA 5IOXA 3EE2A 3D6IA 4BVXB 2FNOA 4NWYA 4HS1A 1WPIA 1BAYA 1XOAA 3UVTA 3I9V2 4ZL9A 4ZXGA 2AB6A 3MAKA 1EOGA 4IBPA 1Z6NA 1R26A 3PINA 2JADA 1X9SB 4BWSA 4MH2A 3VWWA 1ST9A 3TJGA 1AQXA 5ABRA 4KCAA 3F8UA 1M2BA 4HUAA 4EDZA 2P31A 1GP1A 1QGVA 5B7CA 2K9FA 4TXVA 1EP8A 3HJMA 3FR3A 4V1Ag 2YCDA 22GSA 3L78A 4JEDA 2M80A 3LXTA 1M99A 1PD21 2MMNA 2HI7A 2HQTA 2FWHA 1LBKA 2XHFA 1G6WA 1X5CA 4NV5A 3IAM2 3KCMA 4AGSA 1EGRA 4TR0A 5ELAA 1ERWA 2X8HA 3ZFBA 3SWLA 5ECKB 2H74A 1CQGA 5J41A 4TVEA 4H86A 5B8AA 3DD3A 2VAFA 4POLA 4WR4A 6GSUA 4HQSA 1OKTA 3FKFA 2CZ3A 1T00A 1WP0A 2IL3A 2FGXA 4K8MA 5HQPA 3F0IA 1XXUA 4DSSA 1AC1A 2LJKA 4QL7A 4F2IA 4ZL7A 5FWGA 2V2GA 4KW6A 5HR3A 4JR6A 2OA7A 1MD3A 2WULA 2LRTA 1BEDA 3FHKA 3KJYA 3GKMA 4WXTA 3TCOA 2LS5A 1N8JA 4NAXA 5GAPD 4I6XA 2BJXA
chains in the Genus database with same CATH superfamily
2OACA 1Q98A 1AXDA 2C0EA 2HFDA 4ZILA 2MBTA 2DC5A 5HFGA 3QDNA 5AIXA 5DAKB 3GHAA 1VGLA 1SK2A 2LRNA 3C7MA 4D73B 4BVYB 3HMJG 1WRYA 1A2LA 4MP4A 4ISDA 2EFCA 3NIVA 4USSA 16GSA 4MF7A 1A8LA 4IQAA 3M1GA 1C72A 1JZWA 1M3IA 3ZMKA 4NHZA 4KCEA 4LLRA 3WD6A 4HEA2 4KB3A 3W6GA 1SKWB 1UVZA 3KGKA 4AKGA 3UL3A 5D9VA 5H5RA 4HU7A 2F8AA 4E68A 2VLTA 3DEXA 2X64A 2LNSA 1M7TA 2DJKA 2HSMA 1XVQA 2H1GA 3GIXA 3IK7A 4MJAA 4X43A 3Q19A 5DALA 4V2LA 2HE3A 5F8BA 3KH9A 4YQVA 3BOAA 4TXOA 5H5QA 2I4AA 1WIKA 5LD0A 3E3EA 5IMFA 3WGEA 4MCUA 1TKDB 1TTZA 1V2AA 1GSDA 2QC7A 1EZKA 4KSOA 2N5FA 4MLYA 3FEUA 3KP9A 4HJ2A 3EC3A 1FHEA 3L4NA 3VWXA 5CRHA 1RW1A 4L5OA 2ALBA 3UAPA 4Z7XA 4AKHA 3J7Yb 2C0DA 2QSIA 4KDXA 1QFNA 2CT6A 1MDJA 4RQRA 4TW5A 3EMPA 3RPNA 1VF3A 2BMXA 1ZYQB 1XWKA 1K0AA 1T4ZA 4PNFA 3V1WA 3LYKA 2H1DA 3BD2A 2FA8A 1YF0A 2H01A 4TR4A 3IC4A 5A4WA 2GQLA 2VUPA 3TJFA 2QA1A 1S3DA 1K0MA 4YKFA 5HR0A 3O76A 1K0NA 3OR5A 1ILOA 4Q5RA 1G6YA 1AIUA 2CX4A 1OC3A 4Q5NA 3LEFA 3IC8A 4Q5FA 3LJRA 2L6DA 2KUCA 5A5HB 2L57A 1R5AA 7GSSA 4NMUA 3RAZA 1ZGNA 4KDYA 3O6TA 2L4CA 1Z3EA 3AY8A 3TRPA 4V2NA 2VLUA 4PHZC 17GSA 1ZCPA 2HZEB 4AJ7A 2H73A 2VKZG 5IOWA 4ZB8A 1SL2B 2R4VA 2H70A 2TIRA 2DSAA 2H0IA 1UN2A 6GSWA 1ZMAA 1GH2A 2GSTA 4QMKA 5CNWA 4N10A 5F05A 3GX8A 3D5JA 1A0RP 2ZNMA 4ZBAA 2NPBA 1FAAA 2DMMA 1THXA 3I69A 1XWGA 6GSVA 1TRVA 4DEJA 3Q18A 2YOIA 3HKRA 1T8EB 3E0UA 3TDGA 1GWCA 5DQSA 4OO5A 1IYIA 4TR1B 2BTOT 1GSEA 2VD1A 3CSJA 2L4QA 1SYXA 2VM1A 1MTCA 3CQFA 4WKWA 1HQOA 3DWVA 1YEXA 1PMTA 5FHIA 3GTUA 3H93A 5G30A 2VD0A 5BMUA 4GSSA 4E8HA 4POKA 3FMWA 1HNAA 1T1VA 2V41A 2HYXA 3DVWA 3GKXA 3TKSA 1K3LA 1SK1A 2R0PA 4RQXA 3D0ZA 1V98A 5JWOB 5BRTA 3G7IA 1V40A 2R0GA 5J9BA 2OE1A 5J47A 3PH9A 3ERGA 2B5YA 1XW9A 1HYUA 3HVSA 3G7JA 3GFKA 3LXZA 1U88A 3F6FA 3F4RA 3WYWA 3HVXA 2IMEA 3TOTA 3CMIA 2H1AA 2XPDA 1H75A 1FG4A 4TN8A 3RBTA 1FB6A 3WGXA 1GUHA 1GSUA 2H76A 2H6YA 6GSXA 1YJ6A 2FA4A 2A4HA 1U3IA 2PWJA 3UEMA 3N9JA 2GVPA 1FVJA 3UBLA 1SYRA 1JZRA 5J4UA 5DVBA 4AJ8A 3HVNA 4QQ7A 1JZOA 1OC8A 2EIRA 1R7HA 1SL0B 1GLPA 3UMAA 1SJIA 3K8NA 2A2PA 2EC4A 5GSSA 2YV9A 4TR3A 3TJJA 3IPZA 4TKYA 2LNTA 1BQ7A 1F9MA 2EIOA 1TRSA 4HI7A 3NOFA 3EINA 1GUKA 4OFNA 5E59A 3ZIVA 2H6XA 3H1NA 4OO4A 4ECBA 3F63A 2V6OA 1OE7A 2C80A 1EEMA 4DSQA 2HZFA 3FW2A 2GZZA 4ILFA 4AF2A 4OFTA 5ECSA 3PR8A 1ERVA 4HQZA 2A4VA 5IO2A 3UVHA 2DJ2A 5DJMA 1JFUA 4IP6A 2VLVA 5CAXA 2E0QA 1PX7A 1XCCA 18GSA 2VM2A 3LWAA 1AQVA 3GKKA 1DBYA 2HRAA 3ZFLA 1SU9A 2JL4A 19GSA 1H4OA 3GNJA 4K9ZA 2AV4A 1GTBA 1WMJA 1GUMA 4ZB6A 3ZTLA 2KP1A 3KTLA 4GSTA 4IJ3A 2PBJA 4F03A 5COHA 4MZBA 1B9XC 14GSA 4AJ6A 4MK3A 4A5PA 3WT1A 1XIYA 1MD4A 1Z7RA 4MPGA 2J23A 3VLNA 4ECJA 3QFAC 2LQOA 5KOWA 2F3MA 5INYA 1F37A 1Y6EA 3HD5A 5G2ZA 1G7OA 2VL2C 2V1MA 5GZZB 2C3QA 1O7UA 5HR2A 4ML1A 3DIEA 1OYJA 2HSNA 1OKDA 2M46A 3FYGA 4RI7A 4GWRA 1PX6A 5DDLA 2WGRA 3LG6A 1I1IP 1XOBA 3HJPA 3HZ8A 4WF4A 2YJHA 2DJJA 4MJEA 1DUGA 2FLSA 4J57E 4IGJA 1Z7PA 4L0UA 4PGTA 2PVQA 4WBRD 1Z5YE 2C3TA 3WT2A 4LL1B 3TRQA 5IPHA 2PMTA 3IOSA 4DSSB 5G1KA 1GSYA 3RHBA 5B6NA 2LKUA 1GNWA 4BVXA 3GL3A 5IQYA 5CRDA 2DIZA 2VCTA 1A8YA 3KZQA 2HRNA 2R37A 3GSSA 3CTFA 1M2DA 2LUSA 2OBKA 2IPAA 5ECOB 3FRCA 4ID0A 4G10A 1TRUA 4PQ1A 3FR6A 5CP1A 5KEJA 3D4MA 2ON5A 2FWFA 5DJLA 3G7YA 4GF0A 4IS0A 1BYEA 2CAIA 2EFDA 3ISOA 3CSHA 4GLTA 3QAWA 3CRUA 2C3NA 2LJAA 3HDCA 1U87A 3IRAA 3TJKA 1I9DA 1B4QA 2RM5A 1THOA 1YEWC 4F0BA 1VRSD 2IFQB 2UZ8A 5J4VA 3EWLA 3QAGA 1GTAA 1JLWA 2H66A 3VFIA 1K3YA 1W4VA 3CYNA 4PUAA 9GSSA 4RUVA 4PI2C 2B7JA 1TDIA 1TXXA 2O5VA 5EPFA 4K5SA 3KIJA 4GQCA 3VURA 5A34A 5ENUA 1USBA 2MYGA 1AAZA 5ECQB 2X99A 4WETA 3UIWA 3F3QA 2GT5A 2LJRA 5DALB 2C0FA 3L0HA 2WJUA 4N3ZA 1XBSA 2MMOA 1SVMA 2CVKA 3HVVA 5D8IA 5LCZA 2GSSA 4YAPA 3U5RE 4O5UA 2VCQA 2IMIA 2DJ0A 2O89A 1ZOFA 2A2RA 4G0KA 2KLXA 4NHWA 4EF0A 1TW9A 2RUEA 5IMAA 2YNXA 5KOXA 2GT6A 4IJIA 1T4YA 4EIQA 3VWUA 2WB9A 4LMVA 5G5EA 4HSCX 3WGDA 5GSTA 4POMA 2YWMA 3BBYA 5EL8A 2E2GA 4XRAA 5FT3A 1DE2A 2YN1A 3GX0A 4ZIJA 4W66A 3Q74A 2FY6A 4KF9A 2OE0A 4PTSA 2MZCA 3C1RA 1W89A 3JCML 2CX3A 1GSSA 2WVYA 4ICYA 2DBCA 1YDKA 3MWHA 4RI6A 1OAZA 4ULXA 4G19A 4ECCA 1FW1A 2K8SA 3TGZA 5A4UA 1WE0A 2F8FA 3GV1A 2DKIA 5IMCA 1BX9A 2HRKA 2RM6A 1G7EA 5GAND 1SKSB 5ID2A 1SJZA 4OFMA 3I43A 1OC9A 2JZRA 1M9AA 3LYPA 2AUVA 4K0NA 2DMLA 4YAVA 3A2WA 5D9XA 1HNCA 2NDOA 3KP8A 5ECNB 2GZPA 1K0BA 2DIYA 4O5QA 3CSIA 2R2JA 1CQHA 3A2XA 3HXSA 2LSTA 1V9WA 4BWQA 2JU5A 2X8GA 2GZYA 2H30A 1S3RA 5CYYA 4OMVA 1PKWA 4F82A 1R4WA 4BPYA 2HRFA 1XFLA 4ZL8A 2L5OA 1QQ2A 2PVOC 5AIVA 1OE8A 1TU8A 4I8BA 2WRTA 4XS4A 6GSSA 3A5IA 3RPPA 2CVBA 2H71A 1GSQA 3IV4A 4OWYA 1B9YC 1MDIA 1U3AA 4YKGA 4LA1A 4ZBBA 2VOCA 4BIKA 6GSYA 4WR5A 2A2SA 4PNGA 5D96A 2LEGA 4EUYA 4PURA 3MNGA 4AKXB 3ZL5A 5F06A 2IMDA 4HZ2A 4YH2A 1T3BA 2YANA 3MIXA 4YQMA 4KGIA 3LSZA 4HDEA 1YKCA 2F51A 5G1LA 3ZREA 1F2EA 2AAWA 1ERTA 3D4TA 1B4PA 5KN3A 4IVFA 5DQYA 4GTUA 4Z2UA 1Y1UA 3CXGA 3KXOA 1F3AA 1XW6A 3IHGA 3RDWA 5HR1A 2XPEA 2VCZA 3MDKA 2HSYA 4XIHA 4I2TA 2YZUA 5H5SA 5J9CA 2UV8G 2YZHA 4X1UA 5ECRB 2GSQA 4GDFA 1HD2A 1TK0B 2ON7A 2G0FA 1BJXA 1AUCA 5IO0A 1SJ6A 3TKPA 2WVXB 3H4KA 3DMLA 3MSZA 3P2AA 4PQHA 3ME7A 1SD9A 1JZDA 4HZ4A 2VCWA 3QAVA 1A23A 1ZYEA 2TRCP 2L59A 3D22A 4PUFC 3M0FA 3VK9A 4G01A 2MMZA 4F0CA 2GQMA 4KE3A 4GCIA 1EGOA 2QKEA 3TB2A 1NSWA 5CO3A 4N0ZA 3TKQA 2NTOA 5EVOA 5IMDA 3FZ4A 3ERWA 3F4SA 4G0LA 1S3AA 4FYCA 5A1NA 1FB0A 3ERFA 4EO3A 3IDVA 4L5LA 1MEKA 2VCXA 4FQUA 2CAQA 1T7PB 4Z2RA 3CWGA 2VL2A 2B7KA 1K0CA 2O85A 3EPTA 2CZ2A 1GNEA 2GDRA 4O92A 3IE3A 4JE1A 1M3JA 3KEBA 4MA9A 1XVWA 3R3EA 1ML6A 4BL7B 4XHMA 2X8CA 4ZB9A 4XS6A 3VPTA 2VL3A 3DXBA 2I3YA 2GQKA 1QK8A 4MABA 2VCVA 1Z6MA 2D2ZA 2C8UA 1G0TA 2YP6A 3P90A 3TUEA 3RGBC 2V6KA 4K6XA 2B5XA 2LQQA 3TRXA 4X4JA 4N30A 3R2QA 1EV9A 2E7PA 2K8VA 5CREA 2XBIA 2CA8A 3CTGA 3W8JA 2LV3A 2WS2A 4JRRA 1SK0A 1ZYNA 4I2UA 2JSYA 2R5GA 5G31A 2ZCTA 3KTBA 2HSNB 3LGCA 2XC2A 1VF2A 2B6MA 2F9SA 2PGTA 1TXUA 2YWOA 3DGQA 3FR9A 2H19A 1F6MC 2EIQA 2JZSA 5AN1A 5A5KA 3LW9A 1PSQA 4OCFA 5E4WA 3DYRA 2FD3A 3MYDA 1SD8A 1DSBA 4O5RA 3ED3A 4KDUA 2WFCA 2OJLA 2CVDA 1LU4A 2KP2A 5D9TA 4HJMA 2H75A 1PFOA 3QD9A 4GXZA 3RHCA 2C1YA 4EKZA 3M9JA 1KEBA 2PU9C 3IAS2 2AYTA 3US3A 4ACSA 5LNKe 2DJ1A 4J2FA 1KTEA 1TI3A 5JWQB 3FZ9A 2OBIA 3CHXC 5D9WA 2YPMA 3U6VA 1Q4JA 3G9BA 4AI6A 2O3EA 4YQUA 2HT9A 3EURA 2YWNA 1O81A 1WOUA 2X49A 3IXRA 1RK4A 4I97A 3IK9A 2Z9SA 4IKHA 4MNNA 6GSTA 5HFIA 2PN8A 3IHQA 1O73A 1GULA 1QXHA 5IPGA 5DCHA 1B8XA 1NM3A 4K7OA 2WZSA 1ZZYA 2LRCA 1PKZA 2DJ3A 1TJDA 3W8SA 1XWBA 3GRXA 4WBJA 4GSNA 1XW5A 2GS3A 3GYKA 4FO5A 2O7KA 1BF5A 2OADA 4K7NA 1GRXA 4EE0A 1YZXA 2R0CA 2B5EA 1FVKA 2WZ9A 3J7Yk 4IN0A 2YV7A 2ES7A 1BG5A 3KH7A 1A24A 1N25A 3LORA 1A2JA 5IMVA 1PL1A 4FH8A 2AJQB 1EOHA 3IA1A 4FYBA 1U6TA 5ECPB 2IMKA 4LL4B 1R5PA 4POBA 3HCZA 2WW3A 3BJ5A 3KMNA 5IM9A 2AHEA 3HJOA 5B6MA 2N5AA 2I1UA 1M9BA 3E9JB 1QUWA 2B1LA 3S9FA 2N5BA 4PQIA 3CRTA 4K1FA 2L6CA 3QR6A 4NV2A 2P0GA 13GSA 4GQFA 1V58A 3FZAA 4ZBDA 4PI0C 4PX1A 3IR4A 1GL8A 4G0IA 4V1Ap 4ECIA 5A4VA 2B3SA 2IJYA 3ZRDA 2HNLA 1RQMA 3EU3A 1X9WB 3I6AA 2NVLA 3APSA 4MJCA 10GSA 4MDCA 2HSMB 3A3TA 4Z2TA 2O36A 2FWGA 3ZLPA 4JU5A 1PRXA 2H1BA 2WW0A 3IBHA 4MF6A 2ZUPA 3BCIA 4EL1A 1EP7A 4TXOB 3H8QA 4KA0A 4TRXA 2IIYA 3HZ4A 1KNGA 2VO4A 2IFQA 1AW9A 5J4YA 2FHEA 2E2MA 1UA5A 2YWIA 2QA2A 4HU9A 4G9HA 5J40A 1WJKA 5C00A 1ABAA 4MZCA 2JACA 2HRKB 2RLIA 3QCPA 1GTIA 5F0GA 5DAKA 5ID2B 5DCGA 2WW1A 1Z9HA 1OC9B 1EV4A 2HLSA 4XCSA 2X4AA 2C0GA 4CDOA 2NBSA 4BVYA 1S3CA 4D73A 1A0FA 2PPTA 1Y25A 1NW2A 1BG1A 1K0DA 1VF4A 4Q5QA 3C8EA 4NXIA 3HA9A 4BA7A 1SVOA 5JCWA 2VL9A 4CHSA 5IIZA 4K2DA 3EVIA 3NZNA 2JZTA 1SL1B 5D93A 2IMFA 2M72A 3BCKA 3C73A 4FIWA 3L9VA 2I9HA 1YKAA 1FOVA 