5JCWA

Crystal structure of hgstp1-1 with glutathione adduct of phenethyl isothiocyanate
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
209
structure length
209
Chain Sequence
PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase P
publication title Irreversible Inhibition of Glutathione S-Transferase by Phenethyl Isothiocyanate (PEITC), a Dietary Cancer Chemopreventive Phytochemical.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5jcwA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5jcwA01
2FNOA 2F8FA 1G7EA 1OKDA 5GSTA 2H74A 3C1RA 1VF1A 4LMVA 4PNGA 2OADA 4MJBA 4N11A 4MCUA 2VL2C 2G2QA 5D9VA 1GULA 4ECIA 3QR6A 4GF0A 4IP1A 2LTKA 2I9HA 3KXOA 2NTOA 2I3YA 4G10A 1TK8B 3CSIA 3LORA 1GTBA 2G0FA 2XC2A 1SK1A 5IMCA 4XHMA 2C3QA 1AUCA 2R6KA 3HVSA 3OR5A 3M3MA 4KDXA 3L9VA 2KOKA 1T00A 3DVWA 3KP8A 4WKWA 4IGJA 5B8AA 5L71A 1XOAA 2L6CA 4ILFA 4XIHA 4XRAA 1XPVA 4ECCA 4HZ2A 1PL1A 2VO4A 4F2IA 2B3SA 3KMNA 1ERVA 3MNGA 3VPTA 1SU9A 3MSZA 3BCKA 5J9CA 4Q5QA 4P3YB 2HFDA 4ZILA 3EMPA 16GSA 5DCGA 4IP6A 2LQOA 3FEUA 1TXXA 2VL2A 2VLTA 2D2ZA 2E0QA 3F6FA 2AYTA 1U6TA 1JFUA 1JZWA 1RQMA 1FB0A 1KTEA 3GIXA 4CW9A 1XW6A 2JL4A 4V2LA 5B6MA 1SJZA 2HSMA 5DDLA 2VL3A 3KD0A 1MD4A 2I81A 2L59A 5B6NA 2B5YA 3KMOA 4HZ4A 3N5OA 1J0FA 2FWFA 3WD6A 4AGSA 3CMIA 3US3A 1GUMA 4ZL8A 3EMXA 2CVBA 2K9FA 5IO0A 2DIZA 5EY6A 3GKXA 1S3CA 2K8SA 1THXA 1X5EA 3IA1A 3C1SA 1Z3EA 1EEJA 2WS2A 3BCIA 3U6VA 3C7MA 5CRHA 5LNKe 3GHAA 4MPGA 2HRAA 3KM6A 3VURA 1G0TA 3TDGA 2FUG2 1WOUA 3ME7A 3RPNA 3QPMA 1Z6MA 1OKTA 2H75A 2DJ1A 2PGTA 2B1KA 4KH7A 1M9AA 3DIEA 4RI7A 5KEJA 3C73A 4DSSA 3IAS2 4G2EA 4ID0A 2VOCA 1HNAA 3UARA 3IK9A 4EUYA 4X1UA 5GAND 1HQOA 4KCEA 3TKPA 2ZNMA 4TOPA 4ZXGA 1XCCA 4G0IA 4AJ7A 5DVBA 2XHFA 1E2YA 1Z7PA 3IAM2 4EF0A 1PMTA 3LJRA 5AISA 1OE8A 4K7NA 2VIMA 5HR2A 4ACSA 2OE1A 1VF3A 3EE2A 3TRXA 3HD5A 2O87A 1B4PA 2IFQA 4GXZA 5E59A 1SYXA 3FZ9A 4OCEA 19GSA 2YZUA 1H4OA 2HI7A 1XWGA 1V58A 4KB3A 3CBUA 3RHCA 2FGXA 4XS6A 1G6YA 2BMXA 1G7OA 3HJPA 5ABRA 1M9BA 4LL1B 1M99A 4EL1A 2YWOA 1ZYQB 1T8EB 3CSHA 4BVYB 4HU7A 1ERTA 1EWXA 2R37A 1G6WA 3GX0A 1F6MC 5A4WA 1BX9A 4H86A 2HRFA 1GSQA 3EINA 2JACA 2J23A 2IMDA 1TU7A 3ZL5A 3Q6OA 5LCZA 1TKDB 4Q5FA 1RK4A 1T1VA 1PGTA 3KP9A 5JWQB 3RDWA 3L4NA 1V9WA 1SK2A 1T4ZA 2B5EA 2MMOA 4ZB9A 3AY8A 3UBKA 1I5GA 1Z5YE 4NMUA 2V32A 2YJHA 2XBQA 2ES7A 4IVFA 1EZKA 1TRSA 3ZIVA 1W4VA 1R7HA 1TP9A 2LJRA 1PL2A 2PWJA 1BJXA 3HZ4A 2KHPA 4EC0A 4GTUA 1A0FA 4LLRA 4IJIA 2DJJA 3UEMA 4WEYA 1PKWA 4NV2A 1TK0B 2KLXA 1DUGA 2B1LA 4MDCA 2H66A 1A2LA 2YJ7A 4MZWA 3GX8A 3RAZA 2KP2A 1FVJA 2XPEA 5D93A 5JWRB 4ZL9A 4I5QA 2H19A 4PUFC 5KN1A 2DC5A 1WMJA 3LXZA 1WPIA 3IXRA 1MD3A 4ZB8A 4WBRD 2L5LA 2CA8A 5CYYA 5CRWA 1XIYA 1ZL9A 3UIWA 1B8XA 1HNCA 1X9MB 5DQSA 3IR4A 4XTSA 2WDUA 2C0DA 1XWCA 1YJ6A 2LQQA 4KF9A 2IMKA 3QCPA 3HXSA 1S3DA 2YPMA 1KEBA 2JZSA 1TU8A 2H70A 2YP6A 3TJKA 1FOVA 3L9SA 3FR3A 2MMAA 3VI5A 2GZYA 4E8EA 3IC4A 1YQ1A 3ISOA 1GUKA 3QOUA 1ZCPA 2AJQB 5IMDA 4MPFA 4OWYA 3TUEA 2DJ2A 3FHKA 1O81A 2PPTA 3GL5A 1HD2A 2HQTA 5C00A 4ZIJA 3GRXA 5F05A 1K0OA 4BL7A 4ML6A 3C71A 5IMVA 1M2AA 1X5DA 1X0RA 5ECKB 4TW5A 2VD1A 2P5RA 4NV5A 2GZZA 3IBHA 1VRSD 2GTUA 2F9SA 1KNGA 4WBJA 2RUEA 4G9HA 3W8JA 1O85A 3TKSC 1GTIA 3FZ4A 1AC1A 4OO4A 3TKRA 2FWHA 4Q5NA 1AXDA 2Z9SA 5G31A 4L5LA 4BWSA 1K0MA 3ZIJA 4PXOA 4DVCA 1OAZA 4EXJA 1R5PA 3BD2A 2FHEA 1Y25A 3APQA 2WCIA 1FB6A 2HSNB 2YANA 2I1UA 4IQ1A 2DBCA 2OBKA 4LMWA 4TRXA 2HXKA 2YZHA 4NWYA 3ERWA 5F0GA 3VWWA 2PERA 1ML6A 4BVXB 2YWMA 2IL3A 4PQ1A 5DBQA 2AHEA 1J9BA 1UC7A 4GSNA 4KAEA 5CRGA 3TKSA 1NM3A 1PKZA 2ALBA 2C3TA 4TVEA 1SKWB 5F8BA 1JZOA 3O76A 4WF4A 4YQVA 1OE7A 5HFGA 2YWNA 2GGTA 4KUNA 5HR0A 2CVDA 3I69A 1EEMA 3D21A 4K8MA 1LBKA 4MH2A 3HVXA 2GSRA 2IN3A 1XWKA 4BVYA 1MDKA 5IIZA 5IPGA 18GSA 5A5KA 2BJXA 3I9V2 2F51A 2EC4A 3F4TA 4V2MA 4MK3A 4WF5A 1FO5A 1F3BA 2RUFA 1X9WB 4GRFA 1USBA 3IRAA 4GSSA 2LJKA 5D9TA 3ZYWA 4MF5A 1QFNA 3BOAA 3GH6A 1SKSB 4IELA 4PGTA 4ZBAA 3M9JA 3V1WA 5JWOB 1W89A 4O32A 3QFBC 1EV4A 3LSZA 4IN0A 2C4JA 2R4VA 3F3QA 4K0GA 3O6TA 1K3OA 3G7JA 3TCOA 3DKSA 1YEXA 3DWVA 3KCMA 3W6GA 1VGLA 5FWGA 2DIYA 4POLA 4HQZA 4OD7A 2DMLA 4N0ZA 3KEBA 1VF2A 1U3AA 4ULXA 3KH7A 4Z7XA 3VWXA 1X9SB 3NIVA 1R5AA 5ELGA 5CAXA 3GH9A 4ECBA 1MTCA 1GSFA 4J2FA 3UL3A 2LJAA 3F0IA 4EE0A 1SJIA 1NW2A 1A0RP 3GYKA 1XXUA 3EYTA 3QAGA 2PUKC 2BTOT 2B5XA 1Q4JA 3I6AA 1B4QA 1U3IA 1GNWA 3DGQA 5ECSA 5ENUA 2CAQA 5HFKA 1O7UA 3DRNA 4EKZA 4KE3A 3HZ8A 2V41A 1TW9A 4MZBA 1T7PB 1NHYA 3KGKA 7GSSA 13GSA 4L0UA 4ZBDA 3GKMA 5IQYA 1K0DA 2GZPA 3FRCA 3VLNA 1RW1A 1QXHA 4IJ3A 4BL7B 1SYRA 2X8CA 3KZQA 5CRDA 1OVNA 4NHWA 1BEDA 4V1Ag 2OJLA 1K3YA 1MDJA 4GSTA 3MWHA 2JSZA 2H01A 4AJ6A 3TKSE 4PX1A 3O3TA 1J08A 1F3AA 3ZREA 3KTBA 1GUHA 2N5AA 3QDNA 5G1KA 4YQUA 4MZCA 3D4MA 1B48A 3CTGA 4GQCA 3PGTA 1GRXA 1QK8A 2DJ3A 3QMXA 4XRDA 6GSWA 11GSA 5A4UA 4JRRA 3N9JA 4MJCA 3E3EA 3WGXA 3ZFLA 1XZOA 2ON5A 3ERGA 2ON7A 1Y6EA 4IKHA 3EVIA 1A8LA 1ZMAA 4NPBA 4MJAA 4ZL7A 1MEKA 2O85A 5H5RA 2AUVA 2EIOA 2PU9C 3ZVJD 2H0HA 3GKKA 5GSSA 3TRQA 3UBLA 2L5OA 1WJKA 4F82A 2HE3A 2GT6A 5CO3A 2JU5A 2E2GA 2OA7A 3HJMA 2IMEA 5IMZA 4I6XA 1QMVA 3F4SA 3ERFA 1YZXA 4KSMA 1PQNA 2H0IA 1NSWA 1K0NA 3EC3A 1K3LA 3GTUB 2YWIA 3W8SA 3LWAA 1N8JA 4BWQA 4BVXA 5ELAA 2FLSA 1ILOA 1JHBA 4KDUA 4PQIA 2DJ0A 2R3XA 3P90A 3HCZA 4FQUA 5ECLB 4TR1B 2MBTA 4I97A 1NHOA 3H8QA 4HQSA 5J3RA 2FWEA 4FYBA 4KGIA 2TIRA 1AQXA 4NXIA 4FIWA 1FG4A 1XOBA 5IM9A 2FY6A 4O92A 4ZBBA 5JCWA 3TRPA 2AB6A 2VLUA 3F3RA 4FH8A 1GSDA 1AIUA 8GSSA 3PPUA 5HFIA 1SD8A 2LUSA 2H73A 3D22A 2LNTA 2C0GA 1I9DA 3H79A 3IC8A 4QQ7A 4RUVA 3EU3A 4JR4A 5KN0A 3A5WA 1Z9HA 1XVQA 4HJ2A 2C1YA 3D0ZA 1AQWA 3S9FA 1AQVA 4K7IA 1ZYEA 3QAWA 4OFTA 1YY7A 1EOHA 3LYKA 4X43A 4JEDA 4K9ZA 1AW9A 2CT6A 2P31A 4K2DA 5KN2A 2PN8A 3DXBA 5J4UA 3CXGA 2HLSA 5DALB 1V57A 5FHIA 2H1DA 4TR0A 1SJ6A 2IIYA 1ACVA 4QL7A 4HJMA 2NPBA 4ECJA 5G5FA 5G2ZA 4OCFA 4HOJA 2GSQA 4D73B 2DJKA 2DLXA 3F8UA 5BMUA 3J7Yb 4FYCA 2V6OA 1YDKA 2YV7A 3ZLPA 4KSOA 4WETA 4HU9A 3K8NA 1CQGA 4L0WA 4XS4B 3MAKA 4TN8A 3A2WA 4TXVA 2YOIA 3F9UA 4G19A 9GSSA 4DSRA 4KNDA 2C8UA 3HJOA 2RIIA 1JLVA 1Z7RA 2H30A 3TOUA 2IMFA 5D8IA 1B9YC 2CQ9A 1EGOA 3LXTA 2FCHA 2VD0A 3M0FA 4L5OA 2VCWA 3KH9A 4K0NA 2K6VA 1T4YA 2CV4A 2LRCA 2HYXA 2N5FA 3APSA 2A4VA 4TXOB 3P2AA 4ZB6A 2HT9A 1M7TA 1SL0B 2GDRA 2M80A 1THOA 2VCZA 1LU4A 3QFAC 2H8LA 3ZITA 1HYUA 2MYGA 2WRTA 1A23A 2IJYA 3M8NA 3KTLA 4MF6A 4L8EA 2LRNA 2F8AA 2F3MA 1XWBA 3RPPA 3GN3A 3ZFBA 5ECPB 2L4CA 2I4AA 3TOTA 4MA9A 2YV9A 2DMMA 2XBIA 6GSUA 4HUAA 2WZ9A 3P7XA 4KX4A 2VUPA 1FHEA 2YCDA 5ID2B 2H0GA 2GQMA 3GSSA 2WFCA 5ECNB 4MLYA 2IWTA 4AJ8A 2EIRA 2EIQA 1SL2B 4F0CA 3VPQA 1EV9A 2NDOA 2TRCP 2K8VA 2ZUPA 5DCHA 4Q5RA 2WB9A 4GLTA 4QL9A 2P5QA 3FZ5A 3WT1A 4YH2A 4BPYA 4PUAA 5HQPA 2WJUA 2HRKB 2MBSA 2LKUA 1O8XA 1GL8A 3H4KA 3LGCA 2QGVA 2X8GA 3RBTA 3HHVA 2L6DA 5C04A 1VF4A 2OKAA 2TRXA 3IDVA 4IQAA 3C8EA 4DSQA 2K18A 5IOWA 3GTUA 4CDOA 4EDYA 2O89A 3F63A 3GL3A 3FKFA 4GCIA 4JZQA 2JZTA 4PURA 4KDYA 3JCML 1GNEA 3VK9A 4J57E 4POBA 1UVZA 1XVWA 2H1GA 5DAKB 3FW2A 5D9WA 3FYGA 1A2MA 2A2SA 3FK8A 3UMAA 4N0VA 3ZMKA 4V2NA 4TR1A 2CZ3A 5D9XA 2YNXA 2C0FA 4XS1A 4EVMA 4YAPA 4X0XA 1BG5A 6GSVA 1A8YA 3DYRA 1K0BA 5B8BA 3GKNA 2VAFA 1ZZYA 4MMMA 4I2TA 4I2UA 4POMA 4NAXA 4YQMA 6GSTA 1TDIA 4EDZA 1A2JA 3F6DA 1WIKA 1YF0A 5EL8A 4PQHA 2H71A 2HZEB 2VM1A 5D73A 3DMLA 3UVTA 2LS5A 1GP1A 4FYUA 3RHBA 5FT3A 5F07A 1IYHA 3GSTA 1GSUA 3G9BA 10GSA 4G0KA 2JZRA 4OFNA 2OE0A 4LL4B 3MDKA 3Q74A 3D5JA 2C3NA 2WULA 2VL9A 3IOSA 1ZGNA 2OE3A 3BBYA 1R26A 1F37A 4IHUA 4V1Ap 1EP8A 5J5NA 1ERUA 1URMA 3PH9A 1V2AA 5DALA 3UVHA 4DEJA 1FVKA 2LNSA 3L9UA 1Z6NA 4IS0A 2VM2A 3APOA 2HNLA 3A3TA 1YF1A 1FAAA 2E2MA 2H72A 1Q98A 3J7Yk 2GS3A 1BQ7A 4D73A 2QC7A 1OC9B 3G7YA 2FWGA 2MMZA 1B9XC 2HRNA 3IHQA 1GTAA 4TR3A 5J41A 3LEFA 1H75A 3D6IA 1GH2A 2X99A 5DJLA 3U5RE 3FY7A 1ST9A 4LA1A 2FD3A 4GQFA 2VCTA 1JZDA 4XS4A 5JCUA 3DVXA 3ZMLA 1R4WA 2QSIA 5ECHB 2OBIA 3DD3A 1V98A 3DEXA 3CYNA 3VI7A 3TKQA 3WGEA 1GTUA 2A2RA 1WE0A 2N5BA 2VLVA 2M46A 4IBPA 2V1MA 4TXOA 14GSA 4MF7A 3GNJA 1EGRA 1X5CA 1BAYA 4JE1A 4OFMA 4TR4A 1OC8A 1TRUA 3LFLA 2RM5A 3SBCA 4USSA 4MJEA 4RQRA 5J9BA 1IYIA 2O8VB 2GVPA 3NOFA 5AIXA 3LG6A 5G5EA 2KUCA 4MP4A 3P8WA 4CHSA 5IMFA 1XWAA 2PVQA 5ID2A 1JZRA 3Q19A 5AGYA 2L4QA 1SK0A 1DE1A 6GSXA 2WGRA 3HA9A 5E4WA 2HZFA 1N2AA 12GSA 3TGZA 5INYA 1AAZA 4HEA2 5EPFA 5H5SA 1EP7A 5GAPD 2PMTA 3D4TA 2P0GA 4HS1A 1XBSA 2CVKA 4PNFA 2LV3A 3UAPA 6GSSA 4MABA 1T3BA 1QUWA 3CRUA 2HRKA 1QGVA 1ZOFA 3UJ1A 5KN3A 1LJRA 6GSYA 3E9JB 2CAIA 2GT5A 1XW9A 4AF2A 1M2BA 1ABAA 1GLQA 2ZCTA 4FO5A 4KCAA 1PX6A 3Q18A 5H5QA 1TJDA 2VCQA 2B6MA 3A2XA 4OMVA 5EVOA 1PD21 2H6YA 3ZTLA 3HVVA 1S3AA 1E6BA 3IE3A 4O5RA 4PTSA 3EURA 3HYPA 3ZVJA 2C0EA 1F9MA 1TK5B 5DAKA 1WWJA 22GSA 1C72A 4N10A 2H6XA 5ECIB 1QQ2A 3ED3A 2GLRA 4F03A 4I8BA 3M9KA 4KW6A 5F06A 3NZNA 1TI3A 4WR5A 2V6KA 4JR6A 4KA0A 3TJBA 3EU4A 5HR1A 2R5GA 1WRYA 1ON4A 1JLWA 3HY2A 3GUSA 2IPAA 1PA3A 5AN1A 2PVOC 1SD9A 3BJ5A 1M2DA 2DSAA 4RI6A 2HZEA 4NHZA 4OO5A 4POKA 2QKEA 3H93A 20GSA 3GURA 4HI7A 3HDCA 4ML1A 1WP0A 3G7IA 2GSSA 2FA4A 1PX7A 2MZCA 2IMIA 2VCXA 3KJYA 5IPHA 2PBJA 5JCGA 2HSHA 4O7HA 5CREA 3KIJA 5DJMA 1F2EA 2AAWA 2E7PA 2HSMB 2HSYA 2GSTA 2LEGA 1K0AA 1HNBA 1MDIA 1XFLA 4WXTA 2B7JA 1V40A 3TJFA 2REMA 1SKRB 2X64A 5AIVA 4K6XA 5G1LA 1UA5A 1M0UA 4F9ZA 3EWLA 3ZZXA 2GQLA 1SENA 3SWLA 5DQYA 1O6JA 4E8HA 1GSSA 2VCVA 2X8HA 1YKCA 1K0CA 3QAVA 2MMNA 1O8WA 1EOGA 1OC9A 2CX4A 2CZ2A 4GWRA 3I43A 1YKAA 2C80A 3CRTA 1XW5A 3GA4A 5CP1A 1PRXA 2H1BA 1OC3A 3TJGA 1DE2A 1TOFA 3E0UA 3H1NA 5ECMB 4IW9A 1GWCA 1CQHA 1OYJA 2H76A 1FW1A 2LRTA 4ISDA 4RQXA 4F0BA 2JSYA 3VWVA 2AV4A 3FR9A 4K7OA 5D96A 3UOMA 5GZZB 4G0LA 5A4VA 3GFKA 4HDEA 1TI1A 4DSSB 4EO3A 1U87A 2XPDA 3WYWA 1U88A 1DBYA 2KP1A 3ZRDA 2YN1A 3FR6A 3IK7A 4JU5A 1SL1B 2O7KA 1A24A 5B7CA 3PINA 4TKYA 4BA7A 1GSEA 1YEPA 2B7KA 2RLIA 2GQKA 4JBBA 3R2QA 2FA8A 2OACA 4YAVA 4N30A 3IPZA 3L78A 4MH3A 3WGDA 1PSQA 3HKRA 2IFQB 3GMFA 5ECRB 2CX3A 2L57A 3TB2A 4XCSA 5LD0A 5IMAA 3GV1A 5ECQB 1PN9A 4WR4A 3VFIA 3CSJA 2NBSA 4J56E 3PR8A 3LQ7A 1TRVA 3L0HA 1UN2A 17GSA 3LYPA 2J9HA 2V2GA 3R3EA 5CNWA 3WT2A 1BYEA 5IO2A 2LSTA 2M72A 3QD9A 5G30A 1KBNA 1GSYA 4K1FA 3FZAA 1O73A 2UZ8A 5IOXA 3CTFA 2NVLA 5HR3A 3VWUA 3TJJA 1DSBA 3IV4A 3F4RA 3M1GA 5ECOB 5COHA 2R2JA 1GLPA 2H1AA 1TRWA 2RM6A 3A2VA 2H6ZA 2JADA 3ME8A 1ERWA 1TTZA
chains in the Genus database with same CATH superfamily
2FNOA 2F8FA 1G7EA 1OKDA 1FOHA 5GSTA 2H74A 3C1RA 1VF1A 4LMVA 4PNGA 2OADA 4MJBA 4N11A 4MCUA 2VL2C 2G2QA 5D9VA 1M3IA 1GULA 4ECIA 3QR6A 4GF0A 4IP1A 2LTKA 2I9HA 3KXOA 2NTOA 2I3YA 4G10A 1TK8B 3CSIA 3LORA 1GTBA 2G0FA 2XC2A 1SK1A 5IMCA 4XHMA 2C3QA 1AUCA 2R6KA 4K5SA 3HVSA 4G01A 3OR5A 3M3MA 4KDXA 3L9VA 2KOKA 1T00A 3DVWA 3KP8A 4WKWA 4BIKA 4IGJA 5B8AA 5L71A 1XOAA 2L6CA 4FXYP 4ILFA 4XIHA 4XRAA 1XPVA 4ECCA 4HZ2A 1PL1A 2VO4A 4F2IA 4YKGA 2B3SA 3KMNA 3IHGA 1ERVA 3MNGA 3VPTA 1SU9A 3MSZA 3BCKA 5J9CA 4Q5QA 4P3YB 2HFDA 4ZILA 3EMPA 16GSA 5DCGA 4IP6A 2DKHA 2LQOA 3FEUA 1TXXA 2VL2A 2VLTA 2D2ZA 2E0QA 3F6FA 2AYTA 1U6TA 1JFUA 1JZWA 4HSCX 1RQMA 1FB0A 1KTEA 3GIXA 4CW9A 1XW6A 2JL4A 4V2LA 5B6MA 1SJZA 2HSMA 5DDLA 2VL3A 4CY8A 3KD0A 1MD4A 2I81A 2L59A 5B6NA 2B5YA 3KMOA 4HZ4A 3N5OA 5J47A 1J0FA 2FWFA 3WD6A 4AGSA 5A5HB 3CMIA 3US3A 1GUMA 4ZL8A 3EMXA 2CVBA 2K9FA 5IO0A 2DIZA 5EY6A 3GKXA 1S3CA 2K8SA 1THXA 1X5EA 3IA1A 3C1SA 1Z3EA 2VKZG 1EEJA 2WS2A 3BCIA 3U6VA 3C7MA 5CRHA 5LNKe 3GHAA 4MPGA 2HRAA 3KM6A 3VURA 1G0TA 3TDGA 1BG1A 2FUG2 1WOUA 3ME7A 3RPNA 3QPMA 1Z6MA 1OKTA 2H75A 2DJ1A 2PGTA 2B1KA 4KH7A 1M9AA 3DIEA 4RI7A 5KEJA 3C73A 4DSSA 3IAS2 4G2EA 4ID0A 2VOCA 1HNAA 3UARA 3IK9A 4EUYA 4X1UA 5GAND 1HQOA 4KCEA 3TKPA 2ZNMA 4TOPA 4ZXGA 1XCCA 4G0IA 4A5PA 4AJ7A 5DVBA 2XHFA 1E2YA 1Z7PA 3IAM2 4EF0A 1PMTA 3LJRA 5AISA 1OE8A 4K7NA 2VIMA 5HR2A 4ACSA 2OE1A 1VF3A 3EE2A 3TRXA 3HD5A 2O87A 1B4PA 2IFQA 4GXZA 5E59A 1SYXA 3FZ9A 4OCEA 19GSA 2YZUA 1H4OA 2HI7A 1XWGA 1V58A 4KB3A 3CBUA 3RHCA 2FGXA 4XS6A 5A34B 1G6YA 2BMXA 1G7OA 3HJPA 5ABRA 1M9BA 4LL1B 1M99A 1TXUA 4EL1A 2YWOA 1ZYQB 1T8EB 3CSHA 4BVYB 4HU7A 1ERTA 1BF5A 1EWXA 2R37A 4AKIA 3HVNA 1G6WA 3GX0A 1F6MC 5A4WA 1BX9A 4H86A 2HRFA 1GSQA 3EINA 2JACA 3MYDA 2J23A 2IMDA 1TU7A 3ZL5A 3Q6OA 1SVMA 5LCZA 1TKDB 4Q5FA 1RK4A 1T1VA 1PGTA 3KP9A 5JWQB 3RDWA 3L4NA 1V9WA 1SK2A 2EFHA 1T4ZA 2B5EA 2O36A 2MMOA 4ZB9A 3AY8A 3UBKA 1I5GA 1Z5YE 4NMUA 2V32A 2YJHA 2XBQA 2ES7A 4IVFA 1EZKA 1TRSA 3ZIVA 1W4VA 1R7HA 1TP9A 2LJRA 1PL2A 2PWJA 1BJXA 3HZ4A 2KHPA 4EC0A 4GTUA 1A0FA 4LLRA 4IJIA 1SVOA 2DJJA 3UEMA 4WEYA 1PKWA 4NV2A 1TK0B 2KLXA 1DUGA 2B1LA 4MDCA 2H66A 1A2LA 2YJ7A 4MZWA 3GX8A 3RAZA 2KP2A 2X4AA 1FVJA 2XPEA 5D93A 5JWRB 4ZL9A 4I5QA 2H19A 4PUFC 5KN1A 2DC5A 1WMJA 3LXZA 3HMJG 1WPIA 3IXRA 1MD3A 4ZB8A 4WBRD 2L5LA 2CA8A 5CYYA 5CRWA 1XIYA 4CY6A 1ZL9A 3UIWA 1B8XA 1HNCA 1X9MB 5DQSA 3IR4A 4XTSA 2WDUA 2C0DA 1XWCA 1YVLA 1YJ6A 2LQQA 4KF9A 2IMKA 3QCPA 3HXSA 1S3DA 2YPMA 1KEBA 2JZSA 1TU8A 2H70A 2YP6A 3TJKA 1FOVA 3L9SA 3FR3A 2MMAA 3VI5A 2H1LA 2GZYA 4E8EA 3IC4A 1YQ1A 3ISOA 1GUKA 3QOUA 1ZCPA 2AJQB 5IMDA 4MPFA 5A5HA 4OWYA 3TUEA 2DJ2A 3FHKA 1O81A 2PPTA 3GL5A 1HD2A 2HQTA 5C00A 4ZIJA 3GRXA 5F05A 1K0OA 4BL7A 4ML6A 3C71A 5IMVA 1M2AA 1X5DA 1X0RA 5ECKB 4TW5A 2VD1A 2P5RA 4NV5A 2GZZA 3IBHA 1VRSD 2GTUA 2F9SA 3TU3B 1KNGA 4WBJA 2RUEA 4G9HA 1PN0A 3W8JA 1O85A 3TKSC 1GTIA 3FZ4A 1AC1A 4OO4A 3TKRA 2FWHA 4Q5NA 1AXDA 2Z9SA 5G31A 4L5LA 4BWSA 1K0MA 3ZIJA 4PXOA 4DVCA 1OAZA 4EXJA 1R5PA 3BD2A 2FHEA 1Y25A 3APQA 2WCIA 1FB6A 2HSNB 4O5QA 2YANA 2I1UA 4IQ1A 2DBCA 2OBKA 4LMWA 4TRXA 2HXKA 2YZHA 1I1IP 4PI0C 