3A5WA 5J5NA 1KBNA 3FZ5A 4CW9A 1XPVA 2G2QA 1XZOA 2K6VA 3C71A 5D73A 4XS4B 4O32A 2CV4A 2WDUA 1ERUA 3SBCA 2OE3A 1J0FA 1J9BA 3P7XA 2HXKA 1NHYA 4IELA 3TOUA 3GUSA 3C1SA 3TU3B 2GLRA 3QFBC 3GMFA 1YEPA 2VIMA 3DVXA 1PL2A 5KN2A 1F3BA 1JLVA 3F4TA 2TRXA 5HFKA 1QMVA 4ML6A 1X9MB 5L71A 1VF1A 1K3OA 2EFHA 3FY7A 1XG8A 4J56E 3ZMLA 1TRWA 4WEYA 3TJBA 3P8WA 2PUKC 2EFEA 3F6DA 1E2YA 3ZVJD 1FO5A 5AGYA 1HNBA 1S4BP 1TU7A 4KUNA 2R3XA 5ECIB 3TKRA 4I5QA 4L0WA 3GTUB 3N5OA 5BMUB 3LQ7A 4V2MA 3ZYWA 1O8XA 2FWEA 4LMWA 2O8VB 4QL9A 2WW2A 4OCEA 3KD0A 2PERA 1X5DA 3APOA 4DSRA 2H0HA 3GL5A 1TOFA 4MZWA 20GSA 1X0RA 1JHBA 2OKAA 3QPMA 3GN3A 4KNDA 1K0OA 4IW9A 1X5EA 1M2AA 3UJ1A 4IHUA 4MJBA 3ZITA 4X0XA 2MBSA 1B48A 5A5HA 1TK5B 2XBQA 5JWRB 5ECHB 2GGTA 4HOJA 4K0GA 4F9ZA 4O7HA 2K18A 5IMZA 1GTUA 3GH9A 11GSA 1ON4A 2HZEA 1IYHA 1TI1A 3L9SA 1SKRB 2CQ9A 3O3TA 5CRWA 4NPBA 3A2VA 3ZVJA 4AKIA 5KN1A 3Q6OA 3UARA 5A1NB 1TK8B 1YVLA 5ELGA 3KM6A 2QGVA 4EIPA 3GH6A 3D21A 2H1LA 3GURA 4OD7A 12GSA 1N2AA 3PGTA 4P3YB 3M8NA 1EEJA 2O87A 1V57A 4FYUA 4JR4A 3UOMA 3ME8A 4TR1A 1PQNA 2KHPA 4EDYA 1DE1A 5ECMB 2IWTA 4MH3A 4EVMA 1UC7A 1O8WA 4IP1A 2DLXA 2P5QA 2P5RA 3VPQA 4N11A 1AQWA 4JBBA 8GSSA 5F07A 3EU4A 1ACVA 3ZZXA 4PXOA 4KAEA 5G5FA 4KH7A 1GSFA 3PPUA 3F9UA 5CRGA 2GTUA 1M0UA 1OVNA 2MMAA 1YQ1A 2H0GA 5J3RA 3L9UA 3QOUA 2WVXA 1MDKA 2IN3A 1O6JA 5DBQA 3EMXA 2LTKA 4KX4A 5KN0A 2WCIA 5JCUA 2FCHA 1EWXA 3GKNA 4MPFA 4WF5A 1XWAA 3H79A 2H6ZA 2YJ7A 2V32A 3DRNA 1A2MA 4EXJA 4DVCA 4N0VA 4IQ1A 5AISA 2B1KA 4MF5A 1PN9A 4XS1A 2RUFA 2I81A 4KSMA 3M9KA 3TKSE 1O85A 2FUG2 4TOPA 2J9HA 4L8EA 4E8EA 3CBUA 4G2EA 4CY6A 1URMA 2H8LA 3TKSC 3M3MA 1XWCA 2HSHA 1E6BA 5EY6A 1SENA 3EYTA 1PA3A 2GSRA 2RIIA 1PN0A 1ZL9A 2KOKA 3HY2A 1GLQA 2C4JA 3UBKA 1YY7A 1J08A 1LJRA 4XTSA 3F3RA 2JSZA 3DKSA 3APQA 4JZQA 3LFLA 1WWJA 5C04A 4FXYP 3ZIJA 3GSTA 3RFRC 4XRDA 4BL7A 4EC0A 1I5GA 1FOHA 5ECLB 3GA4A 1YF1A 3HYPA 4K2XA 3VI5A 5B8BA 5JCGA 1NHOA 2R6KA 3VI7A 4K7IA 3KMOA 4MMMA 3FK8A 4GRFA 2REMA 2L5LA 1TP9A 3QMXA 3HHVA 3VWVA 2H72A 1PGTA 5IOXA 3EE2A 3D6IA 4BVXB 2FNOA 4NWYA 4HS1A 1WPIA 1BAYA 1XOAA 3UVTA 3I9V2 4ZL9A 4ZXGA 2AB6A 3MAKA 1EOGA 4IBPA 1Z6NA 1R26A 3PINA 2JADA 1X9SB 4BWSA 1ZYPA 4MH2A 3VWWA 1ST9A 3TJGA 1AQXA 5ABRA 4KCAA 3F8UA 1M2BA 4HUAA 4EDZA 2P31A 1GP1A 1QGVA 5B7CA 2K9FA 4TXVA 1EP8A 3HJMA 3FR3A 4V1Ag 2YCDA 22GSA 3L78A 4JEDA 2M80A 2OT3A 3LXTA 1M99A 1PD21 2MMNA 4CY8A 2HI7A 2HQTA 2FWHA 1LBKA 4ZB7A 2DKHA 2XHFA 1G6WA 1X5CA 4NV5A 3IAM2 3KCMA 4AGSA 1EGRA 4TR0A 5ELAA 1ERWA 2X8HA 3ZFBA 3SWLA 5ECKB 2H74A 1CQGA 5J41A 4TVEA 4H86A 5B8AA 3DD3A 2VAFA 4POLA 4WR4A 6GSUA 4HQSA 1OKTA 3FKFA 2WVZA 2CZ3A 1T00A 1WP0A 2IL3A 5A34B 2FGXA 4K8MA 5HQPA 3F0IA 1XXUA 4DSSA 1AC1A 2LJKA 4QL7A 4F2IA 4ZL7A 1SVLA 5FWGA 2V2GA 4KW6A 5HR3A 4JR6A 2OA7A 1MD3A 2WULA 2LRTA 1BEDA 3FHKA 3KJYA 3GKMA 4K5RA 4WXTA 3TCOA 2LS5A 1N8JA 4NAXA 5GAPD 4I6XA 2BJXA
chains in the Genus database with same CATH topology
2OACA 1Q98A 1AXDA 2C0EA 2HFDA 4ZILA 2MBTA 2DC5A 5HFGA 3QDNA 5AIXA 5DAKB 3GHAA 1VGLA 1SK2A 2LRNA 3C7MA 4D73B 4BVYB 3HMJG 1WRYA 1A2LA 4MP4A 4ISDA 2EFCA 3NIVA 4USSA 16GSA 4MF7A 1A8LA 4IQAA 3M1GA 1C72A 1JZWA 3ZMKA 4NHZA 4KCEA 4LLRA 3WD6A 4HEA2 4KB3A 3W6GA 1SKWB 1UVZA 3KGKA 4AKGA 3UL3A 5D9VA 5H5RA 4HU7A 2F8AA 4E68A 2VLTA 3DEXA 2X64A 2LNSA 1M7TA 2DJKA 2HSMA 1XVQA 2H1GA 3GIXA 3IK7A 4MJAA 4X43A 3Q19A 5DALA 4V2LA 2HE3A 5F8BA 3KH9A 4YQVA 3BOAA 4TXOA 5H5QA 2I4AA 1WIKA 5LD0A 3E3EA 5IMFA 3WGEA 4MCUA 1TKDB 1TTZA 1V2AA 1GSDA 2QC7A 1EZKA 4KSOA 2N5FA 4MLYA 3FEUA 3KP9A 4HJ2A 3EC3A 1FHEA 3L4NA 3VWXA 5CRHA 1RW1A 4L5OA 2ALBA 3UAPA 4Z7XA 4AKHA 3J7Yb 2C0DA 2QSIA 4KDXA 1QFNA 2CT6A 1MDJA 4RQRA 4TW5A 3EMPA 3RPNA 1VF3A 2BMXA 1ZYQB 1XWKA 1K0AA 1T4ZA 4PNFA 3V1WA 3LYKA 2H1DA 3BD2A 2FA8A 1YF0A 2H01A 4TR4A 3IC4A 5A4WA 2GQLA 2VUPA 3TJFA 2QA1A 1S3DA 1K0MA 4YKFA 5HR0A 3O76A 1K0NA 3OR5A 1ILOA 4Q5RA 1G6YA 1AIUA 2CX4A 1OC3A 4Q5NA 3LEFA 3IC8A 4Q5FA 3LJRA 2L6DA 2KUCA 5A5HB 2L57A 1R5AA 7GSSA 4NMUA 3RAZA 1ZGNA 4KDYA 3O6TA 2L4CA 1Z3EA 3AY8A 3TRPA 4V2NA 2VLUA 17GSA 1ZCPA 2HZEB 4AJ7A 2H73A 2VKZG 5IOWA 4ZB8A 1SL2B 2R4VA 2H70A 2TIRA 2DSAA 2H0IA 1UN2A 6GSWA 1ZMAA 1GH2A 2GSTA 4QMKA 5CNWA 4N10A 5F05A 3GX8A 3D5JA 1A0RP 2ZNMA 4ZBAA 2NPBA 1FAAA 2DMMA 1THXA 3I69A 1XWGA 6GSVA 1TRVA 4DEJA 3Q18A 2YOIA 3HKRA 1T8EB 3E0UA 3TDGA 1GWCA 5DQSA 4OO5A 1IYIA 4TR1B 2BTOT 1GSEA 2VD1A 3CSJA 2L4QA 1SYXA 2VM1A 1MTCA 4WKWA 1HQOA 3DWVA 1YEXA 1PMTA 5FHIA 3GTUA 3H93A 5G30A 2VD0A 5BMUA 4GSSA 4E8HA 4POKA 3FMWA 1HNAA 1T1VA 2V41A 2HYXA 3DVWA 3GKXA 3TKSA 1K3LA 1SK1A 2R0PA 4RQXA 3D0ZA 1V98A 5JWOB 5BRTA 3G7IA 1V40A 2R0GA 5J9BA 2OE1A 5J47A 3PH9A 3ERGA 2B5YA 1XW9A 1HYUA 3HVSA 3G7JA 3GFKA 3LXZA 1U88A 3F6FA 3F4RA 3WYWA 3HVXA 2IMEA 3TOTA 3CMIA 2H1AA 2XPDA 1H75A 1FG4A 4TN8A 3RBTA 1FB6A 3WGXA 1GUHA 1GSUA 2H76A 2H6YA 6GSXA 1YJ6A 2FA4A 2A4HA 1U3IA 2PWJA 3UEMA 3N9JA 2GVPA 1FVJA 3UBLA 1SYRA 1JZRA 5J4UA 5DVBA 4AJ8A 4QQ7A 1JZOA 1OC8A 2EIRA 1R7HA 1SL0B 1GLPA 3UMAA 1SJIA 3K8NA 2A2PA 2EC4A 5GSSA 2YV9A 4TR3A 3TJJA 3IPZA 4TKYA 2LNTA 1BQ7A 1F9MA 2EIOA 1TRSA 4HI7A 3NOFA 3EINA 1GUKA 4OFNA 5E59A 3ZIVA 2H6XA 3H1NA 4OO4A 4ECBA 3F63A 2V6OA 1OE7A 2C80A 1EEMA 4DSQA 2HZFA 3FW2A 2GZZA 4ILFA 4AF2A 4OFTA 5ECSA 3PR8A 1ERVA 4HQZA 2A4VA 5IO2A 3UVHA 2DJ2A 5DJMA 1JFUA 4IP6A 2VLVA 5CAXA 2E0QA 1PX7A 1XCCA 18GSA 2VM2A 3LWAA 1AQVA 3GKKA 1DBYA 2HRAA 3ZFLA 1SU9A 2JL4A 19GSA 1H4OA 3GNJA 4K9ZA 2AV4A 1GTBA 1WMJA 1GUMA 4ZB6A 3ZTLA 2KP1A 3KTLA 4GSTA 4IJ3A 2PBJA 4F03A 5COHA 4MZBA 1B9XC 14GSA 4AJ6A 4MK3A 4A5PA 3WT1A 1XIYA 1MD4A 1Z7RA 4MPGA 2J23A 3VLNA 4ECJA 3QFAC 2LQOA 5KOWA 2F3MA 5INYA 1F37A 1Y6EA 3HD5A 5G2ZA 1G7OA 2VL2C 2V1MA 5GZZB 2C3QA 1O7UA 5HR2A 4ML1A 3DIEA 1OYJA 2HSNA 1OKDA 2M46A 3FYGA 4RI7A 4GWRA 1PX6A 5DDLA 2WGRA 3LG6A 1XOBA 3HJPA 3HZ8A 4WF4A 2YJHA 2DJJA 4MJEA 1DUGA 2FLSA 4J57E 4IGJA 1Z7PA 4L0UA 4PGTA 2PVQA 4WBRD 1Z5YE 2C3TA 3WT2A 4LL1B 3TRQA 5IPHA 2PMTA 3IOSA 4DSSB 5G1KA 1GSYA 3RHBA 5B6NA 2LKUA 1GNWA 4BVXA 3GL3A 5IQYA 5CRDA 2DIZA 2VCTA 1A8YA 3KZQA 2HRNA 2R37A 3GSSA 3CTFA 1M2DA 2LUSA 2OBKA 2IPAA 5ECOB 3FRCA 4ID0A 4G10A 1TRUA 4PQ1A 3FR6A 5CP1A 5KEJA 3D4MA 2ON5A 2FWFA 5DJLA 3G7YA 4GF0A 4IS0A 1BYEA 2CAIA 2EFDA 3ISOA 3CSHA 4GLTA 3QAWA 3CRUA 2C3NA 2LJAA 3HDCA 1U87A 3IRAA 3TJKA 1I9DA 1B4QA 2RM5A 1THOA 4F0BA 1VRSD 2IFQB 2UZ8A 5J4VA 3EWLA 3QAGA 1GTAA 1JLWA 2H66A 3VFIA 1K3YA 1W4VA 3CYNA 4PUAA 9GSSA 4RUVA 2B7JA 1TDIA 1TXXA 2O5VA 5EPFA 4K5SA 3KIJA 4GQCA 3VURA 5A34A 5ENUA 1USBA 2MYGA 1AAZA 5ECQB 2X99A 4WETA 3UIWA 3F3QA 2GT5A 2LJRA 5DALB 2C0FA 3L0HA 2WJUA 4N3ZA 1XBSA 2MMOA 1SVMA 2CVKA 3HVVA 5D8IA 5LCZA 2GSSA 4YAPA 3U5RE 4O5UA 2VCQA 2IMIA 2DJ0A 2O89A 1ZOFA 2A2RA 4G0KA 2KLXA 4NHWA 4EF0A 1TW9A 2RUEA 5IMAA 2YNXA 5KOXA 2GT6A 4IJIA 1T4YA 4EIQA 3VWUA 2WB9A 4LMVA 5G5EA 3WGDA 5GSTA 4POMA 2YWMA 3BBYA 5EL8A 2E2GA 4XRAA 5FT3A 1DE2A 2YN1A 3GX0A 4ZIJA 4W66A 3Q74A 2FY6A 4KF9A 2OE0A 4PTSA 2MZCA 3C1RA 1W89A 3JCML 2CX3A 1GSSA 4ICYA 2DBCA 1YDKA 3MWHA 4RI6A 1OAZA 4ULXA 4G19A 4ECCA 1FW1A 2K8SA 3TGZA 5A4UA 1WE0A 2F8FA 3GV1A 2DKIA 5IMCA 1BX9A 2HRKA 2RM6A 1G7EA 5GAND 1SKSB 5ID2A 1SJZA 4OFMA 3I43A 1OC9A 2JZRA 1M9AA 3LYPA 2AUVA 4K0NA 2DMLA 4YAVA 3A2WA 5D9XA 1HNCA 2NDOA 3KP8A 5ECNB 2GZPA 1K0BA 2DIYA 4O5QA 3CSIA 2R2JA 1CQHA 3A2XA 3HXSA 2LSTA 1V9WA 4BWQA 2JU5A 2X8GA 2GZYA 2H30A 5CYYA 4OMVA 1PKWA 4F82A 1R4WA 4BPYA 2HRFA 1XFLA 4ZL8A 2L5OA 1QQ2A 2PVOC 5AIVA 1OE8A 1TU8A 4I8BA 2WRTA 4XS4A 6GSSA 3A5IA 3RPPA 2CVBA 2H71A 1GSQA 3IV4A 4OWYA 1B9YC 1MDIA 1U3AA 4YKGA 4LA1A 4ZBBA 2VOCA 6GSYA 4WR5A 2A2SA 4PNGA 5D96A 2LEGA 4EUYA 4PURA 3MNGA 4AKXB 3ZL5A 5F06A 2IMDA 4HZ2A 4YH2A 1T3BA 2YANA 3MIXA 4YQMA 4KGIA 3LSZA 4HDEA 1YKCA 2F51A 5G1LA 3ZREA 1F2EA 2AAWA 1ERTA 3D4TA 1B4PA 5KN3A 4IVFA 5DQYA 4GTUA 4Z2UA 1Y1UA 3CXGA 3KXOA 1F3AA 1XW6A 3IHGA 3RDWA 5HR1A 2VCZA 2XPEA 3MDKA 2HSYA 4XIHA 4I2TA 2YZUA 5H5SA 5J9CA 2UV8G 2YZHA 4X1UA 5ECRB 2GSQA 4GDFA 1HD2A 1TK0B 2ON7A 2G0FA 1BJXA 1AUCA 5IO0A 1SJ6A 3TKPA 3H4KA 3DMLA 3MSZA 3P2AA 4PQHA 3ME7A 1SD9A 1JZDA 4HZ4A 2VCWA 3QAVA 1A23A 1ZYEA 2TRCP 2L59A 3D22A 4PUFC 3M0FA 3VK9A 4G01A 2MMZA 4F0CA 2GQMA 4KE3A 4GCIA 1EGOA 2QKEA 3TB2A 1NSWA 5CO3A 4N0ZA 3TKQA 2NTOA 5EVOA 5IMDA 3FZ4A 3ERWA 3F4SA 4G0LA 1S3AA 4FYCA 5A1NA 1FB0A 3ERFA 4EO3A 3IDVA 4L5LA 1MEKA 2VCXA 4FQUA 2CAQA 1T7PB 4Z2RA 3CWGA 2VL2A 2B7KA 1K0CA 2O85A 3EPTA 2CZ2A 1GNEA 2GDRA 4O92A 3IE3A 4JE1A 3KEBA 4MA9A 1XVWA 3R3EA 1ML6A 4BL7B 4XHMA 2X8CA 4ZB9A 4XS6A 3VPTA 2VL3A 3DXBA 2I3YA 2GQKA 1QK8A 4MABA 2VCVA 1Z6MA 2D2ZA 2C8UA 1G0TA 2YP6A 3P90A 3TUEA 2V6KA 4K6XA 2B5XA 2LQQA 3TRXA 4X4JA 4N30A 3R2QA 1EV9A 2E7PA 2K8VA 5CREA 2XBIA 2CA8A 3CTGA 3W8JA 2LV3A 2WS2A 4JRRA 1SK0A 1ZYNA 4I2UA 2JSYA 2R5GA 5G31A 2ZCTA 3KTBA 2HSNB 3LGCA 2XC2A 1VF2A 2B6MA 2F9SA 2PGTA 1TXUA 2YWOA 3DGQA 3FR9A 2H19A 1F6MC 2EIQA 2JZSA 5AN1A 5A5KA 3LW9A 1PSQA 4OCFA 5E4WA 3DYRA 2FD3A 3MYDA 1SD8A 1DSBA 4O5RA 3ED3A 4KDUA 2WFCA 2OJLA 2CVDA 1LU4A 2KP2A 5D9TA 4HJMA 2H75A 3QD9A 4GXZA 3RHCA 2C1YA 4EKZA 3M9JA 1KEBA 2PU9C 3IAS2 2AYTA 3US3A 4ACSA 5LNKe 2DJ1A 4J2FA 1KTEA 1TI3A 5JWQB 3FZ9A 2OBIA 5D9WA 2YPMA 3U6VA 1Q4JA 3G9BA 4AI6A 4YQUA 2HT9A 3EURA 2YWNA 1O81A 1WOUA 2X49A 3IXRA 1RK4A 4I97A 3IK9A 2Z9SA 4IKHA 4MNNA 6GSTA 5HFIA 2PN8A 3IHQA 1O73A 1GULA 1QXHA 5IPGA 5DCHA 1B8XA 1NM3A 4K7OA 1ZZYA 2LRCA 1PKZA 2DJ3A 1TJDA 3W8SA 1XWBA 3GRXA 4WBJA 4GSNA 1XW5A 2GS3A 3GYKA 4FO5A 2O7KA 1BF5A 2OADA 4K7NA 1GRXA 4EE0A 1YZXA 2R0CA 2B5EA 1FVKA 2WZ9A 3J7Yk 4IN0A 2YV7A 2ES7A 1BG5A 3KH7A 1A24A 1N25A 3LORA 1A2JA 5IMVA 1PL1A 4FH8A 2AJQB 1EOHA 3IA1A 4FYBA 1U6TA 5ECPB 2IMKA 4LL4B 1R5PA 4POBA 3HCZA 3BJ5A 3KMNA 5IM9A 2AHEA 3HJOA 5B6MA 2N5AA 2I1UA 1M9BA 3E9JB 1QUWA 2B1LA 3S9FA 2N5BA 4PQIA 3CRTA 4K1FA 2L6CA 3QR6A 4NV2A 2P0GA 13GSA 4GQFA 1V58A 3FZAA 4ZBDA 4PX1A 3IR4A 1GL8A 4G0IA 4V1Ap 4ECIA 5A4VA 2B3SA 2IJYA 3ZRDA 2HNLA 1RQMA 3EU3A 1X9WB 3I6AA 2NVLA 3APSA 4MJCA 10GSA 4MDCA 2HSMB 3A3TA 4Z2TA 2FWGA 3ZLPA 4JU5A 1PRXA 2H1BA 3IBHA 4MF6A 2ZUPA 3BCIA 4EL1A 1EP7A 4TXOB 3H8QA 4KA0A 4TRXA 2IIYA 3HZ4A 1KNGA 2VO4A 2IFQA 1AW9A 5J4YA 2FHEA 2E2MA 1UA5A 2YWIA 2QA2A 4HU9A 4G9HA 5J40A 1WJKA 5C00A 1ABAA 4MZCA 2JACA 2HRKB 2RLIA 3QCPA 1GTIA 5F0GA 5DAKA 5ID2B 5DCGA 1Z9HA 1OC9B 1EV4A 2HLSA 4XCSA 2X4AA 2C0GA 4CDOA 2NBSA 4BVYA 1S3CA 4D73A 1A0FA 2PPTA 1Y25A 1NW2A 1BG1A 1K0DA 1VF4A 4Q5QA 3C8EA 4NXIA 3HA9A 4BA7A 1SVOA 5JCWA 2VL9A 4CHSA 5IIZA 4K2DA 3EVIA 3NZNA 2JZTA 1SL1B 5D93A 2IMFA 2M72A 3BCKA 3C73A 4FIWA 3L9VA 2I9HA 1YKAA 1FOVA 3A5WA 5J5NA 1KBNA 3FZ5A 4CW9A 1XPVA 2G2QA 1XZOA 2K6VA 3C71A 5D73A 4XS4B 4O32A 2CV4A 2WDUA 1ERUA 3SBCA 2OE3A 1J0FA 1J9BA 3P7XA 2HXKA 1NHYA 4IELA 3TOUA 3GUSA 3C1SA 3TU3B 2GLRA 3QFBC 3GMFA 1YEPA 2VIMA 3DVXA 1PL2A 5KN2A 1F3BA 1JLVA 3F4TA 2TRXA 5HFKA 1QMVA 4ML6A 1X9MB 5L71A 1VF1A 1K3OA 2EFHA 3FY7A 4J56E 3ZMLA 1TRWA 4WEYA 3TJBA 3P8WA 2PUKC 2EFEA 3F6DA 1E2YA 3ZVJD 1FO5A 5AGYA 1HNBA 1TU7A 4KUNA 2R3XA 5ECIB 3TKRA 4I5QA 4L0WA 3GTUB 3N5OA 5BMUB 3LQ7A 4V2MA 3ZYWA 1O8XA 2FWEA 4LMWA 2O8VB 4QL9A 4OCEA 3KD0A 2PERA 1X5DA 3APOA 4DSRA 2H0HA 3GL5A 1TOFA 4MZWA 20GSA 1X0RA 1JHBA 2OKAA 3QPMA 3GN3A 4KNDA 1K0OA 4IW9A 1X5EA 1M2AA 3UJ1A 4IHUA 4MJBA 3ZITA 4X0XA 2MBSA 1B48A 5A5HA 1TK5B 2XBQA 5JWRB 5ECHB 2GGTA 4HOJA 4K0GA 4F9ZA 4O7HA 2K18A 5IMZA 1GTUA 3GH9A 11GSA 1ON4A 2HZEA 1IYHA 1TI1A 3L9SA 1SKRB 2CQ9A 3O3TA 5CRWA 4NPBA 3A2VA 3ZVJA 4AKIA 5KN1A 3Q6OA 3UARA 5A1NB 1TK8B 1YVLA 5ELGA 3KM6A 2QGVA 4EIPA 3GH6A 3D21A 2H1LA 3GURA 4OD7A 12GSA 1N2AA 3PGTA 4P3YB 3M8NA 1EEJA 2O87A 1V57A 4FYUA 4JR4A 3UOMA 3ME8A 4TR1A 1PQNA 2KHPA 4EDYA 1DE1A 5ECMB 2IWTA 4MH3A 4EVMA 1UC7A 1O8WA 4IP1A 2DLXA 2P5QA 2P5RA 3VPQA 4N11A 1AQWA 4JBBA 8GSSA 5F07A 3EU4A 1ACVA 3ZZXA 4PXOA 4KAEA 5G5FA 4KH7A 1GSFA 3PPUA 3F9UA 5CRGA 2GTUA 1M0UA 1OVNA 2MMAA 1YQ1A 2H0GA 5J3RA 3L9UA 3QOUA 1MDKA 2IN3A 1O6JA 5DBQA 3EMXA 2LTKA 4KX4A 5KN0A 2WCIA 5JCUA 2FCHA 1EWXA 3GKNA 4MPFA 4WF5A 1XWAA 3H79A 2H6ZA 2YJ7A 2V32A 3DRNA 1A2MA 4EXJA 4DVCA 4N0VA 4IQ1A 5AISA 2B1KA 4MF5A 1PN9A 4XS1A 3M9KA 2RUFA 4KSMA 2I81A 3TKSE 1O85A 2FUG2 4TOPA 2J9HA 4L8EA 4E8EA 3CBUA 4G2EA 4CY6A 1URMA 2H8LA 3TKSC 3M3MA 1XWCA 2HSHA 1E6BA 5EY6A 1SENA 3EYTA 1PA3A 2GSRA 2RIIA 1PN0A 1ZL9A 2KOKA 3HY2A 1GLQA 2C4JA 3UBKA 1YY7A 1J08A 1LJRA 4XTSA 3F3RA 2JSZA 3DKSA 3APQA 4JZQA 3LFLA 1WWJA 5C04A 3ZIJA 3GSTA 4XRDA 4BL7A 4EC0A 1I5GA 1FOHA 5ECLB 3GA4A 1YF1A 3HYPA 4K2XA 3VI5A 5B8BA 5JCGA 1NHOA 2R6KA 3VI7A 4K7IA 3KMOA 4MMMA 3FK8A 4GRFA 2REMA 2L5LA 1TP9A 3QMXA 3HHVA 3VWVA 2H72A 1PGTA 5IOXA 3EE2A 3D6IA 4BVXB 2FNOA 4NWYA 4HS1A 1WPIA 1BAYA 1XOAA 3UVTA 3I9V2 4ZL9A 4ZXGA 2AB6A 3MAKA 1EOGA 4IBPA 1Z6NA 1R26A 3PINA 2JADA 1X9SB 4BWSA 1ZYPA 4MH2A 3VWWA 1ST9A 3TJGA 1AQXA 5ABRA 4KCAA 3F8UA 1M2BA 4HUAA 4EDZA 2P31A 1GP1A 1QGVA 5B7CA 2K9FA 4TXVA 1EP8A 3HJMA 3FR3A 4V1Ag 2YCDA 22GSA 3L78A 4JEDA 2M80A 2OT3A 3LXTA 1M99A 1PD21 2MMNA 4CY8A 2HI7A 2HQTA 2FWHA 1LBKA 4ZB7A 2DKHA 2XHFA 1G6WA 1X5CA 4NV5A 3IAM2 3KCMA 4AGSA 1EGRA 4TR0A 5ELAA 1ERWA 2X8HA 3ZFBA 3SWLA 5ECKB 2H74A 1CQGA 5J41A 4TVEA 4H86A 5B8AA 3DD3A 2VAFA 4POLA 4WR4A 6GSUA 4HQSA 1OKTA 3FKFA 2CZ3A 1T00A 1WP0A 2IL3A 5A34B 2FGXA 4K8MA 5HQPA 3F0IA 1XXUA 4DSSA 1AC1A 2LJKA 4QL7A 4F2IA 4ZL7A 1SVLA 5FWGA 2V2GA 4KW6A 5HR3A 4JR6A 2OA7A 1MD3A 2WULA 2LRTA 1BEDA 3FHKA 3KJYA 3GKMA 4K5RA 4WXTA 3TCOA 2LS5A 1N8JA 4NAXA 5GAPD 4I6XA 2BJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OAC A;  1Q98 A;  1AXD A;  2C0E A;  2HFD A;  4ZIL A;  2MBT A;  2DC5 A;  5HFG A;  3QDN A;  5AIX A;  5DAK B;  3GHA A;  1VGL A;  1SK2 A;  2LRN A;  3C7M A;  4D73 B;  4BVY B;  1WRY A;  1A2L A;  4MP4 A;  4ISD A;  3NIV A;  4USS A;  16GS A;  4MF7 A;  1A8L A;  4IQA A;  3M1G A;  1C72 A;  1JZW A;  3ZMK A;  4NHZ A;  4KCE A;  4LLR A;  3WD6 A;  4HEA 2;  4KB3 A;  3W6G A;  1SKW B;  1UVZ A;  3KGK A;  3UL3 A;  5D9V A;  5H5R A;  4HU7 A;  2F8A A;  2VLT A;  3DEX A;  2X64 A;  2LNS A;  1M7T A;  2DJK A;  2HSM A;  1XVQ A;  2H1G A;  3GIX A;  3IK7 A;  4MJA A;  4X43 A;  3Q19 A;  5DAL A;  4V2L A;  2HE3 A;  5F8B A;  3KH9 A;  4YQV A;  3BOA A;  4TXO A;  5H5Q A;  2I4A A;  1WIK A;  5LD0 A;  3E3E A;  5IMF A;  3WGE A;  4MCU A;  1TKD B;  1TTZ A;  1V2A A;  1GSD A;  2QC7 A;  1EZK A;  4KSO A;  2N5F A;  4MLY A;  3FEU A;  3KP9 A;  4HJ2 A;  3EC3 A;  1FHE A;  3L4N A;  3VWX A;  5CRH A;  1RW1 A;  4L5O A;  2ALB A;  3UAP A;  4Z7X A;  3J7Y b;  2C0D A;  2QSI A;  4KDX A;  1QFN A;  2CT6 A;  1MDJ A;  4RQR A;  4TW5 A;  3EMP A;  3RPN A;  1VF3 A;  2BMX A;  1ZYQ B;  1XWK A;  1K0A A;  1T4Z A;  4PNF A;  3V1W A;  3LYK A;  2H1D A;  3BD2 A;  2FA8 A;  1YF0 A;  2H01 A;  4TR4 A;  3IC4 A;  5A4W A;  2GQL A;  2VUP A;  3TJF A;  1S3D A;  1K0M A;  5HR0 A;  3O76 A;  1K0N A;  3OR5 A;  1ILO A;  4Q5R A;  1G6Y A;  1AIU A;  2CX4 A;  1OC3 A;  4Q5N A;  3LEF A;  3IC8 A;  4Q5F A;  3LJR A;  2L6D A;  2KUC A;  2L57 A;  1R5A A;  7GSS A;  4NMU A;  3RAZ A;  1ZGN A;  4KDY A;  3O6T A;  2L4C A;  1Z3E A;  3AY8 A;  3TRP A;  4V2N A;  2VLU A;  17GS A;  1ZCP A;  2HZE B;  4AJ7 A;  2H73 A;  5IOW A;  4ZB8 A;  1SL2 B;  2R4V A;  2H70 A;  2TIR A;  2DSA A;  2H0I A;  1UN2 A;  6GSW A;  1ZMA A;  1GH2 A;  2GST A;  5CNW A;  4N10 A;  5F05 A;  3GX8 A;  3D5J A;  1A0R P;  2ZNM A;  4ZBA A;  2NPB A;  1FAA A;  2DMM A;  1THX A;  3I69 A;  1XWG A;  6GSV A;  1TRV A;  4DEJ A;  3Q18 A;  2YOI A;  3HKR A;  1T8E B;  3E0U A;  3TDG A;  1GWC A;  5DQS A;  4OO5 A;  1IYI A;  4TR1 B;  2BTO T;  1GSE A;  2VD1 A;  3CSJ A;  2L4Q A;  1SYX A;  2VM1 A;  1MTC A;  4WKW A;  1HQO A;  3DWV A;  1YEX A;  1PMT A;  5FHI A;  3GTU A;  3H93 A;  5G30 A;  2VD0 A;  5BMU A;  4GSS A;  4E8H A;  4POK A;  1HNA A;  1T1V A;  2V41 A;  2HYX A;  3DVW A;  3GKX A;  3TKS A;  1K3L A;  1SK1 A;  4RQX A;  3D0Z A;  1V98 A;  5JWO B;  3G7I A;  1V40 A;  5J9B A;  2OE1 A;  3PH9 A;  3ERG A;  2B5Y A;  1XW9 A;  1HYU A;  3HVS A;  3G7J A;  3GFK A;  3LXZ A;  1U88 A;  3F6F A;  3F4R A;  3WYW A;  3HVX A;  2IME A;  3TOT A;  3CMI A;  2H1A A;  2XPD A;  1H75 A;  1FG4 A;  4TN8 A;  3RBT A;  1FB6 A;  3WGX A;  1GUH A;  1GSU A;  2H76 A;  2H6Y A;  6GSX A;  1YJ6 A;  2FA4 A;  1U3I A;  2PWJ A;  3UEM A;  3N9J A;  2GVP A;  1FVJ A;  3UBL A;  1SYR A;  1JZR A;  5J4U A;  5DVB A;  4AJ8 A;  4QQ7 A;  1JZO A;  1OC8 A;  2EIR A;  1R7H A;  1SL0 B;  1GLP A;  3UMA A;  1SJI A;  3K8N A;  2EC4 A;  5GSS A;  2YV9 A;  4TR3 A;  3TJJ A;  3IPZ A;  4TKY A;  2LNT A;  1BQ7 A;  1F9M A;  2EIO A;  1TRS A;  4HI7 A;  3NOF A;  3EIN A;  1GUK A;  4OFN A;  5E59 A;  3ZIV A;  2H6X A;  3H1N A;  4OO4 A;  4ECB A;  3F63 A;  2V6O A;  1OE7 A;  2C80 A;  1EEM A;  4DSQ A;  2HZF A;  3FW2 A;  2GZZ A;  4ILF A;  4AF2 A;  4OFT A;  5ECS A;  3PR8 A;  1ERV A;  4HQZ A;  2A4V A;  5IO2 A;  3UVH A;  2DJ2 A;  5DJM A;  1JFU A;  4IP6 A;  2VLV A;  5CAX A;  2E0Q A;  1PX7 A;  1XCC A;  18GS A;  2VM2 A;  3LWA A;  1AQV A;  3GKK A;  1DBY A;  2HRA A;  3ZFL A;  1SU9 A;  2JL4 A;  19GS A;  1H4O A;  3GNJ A;  4K9Z A;  2AV4 A;  1GTB A;  1WMJ A;  1GUM A;  4ZB6 A;  3ZTL A;  2KP1 A;  3KTL A;  4GST A;  4IJ3 A;  2PBJ A;  4F03 A;  5COH A;  4MZB A;  