4NWYA 3ERWA 5F0GA 3VWWA 2PERA 1ML6A 4BVXB 2YWMA 2IL3A 4PQ1A 5DBQA 2AHEA 1J9BA 1UC7A 4GSNA 4KAEA 5CRGA 3TKSA 1NM3A 1PKZA 2ALBA 2C3TA 4TVEA 1SKWB 5F8BA 1JZOA 3O76A 4WF4A 4YQVA 1OE7A 5HFGA 5A34A 2YWNA 4EIPA 2GGTA 4KUNA 5HR0A 2CVDA 3I69A 1EEMA 3D21A 4K8MA 1LBKA 4MH2A 3HVXA 2GSRA 2IN3A 1XWKA 4BVYA 1MDKA 5IIZA 5IPGA 18GSA 5A5KA 2BJXA 3I9V2 2F51A 2EC4A 3F4TA 4V2MA 4MK3A 4WF5A 1FO5A 1F3BA 2RUFA 1X9WB 4GRFA 1USBA 3IRAA 4GSSA 2LJKA 5D9TA 3ZYWA 4MF5A 1QFNA 3BOAA 3GH6A 1SKSB 4IELA 4PHZC 4PGTA 4ZBAA 3M9JA 3V1WA 5JWOB 1W89A 4O32A 3QFBC 1EV4A 3LSZA 4IN0A 2C4JA 2R4VA 3F3QA 4K0GA 3O6TA 1K3OA 3G7JA 3TCOA 3DKSA 1YEXA 3DWVA 3KCMA 3W6GA 1VGLA 5FWGA 2DIYA 4POLA 4HQZA 4OD7A 2DMLA 4N0ZA 3KEBA 1YEWC 1VF2A 1U3AA 4ULXA 3KH7A 4Z7XA 3VWXA 1X9SB 3NIVA 1R5AA 5ELGA 5CAXA 3GH9A 4ECBA 1MTCA 1GSFA 4J2FA 3UL3A 2LJAA 3F0IA 4EE0A 1SJIA 1NW2A 2EFCA 3GYKA 1A0RP 1XXUA 3EYTA 3QAGA 2PUKC 2BTOT 2B5XA 1Q4JA 3I6AA 5BMUB 1B4QA 1U3IA 1GNWA 3DGQA 1ZYPA 5ECSA 5ENUA 2CAQA 5HFKA 1O7UA 3DRNA 4EKZA 4KE3A 3HZ8A 2V41A 1TW9A 4K5RA 4MZBA 1T7PB 1NHYA 3KGKA 7GSSA 13GSA 4L0UA 4AKXB 4ZBDA 3GKMA 5IQYA 1K0DA 2GZPA 3FRCA 3VLNA 1RW1A 1QXHA 4IJ3A 4BL7B 1SYRA 2X8CA 3KZQA 5CRDA 1OVNA 4NHWA 1BEDA 2R0GA 4V1Ag 2OJLA 1K3YA 1MDJA 4GSTA 3MWHA 2JSZA 2H01A 4AJ6A 3TKSE 4PX1A 3O3TA 1J08A 1F3AA 3ZREA 3KTBA 1GUHA 2N5AA 3QDNA 5G1KA 4YQUA 4MZCA 3D4MA 1B48A 3CTGA 4GQCA 3PGTA 1GRXA 1QK8A 2DJ3A 3QMXA 4XRDA 6GSWA 11GSA 5A4UA 4JRRA 3N9JA 4MJCA 3E3EA 3WGXA 3ZFLA 1XZOA 2ON5A 3ERGA 2ON7A 1Y6EA 4IKHA 3EVIA 1A8LA 1ZMAA 4NPBA 3CWGA 4MJAA 4ZL7A 1MEKA 2O85A 5H5RA 2AUVA 2EIOA 2PU9C 2EFEA 3ZVJD 2H0HA 3GKKA 5GSSA 3TRQA 3UBLA 2L5OA 1WJKA 4F82A 2HE3A 2GT6A 5CO3A 2JU5A 2E2GA 2OA7A 3HJMA 2IMEA 5IMZA 4I6XA 2HSNA 4MNNA 1QMVA 5A1NB 3F4SA 3ERFA 1YZXA 4KSMA 1PQNA 2H0IA 1NSWA 1K0NA 3EC3A 2EFDA 1K3LA 3GTUB 2YWIA 3W8SA 3LWAA 1N8JA 4BWQA 4BVXA 5ELAA 2FLSA 1ILOA 1JHBA 4KDUA 4PQIA 2DJ0A 2R3XA 3P90A 3HCZA 4FQUA 5ECLB 4TR1B 2MBTA 4I97A 1NHOA 3H8QA 4Z2UA 4HQSA 5J3RA 2FWEA 5J4VA 4FYBA 4KGIA 2TIRA 1AQXA 4NXIA 1FG4A 4FIWA 1XOBA 5IM9A 2FY6A 4K2XA 2DKIA 4O92A 4ZBBA 5JCWA 3TRPA 2WW3A 2AB6A 2VLUA 3F3RA 2WVXB 4FH8A 1GSDA 1AIUA 8GSSA 3PPUA 5HFIA 1SD8A 2LUSA 2H73A 3D22A 2LNTA 2C0GA 1I9DA 3H79A 3IC8A 4QQ7A 4RUVA 3EU3A 4JR4A 5KN0A 3A5WA 1Z9HA 1XVQA 4HJ2A 2C1YA 3D0ZA 1AQWA 2WZSA 3S9FA 1AQVA 4K7IA 1ZYEA 3QAWA 4OFTA 1YY7A 2UV8G 1EOHA 3LYKA 4X43A 4JEDA 4K9ZA 1AW9A 2CT6A 2P31A 4K2DA 5KN2A 2PN8A 3DXBA 5J4UA 3CXGA 4GDFA 2HLSA 5J4YA 5DALB 1V57A 5FHIA 2H1DA 4TR0A 1SJ6A 2IIYA 1ACVA 4QL7A 4HJMA 2NPBA 4ECJA 2A4HA 5G5FA 5G2ZA 4OCFA 4HOJA 2GSQA 4D73B 2DJKA 2DLXA 3F8UA 5BMUA 3J7Yb 4FYCA 2V6OA 1YDKA 2YV7A 4ICYA 3ZLPA 2X49A 4KSOA 4WETA 4HU9A 3K8NA 1CQGA 4L0WA 4XS4B 3MAKA 4TN8A 3A2WA 4TXVA 2YOIA 3F9UA 4G19A 9GSSA 4DSRA 4KNDA 2C8UA 3HJOA 2RIIA 1JLVA 1Z7RA 2H30A 3TOUA 2IMFA 5D8IA 1B9YC 2CQ9A 1EGOA 3LXTA 2FCHA 2VD0A 3M0FA 4L5OA 2VCWA 3KH9A 4K0NA 2K6VA 1T4YA 2CV4A 2LRCA 2HYXA 2N5FA 3APSA 2A4VA 4TXOB 3P2AA 4ZB6A 2HT9A 1M7TA 1SL0B 2GDRA 2M80A 1THOA 2VCZA 1LU4A 3QFAC 3FMWA 2H8LA 4QMKA 3ZITA 1HYUA 2MYGA 2WRTA 1A23A 2IJYA 3M8NA 3KTLA 4MF6A 4L8EA 2LRNA 2F8AA 2F3MA 1XWBA 3RPPA 3GN3A 3ZFBA 5ECPB 2L4CA 2I4AA 3TOTA 4MA9A 2YV9A 2DMMA 2XBIA 6GSUA 4HUAA 2WZ9A 3P7XA 4KX4A 2VUPA 1FHEA 2YCDA 5ID2B 2H0GA 2GQMA 3GSSA 2WFCA 5ECNB 4MLYA 3CHXC 2IWTA 4AJ8A 2EIRA 2EIQA 1SL2B 4F0CA 3VPQA 1EV9A 2NDOA 2TRCP 1S4BP 2K8VA 2ZUPA 5DCHA 4Q5RA 2WB9A 4GLTA 2R0PA 4QL9A 2P5QA 3FZ5A 3WT1A 4YH2A 4BPYA 4PUAA 5HQPA 2WJUA 2HRKB 2MBSA 2LKUA 1O8XA 1GL8A 3H4KA 3LGCA 2QGVA 2X8GA 3RBTA 3HHVA 2L6DA 5C04A 5A1NA 1VF4A 2OKAA 2TRXA 3IDVA 4IQAA 3C8EA 4DSQA 2K18A 5IOWA 3GTUA 4CDOA 4EDYA 5KOWA 2O89A 3F63A 3GL3A 4N3ZA 4GCIA 3FKFA 4JZQA 2JZTA 4PURA 4KDYA 3JCML 1GNEA 3VK9A 4J57E 4POBA 1UVZA 1XVWA 2H1GA 5DAKB 3FW2A 5D9WA 4AKHA 3FYGA 1A2MA 3CQFA 2A2SA 3FK8A 3UMAA 4N0VA 3ZMKA 4V2NA 4TR1A 2CZ3A 4Z2RA 5D9XA 2YNXA 2C0FA 4XS1A 4EVMA 4YAPA 4X0XA 1BG5A 6GSVA 1A8YA 3DYRA 1K0BA 5B8BA 3GKNA 2VAFA 1ZZYA 4MMMA 4I2TA 4I2UA 4POMA 4NAXA 4YQMA 4PI2C 6GSTA 1TDIA 4EDZA 1A2JA 3F6DA 1WIKA 1YF0A 2WVXA 5EL8A 4PQHA 2H71A 2HZEB 2VM1A 5D73A 1PFOA 3DMLA 3UVTA 2LS5A 1GP1A 3RFRC 4FYUA 3RHBA 5FT3A 5F07A 1IYHA 3GSTA 1GSUA 3G9BA 10GSA 4G0KA 2JZRA 4OFNA 2OE0A 4LL4B 4W66A 3MDKA 3Q74A 3D5JA 2C3NA 2WULA 2VL9A 3IOSA 1ZGNA 2OE3A 3BBYA 1R26A 1F37A 4IHUA 4V1Ap 1EP8A 5J5NA 1ERUA 1URMA 3PH9A 4ZB7A 3A5IA 1V2AA 5DALA 3UVHA 4DEJA 1FVKA 2LNSA 3L9UA 1Z6NA 4IS0A 2VM2A 3APOA 2HNLA 3A3TA 1YF1A 1FAAA 2E2MA 2H72A 1Q98A 3J7Yk 2GS3A 1BQ7A 4D73A 2QC7A 1OC9B 3G7YA 2FWGA 2MMZA 1B9XC 2HRNA 3IHQA 1GTAA 4TR3A 5J41A 3LEFA 1H75A 3D6IA 1GH2A 2X99A 5DJLA 3U5RE 3FY7A 1ST9A 4LA1A 2FD3A 4GQFA 2VCTA 1JZDA 4XS4A 3DVXA 5JCUA 3ZMLA 1M3JA 1R4WA 2QSIA 5ECHB 2OBIA 3DD3A 1V98A 4YKFA 3DEXA 3CYNA 2OT3A 3VI7A 3TKQA 3WGEA 1GTUA 2A2RA 1WE0A 2N5BA 2VLVA 2M46A 4IBPA 2V1MA 4TXOA 14GSA 4MF7A 3GNJA 1EGRA 1X5CA 1XG8A 1BAYA 4JE1A 4OFMA 4TR4A 1OC8A 1TRUA 3LFLA 2RM5A 3SBCA 4USSA 4MJEA 4RQRA 5J9BA 1IYIA 2O8VB 2GVPA 3NOFA 5AIXA 3LG6A 5G5EA 2KUCA 4MP4A 3P8WA 4CHSA 4E68A 5IMFA 1XWAA 3MIXA 4O5UA 2PVQA 5ID2A 1JZRA 3Q19A 5AGYA 2L4QA 1SK0A 4EIQA 1DE1A 6GSXA 2WGRA 3HA9A 5E4WA 2HZFA 1N2AA 12GSA 3TGZA 5INYA 1AAZA 4HEA2 5EPFA 5H5SA 1EP7A 5GAPD 2PMTA 3D4TA 2P0GA 4HS1A 1XBSA 2CVKA 4PNFA 2LV3A 3UAPA 6GSSA 4MABA 1T3BA 4X4JA 1QUWA 3CRUA 2HRKA 1QGVA 1ZOFA 3UJ1A 5KN3A 1LJRA 6GSYA 3E9JB 2CAIA 2GT5A 1XW9A 4AF2A 1M2BA 1ABAA 1GLQA 2ZCTA 4FO5A 4KCAA 1PX6A 3Q18A 5H5QA 1TJDA 2VCQA 2B6MA 3A2XA 4OMVA 5EVOA 1PD21 2H6YA 1S3RA 3ZTLA 2R0CA 3HVVA 1S3AA 1E6BA 3IE3A 4O5RA 4PTSA 3EURA 3HYPA 3ZVJA 2C0EA 1F9MA 1TK5B 5DAKA 1WWJA 22GSA 1C72A 4N10A 2H6XA 5ECIB 1QQ2A 1SVLA 3ED3A 2GLRA 4F03A 4I8BA 2WVZA 3M9KA 4KW6A 5F06A 3NZNA 1TI3A 4WR5A 2V6KA 4JR6A 4KA0A 3TJBA 3EU4A 5HR1A 2R5GA 1WRYA 1ON4A 1JLWA 3HY2A 3GUSA 2IPAA 2QA2A 3RGBC 1PA3A 5AN1A 2PVOC 1SD9A 3BJ5A 1M2DA 2DSAA 4RI6A 2HZEA 4NHZA 4OO5A 2WW2A 4POKA 2QKEA 3H93A 20GSA 3GURA 4HI7A 3HDCA 4ML1A 1WP0A 3G7IA 2GSSA 2FA4A 1PX7A 2MZCA 2IMIA 2VCXA 3KJYA 5IPHA 5J40A 2PBJA 5JCGA 2HSHA 2WVYA 4O7HA 5CREA 3KIJA 2O3EA 5DJMA 2A2PA 1F2EA 2AAWA 2E7PA 2HSMB 2HSYA 2GSTA 2LEGA 4AI6A 1K0AA 1HNBA 1MDIA 1XFLA 4AKGA 4WXTA 2B7JA 1V40A 3TJFA 2REMA 1SKRB 2X64A 5AIVA 5KOXA 4K6XA 5G1LA 1UA5A 1M0UA 4F9ZA 3EWLA 3ZZXA 2GQLA 1SENA 3SWLA 5DQYA 1O6JA 4E8HA 1GSSA 2VCVA 2X8HA 1YKCA 1K0CA 3QAVA 2MMNA 1O8WA 1EOGA 1OC9A 2CX4A 2CZ2A 4GWRA 3I43A 2WW1A 1YKAA 2C80A 3CRTA 1XW5A 3GA4A 5CP1A 1PRXA 2H1BA 5BRTA 1OC3A 3TJGA 1DE2A 1TOFA 3E0UA 3H1NA 5ECMB 4IW9A 1GWCA 1CQHA 1OYJA 2H76A 1FW1A 2LRTA 4ISDA 4RQXA 4F0BA 2JSYA 3VWVA 2AV4A 3FR9A 4K7OA 5D96A 3UOMA 5GZZB 4G0LA 5A4VA 3GFKA 4HDEA 1TI1A 4DSSB 4EO3A 1U87A 2XPDA 3WYWA 1U88A 1DBYA 2KP1A 3ZRDA 2YN1A 3FR6A 3IK7A 4JU5A 1SL1B 2O7KA 1A24A 5B7CA 3PINA 4TKYA 4BA7A 1GSEA 1YEPA 2B7KA 2RLIA 2GQKA 4JBBA 3R2QA 2FA8A 2OACA 4YAVA 4N30A 3IPZA 3L78A 4MH3A 3WGDA 1N25A 1PSQA 3HKRA 2IFQB 3GMFA 5ECRB 2CX3A 2L57A 3TB2A 4XCSA 1ZYNA 5LD0A 5IMAA 3GV1A 5ECQB 1PN9A 4WR4A 3VFIA 4Z2TA 3CSJA 2NBSA 4J56E 3EPTA 3PR8A 3LQ7A 1TRVA 3L0HA 1UN2A 17GSA 1Y1UA 2QA1A 3LYPA 2J9HA 2V2GA 3R3EA 5CNWA 3WT2A 1BYEA 5IO2A 2LSTA 2M72A 3QD9A 5G30A 1KBNA 1GSYA 4K1FA 3FZAA 1O73A 2UZ8A 2WW0A 5IOXA 3CTFA 2NVLA 5HR3A 3LW9A 3VWUA 3TJJA 1DSBA 3IV4A 3F4RA 3M1GA 2O5VA 5ECOB 5COHA 2R2JA 1GLPA 2H1AA 1TRWA 2RM6A 3A2VA 2H6ZA 2JADA 1ERWA 3ME8A 1TTZA