1B9X C;  14GS A;  4AJ6 A;  4MK3 A;  3WT1 A;  1XIY A;  1MD4 A;  1Z7R A;  4MPG A;  2J23 A;  3VLN A;  4ECJ A;  3QFA C;  2LQO A;  2F3M A;  5INY A;  1F37 A;  1Y6E A;  3HD5 A;  5G2Z A;  1G7O A;  2VL2 C;  2V1M A;  5GZZ B;  2C3Q A;  1O7U A;  5HR2 A;  4ML1 A;  3DIE A;  1OYJ A;  1OKD A;  2M46 A;  3FYG A;  4RI7 A;  4GWR A;  1PX6 A;  5DDL A;  2WGR A;  3LG6 A;  1XOB A;  3HJP A;  3HZ8 A;  4WF4 A;  2YJH A;  2DJJ A;  4MJE A;  1DUG A;  2FLS A;  4J57 E;  4IGJ A;  1Z7P A;  4L0U A;  4PGT A;  2PVQ A;  4WBR D;  1Z5Y E;  2C3T A;  3WT2 A;  4LL1 B;  3TRQ A;  5IPH A;  2PMT A;  3IOS A;  4DSS B;  5G1K A;  1GSY A;  3RHB A;  5B6N A;  2LKU A;  1GNW A;  4BVX A;  3GL3 A;  5IQY A;  5CRD A;  2DIZ A;  2VCT A;  1A8Y A;  3KZQ A;  2HRN A;  2R37 A;  3GSS A;  3CTF A;  1M2D A;  2LUS A;  2OBK A;  2IPA A;  5ECO B;  3FRC A;  4ID0 A;  4G10 A;  1TRU A;  4PQ1 A;  3FR6 A;  5CP1 A;  5KEJ A;  3D4M A;  2ON5 A;  2FWF A;  5DJL A;  3G7Y A;  4GF0 A;  4IS0 A;  1BYE A;  2CAI A;  3ISO A;  3CSH A;  4GLT A;  3QAW A;  3CRU A;  2C3N A;  2LJA A;  3HDC A;  1U87 A;  3IRA A;  3TJK A;  1I9D A;  1B4Q A;  2RM5 A;  1THO A;  4F0B A;  1VRS D;  2IFQ B;  2UZ8 A;  3EWL A;  3QAG A;  1GTA A;  1JLW A;  2H66 A;  3VFI A;  1K3Y A;  1W4V A;  3CYN A;  4PUA A;  9GSS A;  4RUV A;  2B7J A;  1TDI A;  1TXX A;  5EPF A;  3KIJ A;  4GQC A;  3VUR A;  5ENU A;  1USB A;  2MYG A;  1AAZ A;  5ECQ B;  2X99 A;  4WET A;  3UIW A;  3F3Q A;  2GT5 A;  2LJR A;  5DAL B;  2C0F A;  3L0H A;  2WJU A;  1XBS A;  2MMO A;  2CVK A;  3HVV A;  5D8I A;  5LCZ A;  2GSS A;  4YAP A;  3U5R E;  2VCQ A;  2IMI A;  2DJ0 A;  2O89 A;  1ZOF A;  2A2R A;  4G0K A;  2KLX A;  4NHW A;  4EF0 A;  1TW9 A;  2RUE A;  5IMA A;  2YNX A;  2GT6 A;  4IJI A;  1T4Y A;  3VWU A;  2WB9 A;  4LMV A;  5G5E A;  3WGD A;  5GST A;  4POM A;  2YWM A;  3BBY A;  5EL8 A;  2E2G A;  4XRA A;  5FT3 A;  1DE2 A;  2YN1 A;  3GX0 A;  4ZIJ A;  3Q74 A;  2FY6 A;  4KF9 A;  2OE0 A;  4PTS A;  2MZC A;  3C1R A;  1W89 A;  3JCM L;  2CX3 A;  1GSS A;  2DBC A;  1YDK A;  3MWH A;  4RI6 A;  1OAZ A;  4ULX A;  4G19 A;  4ECC A;  1FW1 A;  2K8S A;  3TGZ A;  5A4U A;  1WE0 A;  2F8F A;  3GV1 A;  5IMC A;  1BX9 A;  2HRK A;  2RM6 A;  1G7E A;  5GAN D;  1SKS B;  5ID2 A;  1SJZ A;  4OFM A;  3I43 A;  1OC9 A;  2JZR A;  1M9A A;  3LYP A;  2AUV A;  4K0N A;  2DML A;  4YAV A;  3A2W A;  5D9X A;  1HNC A;  2NDO A;  3KP8 A;  5ECN B;  2GZP A;  1K0B A;  2DIY A;  3CSI A;  2R2J A;  1CQH A;  3A2X A;  3HXS A;  2LST A;  1V9W A;  4BWQ A;  2JU5 A;  2X8G A;  2GZY A;  2H30 A;  5CYY A;  4OMV A;  1PKW A;  4F82 A;  1R4W A;  4BPY A;  2HRF A;  1XFL A;  4ZL8 A;  2L5O A;  1QQ2 A;  2PVO C;  5AIV A;  1OE8 A;  1TU8 A;  4I8B A;  2WRT A;  4XS4 A;  6GSS A;  3RPP A;  2CVB A;  2H71 A;  1GSQ A;  3IV4 A;  4OWY A;  1B9Y C;  1MDI A;  1U3A A;  4LA1 A;  4ZBB A;  2VOC A;  6GSY A;  4WR5 A;  2A2S A;  4PNG A;  5D96 A;  2LEG A;  4EUY A;  4PUR A;  3MNG A;  3ZL5 A;  5F06 A;  2IMD A;  4HZ2 A;  4YH2 A;  1T3B A;  2YAN A;  4YQM A;  4KGI A;  3LSZ A;  4HDE A;  1YKC A;  2F51 A;  5G1L A;  3ZRE A;  1F2E A;  2AAW A;  1ERT A;  3D4T A;  1B4P A;  5KN3 A;  4IVF A;  5DQY A;  4GTU A;  3CXG A;  3KXO A;  1F3A A;  1XW6 A;  3RDW A;  5HR1 A;  2VCZ A;  2XPE A;  3MDK A;  2HSY A;  4XIH A;  4I2T A;  2YZU A;  5H5S A;  5J9C A;  2YZH A;  4X1U A;  5ECR B;  2GSQ A;  1HD2 A;  1TK0 B;  2ON7 A;  2G0F A;  1BJX A;  1AUC A;  5IO0 A;  1SJ6 A;  3TKP A;  3H4K A;  3DML A;  3MSZ A;  3P2A A;  4PQH A;  3ME7 A;  1SD9 A;  1JZD A;  4HZ4 A;  2VCW A;  3QAV A;  1A23 A;  1ZYE A;  2TRC P;  2L59 A;  3D22 A;  4PUF C;  3M0F A;  3VK9 A;  2MMZ A;  4F0C A;  2GQM A;  4KE3 A;  4GCI A;  1EGO A;  2QKE A;  3TB2 A;  1NSW A;  5CO3 A;  4N0Z A;  3TKQ A;  2NTO A;  5EVO A;  5IMD A;  3FZ4 A;  3ERW A;  3F4S A;  4G0L A;  1S3A A;  4FYC A;  1FB0 A;  3ERF A;  4EO3 A;  3IDV A;  4L5L A;  1MEK A;  2VCX A;  4FQU A;  2CAQ A;  1T7P B;  2VL2 A;  2B7K A;  1K0C A;  2O85 A;  2CZ2 A;  1GNE A;  2GDR A;  4O92 A;  3IE3 A;  4JE1 A;  3KEB A;  4MA9 A;  1XVW A;  3R3E A;  1ML6 A;  4BL7 B;  4XHM A;  2X8C A;  4ZB9 A;  4XS6 A;  3VPT A;  2VL3 A;  3DXB A;  2I3Y A;  2GQK A;  1QK8 A;  4MAB A;  2VCV A;  1Z6M A;  2D2Z A;  2C8U A;  1G0T A;  2YP6 A;  3P90 A;  3TUE A;  2V6K A;  4K6X A;  2B5X A;  2LQQ A;  3TRX A;  4N30 A;  3R2Q A;  1EV9 A;  2E7P A;  2K8V A;  5CRE A;  2XBI A;  2CA8 A;  3CTG A;  3W8J A;  2LV3 A;  2WS2 A;  4JRR A;  1SK0 A;  4I2U A;  2JSY A;  2R5G A;  5G31 A;  2ZCT A;  3KTB A;  2HSN B;  3LGC A;  2XC2 A;  1VF2 A;  2B6M A;  2F9S A;  2PGT A;  2YWO A;  3DGQ A;  3FR9 A;  2H19 A;  1F6M C;  2EIQ A;  2JZS A;  5AN1 A;  5A5K A;  1PSQ A;  4OCF A;  5E4W A;  3DYR A;  2FD3 A;  1SD8 A;  1DSB A;  4O5R A;  3ED3 A;  4KDU A;  2WFC A;  2OJL A;  2CVD A;  1LU4 A;  2KP2 A;  5D9T A;  4HJM A;  2H75 A;  3QD9 A;  4GXZ A;  3RHC A;  2C1Y A;  4EKZ A;  3M9J A;  1KEB A;  2PU9 C;  3IAS 2;  2AYT A;  3US3 A;  4ACS A;  5LNK e;  2DJ1 A;  4J2F A;  1KTE A;  1TI3 A;  5JWQ B;  3FZ9 A;  2OBI A;  5D9W A;  2YPM A;  3U6V A;  1Q4J A;  3G9B A;  4YQU A;  2HT9 A;  3EUR A;  2YWN A;  1O81 A;  1WOU A;  3IXR A;  1RK4 A;  4I97 A;  3IK9 A;  2Z9S A;  4IKH A;  6GST A;  5HFI A;  2PN8 A;  3IHQ A;  1O73 A;  1GUL A;  1QXH A;  5IPG A;  5DCH A;  1B8X A;  1NM3 A;  4K7O A;  1ZZY A;  2LRC A;  1PKZ A;  2DJ3 A;  1TJD A;  3W8S A;  1XWB A;  3GRX A;  4WBJ A;  4GSN A;  1XW5 A;  2GS3 A;  3GYK A;  4FO5 A;  2O7K A;  2OAD A;  4K7N A;  1GRX A;  4EE0 A;  1YZX A;  2B5E A;  1FVK A;  2WZ9 A;  3J7Y k;  4IN0 A;  2YV7 A;  2ES7 A;  1BG5 A;  3KH7 A;  1A24 A;  3LOR A;  1A2J A;  5IMV A;  1PL1 A;  4FH8 A;  2AJQ B;  1EOH A;  3IA1 A;  4FYB A;  1U6T A;  5ECP B;  2IMK A;  4LL4 B;  1R5P A;  4POB A;  3HCZ A;  3BJ5 A;  3KMN A;  5IM9 A;  2AHE A;  3HJO A;  5B6M A;  2N5A A;  2I1U A;  1M9B A;  3E9J B;  1QUW A;  2B1L A;  3S9F A;  2N5B A;  4PQI A;  3CRT A;  4K1F A;  2L6C A;  3QR6 A;  4NV2 A;  2P0G A;  13GS A;  4GQF A;  1V58 A;  3FZA A;  4ZBD A;  4PX1 A;  3IR4 A;  1GL8 A;  4G0I A;  4V1A p;  4ECI A;  5A4V A;  2B3S A;  2IJY A;  3ZRD A;  2HNL A;  1RQM A;  3EU3 A;  1X9W B;  3I6A A;  2NVL A;  3APS A;  4MJC A;  10GS A;  4MDC A;  2HSM B;  3A3T A;  2FWG A;  3ZLP A;  4JU5 A;  1PRX A;  2H1B A;  3IBH A;  4MF6 A;  2ZUP A;  3BCI A;  4EL1 A;  1EP7 A;  4TXO B;  3H8Q A;  4KA0 A;  4TRX A;  2IIY A;  3HZ4 A;  1KNG A;  2VO4 A;  2IFQ A;  1AW9 A;  2FHE A;  2E2M A;  1UA5 A;  2YWI A;  4HU9 A;  4G9H A;  1WJK A;  5C00 A;  1ABA A;  4MZC A;  2JAC A;  2HRK B;  2RLI A;  3QCP A;  1GTI A;  5F0G A;  5DAK A;  5ID2 B;  5DCG A;  1Z9H A;  1OC9 B;  1EV4 A;  2HLS A;  4XCS A;  2C0G A;  4CDO A;  2NBS A;  4BVY A;  1S3C A;  4D73 A;  1A0F A;  1Y25 A;  2PPT A;  1NW2 A;  1K0D A;  1VF4 A;  4Q5Q A;  3C8E A;  4NXI A;  3HA9 A;  4BA7 A;  5JCW A;  2VL9 A;  4CHS A;  5IIZ A;  4K2D A;  3EVI A;  3NZN A;  2JZT A;  1SL1 B;  5D93 A;  2IMF A;  2M72 A;  3BCK A;  3C73 A;  4FIW A;  3L9V A;  2I9H A;  1YKA A;  1FOV A;  3A5W A;  5J5N A;  1KBN A;  3FZ5 A;  4CW9 A;  1XPV A;  2G2Q A;  1XZO A;  2K6V A;  3C71 A;  5D73 A;  4XS4 B;  4O32 A;  2CV4 A;  2WDU A;  1ERU A;  3SBC A;  2OE3 A;  1J0F A;  1J9B A;  3P7X A;  2HXK A;  1NHY A;  4IEL A;  3TOU A;  3GUS A;  3C1S A;  3QFB C;  2GLR A;  3GMF A;  1YEP A;  2VIM A;  3DVX A;  1PL2 A;  5KN2 A;  1F3B A;  1JLV A;  3F4T A;  2TRX A;  5HFK A;  1QMV A;  4ML6 A;  1X9M B;  5L71 A;  1VF1 A;  1K3O A;  3FY7 A;  4J56 E;  3ZML A;  1TRW A;  4WEY A;  3TJB A;  3P8W A;  2PUK C;  3F6D A;  1E2Y A;  3ZVJ D;  1FO5 A;  5AGY A;  1HNB A;  1TU7 A;  4KUN A;  2R3X A;  5ECI B;  3TKR A;  4I5Q A;  4L0W A;  3GTU B;  3N5O A;  3LQ7 A;  4V2M A;  3ZYW A;  1O8X A;  2FWE A;  4LMW A;  2O8V B;  4QL9 A;  4OCE A;  3KD0 A;  2PER A;  1X5D A;  3APO A;  4DSR A;  2H0H A;  3GL5 A;  1TOF A;  4MZW A;  20GS A;  1X0R A;  1JHB A;  2OKA A;  3QPM A;  3GN3 A;  4KND A;  1K0O A;  4IW9 A;  1X5E A;  1M2A A;  3UJ1 A;  4IHU A;  4MJB A;  3ZIT A;  4X0X A;  2MBS A;  1B48 A;  1TK5 B;  2XBQ A;  5JWR B;  5ECH B;  2GGT A;  4HOJ A;  4K0G A;  4F9Z A;  4O7H A;  2K18 A;  5IMZ A;  1GTU A;  3GH9 A;  11GS A;  1ON4 A;  2HZE A;  1IYH A;  1TI1 A;  3L9S A;  1SKR B;  2CQ9 A;  3O3T A;  5CRW A;  4NPB A;  3A2V A;  3ZVJ A;  5KN1 A;  3Q6O A;  3UAR A;  1TK8 B;  5ELG A;  3KM6 A;  2QGV A;  3GH6 A;  3D21 A;  3GUR A;  4OD7 A;  12GS A;  1N2A A;  3PGT A;  4P3Y B;  3M8N A;  1EEJ A;  2O87 A;  1V57 A;  4FYU A;  4JR4 A;  3UOM A;  3ME8 A;  4TR1 A;  1PQN A;  2KHP A;  4EDY A;  1DE1 A;  5ECM B;  2IWT A;  4MH3 A;  4EVM A;  1UC7 A;  1O8W A;  4IP1 A;  2DLX A;  2P5Q A;  2P5R A;  3VPQ A;  4N11 A;  1AQW A;  4JBB A;  8GSS A;  5F07 A;  3EU4 A;  1ACV A;  3ZZX A;  4PXO A;  4KAE A;  5G5F A;  4KH7 A;  1GSF A;  3PPU A;  3F9U A;  5CRG A;  2GTU A;  1M0U A;  1OVN A;  2MMA A;  1YQ1 A;  2H0G A;  5J3R A;  3L9U A;  3QOU A;  1MDK A;  2IN3 A;  1O6J A;  5DBQ A;  3EMX A;  2LTK A;  4KX4 A;  5KN0 A;  2WCI A;  5JCU A;  2FCH A;  1EWX A;  3GKN A;  4MPF A;  4WF5 A;  1XWA A;  3H79 A;  2H6Z A;  2YJ7 A;  2V32 A;  3DRN A;  1A2M A;  4EXJ A;  4DVC A;  4N0V A;  4IQ1 A;  5AIS A;  2B1K A;  4MF5 A;  1PN9 A;  4XS1 A;  3M9K A;  2RUF A;  4KSM A;  2I81 A;  3TKS E;  1O85 A;  2FUG 2;  4TOP A;  2J9H A;  4L8E A;  4E8E A;  3CBU A;  4G2E A;  1URM A;  2H8L A;  3TKS C;  3M3M A;  1XWC A;  2HSH A;  1E6B A;  5EY6 A;  1SEN A;  3EYT A;  1PA3 A;  2GSR A;  2RII A;  1ZL9 A;  2KOK A;  3HY2 A;  1GLQ A;  2C4J A;  3UBK A;  1YY7 A;  1J08 A;  1LJR A;  4XTS A;  3F3R A;  2JSZ A;  3DKS A;  3APQ A;  4JZQ A;  3LFL A;  1WWJ A;  5C04 A;  3ZIJ A;  3GST A;  4XRD A;  4BL7 A;  4EC0 A;  1I5G A;  5ECL B;  3GA4 A;  1YF1 A;  3HYP A;  3VI5 A;  5B8B A;  5JCG A;  1NHO A;  2R6K A;  3VI7 A;  4K7I A;  3KMO A;  4MMM A;  3FK8 A;  4GRF A;  2REM A;  2L5L A;  1TP9 A;  3QMX A;  3HHV A;  3VWV A;  2H72 A;  1PGT A;  5IOX A;  3EE2 A;  3D6I A;  4BVX B;  2FNO A;  4NWY A;  4HS1 A;  1WPI A;  1BAY A;  1XOA A;  3UVT A;  3I9V 2;  4ZL9 A;  4ZXG A;  2AB6 A;  3MAK A;  1EOG A;  4IBP A;  1Z6N A;  1R26 A;  3PIN A;  2JAD A;  1X9S B;  4BWS A;  4MH2 A;  3VWW A;  1ST9 A;  3TJG A;  1AQX A;  5ABR A;  4KCA A;  3F8U A;  1M2B A;  4HUA A;  4EDZ A;  2P31 A;  1GP1 A;  1QGV A;  5B7C A;  2K9F A;  4TXV A;  1EP8 A;  3HJM A;  3FR3 A;  4V1A g;  2YCD A;  22GS A;  3L78 A;  4JED A;  2M80 A;  3LXT A;  1M99 A;  1PD2 1;  2MMN A;  2HI7 A;  2HQT A;  2FWH A;  1LBK A;  2XHF A;  1G6W A;  1X5C A;  4NV5 A;  3IAM 2;  3KCM A;  4AGS A;  1EGR A;  4TR0 A;  5ELA A;  1ERW A;  2X8H A;  3ZFB A;  3SWL A;  5ECK B;  2H74 A;  1CQG A;  5J41 A;  4TVE A;  4H86 A;  5B8A A;  3DD3 A;  2VAF A;  4POL A;  4WR4 A;  6GSU A;  4HQS A;  1OKT A;  3FKF A;  2CZ3 A;  1T00 A;  1WP0 A;  2IL3 A;  2FGX A;  4K8M A;  5HQP A;  3F0I A;  1XXU A;  4DSS A;  1AC1 A;  2LJK A;  4QL7 A;  4F2I A;  4ZL7 A;  5FWG A;  2V2G A;  4KW6 A;  5HR3 A;  4JR6 A;  2OA7 A;  1MD3 A;  2WUL A;  2LRT A;  1BED A;  3FHK A;  3KJY A;  3GKM A;  4WXT A;  3TCO A;  2LS5 A;  1N8J A;  4NAX A;  5GAP D;  4I6X A;  2BJX A; 
#chains in the Genus database with same CATH topology
 2OAC A;  1Q98 A;  1AXD A;  2C0E A;  2HFD A;  4ZIL A;  2MBT A;  2DC5 A;  5HFG A;  3QDN A;  5AIX A;  5DAK B;  3GHA A;  1VGL A;  1SK2 A;  2LRN A;  3C7M A;  4D73 B;  4BVY B;  3HMJ G;  1WRY A;  1A2L A;  4MP4 A;  4ISD A;  2EFC A;  3NIV A;  4USS A;  16GS A;  4MF7 A;  1A8L A;  4IQA A;  3M1G A;  1C72 A;  1JZW A;  1M3I A;  3ZMK A;  4NHZ A;  4KCE A;  4LLR A;  3WD6 A;  4HEA 2;  4KB3 A;  3W6G A;  1SKW B;  1UVZ A;  3KGK A;  4AKG A;  3UL3 A;  5D9V A;  5H5R A;  4HU7 A;  2F8A A;  4E68 A;  2VLT A;  3DEX A;  2X64 A;  2LNS A;  1M7T A;  2DJK A;  2HSM A;  1XVQ A;  2H1G A;  3GIX A;  3IK7 A;  4MJA A;  4X43 A;  3Q19 A;  5DAL A;  4V2L A;  2HE3 A;  5F8B A;  3KH9 A;  4YQV A;  3BOA A;  4TXO A;  5H5Q A;  2I4A A;  1WIK A;  5LD0 A;  3E3E A;  5IMF A;  3WGE A;  4MCU A;  1TKD B;  1TTZ A;  1V2A A;  1GSD A;  2QC7 A;  1EZK A;  4KSO A;  2N5F A;  4MLY A;  3FEU A;  3KP9 A;  4HJ2 A;  3EC3 A;  1FHE A;  3L4N A;  3VWX A;  5CRH A;  1RW1 A;  4L5O A;  2ALB A;  3UAP A;  4Z7X A;  4AKH A;  3J7Y b;  2C0D A;  2QSI A;  4KDX A;  1QFN A;  2CT6 A;  1MDJ A;  4RQR A;  4TW5 A;  3EMP A;  3RPN A;  1VF3 A;  2BMX A;  1ZYQ B;  1XWK A;  1K0A A;  1T4Z A;  4PNF A;  3V1W A;  3LYK A;  2H1D A;  3BD2 A;  2FA8 A;  1YF0 A;  2H01 A;  4TR4 A;  3IC4 A;  5A4W A;  2GQL A;  2VUP A;  3TJF A;  2QA1 A;  1S3D A;  1K0M A;  4YKF A;  5HR0 A;  3O76 A;  1K0N A;  3OR5 A;  1ILO A;  4Q5R A;  1G6Y A;  1AIU A;  2CX4 A;  1OC3 A;  4Q5N A;  3LEF A;  3IC8 A;  4Q5F A;  3LJR A;  2L6D A;  2KUC A;  5A5H B;  2L57 A;  1R5A A;  7GSS A;  4NMU A;  3RAZ A;  1ZGN A;  4KDY A;  3O6T A;  2L4C A;  1Z3E A;  3AY8 A;  3TRP A;  4V2N A;  2VLU A;  4PHZ C;  17GS A;  1ZCP A;  2HZE B;  4AJ7 A;  2H73 A;  2VKZ G;  5IOW A;  4ZB8 A;  1SL2 B;  2R4V A;  2H70 A;  2TIR A;  2DSA A;  2H0I A;  1UN2 A;  6GSW A;  1ZMA A;  1GH2 A;  2GST A;  4QMK A;  5CNW A;  4N10 A;  5F05 A;  3GX8 A;  3D5J A;  1A0R P;  2ZNM A;  4ZBA A;  2NPB A;  1FAA A;  2DMM A;  1THX A;  3I69 A;  1XWG A;  6GSV A;  1TRV A;  4DEJ A;  3Q18 A;  2YOI A;  3HKR A;  1T8E B;  3E0U A;  3TDG A;  1GWC A;  5DQS A;  4OO5 A;  1IYI A;  4TR1 B;  2BTO T;  1GSE A;  2VD1 A;  3CSJ A;  2L4Q A;  1SYX A;  2VM1 A;  1MTC A;  3CQF A;  4WKW A;  1HQO A;  3DWV A;  1YEX A;  1PMT A;  5FHI A;  3GTU A;  3H93 A;  5G30 A;  2VD0 A;  5BMU A;  4GSS A;  4E8H A;  4POK A;  3FMW A;  1HNA A;  1T1V A;  2V41 A;  2HYX A;  3DVW A;  3GKX A;  3TKS A;  1K3L A;  1SK1 A;  2R0P A;  4RQX A;  3D0Z A;  1V98 A;  5JWO B;  5BRT A;  3G7I A;  1V40 A;  2R0G A;  5J9B A;  2OE1 A;  5J47 A;  3PH9 A;  3ERG A;  2B5Y A;  1XW9 A;  1HYU A;  3HVS A;  3G7J A;  3GFK A;  3LXZ A;  1U88 A;  3F6F A;  3F4R A;  3WYW A;  3HVX A;  2IME A;  3TOT A;  3CMI A;  2H1A A;  2XPD A;  1H75 A;  1FG4 A;  4TN8 A;  3RBT A;  1FB6 A;  3WGX A;  1GUH A;  1GSU A;  2H76 A;  2H6Y A;  6GSX A;  1YJ6 A;  2FA4 A;  2A4H A;  1U3I A;  2PWJ A;  3UEM A;  3N9J A;  2GVP A;  1FVJ A;  3UBL A;  1SYR A;  1JZR A;  5J4U A;  5DVB A;  4AJ8 A;  3HVN A;  4QQ7 A;  1JZO A;  1OC8 A;  2EIR A;  1R7H A;  1SL0 B;  1GLP A;  3UMA A;  1SJI A;  3K8N A;  2A2P A;  2EC4 A;  5GSS A;  2YV9 A;  4TR3 A;  3TJJ A;  3IPZ A;  4TKY A;  2LNT A;  1BQ7 A;  1F9M A;  2EIO A;  1TRS A;  4HI7 A;  3NOF A;  3EIN A;  1GUK A;  4OFN A;  5E59 A;  3ZIV A;  2H6X A;  3H1N A;  4OO4 A;  4ECB A;  3F63 A;  2V6O A;  1OE7 A;  2C80 A;  1EEM A;  4DSQ A;  2HZF A;  3FW2 A;  2GZZ A;  4ILF A;  4AF2 A;  4OFT A;  5ECS A;  3PR8 A;  1ERV A;  4HQZ A;  2A4V A;  5IO2 A;  3UVH A;  2DJ2 A;  5DJM A;  1JFU A;  4IP6 A;  2VLV A;  5CAX A;  2E0Q A;  1PX7 A;  1XCC A;  18GS A;  2VM2 A;  3LWA A;  1AQV A;  3GKK A;  1DBY A;  2HRA A;  3ZFL A;  1SU9 A;  2JL4 A;  19GS A;  1H4O A;  3GNJ A;  4K9Z A;  2AV4 A;  1GTB A;  1WMJ A;  1GUM A;  4ZB6 A;  3ZTL A;  2KP1 A;  3KTL A;  4GST A;  4IJ3 A;  2PBJ A;  4F03 A;  5COH A;  4MZB A;  1B9X C;  14GS A;  4AJ6 A;  4MK3 A;  4A5P A;  3WT1 A;  1XIY A;  1MD4 A;  1Z7R A;  4MPG A;  2J23 A;  3VLN A;  4ECJ A;  3QFA C;  2LQO A;  5KOW A;  2F3M A;  5INY A;  1F37 A;  1Y6E A;  3HD5 A;  5G2Z A;  1G7O A;  2VL2 C;  2V1M A;  5GZZ B;  2C3Q A;  1O7U A;  5HR2 A;  4ML1 A;  3DIE A;  1OYJ A;  2HSN A;  1OKD A;  2M46 A;  3FYG A;  4RI7 A;  4GWR A;  1PX6 A;  5DDL A;  2WGR A;  3LG6 A;  1I1I P;  1XOB A;  3HJP A;  3HZ8 A;  4WF4 A;  2YJH A;  2DJJ A;  4MJE A;  1DUG A;  2FLS A;  4J57 E;  4IGJ A;  1Z7P A;  4L0U A;  4PGT A;  2PVQ A;  4WBR D;  1Z5Y E;  2C3T A;  3WT2 A;  4LL1 B;  3TRQ A;  5IPH A;  2PMT A;  3IOS A;  4DSS B;  5G1K A;  1GSY A;  3RHB A;  5B6N A;  2LKU A;  1GNW A;  4BVX A;  3GL3 A;  5IQY A;  5CRD A;  2DIZ A;  2VCT A;  1A8Y A;  3KZQ A;  2HRN A;  2R37 A;  3GSS A;  3CTF A;  1M2D A;  2LUS A;  2OBK A;  2IPA A;  5ECO B;  3FRC A;  4ID0 A;  4G10 A;  1TRU A;  4PQ1 A;  3FR6 A;  5CP1 A;  5KEJ A;  3D4M A;  2ON5 A;  2FWF A;  5DJL A;  3G7Y A;  4GF0 A;  4IS0 A;  1BYE A;  2CAI A;  2EFD A;  3ISO A;  3CSH A;  4GLT A;  3QAW A;  3CRU A;  2C3N A;  2LJA A;  3HDC A;  1U87 A;  3IRA A;  3TJK A;  1I9D A;  1B4Q A;  2RM5 A;  1THO A;  1YEW C;  4F0B A;  1VRS D;  2IFQ B;  2UZ8 A;  5J4V A;  3EWL A;  3QAG A;  1GTA A;  1JLW A;  2H66 A;  3VFI A;  1K3Y A;  1W4V A;  3CYN A;  4PUA A;  9GSS A;  4RUV A;  4PI2 C;  2B7J A;  1TDI A;  1TXX A;  2O5V A;  5EPF A;  4K5S A;  3KIJ A;  4GQC A;  3VUR A;  5A34 A;  5ENU A;  1USB A;  2MYG A;  1AAZ A;  5ECQ B;  2X99 A;  4WET A;  3UIW A;  3F3Q A;  2GT5 A;  2LJR A;  5DAL B;  2C0F A;  3L0H A;  2WJU A;  4N3Z A;  1XBS A;  2MMO A;  1SVM A;  2CVK A;  3HVV A;  5D8I A;  5LCZ A;  2GSS A;  4YAP A;  3U5R E;  4O5U A;  2VCQ A;  2IMI A;  2DJ0 A;  2O89 A;  1ZOF A;  2A2R A;  4G0K A;  2KLX A;  4NHW A;  4EF0 A;  1TW9 A;  2RUE A;  5IMA A;  2YNX A;  5KOX A;  2GT6 A;  4IJI A;  1T4Y A;  4EIQ A;  3VWU A;  2WB9 A;  4LMV A;  5G5E A;  4HSC X;  3WGD A;  5GST A;  4POM A;  2YWM A;  3BBY A;  5EL8 A;  2E2G A;  4XRA A;  5FT3 A;  1DE2 A;  2YN1 A;  3GX0 