chains in the Genus database with same CATH topology
2FNOA 2F8FA 1G7EA 1OKDA 1FOHA 5GSTA 2H74A 3C1RA 1VF1A 4LMVA 4PNGA 2OADA 4MJBA 4N11A 4MCUA 2VL2C 2G2QA 5D9VA 1GULA 4ECIA 3QR6A 4GF0A 4IP1A 2LTKA 2I9HA 3KXOA 2NTOA 2I3YA 4G10A 1TK8B 3CSIA 3LORA 1GTBA 2G0FA 2XC2A 1SK1A 5IMCA 4XHMA 2C3QA 1AUCA 2R6KA 4K5SA 3HVSA 4G01A 3OR5A 3M3MA 4KDXA 3L9VA 2KOKA 1T00A 3DVWA 3KP8A 4WKWA 4IGJA 5B8AA 5L71A 1XOAA 2L6CA 4ILFA 4XIHA 4XRAA 1XPVA 4ECCA 4HZ2A 1PL1A 2VO4A 4F2IA 4YKGA 2B3SA 3KMNA 3IHGA 1ERVA 3MNGA 3VPTA 1SU9A 3MSZA 3BCKA 5J9CA 4Q5QA 4P3YB 2HFDA 4ZILA 3EMPA 16GSA 5DCGA 4IP6A 2DKHA 2LQOA 3FEUA 1TXXA 2VL2A 2VLTA 2D2ZA 2E0QA 3F6FA 2AYTA 1U6TA 1JFUA 1JZWA 1RQMA 1FB0A 1KTEA 3GIXA 4CW9A 1XW6A 2JL4A 4V2LA 5B6MA 1SJZA 2HSMA 5DDLA 2VL3A 4CY8A 3KD0A 1MD4A 2I81A 2L59A 5B6NA 2B5YA 3KMOA 4HZ4A 3N5OA 5J47A 1J0FA 2FWFA 3WD6A 4AGSA 5A5HB 3CMIA 3US3A 1GUMA 4ZL8A 3EMXA 2CVBA 2K9FA 5IO0A 2DIZA 5EY6A 3GKXA 1S3CA 2K8SA 1THXA 1X5EA 3IA1A 3C1SA 1Z3EA 2VKZG 1EEJA 2WS2A 3BCIA 3U6VA 3C7MA 5CRHA 5LNKe 3GHAA 4MPGA 2HRAA 3KM6A 3VURA 1G0TA 3TDGA 1BG1A 2FUG2 1WOUA 3ME7A 3RPNA 3QPMA 1Z6MA 1OKTA 2H75A 2DJ1A 2PGTA 2B1KA 4KH7A 1M9AA 3DIEA 4RI7A 5KEJA 3C73A 4DSSA 3IAS2 4G2EA 4ID0A 2VOCA 1HNAA 3UARA 3IK9A 4EUYA 4X1UA 5GAND 1HQOA 4KCEA 3TKPA 2ZNMA 4TOPA 4ZXGA 1XCCA 4G0IA 4A5PA 4AJ7A 5DVBA 2XHFA 1E2YA 1Z7PA 3IAM2 4EF0A 1PMTA 3LJRA 5AISA 1OE8A 4K7NA 2VIMA 5HR2A 4ACSA 2OE1A 1VF3A 3EE2A 3TRXA 3HD5A 2O87A 1B4PA 2IFQA 4GXZA 5E59A 1SYXA 3FZ9A 4OCEA 19GSA 2YZUA 1H4OA 2HI7A 1XWGA 1V58A 4KB3A 3CBUA 3RHCA 2FGXA 4XS6A 5A34B 1G6YA 2BMXA 1G7OA 3HJPA 5ABRA 1M9BA 4LL1B 1M99A 1TXUA 4EL1A 2YWOA 1ZYQB 1T8EB 3CSHA 4BVYB 4HU7A 1ERTA 1BF5A 1EWXA 2R37A 4AKIA 1G6WA 3GX0A 1F6MC 5A4WA 1BX9A 4H86A 2HRFA 1GSQA 3EINA 2JACA 3MYDA 2J23A 2IMDA 1TU7A 3ZL5A 3Q6OA 1SVMA 5LCZA 1TKDB 4Q5FA 1RK4A 1T1VA 1PGTA 3KP9A 5JWQB 3RDWA 3L4NA 1V9WA 1SK2A 2EFHA 1T4ZA 2B5EA 2MMOA 4ZB9A 3AY8A 3UBKA 1I5GA 1Z5YE 4NMUA 2V32A 2YJHA 2XBQA 2ES7A 4IVFA 1EZKA 1TRSA 3ZIVA 1W4VA 1R7HA 1TP9A 2LJRA 1PL2A 2PWJA 1BJXA 3HZ4A 2KHPA 4EC0A 4GTUA 1A0FA 4LLRA 4IJIA 1SVOA 2DJJA 3UEMA 4WEYA 1PKWA 4NV2A 1TK0B 2KLXA 1DUGA 2B1LA 4MDCA 2H66A 1A2LA 2YJ7A 4MZWA 3GX8A 3RAZA 2KP2A 2X4AA 1FVJA 2XPEA 5D93A 5JWRB 4ZL9A 4I5QA 2H19A 4PUFC 5KN1A 2DC5A 1WMJA 3LXZA 3HMJG 1WPIA 3IXRA 1MD3A 4ZB8A 4WBRD 2L5LA 2CA8A 5CYYA 5CRWA 1XIYA 4CY6A 1ZL9A 3UIWA 1B8XA 1HNCA 1X9MB 5DQSA 3IR4A 4XTSA 2WDUA 2C0DA 1XWCA 1YVLA 1YJ6A 2LQQA 4KF9A 2IMKA 3QCPA 3HXSA 1S3DA 2YPMA 1KEBA 2JZSA 1TU8A 2H70A 2YP6A 3TJKA 1FOVA 3L9SA 3FR3A 2MMAA 3VI5A 2H1LA 2GZYA 4E8EA 3IC4A 1YQ1A 3ISOA 1GUKA 3QOUA 1ZCPA 2AJQB 5IMDA 4MPFA 5A5HA 4OWYA 3TUEA 2DJ2A 3FHKA 1O81A 2PPTA 3GL5A 1HD2A 2HQTA 5C00A 4ZIJA 3GRXA 5F05A 1K0OA 4BL7A 4ML6A 3C71A 5IMVA 1M2AA 1X5DA 1X0RA 5ECKB 4TW5A 2VD1A 2P5RA 4NV5A 2GZZA 3IBHA 1VRSD 2GTUA 2F9SA 3TU3B 1KNGA 4WBJA 2RUEA 4G9HA 1PN0A 3W8JA 1O85A 3TKSC 1GTIA 3FZ4A 1AC1A 4OO4A 3TKRA 2FWHA 4Q5NA 1AXDA 2Z9SA 5G31A 4L5LA 4BWSA 1K0MA 3ZIJA 4PXOA 4DVCA 1OAZA 4EXJA 1R5PA 3BD2A 2FHEA 1Y25A 3APQA 2WCIA 1FB6A 2HSNB 4O5QA 2YANA 2I1UA 4IQ1A 2DBCA 2OBKA 4LMWA 4TRXA 2HXKA 2YZHA 4NWYA 3ERWA 5F0GA 3VWWA 2PERA 1ML6A 4BVXB 2YWMA 2IL3A 4PQ1A 5DBQA 2AHEA 1J9BA 1UC7A 4GSNA 4KAEA 5CRGA 3TKSA 1NM3A 1PKZA 2ALBA 2C3TA 4TVEA 1SKWB 5F8BA 1JZOA 3O76A 4WF4A 4YQVA 1OE7A 5HFGA 5A34A 2YWNA 4EIPA 2GGTA 4KUNA 5HR0A 2CVDA 3I69A 1EEMA 3D21A 4K8MA 1LBKA 4MH2A 3HVXA 2GSRA 2IN3A 1XWKA 4BVYA 1MDKA 5IIZA 5IPGA 18GSA 5A5KA 2BJXA 3I9V2 2F51A 2EC4A 3F4TA 4V2MA 4MK3A 4WF5A 1FO5A 1F3BA 2RUFA 1X9WB 4GRFA 1USBA 3IRAA 4GSSA 2LJKA 5D9TA 3ZYWA 4MF5A 1QFNA 3BOAA 3GH6A 1SKSB 4IELA 4PGTA 4ZBAA 3M9JA 3V1WA 5JWOB 1W89A 4O32A 3QFBC 1EV4A 3LSZA 4IN0A 2C4JA 2R4VA 3F3QA 4K0GA 3O6TA 1K3OA 3G7JA 3TCOA 3DKSA 1YEXA 3DWVA 3KCMA 3W6GA 1VGLA 5FWGA 2DIYA 4POLA 4HQZA 4OD7A 2DMLA 4N0ZA 3KEBA 1VF2A 1U3AA 4ULXA 3KH7A 4Z7XA 3VWXA 1X9SB 3NIVA 1R5AA 5ELGA 5CAXA 3GH9A 4ECBA 1MTCA 1GSFA 4J2FA 3UL3A 2LJAA 3F0IA 4EE0A 1SJIA 1NW2A 2EFCA 3GYKA 1A0RP 1XXUA 3EYTA 3QAGA 2PUKC 2BTOT 2B5XA 1Q4JA 3I6AA 5BMUB 1B4QA 1U3IA 1GNWA 3DGQA 1ZYPA 5ECSA 5ENUA 2CAQA 5HFKA 1O7UA 3DRNA 4EKZA 4KE3A 3HZ8A 2V41A 1TW9A 4K5RA 4MZBA 1T7PB 1NHYA 3KGKA 7GSSA 13GSA 4L0UA 4AKXB 4ZBDA 3GKMA 5IQYA 1K0DA 2GZPA 3FRCA 3VLNA 1RW1A 1QXHA 4IJ3A 4BL7B 1SYRA 2X8CA 3KZQA 5CRDA 1OVNA 4NHWA 1BEDA 2R0GA 4V1Ag 2OJLA 1K3YA 1MDJA 4GSTA 3MWHA 2JSZA 2H01A 4AJ6A 3TKSE 4PX1A 3O3TA 1J08A 1F3AA 3ZREA 3KTBA 1GUHA 2N5AA 3QDNA 5G1KA 4YQUA 4MZCA 3D4MA 1B48A 3CTGA 4GQCA 3PGTA 1GRXA 1QK8A 2DJ3A 3QMXA 4XRDA 6GSWA 11GSA 5A4UA 4JRRA 3N9JA 4MJCA 3E3EA 3WGXA 3ZFLA 1XZOA 2ON5A 3ERGA 2ON7A 1Y6EA 4IKHA 3EVIA 1A8LA 1ZMAA 4NPBA 3CWGA 4MJAA 4ZL7A 1MEKA 2O85A 5H5RA 2AUVA 2EIOA 2PU9C 2EFEA 3ZVJD 2H0HA 3GKKA 5GSSA 3TRQA 3UBLA 2L5OA 1WJKA 4F82A 2HE3A 2GT6A 5CO3A 2JU5A 2E2GA 2OA7A 3HJMA 2IMEA 5IMZA 4I6XA 2HSNA 4MNNA 1QMVA 5A1NB 3F4SA 3ERFA 1YZXA 4KSMA 1PQNA 2H0IA 1NSWA 1K0NA 3EC3A 2EFDA 1K3LA 3GTUB 2YWIA 3W8SA 3LWAA 1N8JA 4BWQA 4BVXA 5ELAA 2FLSA 1ILOA 1JHBA 4KDUA 4PQIA 2DJ0A 2R3XA 3P90A 3HCZA 4FQUA 5ECLB 4TR1B 2MBTA 4I97A 1NHOA 3H8QA 4Z2UA 4HQSA 5J3RA 2FWEA 5J4VA 4FYBA 4KGIA 2TIRA 1AQXA 4NXIA 1FG4A 4FIWA 1XOBA 5IM9A 2FY6A 4K2XA 2DKIA 4O92A 4ZBBA 5JCWA 3TRPA 2AB6A 2VLUA 3F3RA 4FH8A 1GSDA 1AIUA 8GSSA 3PPUA 5HFIA 1SD8A 2LUSA 2H73A 3D22A 2LNTA 2C0GA 1I9DA 3H79A 3IC8A 4QQ7A 4RUVA 3EU3A 4JR4A 5KN0A 3A5WA 1Z9HA 1XVQA 4HJ2A 2C1YA 3D0ZA 1AQWA 3S9FA 1AQVA 4K7IA 1ZYEA 3QAWA 4OFTA 1YY7A 2UV8G 1EOHA 3LYKA 4X43A 4JEDA 4K9ZA 1AW9A 2CT6A 2P31A 4K2DA 5KN2A 2PN8A 3DXBA 5J4UA 3CXGA 4GDFA 2HLSA 5J4YA 5DALB 1V57A 5FHIA 2H1DA 4TR0A 1SJ6A 2IIYA 1ACVA 4QL7A 4HJMA 2NPBA 4ECJA 2A4HA 5G5FA 5G2ZA 4OCFA 4HOJA 2GSQA 4D73B 2DJKA 2DLXA 3F8UA 5BMUA 3J7Yb 4FYCA 2V6OA 1YDKA 2YV7A 4ICYA 3ZLPA 2X49A 4KSOA 4WETA 4HU9A 3K8NA 1CQGA 4L0WA 4XS4B 3MAKA 4TN8A 3A2WA 4TXVA 2YOIA 3F9UA 4G19A 9GSSA 4DSRA 4KNDA 2C8UA 3HJOA 2RIIA 1JLVA 1Z7RA 2H30A 3TOUA 2IMFA 5D8IA 1B9YC 2CQ9A 1EGOA 3LXTA 2FCHA 2VD0A 3M0FA 4L5OA 2VCWA 3KH9A 4K0NA 2K6VA 1T4YA 2CV4A 2LRCA 2HYXA 2N5FA 3APSA 2A4VA 4TXOB 3P2AA 4ZB6A 2HT9A 1M7TA 1SL0B 2GDRA 2M80A 