A;  4ZIJ A;  4W66 A;  3Q74 A;  2FY6 A;  4KF9 A;  2OE0 A;  4PTS A;  2MZC A;  3C1R A;  1W89 A;  3JCM L;  2CX3 A;  1GSS A;  2WVY A;  4ICY A;  2DBC A;  1YDK A;  3MWH A;  4RI6 A;  1OAZ A;  4ULX A;  4G19 A;  4ECC A;  1FW1 A;  2K8S A;  3TGZ A;  5A4U A;  1WE0 A;  2F8F A;  3GV1 A;  2DKI A;  5IMC A;  1BX9 A;  2HRK A;  2RM6 A;  1G7E A;  5GAN D;  1SKS B;  5ID2 A;  1SJZ A;  4OFM A;  3I43 A;  1OC9 A;  2JZR A;  1M9A A;  3LYP A;  2AUV A;  4K0N A;  2DML A;  4YAV A;  3A2W A;  5D9X A;  1HNC A;  2NDO A;  3KP8 A;  5ECN B;  2GZP A;  1K0B A;  2DIY A;  4O5Q A;  3CSI A;  2R2J A;  1CQH A;  3A2X A;  3HXS A;  2LST A;  1V9W A;  4BWQ A;  2JU5 A;  2X8G A;  2GZY A;  2H30 A;  1S3R A;  5CYY A;  4OMV A;  1PKW A;  4F82 A;  1R4W A;  4BPY A;  2HRF A;  1XFL A;  4ZL8 A;  2L5O A;  1QQ2 A;  2PVO C;  5AIV A;  1OE8 A;  1TU8 A;  4I8B A;  2WRT A;  4XS4 A;  6GSS A;  3A5I A;  3RPP A;  2CVB A;  2H71 A;  1GSQ A;  3IV4 A;  4OWY A;  1B9Y C;  1MDI A;  1U3A A;  4YKG A;  4LA1 A;  4ZBB A;  2VOC A;  4BIK A;  6GSY A;  4WR5 A;  2A2S A;  4PNG A;  5D96 A;  2LEG A;  4EUY A;  4PUR A;  3MNG A;  4AKX B;  3ZL5 A;  5F06 A;  2IMD A;  4HZ2 A;  4YH2 A;  1T3B A;  2YAN A;  3MIX A;  4YQM A;  4KGI A;  3LSZ A;  4HDE A;  1YKC A;  2F51 A;  5G1L A;  3ZRE A;  1F2E A;  2AAW A;  1ERT A;  3D4T A;  1B4P A;  5KN3 A;  4IVF A;  5DQY A;  4GTU A;  4Z2U A;  1Y1U A;  3CXG A;  3KXO A;  1F3A A;  1XW6 A;  3IHG A;  3RDW A;  5HR1 A;  2XPE A;  2VCZ A;  3MDK A;  2HSY A;  4XIH A;  4I2T A;  2YZU A;  5H5S A;  5J9C A;  2UV8 G;  2YZH A;  4X1U A;  5ECR B;  2GSQ A;  4GDF A;  1HD2 A;  1TK0 B;  2ON7 A;  2G0F A;  1BJX A;  1AUC A;  5IO0 A;  1SJ6 A;  3TKP A;  2WVX B;  3H4K A;  3DML A;  3MSZ A;  3P2A A;  4PQH A;  3ME7 A;  1SD9 A;  1JZD A;  4HZ4 A;  2VCW A;  3QAV A;  1A23 A;  1ZYE A;  2TRC P;  2L59 A;  3D22 A;  4PUF C;  3M0F A;  3VK9 A;  4G01 A;  2MMZ A;  4F0C A;  2GQM A;  4KE3 A;  4GCI A;  1EGO A;  2QKE A;  3TB2 A;  1NSW A;  5CO3 A;  4N0Z A;  3TKQ A;  2NTO A;  5EVO A;  5IMD A;  3FZ4 A;  3ERW A;  3F4S A;  4G0L A;  1S3A A;  4FYC A;  5A1N A;  1FB0 A;  3ERF A;  4EO3 A;  3IDV A;  4L5L A;  1MEK A;  2VCX A;  4FQU A;  2CAQ A;  1T7P B;  4Z2R A;  3CWG A;  2VL2 A;  2B7K A;  1K0C A;  2O85 A;  3EPT A;  2CZ2 A;  1GNE A;  2GDR A;  4O92 A;  3IE3 A;  4JE1 A;  1M3J A;  3KEB A;  4MA9 A;  1XVW A;  3R3E A;  1ML6 A;  4BL7 B;  4XHM A;  2X8C A;  4ZB9 A;  4XS6 A;  3VPT A;  2VL3 A;  3DXB A;  2I3Y A;  2GQK A;  1QK8 A;  4MAB A;  2VCV A;  1Z6M A;  2D2Z A;  2C8U A;  1G0T A;  2YP6 A;  3P90 A;  3TUE A;  3RGB C;  2V6K A;  4K6X A;  2B5X A;  2LQQ A;  3TRX A;  4X4J A;  4N30 A;  3R2Q A;  1EV9 A;  2E7P A;  2K8V A;  5CRE A;  2XBI A;  2CA8 A;  3CTG A;  3W8J A;  2LV3 A;  2WS2 A;  4JRR A;  1SK0 A;  1ZYN A;  4I2U A;  2JSY A;  2R5G A;  5G31 A;  2ZCT A;  3KTB A;  2HSN B;  3LGC A;  2XC2 A;  1VF2 A;  2B6M A;  2F9S A;  2PGT A;  1TXU A;  2YWO A;  3DGQ A;  3FR9 A;  2H19 A;  1F6M C;  2EIQ A;  2JZS A;  5AN1 A;  5A5K A;  3LW9 A;  1PSQ A;  4OCF A;  5E4W A;  3DYR A;  2FD3 A;  3MYD A;  1SD8 A;  1DSB A;  4O5R A;  3ED3 A;  4KDU A;  2WFC A;  2OJL A;  2CVD A;  1LU4 A;  2KP2 A;  5D9T A;  4HJM A;  2H75 A;  1PFO A;  3QD9 A;  4GXZ A;  3RHC A;  2C1Y A;  4EKZ A;  3M9J A;  1KEB A;  2PU9 C;  3IAS 2;  2AYT A;  3US3 A;  4ACS A;  5LNK e;  2DJ1 A;  4J2F A;  1KTE A;  1TI3 A;  5JWQ B;  3FZ9 A;  2OBI A;  3CHX C;  5D9W A;  2YPM A;  3U6V A;  1Q4J A;  3G9B A;  4AI6 A;  2O3E A;  4YQU A;  2HT9 A;  3EUR A;  2YWN A;  1O81 A;  1WOU A;  2X49 A;  3IXR A;  1RK4 A;  4I97 A;  3IK9 A;  2Z9S A;  4IKH A;  4MNN A;  6GST A;  5HFI A;  2PN8 A;  3IHQ A;  1O73 A;  1GUL A;  1QXH A;  5IPG A;  5DCH A;  1B8X A;  1NM3 A;  4K7O A;  2WZS A;  1ZZY A;  2LRC A;  1PKZ A;  2DJ3 A;  1TJD A;  3W8S A;  1XWB A;  3GRX A;  4WBJ A;  4GSN A;  1XW5 A;  2GS3 A;  3GYK A;  4FO5 A;  2O7K A;  1BF5 A;  2OAD A;  4K7N A;  1GRX A;  4EE0 A;  1YZX A;  2R0C A;  2B5E A;  1FVK A;  2WZ9 A;  3J7Y k;  4IN0 A;  2YV7 A;  2ES7 A;  1BG5 A;  3KH7 A;  1A24 A;  1N25 A;  3LOR A;  1A2J A;  5IMV A;  1PL1 A;  4FH8 A;  2AJQ B;  1EOH A;  3IA1 A;  4FYB A;  1U6T A;  5ECP B;  2IMK A;  4LL4 B;  1R5P A;  4POB A;  3HCZ A;  2WW3 A;  3BJ5 A;  3KMN A;  5IM9 A;  2AHE A;  3HJO A;  5B6M A;  2N5A A;  2I1U A;  1M9B A;  3E9J B;  1QUW A;  2B1L A;  3S9F A;  2N5B A;  4PQI A;  3CRT A;  4K1F A;  2L6C A;  3QR6 A;  4NV2 A;  2P0G A;  13GS A;  4GQF A;  1V58 A;  3FZA A;  4ZBD A;  4PI0 C;  4PX1 A;  3IR4 A;  1GL8 A;  4G0I A;  4V1A p;  4ECI A;  5A4V A;  2B3S A;  2IJY A;  3ZRD A;  2HNL A;  1RQM A;  3EU3 A;  1X9W B;  3I6A A;  2NVL A;  3APS A;  4MJC A;  10GS A;  4MDC A;  2HSM B;  3A3T A;  4Z2T A;  2O36 A;  2FWG A;  3ZLP A;  4JU5 A;  1PRX A;  2H1B A;  2WW0 A;  3IBH A;  4MF6 A;  2ZUP A;  3BCI A;  4EL1 A;  1EP7 A;  4TXO B;  3H8Q A;  4KA0 A;  4TRX A;  2IIY A;  3HZ4 A;  1KNG A;  2VO4 A;  2IFQ A;  1AW9 A;  5J4Y A;  2FHE A;  2E2M A;  1UA5 A;  2YWI A;  2QA2 A;  4HU9 A;  4G9H A;  5J40 A;  1WJK A;  5C00 A;  1ABA A;  4MZC A;  2JAC A;  2HRK B;  2RLI A;  3QCP A;  1GTI A;  5F0G A;  5DAK A;  5ID2 B;  5DCG A;  2WW1 A;  1Z9H A;  1OC9 B;  1EV4 A;  2HLS A;  4XCS A;  2X4A A;  2C0G A;  4CDO A;  2NBS A;  4BVY A;  1S3C A;  4D73 A;  1A0F A;  2PPT A;  1Y25 A;  1NW2 A;  1BG1 A;  1K0D A;  1VF4 A;  4Q5Q A;  3C8E A;  4NXI A;  3HA9 A;  4BA7 A;  1SVO A;  5JCW A;  2VL9 A;  4CHS A;  5IIZ A;  4K2D A;  3EVI A;  3NZN A;  2JZT A;  1SL1 B;  5D93 A;  2IMF A;  2M72 A;  3BCK A;  3C73 A;  4FIW A;  3L9V A;  2I9H A;  1YKA A;  1FOV A;  3A5W A;  5J5N A;  1KBN A;  3FZ5 A;  4CW9 A;  1XPV A;  2G2Q A;  1XZO A;  2K6V A;  3C71 A;  5D73 A;  4XS4 B;  4O32 A;  2CV4 A;  2WDU A;  1ERU A;  3SBC A;  2OE3 A;  1J0F A;  1J9B A;  3P7X A;  2HXK A;  1NHY A;  4IEL A;  3TOU A;  3GUS A;  3C1S A;  3TU3 B;  2GLR A;  3QFB C;  3GMF A;  1YEP A;  2VIM A;  3DVX A;  1PL2 A;  5KN2 A;  1F3B A;  1JLV A;  3F4T A;  2TRX A;  5HFK A;  1QMV A;  4ML6 A;  1X9M B;  5L71 A;  1VF1 A;  1K3O A;  2EFH A;  3FY7 A;  1XG8 A;  4J56 E;  3ZML A;  1TRW A;  4WEY A;  3TJB A;  3P8W A;  2PUK C;  2EFE A;  3F6D A;  1E2Y A;  3ZVJ D;  1FO5 A;  5AGY A;  1HNB A;  1S4B P;  1TU7 A;  4KUN A;  2R3X A;  5ECI B;  3TKR A;  4I5Q A;  4L0W A;  3GTU B;  3N5O A;  5BMU B;  3LQ7 A;  4V2M A;  3ZYW A;  1O8X A;  2FWE A;  4LMW A;  2O8V B;  4QL9 A;  2WW2 A;  4OCE A;  3KD0 A;  2PER A;  1X5D A;  3APO A;  4DSR A;  2H0H A;  3GL5 A;  1TOF A;  4MZW A;  20GS A;  1X0R A;  1JHB A;  2OKA A;  3QPM A;  3GN3 A;  4KND A;  1K0O A;  4IW9 A;  1X5E A;  1M2A A;  3UJ1 A;  4IHU A;  4MJB A;  3ZIT A;  4X0X A;  2MBS A;  1B48 A;  5A5H A;  1TK5 B;  2XBQ A;  5JWR B;  5ECH B;  2GGT A;  4HOJ A;  4K0G A;  4F9Z A;  4O7H A;  2K18 A;  5IMZ A;  1GTU A;  3GH9 A;  11GS A;  1ON4 A;  2HZE A;  1IYH A;  1TI1 A;  3L9S A;  1SKR B;  2CQ9 A;  3O3T A;  5CRW A;  4NPB A;  3A2V A;  3ZVJ A;  4AKI A;  5KN1 A;  3Q6O A;  3UAR A;  5A1N B;  1TK8 B;  1YVL A;  5ELG A;  3KM6 A;  2QGV A;  4EIP A;  3GH6 A;  3D21 A;  2H1L A;  3GUR A;  4OD7 A;  12GS A;  1N2A A;  3PGT A;  4P3Y B;  3M8N A;  1EEJ A;  2O87 A;  1V57 A;  4FYU A;  4JR4 A;  3UOM A;  3ME8 A;  4TR1 A;  1PQN A;  2KHP A;  4EDY A;  1DE1 A;  5ECM B;  2IWT A;  4MH3 A;  4EVM A;  1UC7 A;  1O8W A;  4IP1 A;  2DLX A;  2P5Q A;  2P5R A;  3VPQ A;  4N11 A;  1AQW A;  4JBB A;  8GSS A;  5F07 A;  3EU4 A;  1ACV A;  3ZZX A;  4PXO A;  4KAE A;  5G5F A;  4KH7 A;  1GSF A;  3PPU A;  3F9U A;  5CRG A;  2GTU A;  1M0U A;  1OVN A;  2MMA A;  1YQ1 A;  2H0G A;  5J3R A;  3L9U A;  3QOU A;  2WVX A;  1MDK A;  2IN3 A;  1O6J A;  5DBQ A;  3EMX A;  2LTK A;  4KX4 A;  5KN0 A;  2WCI A;  5JCU A;  2FCH A;  1EWX A;  3GKN A;  4MPF A;  4WF5 A;  1XWA A;  3H79 A;  2H6Z A;  2YJ7 A;  2V32 A;  3DRN A;  1A2M A;  4EXJ A;  4DVC A;  4N0V A;  4IQ1 A;  5AIS A;  2B1K A;  4MF5 A;  1PN9 A;  4XS1 A;  2RUF A;  2I81 A;  4KSM A;  3M9K A;  3TKS E;  1O85 A;  2FUG 2;  4TOP A;  2J9H A;  4L8E A;  4E8E A;  3CBU A;  4G2E A;  4CY6 A;  1URM A;  2H8L A;  3TKS C;  3M3M A;  1XWC A;  2HSH A;  1E6B A;  5EY6 A;  1SEN A;  3EYT A;  1PA3 A;  2GSR A;  2RII A;  1PN0 A;  1ZL9 A;  2KOK A;  3HY2 A;  1GLQ A;  2C4J A;  3UBK A;  1YY7 A;  1J08 A;  1LJR A;  4XTS A;  3F3R A;  2JSZ A;  3DKS A;  3APQ A;  4JZQ A;  3LFL A;  1WWJ A;  5C04 A;  4FXY P;  3ZIJ A;  3GST A;  3RFR C;  4XRD A;  4BL7 A;  4EC0 A;  1I5G A;  1FOH A;  5ECL B;  3GA4 A;  1YF1 A;  3HYP A;  4K2X A;  3VI5 A;  5B8B A;  5JCG A;  1NHO A;  2R6K A;  3VI7 A;  4K7I A;  3KMO A;  4MMM A;  3FK8 A;  4GRF A;  2REM A;  2L5L A;  1TP9 A;  3QMX A;  3HHV A;  3VWV A;  2H72 A;  1PGT A;  5IOX A;  3EE2 A;  3D6I A;  4BVX B;  2FNO A;  4NWY A;  4HS1 A;  1WPI A;  1BAY A;  1XOA A;  3UVT A;  3I9V 2;  4ZL9 A;  4ZXG A;  2AB6 A;  3MAK A;  1EOG A;  4IBP A;  1Z6N A;  1R26 A;  3PIN A;  2JAD A;  1X9S B;  4BWS A;  1ZYP A;  4MH2 A;  3VWW A;  1ST9 A;  3TJG A;  1AQX A;  5ABR A;  4KCA A;  3F8U A;  1M2B A;  4HUA A;  4EDZ A;  2P31 A;  1GP1 A;  1QGV A;  5B7C A;  2K9F A;  4TXV A;  1EP8 A;  3HJM A;  3FR3 A;  4V1A g;  2YCD A;  22GS A;  3L78 A;  4JED A;  2M80 A;  2OT3 A;  3LXT A;  1M99 A;  1PD2 1;  2MMN A;  4CY8 A;  2HI7 A;  2HQT A;  2FWH A;  1LBK A;  4ZB7 A;  2DKH A;  2XHF A;  1G6W A;  1X5C A;  4NV5 A;  3IAM 2;  3KCM A;  4AGS A;  1EGR A;  4TR0 A;  5ELA A;  1ERW A;  2X8H A;  3ZFB A;  3SWL A;  5ECK B;  2H74 A;  1CQG A;  5J41 A;  4TVE A;  4H86 A;  5B8A A;  3DD3 A;  2VAF A;  4POL A;  4WR4 A;  6GSU A;  4HQS A;  1OKT A;  3FKF A;  2WVZ A;  2CZ3 A;  1T00 A;  1WP0 A;  2IL3 A;  5A34 B;  2FGX A;  4K8M A;  5HQP A;  3F0I A;  1XXU A;  4DSS A;  1AC1 A;  2LJK A;  4QL7 A;  4F2I A;  4ZL7 A;  1SVL A;  5FWG A;  2V2G A;  4KW6 A;  5HR3 A;  4JR6 A;  2OA7 A;  1MD3 A;  2WUL A;  2LRT A;  1BED A;  3FHK A;  3KJY A;  3GKM A;  4K5R A;  4WXT A;  3TCO A;  2LS5 A;  1N8J A;  4NAX A;  5GAP D;  4I6X A;  2BJX A; 
#chains in the Genus database with same CATH homology
 2OAC A;  1Q98 A;  1AXD A;  2C0E A;  2HFD A;  4ZIL A;  2MBT A;  2DC5 A;  5HFG A;  3QDN A;  5AIX A;  5DAK B;  3GHA A;  1VGL A;  1SK2 A;  2LRN A;  3C7M A;  4D73 B;  4BVY B;  3HMJ G;  1WRY A;  1A2L A;  4MP4 A;  4ISD A;  2EFC A;  3NIV A;  4USS A;  16GS A;  4MF7 A;  1A8L A;  4IQA A;  3M1G A;  1C72 A;  1JZW A;  3ZMK A;  4NHZ A;  4KCE A;  4LLR A;  3WD6 A;  4HEA 2;  4KB3 A;  3W6G A;  1SKW B;  1UVZ A;  3KGK A;  4AKG A;  3UL3 A;  5D9V A;  5H5R A;  4HU7 A;  2F8A A;  4E68 A;  2VLT A;  3DEX A;  2X64 A;  2LNS A;  1M7T A;  2DJK A;  2HSM A;  1XVQ A;  2H1G A;  3GIX A;  3IK7 A;  4MJA A;  4X43 A;  3Q19 A;  5DAL A;  4V2L A;  2HE3 A;  5F8B A;  3KH9 A;  4YQV A;  3BOA A;  4TXO A;  5H5Q A;  2I4A A;  1WIK A;  5LD0 A;  3E3E A;  5IMF A;  3WGE A;  4MCU A;  1TKD B;  1TTZ A;  1V2A A;  1GSD A;  2QC7 A;  1EZK A;  4KSO A;  2N5F A;  4MLY A;  3FEU A;  3KP9 A;  4HJ2 A;  3EC3 A;  1FHE A;  3L4N A;  3VWX A;  5CRH A;  1RW1 A;  4L5O A;  2ALB A;  3UAP A;  4Z7X A;  4AKH A;  3J7Y b;  2C0D A;  2QSI A;  4KDX A;  1QFN A;  2CT6 A;  1MDJ A;  4RQR A;  4TW5 A;  3EMP A;  3RPN A;  1VF3 A;  2BMX A;  1ZYQ B;  1XWK A;  1K0A A;  1T4Z A;  4PNF A;  3V1W A;  3LYK A;  2H1D A;  3BD2 A;  2FA8 A;  1YF0 A;  2H01 A;  4TR4 A;  3IC4 A;  5A4W A;  2GQL A;  2VUP A;  3TJF A;  2QA1 A;  1S3D A;  1K0M A;  4YKF A;  5HR0 A;  3O76 A;  1K0N A;  3OR5 A;  1ILO A;  4Q5R A;  1G6Y A;  1AIU A;  2CX4 A;  1OC3 A;  4Q5N A;  3LEF A;  3IC8 A;  4Q5F A;  3LJR A;  2L6D A;  2KUC A;  5A5H B;  2L57 A;  1R5A A;  7GSS A;  4NMU A;  3RAZ A;  1ZGN A;  4KDY A;  3O6T A;  2L4C A;  1Z3E A;  3AY8 A;  3TRP A;  4V2N A;  2VLU A;  17GS A;  1ZCP A;  2HZE B;  4AJ7 A;  2H73 A;  2VKZ G;  5IOW A;  4ZB8 A;  1SL2 B;  2R4V A;  2H70 A;  2TIR A;  2DSA A;  2H0I A;  1UN2 A;  6GSW A;  1ZMA A;  1GH2 A;  2GST A;  4QMK A;  5CNW A;  4N10 A;  5F05 A;  3GX8 A;  3D5J A;  1A0R P;  2ZNM A;  4ZBA A;  2NPB A;  1FAA A;  2DMM A;  1THX A;  3I69 A;  1XWG A;  6GSV A;  1TRV A;  4DEJ A;  3Q18 A;  2YOI A;  3HKR A;  1T8E B;  3E0U A;  3TDG A;  1GWC A;  5DQS A;  4OO5 A;  1IYI A;  4TR1 B;  2BTO T;  1GSE A;  2VD1 A;  3CSJ A;  2L4Q A;  1SYX A;  2VM1 A;  1MTC A;  4WKW A;  1HQO A;  3DWV A;  1YEX A;  1PMT A;  5FHI A;  3GTU A;  3H93 A;  5G30 A;  2VD0 A;  5BMU A;  4GSS A;  4E8H A;  4POK A;  3FMW A;  1HNA A;  1T1V A;  2V41 A;  2HYX A;  3DVW A;  3GKX A;  3TKS A;  1K3L A;  1SK1 A;  2R0P A;  4RQX A;  3D0Z A;  1V98 A;  5JWO B;  5BRT A;  3G7I A;  1V40 A;  2R0G A;  5J9B A;  2OE1 A;  5J47 A;  3PH9 A;  3ERG A;  2B5Y A;  1XW9 A;  1HYU A;  3HVS A;  3G7J A;  3GFK A;  3LXZ A;  1U88 A;  3F6F A;  3F4R A;  3WYW A;  3HVX A;  2IME A;  3TOT A;  3CMI A;  2H1A A;  2XPD A;  1H75 A;  1FG4 A;  4TN8 A;  3RBT A;  1FB6 A;  3WGX A;  1GUH A;  1GSU A;  2H76 A;  2H6Y A;  6GSX A;  1YJ6 A;  2FA4 A;  2A4H A;  1U3I A;  2PWJ A;  3UEM A;  3N9J A;  2GVP A;  1FVJ A;  3UBL A;  1SYR A;  1JZR A;  5J4U A;  5DVB A;  4AJ8 A;  4QQ7 A;  1JZO A;  1OC8 A;  2EIR A;  1R7H A;  1SL0 B;  1GLP A;  3UMA A;  1SJI A;  3K8N A;  2A2P A;  2EC4 A;  5GSS A;  2YV9 A;  4TR3 A;  3TJJ A;  3IPZ A;  4TKY A;  2LNT A;  1BQ7 A;  1F9M A;  2EIO A;  1TRS A;  4HI7 A;  3NOF A;  3EIN A;  1GUK A;  4OFN A;  5E59 A;  3ZIV A;  2H6X A;  3H1N A;  4OO4 A;  4ECB A;  3F63 A;  2V6O A;  1OE7 A;  2C80 A;  1EEM A;  4DSQ A;  2HZF A;  3FW2 A;  2GZZ A;  4ILF A;  4AF2 A;  4OFT A;  5ECS A;  3PR8 A;  1ERV A;  4HQZ A;  2A4V A;  5IO2 A;  3UVH A;  2DJ2 A;  5DJM A;  1JFU A;  4IP6 A;  2VLV A;  5CAX A;  2E0Q A;  1PX7 A;  1XCC A;  18GS A;  2VM2 A;  3LWA A;  1AQV A;  3GKK A;  1DBY A;  2HRA A;  3ZFL A;  1SU9 A;  2JL4 A;  19GS A;  1H4O A;  3GNJ A;  4K9Z A;  2AV4 A;  1GTB A;  1WMJ A;  1GUM A;  4ZB6 A;  3ZTL A;  2KP1 A;  3KTL A;  4GST A;  4IJ3 A;  2PBJ A;  4F03 A;  5COH A;  4MZB A;  1B9X C;  14GS A;  4AJ6 A;  4MK3 A;  4A5P A;  3WT1 A;  1XIY A;  1MD4 A;  1Z7R A;  4MPG A;  2J23 A;  3VLN A;  4ECJ A;  3QFA C;  2LQO A;  5KOW A;  2F3M A;  5INY A;  1F37 A;  1Y6E A;  3HD5 A;  5G2Z A;  1G7O A;  2VL2 C;  2V1M A;  5GZZ B;  2C3Q A;  1O7U A;  5HR2 A;  4ML1 A;  3DIE A;  1OYJ A;  2HSN A;  1OKD A;  2M46 A;  3FYG A;  4RI7 A;  4GWR A;  1PX6 A;  5DDL A;  2WGR A;  3LG6 A;  1XOB A;  3HJP A;  3HZ8 A;  4WF4 A;  2YJH A;  2DJJ A;  4MJE A;  1DUG A;  2FLS A;  4J57 E;  4IGJ A;  1Z7P A;  4L0U A;  4PGT A;  2PVQ A;  4WBR D;  1Z5Y E;  2C3T A;  3WT2 A;  4LL1 B;  3TRQ A;  5IPH A;  2PMT A;  3IOS A;  4DSS B;  5G1K A;  1GSY A;  3RHB A;  5B6N A;  2LKU A;  1GNW A;  4BVX A;  3GL3 A;  5IQY A;  5CRD A;  2DIZ A;  2VCT A;  1A8Y A;  3KZQ A;  2HRN A;  2R37 A;  3GSS A;  3CTF A;  1M2D A;  2LUS A;  2OBK A;  2IPA A;  5ECO B;  3FRC A;  4ID0 A;  4G10 A;  1TRU A;  4PQ1 A;  3FR6 A;  5CP1 A;  5KEJ A;  3D4M A;  2ON5 A;  2FWF A;  5DJL A;  3G7Y A;  4GF0 A;  4IS0 A;  1BYE A;  2CAI A;  2EFD A;  3ISO A;  3CSH A;  4GLT A;  3QAW A;  3CRU A;  2C3N A;  2LJA A;  3HDC A;  1U87 A;  3IRA A;  3TJK A;  1I9D A;  1B4Q A;  2RM5 A;  1THO A;  4F0B A;  1VRS D;  2IFQ B;  2UZ8 A;  5J4V A;  3EWL A;  3QAG A;  1GTA A;  1JLW A;  2H66 A;  3VFI A;  1K3Y A;  1W4V A;  3CYN A;  4PUA A;  9GSS A;  4RUV A;  2B7J A;  1TDI A;  1TXX A;  2O5V A;  5EPF A;  4K5S A;  3KIJ A;  4GQC A;  3VUR A;  5A34 A;  5ENU A;  1USB A;  2MYG A;  1AAZ A;  5ECQ B;  2X99 A;  4WET A;  3UIW A;  3F3Q A;  2GT5 A;  2LJR A;  5DAL B;  2C0F A;  3L0H A;  2WJU A;  4N3Z A;  1XBS A;  2MMO A;  1SVM A;  2CVK A;  3HVV A;  5D8I A;  5LCZ A;  2GSS A;  4YAP A;  3U5R E;  4O5U A;  2VCQ A;  2IMI A;  2DJ0 A;  2O89 A;  1ZOF A;  2A2R A;  4G0K A;  2KLX A;  4NHW A;  4EF0 A;  1TW9 A;  2RUE A;  5IMA A;  2YNX A;  5KOX A;  2GT6 A;  4IJI A;  1T4Y A;  4EIQ A;  3VWU A;  2WB9 A;  4LMV A;  5G5E A;  3WGD A;  5GST A;  4POM A;  2YWM A;  3BBY A;  5EL8 A;  2E2G A;  4XRA A;  5FT3 A;  1DE2 A;  2YN1 A;  3GX0 A;  4ZIJ A;  4W66 A;  3Q74 A;  2FY6 A;  4KF9 A;  2OE0 A;  4PTS A;  2MZC A;  3C1R A;  1W89 A;  3JCM L;  2CX3 A;  1GSS A;  4ICY A;  2DBC A;  1YDK A;  3MWH A;  4RI6 A;  1OAZ A;  4ULX A;  4G19 A;  4ECC A;  1FW1 A;  2K8S A;  3TGZ A;  5A4U A;  1WE0 A;  2F8F A;  3GV1 A;  2DKI A;  5IMC A;  1BX9 A;  2HRK A;  2RM6 A;  1G7E A;  5GAN D;  1SKS B;  5ID2 A;  1SJZ A;  4OFM A;  3I43 A;  1OC9 A;  2JZR A;  1M9A A;  3LYP A;  2AUV A;  4K0N A;  2DML A;  4YAV A;  3A2W A;  5D9X A;  1HNC A;  2NDO A;  3KP8 A;  5ECN B;  2GZP A;  1K0B A;  2DIY A;  4O5Q A;  3CSI A;  2R2J A;  1CQH A;  3A2X A;  3HXS A;  2LST A;  1V9W A;  4BWQ A;  2JU5 A;  2X8G A;  2GZY A;  2H30 A;  5CYY A;  4OMV A;  1PKW A;  4F82 A;  1R4W A;  4BPY A;  2HRF A;  1XFL A;  4ZL8 A;  2L5O A;  1QQ2 A;  2PVO C;  5AIV A;  1OE8 A;  1TU8 A;  4I8B A;  2WRT A;  4XS4 A;  6GSS A;  3A5I A;  3RPP A;  2CVB A;  2H71 A;  1GSQ A;  3IV4 A;  4OWY A;  1B9Y C;  1MDI A;  1U3A A;  4YKG A;  4LA1 A;  4ZBB A;  2VOC A;  6GSY A;  4WR5 A;  2A2S A;  4PNG A;  5D96 A;  2LEG A;  4EUY A;  4PUR A;  3MNG A;  4AKX B;  3ZL5 A;  5F06 A;  2IMD A;  4HZ2 A;  4YH2 A;  1T3B A;  2YAN A;  3MIX A;  4YQM A;  4KGI A;  3LSZ A;  4HDE A;  