1THOA 2VCZA 1LU4A 3QFAC 3FMWA 2H8LA 4QMKA 3ZITA 1HYUA 2MYGA 2WRTA 1A23A 2IJYA 3M8NA 3KTLA 4MF6A 4L8EA 2LRNA 2F8AA 2F3MA 1XWBA 3RPPA 3GN3A 3ZFBA 5ECPB 2L4CA 2I4AA 3TOTA 4MA9A 2YV9A 2DMMA 2XBIA 6GSUA 4HUAA 2WZ9A 3P7XA 4KX4A 2VUPA 1FHEA 2YCDA 5ID2B 2H0GA 2GQMA 3GSSA 2WFCA 5ECNB 4MLYA 2IWTA 4AJ8A 2EIRA 2EIQA 1SL2B 4F0CA 3VPQA 1EV9A 2NDOA 2TRCP 2K8VA 2ZUPA 5DCHA 4Q5RA 2WB9A 4GLTA 2R0PA 4QL9A 2P5QA 3FZ5A 3WT1A 4YH2A 4BPYA 4PUAA 5HQPA 2WJUA 2HRKB 2MBSA 2LKUA 1O8XA 1GL8A 3H4KA 3LGCA 2QGVA 2X8GA 3RBTA 3HHVA 2L6DA 5C04A 5A1NA 1VF4A 2OKAA 2TRXA 3IDVA 4IQAA 3C8EA 4DSQA 2K18A 5IOWA 3GTUA 4CDOA 4EDYA 5KOWA 2O89A 3F63A 3GL3A 4N3ZA 4GCIA 3FKFA 4JZQA 2JZTA 4PURA 4KDYA 3JCML 1GNEA 3VK9A 4J57E 4POBA 1UVZA 1XVWA 2H1GA 5DAKB 3FW2A 5D9WA 4AKHA 3FYGA 1A2MA 2A2SA 3FK8A 3UMAA 4N0VA 3ZMKA 4V2NA 4TR1A 2CZ3A 4Z2RA 5D9XA 2YNXA 2C0FA 4XS1A 4EVMA 4YAPA 4X0XA 1BG5A 6GSVA 1A8YA 3DYRA 1K0BA 5B8BA 3GKNA 2VAFA 1ZZYA 4MMMA 4I2TA 4I2UA 4POMA 4NAXA 4YQMA 6GSTA 1TDIA 4EDZA 1A2JA 3F6DA 1WIKA 1YF0A 5EL8A 4PQHA 2H71A 2HZEB 2VM1A 5D73A 3DMLA 3UVTA 2LS5A 1GP1A 4FYUA 3RHBA 5FT3A 5F07A 1IYHA 3GSTA 1GSUA 3G9BA 10GSA 4G0KA 2JZRA 4OFNA 2OE0A 4LL4B 4W66A 3MDKA 3Q74A 3D5JA 2C3NA 2WULA 2VL9A 3IOSA 1ZGNA 2OE3A 3BBYA 1R26A 1F37A 4IHUA 4V1Ap 1EP8A 5J5NA 1ERUA 1URMA 3PH9A 4ZB7A 3A5IA 1V2AA 5DALA 3UVHA 4DEJA 1FVKA 2LNSA 3L9UA 1Z6NA 4IS0A 2VM2A 3APOA 2HNLA 3A3TA 1YF1A 1FAAA 2E2MA 2H72A 1Q98A 3J7Yk 2GS3A 1BQ7A 4D73A 2QC7A 1OC9B 3G7YA 2FWGA 2MMZA 1B9XC 2HRNA 3IHQA 1GTAA 4TR3A 5J41A 3LEFA 1H75A 3D6IA 1GH2A 2X99A 5DJLA 3U5RE 3FY7A 1ST9A 4LA1A 2FD3A 4GQFA 2VCTA 1JZDA 4XS4A 3DVXA 5JCUA 3ZMLA 1R4WA 2QSIA 5ECHB 2OBIA 3DD3A 1V98A 4YKFA 3DEXA 3CYNA 2OT3A 3VI7A 3TKQA 3WGEA 1GTUA 2A2RA 1WE0A 2N5BA 2VLVA 2M46A 4IBPA 2V1MA 4TXOA 14GSA 4MF7A 3GNJA 1EGRA 1X5CA 1BAYA 4JE1A 4OFMA 4TR4A 1OC8A 1TRUA 3LFLA 2RM5A 3SBCA 4USSA 4MJEA 4RQRA 5J9BA 1IYIA 2O8VB 2GVPA 3NOFA 5AIXA 3LG6A 5G5EA 2KUCA 4MP4A 3P8WA 4CHSA 4E68A 5IMFA 1XWAA 3MIXA 4O5UA 2PVQA 5ID2A 1JZRA 3Q19A 5AGYA 2L4QA 1SK0A 4EIQA 1DE1A 6GSXA 2WGRA 3HA9A 5E4WA 2HZFA 1N2AA 12GSA 3TGZA 5INYA 1AAZA 4HEA2 5EPFA 5H5SA 1EP7A 5GAPD 2PMTA 3D4TA 2P0GA 4HS1A 1XBSA 2CVKA 4PNFA 2LV3A 3UAPA 6GSSA 4MABA 1T3BA 4X4JA 1QUWA 3CRUA 2HRKA 1QGVA 1ZOFA 3UJ1A 5KN3A 1LJRA 6GSYA 3E9JB 2CAIA 2GT5A 1XW9A 4AF2A 1M2BA 1ABAA 1GLQA 2ZCTA 4FO5A 4KCAA 1PX6A 3Q18A 5H5QA 1TJDA 2VCQA 2B6MA 3A2XA 4OMVA 5EVOA 1PD21 2H6YA 3ZTLA 2R0CA 3HVVA 1S3AA 1E6BA 3IE3A 4O5RA 4PTSA 3EURA 3HYPA 3ZVJA 2C0EA 1F9MA 1TK5B 5DAKA 1WWJA 22GSA 1C72A 4N10A 2H6XA 5ECIB 1QQ2A 1SVLA 3ED3A 2GLRA 4F03A 4I8BA 3M9KA 4KW6A 5F06A 3NZNA 1TI3A 4WR5A 2V6KA 4JR6A 4KA0A 3TJBA 3EU4A 5HR1A 2R5GA 1WRYA 1ON4A 1JLWA 3HY2A 3GUSA 2IPAA 2QA2A 1PA3A 5AN1A 2PVOC 1SD9A 3BJ5A 1M2DA 2DSAA 4RI6A 2HZEA 4NHZA 4OO5A 4POKA 2QKEA 3H93A 20GSA 3GURA 4HI7A 3HDCA 4ML1A 1WP0A 3G7IA 2GSSA 2FA4A 1PX7A 2MZCA 2IMIA 2VCXA 3KJYA 5IPHA 5J40A 2PBJA 5JCGA 2HSHA 4O7HA 5CREA 3KIJA 5DJMA 2A2PA 1F2EA 2AAWA 2E7PA 2HSMB 2HSYA 2GSTA 2LEGA 4AI6A 1K0AA 1HNBA 1MDIA 1XFLA 4AKGA 4WXTA 2B7JA 1V40A 3TJFA 2REMA 1SKRB 2X64A 5AIVA 5KOXA 4K6XA 5G1LA 1UA5A 1M0UA 4F9ZA 3EWLA 3ZZXA 2GQLA 1SENA 3SWLA 5DQYA 1O6JA 4E8HA 1GSSA 2VCVA 2X8HA 1YKCA 1K0CA 3QAVA 2MMNA 1O8WA 1EOGA 1OC9A 2CX4A 2CZ2A 4GWRA 3I43A 1YKAA 2C80A 3CRTA 1XW5A 3GA4A 5CP1A 1PRXA 2H1BA 5BRTA 1OC3A 3TJGA 1DE2A 1TOFA 3E0UA 3H1NA 5ECMB 4IW9A 1GWCA 1CQHA 1OYJA 2H76A 1FW1A 2LRTA 4ISDA 4RQXA 4F0BA 2JSYA 3VWVA 2AV4A 3FR9A 4K7OA 5D96A 3UOMA 5GZZB 4G0LA 5A4VA 3GFKA 4HDEA 1TI1A 4DSSB 4EO3A 1U87A 2XPDA 3WYWA 1U88A 1DBYA 2KP1A 3ZRDA 2YN1A 3FR6A 3IK7A 4JU5A 1SL1B 2O7KA 1A24A 5B7CA 3PINA 4TKYA 4BA7A 1GSEA 1YEPA 2B7KA 2RLIA 2GQKA 4JBBA 3R2QA 2FA8A 2OACA 4YAVA 4N30A 3IPZA 3L78A 4MH3A 3WGDA 1N25A 1PSQA 3HKRA 2IFQB 3GMFA 5ECRB 2CX3A 2L57A 3TB2A 4XCSA 1ZYNA 5LD0A 5IMAA 3GV1A 5ECQB 1PN9A 4WR4A 3VFIA 4Z2TA 3CSJA 2NBSA 4J56E 3EPTA 3PR8A 3LQ7A 1TRVA 3L0HA 1UN2A 17GSA 1Y1UA 2QA1A 3LYPA 2J9HA 2V2GA 3R3EA 5CNWA 3WT2A 1BYEA 5IO2A 2LSTA 2M72A 3QD9A 5G30A 1KBNA 1GSYA 4K1FA 3FZAA 1O73A 2UZ8A 5IOXA 3CTFA 2NVLA 5HR3A 3LW9A 3VWUA 3TJJA 1DSBA 3IV4A 3F4RA 3M1GA 2O5VA 5ECOB 5COHA 2R2JA 1GLPA 2H1AA 1TRWA 2RM6A 3A2VA 2H6ZA 2JADA 3ME8A 1ERWA 1TTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNO A;  2F8F A;  1G7E A;  1OKD A;  5GST A;  2H74 A;  3C1R A;  1VF1 A;  4LMV A;  4PNG A;  2OAD A;  4MJB A;  4N11 A;  4MCU A;  2VL2 C;  2G2Q A;  5D9V A;  1GUL A;  4ECI A;  3QR6 A;  4GF0 A;  4IP1 A;  2LTK A;  2I9H A;  3KXO A;  2NTO A;  2I3Y A;  4G10 A;  1TK8 B;  3CSI A;  3LOR A;  1GTB A;  2G0F A;  2XC2 A;  1SK1 A;  5IMC A;  4XHM A;  2C3Q A;  1AUC A;  2R6K A;  3HVS A;  3OR5 A;  3M3M A;  4KDX A;  3L9V A;  2KOK A;  1T00 A;  3DVW A;  3KP8 A;  4WKW A;  4IGJ A;  5B8A A;  5L71 A;  1XOA A;  2L6C A;  4ILF A;  4XIH A;  4XRA A;  1XPV A;  4ECC A;  4HZ2 A;  1PL1 A;  2VO4 A;  4F2I A;  2B3S A;  3KMN A;  1ERV A;  3MNG A;  3VPT A;  1SU9 A;  3MSZ A;  3BCK A;  5J9C A;  4Q5Q A;  4P3Y B;  2HFD A;  4ZIL A;  3EMP A;  16GS A;  5DCG A;  4IP6 A;  2LQO A;  3FEU A;  1TXX A;  2VL2 A;  2VLT A;  2D2Z A;  2E0Q A;  3F6F A;  2AYT A;  1U6T A;  1JFU A;  1JZW A;  1RQM A;  1FB0 A;  1KTE A;  3GIX A;  4CW9 A;  1XW6 A;  2JL4 A;  4V2L A;  5B6M A;  1SJZ A;  2HSM A;  5DDL A;  2VL3 A;  3KD0 A;  1MD4 A;  2I81 A;  2L59 A;  5B6N A;  2B5Y A;  3KMO A;  4HZ4 A;  3N5O A;  1J0F A;  2FWF A;  3WD6 A;  4AGS A;  3CMI A;  3US3 A;  1GUM A;  4ZL8 A;  3EMX A;  2CVB A;  2K9F A;  5IO0 A;  2DIZ A;  5EY6 A;  3GKX A;  1S3C A;  2K8S A;  1THX A;  1X5E A;  3IA1 A;  3C1S A;  1Z3E A;  1EEJ A;  2WS2 A;  3BCI A;  3U6V A;  3C7M A;  5CRH A;  5LNK e;  3GHA A;  4MPG A;  2HRA A;  3KM6 A;  3VUR A;  1G0T A;  3TDG A;  2FUG 2;  1WOU A;  3ME7 A;  3RPN A;  3QPM A;  1Z6M A;  1OKT A;  2H75 A;  2DJ1 A;  2PGT A;  2B1K A;  4KH7 A;  1M9A A;  3DIE A;  4RI7 A;  5KEJ A;  3C73 A;  4DSS A;  3IAS 2;  4G2E A;  4ID0 A;  2VOC A;  1HNA A;  3UAR A;  3IK9 A;  4EUY A;  4X1U A;  5GAN D;  1HQO A;  4KCE A;  3TKP A;  2ZNM A;  4TOP A;  4ZXG A;  1XCC A;  4G0I A;  4AJ7 A;  5DVB A;  2XHF A;  1E2Y A;  1Z7P A;  3IAM 2;  4EF0 A;  1PMT A;  3LJR A;  5AIS A;  1OE8 A;  4K7N A;  2VIM A;  5HR2 A;  4ACS A;  2OE1 A;  1VF3 A;  3EE2 A;  3TRX A;  3HD5 A;  2O87 A;  1B4P A;  2IFQ A;  4GXZ A;  5E59 A;  1SYX A;  3FZ9 A;  4OCE A;  19GS A;  2YZU A;  1H4O A;  2HI7 A;  1XWG A;  1V58 A;  4KB3 A;  3CBU A;  3RHC A;  2FGX A;  4XS6 A;  1G6Y A;  2BMX A;  1G7O A;  3HJP A;  5ABR A;  1M9B A;  4LL1 B;  1M99 A;  4EL1 A;  2YWO A;  1ZYQ B;  1T8E B;  3CSH A;  4BVY B;  4HU7 A;  1ERT A;  1EWX A;  2R37 A;  1G6W A;  3GX0 A;  1F6M C;  5A4W A;  1BX9 A;  4H86 A;  2HRF A;  1GSQ A;  3EIN A;  2JAC A;  2J23 A;  2IMD A;  1TU7 A;  3ZL5 