1YKC A;  2F51 A;  5G1L A;  3ZRE A;  1F2E A;  2AAW A;  1ERT A;  3D4T A;  1B4P A;  5KN3 A;  4IVF A;  5DQY A;  4GTU A;  4Z2U A;  1Y1U A;  3CXG A;  3KXO A;  1F3A A;  1XW6 A;  3IHG A;  3RDW A;  5HR1 A;  2VCZ A;  2XPE A;  3MDK A;  2HSY A;  4XIH A;  4I2T A;  2YZU A;  5H5S A;  5J9C A;  2UV8 G;  2YZH A;  4X1U A;  5ECR B;  2GSQ A;  4GDF A;  1HD2 A;  1TK0 B;  2ON7 A;  2G0F A;  1BJX A;  1AUC A;  5IO0 A;  1SJ6 A;  3TKP A;  3H4K A;  3DML A;  3MSZ A;  3P2A A;  4PQH A;  3ME7 A;  1SD9 A;  1JZD A;  4HZ4 A;  2VCW A;  3QAV A;  1A23 A;  1ZYE A;  2TRC P;  2L59 A;  3D22 A;  4PUF C;  3M0F A;  3VK9 A;  4G01 A;  2MMZ A;  4F0C A;  2GQM A;  4KE3 A;  4GCI A;  1EGO A;  2QKE A;  3TB2 A;  1NSW A;  5CO3 A;  4N0Z A;  3TKQ A;  2NTO A;  5EVO A;  5IMD A;  3FZ4 A;  3ERW A;  3F4S A;  4G0L A;  1S3A A;  4FYC A;  5A1N A;  1FB0 A;  3ERF A;  4EO3 A;  3IDV A;  4L5L A;  1MEK A;  2VCX A;  4FQU A;  2CAQ A;  1T7P B;  4Z2R A;  3CWG A;  2VL2 A;  2B7K A;  1K0C A;  2O85 A;  3EPT A;  2CZ2 A;  1GNE A;  2GDR A;  4O92 A;  3IE3 A;  4JE1 A;  3KEB A;  4MA9 A;  1XVW A;  3R3E A;  1ML6 A;  4BL7 B;  4XHM A;  2X8C A;  4ZB9 A;  4XS6 A;  3VPT A;  2VL3 A;  3DXB A;  2I3Y A;  2GQK A;  1QK8 A;  4MAB A;  2VCV A;  1Z6M A;  2D2Z A;  2C8U A;  1G0T A;  2YP6 A;  3P90 A;  3TUE A;  2V6K A;  4K6X A;  2B5X A;  2LQQ A;  3TRX A;  4X4J A;  4N30 A;  3R2Q A;  1EV9 A;  2E7P A;  2K8V A;  5CRE A;  2XBI A;  2CA8 A;  3CTG A;  3W8J A;  2LV3 A;  2WS2 A;  4JRR A;  1SK0 A;  1ZYN A;  4I2U A;  2JSY A;  2R5G A;  5G31 A;  2ZCT A;  3KTB A;  2HSN B;  3LGC A;  2XC2 A;  1VF2 A;  2B6M A;  2F9S A;  2PGT A;  1TXU A;  2YWO A;  3DGQ A;  3FR9 A;  2H19 A;  1F6M C;  2EIQ A;  2JZS A;  5AN1 A;  5A5K A;  3LW9 A;  1PSQ A;  4OCF A;  5E4W A;  3DYR A;  2FD3 A;  3MYD A;  1SD8 A;  1DSB A;  4O5R A;  3ED3 A;  4KDU A;  2WFC A;  2OJL A;  2CVD A;  1LU4 A;  2KP2 A;  5D9T A;  4HJM A;  2H75 A;  3QD9 A;  4GXZ A;  3RHC A;  2C1Y A;  4EKZ A;  3M9J A;  1KEB A;  2PU9 C;  3IAS 2;  2AYT A;  3US3 A;  4ACS A;  5LNK e;  2DJ1 A;  4J2F A;  1KTE A;  1TI3 A;  5JWQ B;  3FZ9 A;  2OBI A;  5D9W A;  2YPM A;  3U6V A;  1Q4J A;  3G9B A;  4AI6 A;  4YQU A;  2HT9 A;  3EUR A;  2YWN A;  1O81 A;  1WOU A;  2X49 A;  3IXR A;  1RK4 A;  4I97 A;  3IK9 A;  2Z9S A;  4IKH A;  4MNN A;  6GST A;  5HFI A;  2PN8 A;  3IHQ A;  1O73 A;  1GUL A;  1QXH A;  5IPG A;  5DCH A;  1B8X A;  1NM3 A;  4K7O A;  1ZZY A;  2LRC A;  1PKZ A;  2DJ3 A;  1TJD A;  3W8S A;  1XWB A;  3GRX A;  4WBJ A;  4GSN A;  1XW5 A;  2GS3 A;  3GYK A;  4FO5 A;  2O7K A;  1BF5 A;  2OAD A;  4K7N A;  1GRX A;  4EE0 A;  1YZX A;  2R0C A;  2B5E A;  1FVK A;  2WZ9 A;  3J7Y k;  4IN0 A;  2YV7 A;  2ES7 A;  1BG5 A;  3KH7 A;  1A24 A;  1N25 A;  3LOR A;  1A2J A;  5IMV A;  1PL1 A;  4FH8 A;  2AJQ B;  1EOH A;  3IA1 A;  4FYB A;  1U6T A;  5ECP B;  2IMK A;  4LL4 B;  1R5P A;  4POB A;  3HCZ A;  3BJ5 A;  3KMN A;  5IM9 A;  2AHE A;  3HJO A;  5B6M A;  2N5A A;  2I1U A;  1M9B A;  3E9J B;  1QUW A;  2B1L A;  3S9F A;  2N5B A;  4PQI A;  3CRT A;  4K1F A;  2L6C A;  3QR6 A;  4NV2 A;  2P0G A;  13GS A;  4GQF A;  1V58 A;  3FZA A;  4ZBD A;  4PX1 A;  3IR4 A;  1GL8 A;  4G0I A;  4V1A p;  4ECI A;  5A4V A;  2B3S A;  2IJY A;  3ZRD A;  2HNL A;  1RQM A;  3EU3 A;  1X9W B;  3I6A A;  2NVL A;  3APS A;  4MJC A;  10GS A;  4MDC A;  2HSM B;  3A3T A;  4Z2T A;  2FWG A;  3ZLP A;  4JU5 A;  1PRX A;  2H1B A;  3IBH A;  4MF6 A;  2ZUP A;  3BCI A;  4EL1 A;  1EP7 A;  4TXO B;  3H8Q A;  4KA0 A;  4TRX A;  2IIY A;  3HZ4 A;  1KNG A;  2VO4 A;  2IFQ A;  1AW9 A;  5J4Y A;  2FHE A;  2E2M A;  1UA5 A;  2YWI A;  2QA2 A;  4HU9 A;  4G9H A;  5J40 A;  1WJK A;  5C00 A;  1ABA A;  4MZC A;  2JAC A;  2HRK B;  2RLI A;  3QCP A;  1GTI A;  5F0G A;  5DAK A;  5ID2 B;  5DCG A;  1Z9H A;  1OC9 B;  1EV4 A;  2HLS A;  4XCS A;  2X4A A;  2C0G A;  4CDO A;  2NBS A;  4BVY A;  1S3C A;  4D73 A;  1A0F A;  2PPT A;  1Y25 A;  1NW2 A;  1BG1 A;  1K0D A;  1VF4 A;  4Q5Q A;  3C8E A;  4NXI A;  3HA9 A;  4BA7 A;  1SVO A;  5JCW A;  2VL9 A;  4CHS A;  5IIZ A;  4K2D A;  3EVI A;  3NZN A;  2JZT A;  1SL1 B;  5D93 A;  2IMF A;  2M72 A;  3BCK A;  3C73 A;  4FIW A;  3L9V A;  2I9H A;  1YKA A;  1FOV A;  3A5W A;  5J5N A;  1KBN A;  3FZ5 A;  4CW9 A;  1XPV A;  2G2Q A;  1XZO A;  2K6V A;  3C71 A;  5D73 A;  4XS4 B;  4O32 A;  2CV4 A;  2WDU A;  1ERU A;  3SBC A;  2OE3 A;  1J0F A;  1J9B A;  3P7X A;  2HXK A;  1NHY A;  4IEL A;  3TOU A;  3GUS A;  3C1S A;  3TU3 B;  2GLR A;  3QFB C;  3GMF A;  1YEP A;  2VIM A;  3DVX A;  1PL2 A;  5KN2 A;  1F3B A;  1JLV A;  3F4T A;  2TRX A;  5HFK A;  1QMV A;  4ML6 A;  1X9M B;  5L71 A;  1VF1 A;  1K3O A;  2EFH A;  3FY7 A;  4J56 E;  3ZML A;  1TRW A;  4WEY A;  3TJB A;  3P8W A;  2PUK C;  2EFE A;  3F6D A;  1E2Y A;  3ZVJ D;  1FO5 A;  5AGY A;  1HNB A;  1TU7 A;  4KUN A;  2R3X A;  5ECI B;  3TKR A;  4I5Q A;  4L0W A;  3GTU B;  3N5O A;  5BMU B;  3LQ7 A;  4V2M A;  3ZYW A;  1O8X A;  2FWE A;  4LMW A;  2O8V B;  4QL9 A;  4OCE A;  3KD0 A;  2PER A;  1X5D A;  3APO A;  4DSR A;  2H0H A;  3GL5 A;  1TOF A;  4MZW A;  20GS A;  1X0R A;  1JHB A;  2OKA A;  3QPM A;  3GN3 A;  4KND A;  1K0O A;  4IW9 A;  1X5E A;  1M2A A;  3UJ1 A;  4IHU A;  4MJB A;  3ZIT A;  4X0X A;  2MBS A;  1B48 A;  5A5H A;  1TK5 B;  2XBQ A;  5JWR B;  5ECH B;  2GGT A;  4HOJ A;  4K0G A;  4F9Z A;  4O7H A;  2K18 A;  5IMZ A;  1GTU A;  3GH9 A;  11GS A;  1ON4 A;  2HZE A;  1IYH A;  1TI1 A;  3L9S A;  1SKR B;  2CQ9 A;  3O3T A;  5CRW A;  4NPB A;  3A2V A;  3ZVJ A;  4AKI A;  5KN1 A;  3Q6O A;  3UAR A;  5A1N B;  1TK8 B;  1YVL A;  5ELG A;  3KM6 A;  2QGV A;  4EIP A;  3GH6 A;  3D21 A;  2H1L A;  3GUR A;  4OD7 A;  12GS A;  1N2A A;  3PGT A;  4P3Y B;  3M8N A;  1EEJ A;  2O87 A;  1V57 A;  4FYU A;  4JR4 A;  3UOM A;  3ME8 A;  4TR1 A;  1PQN A;  2KHP A;  4EDY A;  1DE1 A;  5ECM B;  2IWT A;  4MH3 A;  4EVM A;  1UC7 A;  1O8W A;  4IP1 A;  2DLX A;  2P5Q A;  2P5R A;  3VPQ A;  4N11 A;  1AQW A;  4JBB A;  8GSS A;  5F07 A;  3EU4 A;  1ACV A;  3ZZX A;  4PXO A;  4KAE A;  5G5F A;  4KH7 A;  1GSF A;  3PPU A;  3F9U A;  5CRG A;  2GTU A;  1M0U A;  1OVN A;  2MMA A;  1YQ1 A;  2H0G A;  5J3R A;  3L9U A;  3QOU A;  1MDK A;  2IN3 A;  1O6J A;  5DBQ A;  3EMX A;  2LTK A;  4KX4 A;  5KN0 A;  2WCI A;  5JCU A;  2FCH A;  1EWX A;  3GKN A;  4MPF A;  4WF5 A;  1XWA A;  3H79 A;  2H6Z A;  2YJ7 A;  2V32 A;  3DRN A;  1A2M A;  4EXJ A;  4DVC A;  4N0V A;  4IQ1 A;  5AIS A;  2B1K A;  4MF5 A;  1PN9 A;  4XS1 A;  3M9K A;  2RUF A;  4KSM A;  2I81 A;  3TKS E;  1O85 A;  2FUG 2;  4TOP A;  2J9H A;  4L8E A;  4E8E A;  3CBU A;  4G2E A;  4CY6 A;  1URM A;  2H8L A;  3TKS C;  3M3M A;  1XWC A;  2HSH A;  1E6B A;  5EY6 A;  1SEN A;  3EYT A;  1PA3 A;  2GSR A;  2RII A;  1PN0 A;  1ZL9 A;  2KOK A;  3HY2 A;  1GLQ A;  2C4J A;  3UBK A;  1YY7 A;  1J08 A;  1LJR A;  4XTS A;  3F3R A;  2JSZ A;  3DKS A;  3APQ A;  4JZQ A;  3LFL A;  1WWJ A;  5C04 A;  3ZIJ A;  3GST A;  4XRD A;  4BL7 A;  4EC0 A;  1I5G A;  1FOH A;  5ECL B;  3GA4 A;  1YF1 A;  3HYP A;  4K2X A;  3VI5 A;  5B8B A;  5JCG A;  1NHO A;  2R6K A;  3VI7 A;  4K7I A;  3KMO A;  4MMM A;  3FK8 A;  4GRF A;  2REM A;  2L5L A;  1TP9 A;  3QMX A;  3HHV A;  3VWV A;  2H72 A;  1PGT A;  5IOX A;  3EE2 A;  3D6I A;  4BVX B;  2FNO A;  4NWY A;  4HS1 A;  1WPI A;  1BAY A;  1XOA A;  3UVT A;  3I9V 2;  4ZL9 A;  4ZXG A;  2AB6 A;  3MAK A;  1EOG A;  4IBP A;  1Z6N A;  1R26 A;  3PIN A;  2JAD A;  1X9S B;  4BWS A;  1ZYP A;  4MH2 A;  3VWW A;  1ST9 A;  3TJG A;  1AQX A;  5ABR A;  4KCA A;  3F8U A;  1M2B A;  4HUA A;  4EDZ A;  2P31 A;  1GP1 A;  1QGV A;  5B7C A;  2K9F A;  4TXV A;  1EP8 A;  3HJM A;  3FR3 A;  4V1A g;  2YCD A;  22GS A;  3L78 A;  4JED A;  2M80 A;  2OT3 A;  3LXT A;  1M99 A;  1PD2 1;  2MMN A;  4CY8 A;  2HI7 A;  2HQT A;  2FWH A;  1LBK A;  4ZB7 A;  2DKH A;  2XHF A;  1G6W A;  1X5C A;  4NV5 A;  3IAM 2;  3KCM A;  4AGS A;  1EGR A;  4TR0 A;  5ELA A;  1ERW A;  2X8H A;  3ZFB A;  3SWL A;  5ECK B;  2H74 A;  1CQG A;  5J41 A;  4TVE A;  4H86 A;  5B8A A;  3DD3 A;  2VAF A;  4POL A;  4WR4 A;  6GSU A;  4HQS A;  1OKT A;  3FKF A;  2CZ3 A;  1T00 A;  1WP0 A;  2IL3 A;  5A34 B;  2FGX A;  4K8M A;  5HQP A;  3F0I A;  1XXU A;  4DSS A;  1AC1 A;  2LJK A;  4QL7 A;  4F2I A;  4ZL7 A;  1SVL A;  5FWG A;  2V2G A;  4KW6 A;  5HR3 A;  4JR6 A;  2OA7 A;  1MD3 A;  2WUL A;  2LRT A;  1BED A;  3FHK A;  3KJY A;  3GKM A;  4K5R A;  4WXT A;  3TCO A;  2LS5 A;  1N8J A;  4NAX A;  5GAP D;  4I6X A;  2BJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...