A;  3Q6O A;  5LCZ A;  1TKD B;  4Q5F A;  1RK4 A;  1T1V A;  1PGT A;  3KP9 A;  5JWQ B;  3RDW A;  3L4N A;  1V9W A;  1SK2 A;  1T4Z A;  2B5E A;  2MMO A;  4ZB9 A;  3AY8 A;  3UBK A;  1I5G A;  1Z5Y E;  4NMU A;  2V32 A;  2YJH A;  2XBQ A;  2ES7 A;  4IVF A;  1EZK A;  1TRS A;  3ZIV A;  1W4V A;  1R7H A;  1TP9 A;  2LJR A;  1PL2 A;  2PWJ A;  1BJX A;  3HZ4 A;  2KHP A;  4EC0 A;  4GTU A;  1A0F A;  4LLR A;  4IJI A;  2DJJ A;  3UEM A;  4WEY A;  1PKW A;  4NV2 A;  1TK0 B;  2KLX A;  1DUG A;  2B1L A;  4MDC A;  2H66 A;  1A2L A;  2YJ7 A;  4MZW A;  3GX8 A;  3RAZ A;  2KP2 A;  1FVJ A;  2XPE A;  5D93 A;  5JWR B;  4ZL9 A;  4I5Q A;  2H19 A;  4PUF C;  5KN1 A;  2DC5 A;  1WMJ A;  3LXZ A;  1WPI A;  3IXR A;  1MD3 A;  4ZB8 A;  4WBR D;  2L5L A;  2CA8 A;  5CYY A;  5CRW A;  1XIY A;  1ZL9 A;  3UIW A;  1B8X A;  1HNC A;  1X9M B;  5DQS A;  3IR4 A;  4XTS A;  2WDU A;  2C0D A;  1XWC A;  1YJ6 A;  2LQQ A;  4KF9 A;  2IMK A;  3QCP A;  3HXS A;  1S3D A;  2YPM A;  1KEB A;  2JZS A;  1TU8 A;  2H70 A;  2YP6 A;  3TJK A;  1FOV A;  3L9S A;  3FR3 A;  2MMA A;  3VI5 A;  2GZY A;  4E8E A;  3IC4 A;  1YQ1 A;  3ISO A;  1GUK A;  3QOU A;  1ZCP A;  2AJQ B;  5IMD A;  4MPF A;  4OWY A;  3TUE A;  2DJ2 A;  3FHK A;  1O81 A;  2PPT A;  3GL5 A;  1HD2 A;  2HQT A;  5C00 A;  4ZIJ A;  3GRX A;  5F05 A;  1K0O A;  4BL7 A;  4ML6 A;  3C71 A;  5IMV A;  1M2A A;  1X5D A;  1X0R A;  5ECK B;  4TW5 A;  2VD1 A;  2P5R A;  4NV5 A;  2GZZ A;  3IBH A;  1VRS D;  2GTU A;  2F9S A;  1KNG A;  4WBJ A;  2RUE A;  4G9H A;  3W8J A;  1O85 A;  3TKS C;  1GTI A;  3FZ4 A;  1AC1 A;  4OO4 A;  3TKR A;  2FWH A;  4Q5N A;  1AXD A;  2Z9S A;  5G31 A;  4L5L A;  4BWS A;  1K0M A;  3ZIJ A;  4PXO A;  4DVC A;  1OAZ A;  4EXJ A;  1R5P A;  3BD2 A;  2FHE A;  1Y25 A;  3APQ A;  2WCI A;  1FB6 A;  2HSN B;  2YAN A;  2I1U A;  4IQ1 A;  2DBC A;  2OBK A;  4LMW A;  4TRX A;  2HXK A;  2YZH A;  4NWY A;  3ERW A;  5F0G A;  3VWW A;  2PER A;  1ML6 A;  4BVX B;  2YWM A;  2IL3 A;  4PQ1 A;  5DBQ A;  2AHE A;  1J9B A;  1UC7 A;  4GSN A;  4KAE A;  5CRG A;  3TKS A;  1NM3 A;  1PKZ A;  2ALB A;  2C3T A;  4TVE A;  1SKW B;  5F8B A;  1JZO A;  3O76 A;  4WF4 A;  4YQV A;  1OE7 A;  5HFG A;  2YWN A;  2GGT A;  4KUN A;  5HR0 A;  2CVD A;  3I69 A;  1EEM A;  3D21 A;  4K8M A;  1LBK A;  4MH2 A;  3HVX A;  2GSR A;  2IN3 A;  1XWK A;  4BVY A;  1MDK A;  5IIZ A;  5IPG A;  18GS A;  5A5K A;  2BJX A;  3I9V 2;  2F51 A;  2EC4 A;  3F4T A;  4V2M A;  4MK3 A;  4WF5 A;  1FO5 A;  1F3B A;  2RUF A;  1X9W B;  4GRF A;  1USB A;  3IRA A;  4GSS A;  2LJK A;  5D9T A;  3ZYW A;  4MF5 A;  1QFN A;  3BOA A;  3GH6 A;  1SKS B;  4IEL A;  4PGT A;  4ZBA A;  3M9J A;  3V1W A;  5JWO B;  1W89 A;  4O32 A;  3QFB C;  1EV4 A;  3LSZ A;  4IN0 A;  2C4J A;  2R4V A;  3F3Q A;  4K0G A;  3O6T A;  1K3O A;  3G7J A;  3TCO A;  3DKS A;  1YEX A;  3DWV A;  3KCM A;  3W6G A;  1VGL A;  5FWG A;  2DIY A;  4POL A;  4HQZ A;  4OD7 A;  2DML A;  4N0Z A;  3KEB A;  1VF2 A;  1U3A A;  4ULX A;  3KH7 A;  4Z7X A;  3VWX A;  1X9S B;  3NIV A;  1R5A A;  5ELG A;  5CAX A;  3GH9 A;  4ECB A;  1MTC A;  1GSF A;  4J2F A;  3UL3 A;  2LJA A;  3F0I A;  4EE0 A;  1SJI A;  1NW2 A;  1A0R P;  3GYK A;  1XXU A;  3EYT A;  3QAG A;  2PUK C;  2BTO T;  2B5X A;  1Q4J A;  3I6A A;  1B4Q A;  1U3I A;  1GNW A;  3DGQ A;  5ECS A;  5ENU A;  2CAQ A;  5HFK A;  1O7U A;  3DRN A;  4EKZ A;  4KE3 A;  3HZ8 A;  2V41 A;  1TW9 A;  4MZB A;  1T7P B;  1NHY A;  3KGK A;  7GSS A;  13GS A;  4L0U A;  4ZBD A;  3GKM A;  5IQY A;  1K0D A;  2GZP A;  3FRC A;  3VLN A;  1RW1 A;  1QXH A;  4IJ3 A;  4BL7 B;  1SYR A;  2X8C A;  3KZQ A;  5CRD A;  1OVN A;  4NHW A;  1BED A;  4V1A g;  2OJL A;  1K3Y A;  1MDJ A;  4GST A;  3MWH A;  2JSZ A;  2H01 A;  4AJ6 A;  3TKS E;  4PX1 A;  3O3T A;  1J08 A;  1F3A A;  3ZRE A;  3KTB A;  1GUH A;  2N5A A;  3QDN A;  5G1K A;  4YQU A;  4MZC A;  3D4M A;  1B48 A;  3CTG A;  4GQC A;  3PGT A;  1GRX A;  1QK8 A;  2DJ3 A;  3QMX A;  4XRD A;  6GSW A;  11GS A;  5A4U A;  4JRR A;  3N9J A;  4MJC A;  3E3E A;  3WGX A;  3ZFL A;  1XZO A;  2ON5 A;  3ERG A;  2ON7 A;  1Y6E A;  4IKH A;  3EVI A;  1A8L A;  1ZMA A;  4NPB A;  4MJA A;  4ZL7 A;  1MEK A;  2O85 A;  5H5R A;  2AUV A;  2EIO A;  2PU9 C;  3ZVJ D;  2H0H A;  3GKK A;  5GSS A;  3TRQ A;  3UBL A;  2L5O A;  1WJK A;  4F82 A;  2HE3 A;  2GT6 A;  5CO3 A;  2JU5 A;  2E2G A;  2OA7 A;  3HJM A;  2IME A;  5IMZ A;  4I6X A;  1QMV A;  3F4S A;  3ERF A;  1YZX A;  4KSM A;  1PQN A;  2H0I A;  1NSW A;  1K0N A;  3EC3 A;  1K3L A;  3GTU B;  2YWI A;  3W8S A;  3LWA A;  1N8J A;  4BWQ A;  4BVX A;  5ELA A;  2FLS A;  1ILO A;  1JHB A;  4KDU A;  4PQI A;  2DJ0 A;  2R3X A;  3P90 A;  3HCZ A;  4FQU A;  5ECL B;  4TR1 B;  2MBT A;  4I97 A;  1NHO A;  3H8Q A;  4HQS A;  5J3R A;  2FWE A;  4FYB A;  4KGI A;  2TIR A;  1AQX A;  4NXI A;  4FIW A;  1FG4 A;  1XOB A;  5IM9 A;  2FY6 A;  4O92 A;  4ZBB A;  5JCW A;  3TRP A;  2AB6 A;  2VLU A;  3F3R A;  4FH8 A;  1GSD A;  1AIU A;  8GSS A;  3PPU A;  5HFI A;  1SD8 A;  2LUS A;  2H73 A;  3D22 A;  2LNT A;  2C0G A;  1I9D A;  3H79 A;  3IC8 A;  4QQ7 A;  4RUV A;  3EU3 A;  4JR4 A;  5KN0 A;  3A5W A;  1Z9H A;  1XVQ A;  4HJ2 A;  2C1Y A;  3D0Z A;  1AQW A;  3S9F A;  1AQV A;  4K7I A;  1ZYE A;  3QAW A;  4OFT A;  1YY7 A;  1EOH A;  3LYK A;  4X43 A;  4JED A;  4K9Z A;  1AW9 A;  2CT6 A;  2P31 A;  4K2D A;  5KN2 A;  2PN8 A;  3DXB A;  5J4U A;  3CXG A;  2HLS A;  5DAL B;  1V57 A;  5FHI A;  2H1D A;  4TR0 A;  1SJ6 A;  2IIY A;  1ACV A;  4QL7 A;  4HJM A;  2NPB A;  4ECJ A;  5G5F A;  5G2Z A;  4OCF A;  4HOJ A;  2GSQ A;  4D73 B;  2DJK A;  2DLX A;  3F8U A;  5BMU A;  3J7Y b;  4FYC A;  2V6O A;  1YDK A;  2YV7 A;  3ZLP A;  4KSO A;  4WET A;  4HU9 A;  3K8N A;  1CQG A;  4L0W A;  4XS4 B;  3MAK A;  4TN8 A;  3A2W A;  4TXV A;  2YOI A;  3F9U A;  4G19 A;  9GSS A;  4DSR A;  4KND A;  2C8U A;  3HJO A;  2RII A;  1JLV A;  1Z7R A;  2H30 A;  3TOU A;  2IMF A;  5D8I A;  1B9Y C;  2CQ9 A;  1EGO A;  3LXT A;  2FCH A;  2VD0 A;  3M0F A;  4L5O A;  2VCW A;  3KH9 A;  4K0N A;  2K6V A;  1T4Y A;  2CV4 A;  2LRC A;  2HYX A;  2N5F A;  3APS A;  2A4V A;  4TXO B;  3P2A A;  4ZB6 A;  2HT9 A;  1M7T A;  1SL0 B;  2GDR A;  2M80 A;  1THO A;  2VCZ A;  1LU4 A;  3QFA C;  2H8L A;  3ZIT A;  1HYU A;  2MYG A;  2WRT A;  1A23 A;  2IJY A;  3M8N A;  3KTL A;  4MF6 A;  4L8E A;  2LRN A;  2F8A A;  2F3M A;  1XWB A;  3RPP A;  3GN3 A;  3ZFB A;  5ECP B;  2L4C A;  2I4A A;  3TOT A;  4MA9 A;  2YV9 A;  2DMM A;  2XBI A;  6GSU A;  4HUA A;  2WZ9 A;  3P7X A;  4KX4 A;  2VUP A;  1FHE A;  2YCD A;  5ID2 B;  2H0G A;  2GQM A;  3GSS A;  2WFC A;  5ECN B;  4MLY A;  2IWT A;  4AJ8 A;  2EIR A;  2EIQ A;  1SL2 B;  4F0C A;  3VPQ A;  1EV9 A;  2NDO A;  2TRC P;  2K8V A;  2ZUP A;  5DCH A;  4Q5R A;  2WB9 A;  4GLT A;  4QL9 A;  2P5Q A;  3FZ5 A;  3WT1 A;  4YH2 A;  4BPY A;  4PUA A;  5HQP A;  2WJU A;  2HRK B;  2MBS A;  2LKU A;  1O8X A;  1GL8 A;  3H4K A;  3LGC A;  2QGV A;  2X8G A;  3RBT A;  3HHV A;  2L6D A;  5C04 A;  1VF4 A;  2OKA A;  2TRX A;  3IDV A;  4IQA A;  3C8E A;  4DSQ A;  2K18 A;  5IOW A;  3GTU A;  4CDO A;  4EDY A;  2O89 A;  3F63 A;  3GL3 A;  3FKF A;  4GCI A;  4JZQ A;  2JZT A;  4PUR A;  4KDY A;  3JCM L;  1GNE A;  3VK9 A;  4J57 E;  4POB A;  1UVZ A;  1XVW A;  2H1G A;  5DAK B;  3FW2 A;  5D9W A;  3FYG A;  1A2M A;  2A2S A;  3FK8 A;  3UMA A;  4N0V A;  3ZMK A;  4V2N A;  4TR1 A;  2CZ3 A;  5D9X A;  2YNX A;  2C0F A;  4XS1 A;  4EVM A;  4YAP A;  4X0X A;  1BG5 A;  6GSV A;  1A8Y A;  3DYR A;  1K0B A;  5B8B A;  3GKN A;  2VAF A;  1ZZY A;  4MMM A;  4I2T A;  4I2U A;  4POM A;  4NAX A;  4YQM A;  6GST A;  1TDI A;  4EDZ A;  1A2J A;  3F6D A;  1WIK A;  1YF0 A;  5EL8 A;  4PQH A;  2H71 A;  2HZE B;  2VM1 A;  5D73 A;  3DML A;  3UVT A;  2LS5 A;  1GP1 A;  4FYU A;  3RHB A;  5FT3 A;  5F07 A;  1IYH A;  3GST A;  1GSU A;  3G9B A;  10GS A;  4G0K A;  2JZR A;  4OFN A;  2OE0 A;  4LL4 B;  3MDK A;  3Q74 A;  3D5J A;  2C3N A;  2WUL A;  2VL9 A;  3IOS A;  1ZGN A;  2OE3 A;  3BBY A;  1R26 A;  1F37 A;  4IHU A;  4V1A p;  1EP8 A;  5J5N A;  1ERU A;  1URM A;  3PH9 A;  1V2A A;  5DAL A;  3UVH A;  4DEJ A;  1FVK A;  2LNS A;  3L9U A;  1Z6N A;  4IS0 A;  2VM2 A;  3APO A;  2HNL A;  3A3T A;  1YF1 A;  1FAA A;  2E2M A;  2H72 A;  1Q98 A;  3J7Y k;  2GS3 A;  1BQ7 A;  4D73 A;  2QC7 A;  1OC9 B;  3G7Y A;  2FWG A;  2MMZ A;  1B9X C;  2HRN A;  3IHQ A;  1GTA A;  4TR3 A;  5J41 A;  3LEF A;  1H75 A;  3D6I A;  1GH2 A;  2X99 A;  5DJL A;  3U5R E;  3FY7 A;  1ST9 A;  4LA1 A;  2FD3 A;  4GQF A;  2VCT A;  1JZD A;  4XS4 A;  5JCU A;  3DVX A;  3ZML A;  1R4W A;  2QSI A;  5ECH B;  2OBI A;  3DD3 A;  1V98 A;  3DEX A;  3CYN A;  3VI7 A;  3TKQ A;  3WGE A;  1GTU A;  2A2R A;  1WE0 A;  2N5B A;  2VLV A;  2M46 A;  4IBP A;  2V1M A;  4TXO A;  14GS A;  4MF7 A;  3GNJ A;  1EGR A;  1X5C A;  1BAY A;  4JE1 A;  4OFM A;  4TR4 A;  1OC8 A;  1TRU A;  3LFL A;  2RM5 A;  3SBC A;  4USS A;  4MJE A;  4RQR A;  5J9B A;  1IYI A;  2O8V B;  2GVP A;  3NOF A;  5AIX A;  3LG6 A;  5G5E A;  2KUC A;  4MP4 A;  3P8W A;  4CHS A;  5IMF A;  1XWA A;  2PVQ A;  5ID2 A;  1JZR A;  3Q19 A;  5AGY A;  2L4Q A;  1SK0 A;  1DE1 A;  6GSX A;  2WGR A;  3HA9 A;  5E4W A;  2HZF A;  1N2A A;  12GS A;  3TGZ A;  5INY A;  1AAZ A;  4HEA 2;  5EPF A;  5H5S A;  1EP7 A;  5GAP D;  2PMT A;  3D4T A;  2P0G A;  4HS1 A;  1XBS A;  2CVK A;  4PNF A;  2LV3 A;  3UAP A;  6GSS A;  4MAB A;  1T3B A;  1QUW A;  3CRU A;  2HRK A;  1QGV A;  1ZOF A;  3UJ1 A;  5KN3 A;  1LJR A;  6GSY A;  3E9J B;  2CAI A;  2GT5 A;  1XW9 A;  4AF2 A;  1M2B A;  1ABA A;  1GLQ A;  2ZCT A;  4FO5 A;  4KCA A;  1PX6 A;  3Q18 A;  5H5Q A;  1TJD A;  2VCQ A;  2B6M A;  3A2X A;  4OMV A;  5EVO A;  1PD2 1;  2H6Y A;  3ZTL A;  3HVV A;  1S3A A;  1E6B A;  3IE3 A;  4O5R A;  4PTS A;  3EUR A;  3HYP A;  3ZVJ A;  2C0E A;  1F9M A;  1TK5 B;  5DAK A;  1WWJ A;  22GS A;  1C72 A;  4N10 A;  2H6X A;  5ECI B;  1QQ2 A;  3ED3 A;  2GLR A;  4F03 A;  4I8B A;  3M9K A;  4KW6 A;  5F06 A;  3NZN A;  1TI3 A;  4WR5 A;  2V6K A;  4JR6 A;  4KA0 A;  3TJB A;  3EU4 A;  5HR1 A;  2R5G A;  1WRY A;  1ON4 A;  1JLW A;  3HY2 A;  3GUS A;  2IPA A;  1PA3 A;  5AN1 A;  2PVO C;  1SD9 A;  3BJ5 A;  1M2D A;  2DSA A;  4RI6 A;  2HZE A;  4NHZ A;  4OO5 A;  4POK A;  2QKE A;  3H93 A;  20GS A;  3GUR A;  4HI7 A;  3HDC A;  4ML1 A;  1WP0 A;  3G7I A;  2GSS A;  2FA4 A;  1PX7 A;  2MZC A;  2IMI A;  2VCX A;  3KJY A;  5IPH A;  2PBJ A;  5JCG A;  2HSH A;  4O7H A;  5CRE A;  3KIJ A;  5DJM A;  1F2E A;  2AAW A;  2E7P A;  2HSM B;  2HSY A;  2GST A;  2LEG A;  1K0A A;  1HNB A;  1MDI A;  1XFL A;  4WXT A;  2B7J A;  1V40 A;  3TJF A;  2REM A;  1SKR B;  2X64 A;  5AIV A;  4K6X A;  5G1L A;  1UA5 A;  1M0U A;  4F9Z A;  3EWL A;  3ZZX A;  2GQL A;  1SEN A;  3SWL A;  5DQY A;  1O6J A;  4E8H A;  1GSS A;  2VCV A;  2X8H A;  1YKC A;  1K0C A;  3QAV A;  2MMN A;  1O8W A;  1EOG A;  1OC9 A;  2CX4 A;  2CZ2 A;  4GWR A;  3I43 A;  1YKA A;  2C80 A;  3CRT A;  1XW5 A;  3GA4 A;  5CP1 A;  1PRX A;  2H1B A;  1OC3 A;  3TJG A;  1DE2 A;  1TOF A;  3E0U A;  3H1N A;  5ECM B;  4IW9 A;  1GWC A;  1CQH A;  1OYJ A;  2H76 A;  1FW1 A;  2LRT A;  4ISD A;  4RQX A;  4F0B A;  2JSY A;  3VWV A;  2AV4 A;  3FR9 A;  4K7O A;  5D96 A;  3UOM A;  5GZZ B;  4G0L A;  5A4V A;  3GFK A;  4HDE A;  1TI1 A;  4DSS B;  4EO3 A;  1U87 A;  2XPD A;  3WYW A;  1U88 A;  1DBY A;  2KP1 A;  3ZRD A;  2YN1 A;  3FR6 A;  3IK7 A;  4JU5 A;  1SL1 B;  2O7K A;  1A24 A;  5B7C A;  3PIN A;  4TKY A;  4BA7 A;  1GSE A;  1YEP A;  2B7K A;  2RLI A;  2GQK A;  4JBB A;  3R2Q A;  2FA8 A;  2OAC A;  4YAV A;  4N30 A;  3IPZ A;  3L78 A;  4MH3 A;  3WGD A;  1PSQ A;  3HKR A;  2IFQ B;  3GMF A;  5ECR B;  2CX3 A;  2L57 A;  3TB2 A;  4XCS A;  5LD0 A;  5IMA A;  3GV1 A;  5ECQ B;  1PN9 A;  4WR4 A;  3VFI A;  3CSJ A;  2NBS A;  4J56 E;  3PR8 A;  3LQ7 A;  1TRV A;  3L0H A;  1UN2 A;  17GS A;  3LYP A;  2J9H A;  2V2G A;  3R3E A;  5CNW A;  3WT2 A;  1BYE A;  5IO2 A;  2LST A;  2M72 A;  3QD9 A;  5G30 A;  1KBN A;  1GSY A;  4K1F A;  3FZA A;  1O73 A;  2UZ8 A;  5IOX A;  3CTF A;  2NVL A;  5HR3 A;  3VWU A;  3TJJ A;  1DSB A;  3IV4 A;  3F4R A;  3M1G A;  5ECO B;  5COH A;  2R2J A;  1GLP A;  2H1A A;  1TRW A;  2RM6 A;  3A2V A;  2H6Z A;  2JAD A;  3ME8 A;  1ERW A;  1TTZ A; 
#chains in the Genus database with same CATH topology
 2FNO A;  2F8F A;  1G7E A;  1OKD A;  1FOH A;  5GST A;  2H74 A;  3C1R A;  1VF1 A;  4LMV A;  4PNG A;  2OAD A;  4MJB A;  4N11 A;  4MCU A;  2VL2 C;  2G2Q A;  5D9V A;  1M3I A;  1GUL A;  4ECI A;  3QR6 A;  4GF0 A;  4IP1 A;  2LTK A;  2I9H A;  3KXO A;  2NTO A;  2I3Y A;  4G10 A;  1TK8 B;  3CSI A;  3LOR A;  1GTB A;  2G0F A;  2XC2 A;  1SK1 A;  5IMC A;  4XHM A;  2C3Q A;  1AUC A;  2R6K A;  4K5S A;  3HVS A;  4G01 A;  3OR5 A;  3M3M A;  4KDX A;  3L9V A;  2KOK A;  1T00 A;  3DVW A;  3KP8 A;  4WKW A;  4BIK A;  4IGJ A;  5B8A A;  5L71 A;  1XOA A;  2L6C A;  4FXY P;  4ILF A;  4XIH A;  4XRA A;  1XPV A;  4ECC A;  4HZ2 A;  1PL1 A;  2VO4 A;  4F2I A;  4YKG A;  2B3S A;  3KMN A;  3IHG A;  1ERV A;  3MNG A;  3VPT A;  1SU9 A;  3MSZ A;  3BCK A;  5J9C A;  4Q5Q A;  4P3Y B;  2HFD A;  4ZIL A;  3EMP A;  16GS A;  5DCG A;  4IP6 A;  2DKH A;  2LQO A;  3FEU A;  1TXX A;  2VL2 A;  2VLT A;  2D2Z A;  2E0Q A;  3F6F A;  2AYT A;  1U6T A;  1JFU A;  1JZW A;  4HSC X;  1RQM A;  1FB0 A;  1KTE A;  3GIX A;  4CW9 A;  1XW6 A;  2JL4 A;  4V2L A;  5B6M A;  1SJZ A;  2HSM A;  5DDL A;  2VL3 A;  4CY8 A;  3KD0 A;  1MD4 A;  2I81 A;  2L59 A;  5B6N A;  2B5Y A;  3KMO A;  4HZ4 A;  3N5O A;  5J47 A;  1J0F A;  2FWF A;  3WD6 A;  4AGS A;  5A5H B;  3CMI A;  3US3 A;  1GUM A;  4ZL8 A;  3EMX A;  2CVB A;  2K9F A;  5IO0 A;  2DIZ A;  5EY6 A;  3GKX A;  1S3C A;  2K8S A;  1THX A;  1X5E A;  3IA1 A;  3C1S A;  1Z3E A;  2VKZ G;  1EEJ A;  2WS2 A;  3BCI A;  3U6V A;  3C7M A;  5CRH A;  5LNK e;  3GHA A;  4MPG A;  2HRA A;  3KM6 A;  3VUR A;  1G0T A;  3TDG A;  1BG1 A;  2FUG 2;  1WOU A;  3ME7 A;  3RPN A;  3QPM A;  1Z6M A;  1OKT A;  2H75 A;  2DJ1 A;  2PGT A;  2B1K A;  4KH7 A;  1M9A A;  3DIE A;  4RI7 A;  5KEJ A;  3C73 A;  4DSS A;  3IAS 2;  4G2E A;  4ID0 A;  2VOC A;  1HNA A;  3UAR A;  3IK9 A;  4EUY A;  4X1U A;  5GAN D;  1HQO A;  4KCE A;  3TKP A;  2ZNM A;  4TOP A;  4ZXG A;  1XCC A;  4G0I A;  4A5P A;  4AJ7 A;  5DVB A;  2XHF A;  1E2Y A;  1Z7P A;  3IAM 2;  4EF0 A;  1PMT A;  3LJR A;  5AIS A;  1OE8 A;  4K7N A;  2VIM A;  5HR2 A;  4ACS A;  2OE1 A;  1VF3 A;  3EE2 A;  3TRX A;  3HD5 A;  2O87 A;  1B4P A;  2IFQ A;  4GXZ A;  5E59 A;  1SYX A;  3FZ9 A;  4OCE A;  19GS A;  2YZU A;  1H4O A;  2HI7 A;  1XWG A;  1V58 A;  4KB3 A;  3CBU A;  3RHC A;  2FGX A;  4XS6 A;  5A34 B;  1G6Y A;  2BMX A;  1G7O A;  3HJP A;  5ABR A;  1M9B A;  4LL1 B;  1M99 A;  1TXU A;  4EL1 A;  2YWO A;  1ZYQ B;  1T8E B;  3CSH A;  4BVY B;  4HU7 A;  1ERT A;  1BF5 A;  1EWX A;  2R37 A;  4AKI A;  3HVN A;  1G6W A;  3GX0 A;  1F6M C;  5A4W A;  1BX9 A;  4H86 A;  2HRF A;  1GSQ A;  3EIN A;  2JAC A;  3MYD A;  2J23 A;  2IMD A;  1TU7 A;  3ZL5 A;  3Q6O A;  1SVM A;  5LCZ A;  1TKD B;  4Q5F A;  1RK4 A;  1T1V A;  1PGT A;  3KP9 A;  5JWQ B;  3RDW A;  3L4N A;  1V9W A;  1SK2 A;  2EFH A;  1T4Z A;  2B5E A;  2O36 A;  2MMO A;  4ZB9 A;  3AY8 A;  3UBK A;  1I5G A;  1Z5Y E;  4NMU A;  2V32 A;  2YJH A;  2XBQ A;  2ES7 A;  4IVF A;  1EZK A;  1TRS A;  3ZIV A;  1W4V A;  1R7H A;  1TP9 A;  2LJR A;  1PL2 A;  2PWJ A;  1BJX A;  3HZ4 A;  2KHP A;  4EC0 A;  4GTU A;  1A0F A;  4LLR A;  4IJI A;  1SVO A;  2DJJ A;  3UEM A;  4WEY A;  1PKW A;  4NV2 A;  1TK0 B;  2KLX A;  1DUG A;  2B1L A;  4MDC A;  2H66 A;  1A2L A;  2YJ7 A;  4MZW A;  3GX8 A;  3RAZ A;  2KP2 A;  2X4A A;  1FVJ A;  2XPE A;  5D93 A;  5JWR B;  4ZL9 A;  4I5Q A;  2H19 A;  4PUF C;  5KN1 A;  2DC5 A;  1WMJ A;  3LXZ A;  3HMJ G;  1WPI A;  3IXR A;  1MD3 A;  4ZB8 A;  4WBR D;  2L5L A;  2CA8 A;  5CYY A;  5CRW A;  1XIY A;  4CY6 A;  1ZL9 A;  3UIW A;  1B8X A;  1HNC A;  1X9M B;  5DQS A;  3IR4 A;  4XTS A;  2WDU A;  2C0D A;  1XWC A;  1YVL A;  1YJ6 A;  2LQQ A;  4KF9 A;  2IMK A;  3QCP A;  3HXS A;  1S3D A;  2YPM A;  1KEB A;  2JZS A;  1TU8 A;  2H70 A;  2YP6 A;  3TJK A;  1FOV A;  3L9S A;  3FR3 A;  2MMA A;  3VI5 A;  2H1L A;  2GZY A;  4E8E A;  3IC4 A;  1YQ1 A;  3ISO A;  1GUK A;  3QOU A;  1ZCP A;  2AJQ B;  5IMD A;  4MPF A;  5A5H A;  4OWY A;  3TUE A;  2DJ2 A;  3FHK A;  1O81 A;  2PPT A;  3GL5 A;  1HD2 A;  2HQT A;  5C00 A;  4ZIJ A;  3GRX A;  5F05 A;  1K0O A;  4BL7 A;  4ML6 A;  3C71 A;  5IMV A;  1M2A A;  1X5D A;  1X0R A;  5ECK B;  4TW5 A;  2VD1 A;  2P5R A;  4NV5 A;  2GZZ A;  3IBH A;  1VRS D;  2GTU A;  2F9S A;  3TU3 B;  1KNG A;  4WBJ A;  2RUE A;  4G9H A;  1PN0 A;  3W8J A;  1O85 A;  3TKS C;  1GTI A;  3FZ4 A;  1AC1 A;  4OO4 A;  3TKR A;  2FWH A;  4Q5N A;  1AXD A;  2Z9S A;  5G31 A;  4L5L A;  4BWS A;  1K0M A;  3ZIJ A;  4PXO A;  4DVC A;  1OAZ A;  4EXJ A;  1R5P A;  3BD2 A;  2FHE A;  1Y25 A;  3APQ A;  2WCI A;  1FB6 A;  2HSN B;  4O5Q A;  2YAN A;  2I1U A;  4IQ1 A;  2DBC A;  2OBK A;  4LMW A;  4TRX A;  2HXK A;  2YZH A;  1I1I P;  4PI0 C;  4NWY A;  3ERW A;  5F0G A;  3VWW A;  2PER A;  1ML6 A;  4BVX B;  2YWM A;  2IL3 A;  4PQ1 A;  5DBQ A;  2AHE A;  1J9B A;  1UC7 A;  4GSN A;  4KAE A;  5CRG A;  3TKS A;  1NM3 A;  1PKZ A;  2ALB A;  2C3T A;  4TVE A;  1SKW B;  5F8B A;  1JZO A;  3O76 A;  4WF4 A;  4YQV A;  1OE7 A;  5HFG A;  5A34 A;  2YWN A;  4EIP A;  2GGT A;  4KUN A;  5HR0 A;  2CVD A;  3I69 A;  1EEM A;  3D21 A;  4K8M A;  1LBK A;  4MH2 A;  3HVX A;  2GSR A;  2IN3 A;  1XWK A;  4BVY A;  1MDK A;  5IIZ A;  5IPG A;  18GS A;  5A5K A;  2BJX A;  3I9V 2;  2F51 A;  2EC4 A;  3F4T A;  4V2M A;  4MK3 A;  4WF5 A;  1FO5 A;  1F3B A;  2RUF A;  1X9W B;  4GRF A;  1USB A;  3IRA A;  4GSS A;  2LJK A;  5D9T A;  3ZYW A;  4MF5 A;  1QFN A;  3BOA A;  3GH6 A;  1SKS B;  4IEL A;  4PHZ C;  4PGT A;  4ZBA A;  3M9J A;  3V1W A;  5JWO B;  1W89 A;  4O32 A;  3QFB C;  1EV4 A;  3LSZ A;  4IN0 A;  2C4J A;  2R4V A;  3F3Q A;  4K0G A;  3O6T A;  1K3O A;  3G7J A;  3TCO A;  3DKS A;  1YEX A;  3DWV A;  3KCM A;  3W6G A;  1VGL A;  5FWG A;  2DIY A;  4POL A;  4HQZ A;  4OD7 A;  2DML A;  4N0Z A;  3KEB A;  1YEW C;  1VF2 A;  1U3A A;  4ULX A;  3KH7 A;  4Z7X A;  3VWX A;  1X9S B;  3NIV A;  1R5A A;  5ELG A;  5CAX A;  3GH9 A;  4ECB A;  1MTC A;  1GSF A;  4J2F A;  3UL3 A;  2LJA A;  3F0I A;  4EE0 A;  1SJI A;  1NW2 A;  2EFC A;  3GYK A;  1A0R P;  1XXU A;  3EYT A;  3QAG A;  2PUK C;  2BTO T;  2B5X A;  1Q4J A;  3I6A A;  5BMU B;  1B4Q A;  1U3I A;  1GNW A;  3DGQ A;  1ZYP A;  5ECS A;  5ENU A;  2CAQ A;  5HFK A;  1O7U A;  3DRN A;  4EKZ A;  4KE3 A;  3HZ8 A;  2V41 A;  1TW9 A;  4K5R A;  4MZB A;  1T7P B;  1NHY A;  3KGK A;  7GSS A;  13GS A;  4L0U A;  4AKX B;  4ZBD A;  3GKM A;  5IQY A;  1K0D A;  2GZP A;  3FRC A;  3VLN A;  1RW1 A;  1QXH A;  4IJ3 A;  4BL7 B;  1SYR A;  2X8C A;  3KZQ A;  5CRD A;  1OVN A;  4NHW A;  1BED A;  2R0G A;  4V1A g;  2OJL A;  1K3Y A;  1MDJ A;  4GST A;  3MWH A;  2JSZ A;  2H01 A;  4AJ6 A;  3TKS E;  4PX1 A;  3O3T A;  1J08 A;  1F3A A;  3ZRE A;  3KTB A;  1GUH A;  2N5A A;  3QDN A;  5G1K A;  4YQU A;  4MZC A;  3D4M A;  1B48 A;  3CTG A;  4GQC A;  3PGT A;  1GRX A;  1QK8 A;  2DJ3 A;  3QMX A;  4XRD A;  6GSW A;  11GS A;  5A4U A;  4JRR A;  3N9J A;  4MJC A;  3E3E A;  3WGX A;  3ZFL A;  1XZO A;  2ON5 A;  3ERG A;  2ON7 A;  1Y6E A;  4IKH A;  3EVI A;  1A8L A;  1ZMA A;  4NPB A;  3CWG A;  4MJA A;  4ZL7 A;  1MEK A;  2O85 A;  5H5R A;  2AUV A;  2EIO A;  2PU9 C;  2EFE A;  3ZVJ D;  2H0H A;  3GKK A;  5GSS A;  3TRQ A;  3UBL A;  2L5O A;  1WJK A;  4F82 A;  2HE3 A;  2GT6 A;  5CO3 A;  2JU5 A;  2E2G A;  2OA7 A;  3HJM A;  2IME A;  5IMZ A;  4I6X A;  2HSN A;  4MNN A;  1QMV A;  5A1N B;  3F4S A;  3ERF A;  1YZX A;  4KSM A;  1PQN A;  2H0I A;  1NSW A;  1K0N A;  3EC3 A;  2EFD A;  1K3L A;  3GTU B;  2YWI A;  3W8S A;  3LWA A;  1N8J A;  4BWQ A;  4BVX A;  5ELA A;  2FLS A;  1ILO A;  1JHB A;  4KDU A;  4PQI A;  2DJ0 A;  2R3X A;  3P90 A;  3HCZ A;  4FQU A;  5ECL B;  4TR1 B;  2MBT A;  4I97 A;  1NHO A;  3H8Q A;  4Z2U A;  4HQS A;  5J3R A;  2FWE A;  5J4V A;  4FYB A;  4KGI A;  2TIR A;  1AQX A;  4NXI A;  1FG4 A;  4FIW A;  1XOB A;  5IM9 A;  2FY6 A;  4K2X A;  2DKI A;  4O92 A;  4ZBB A;  5JCW A;  3TRP A;  2WW3 A;  2AB6 A;  2VLU A;  3F3R A;  2WVX B;  4FH8 A;  1GSD A;  1AIU A;  8GSS A;  3PPU A;  5HFI A;  1SD8 A;  2LUS A;  2H73 A;  3D22 A;  2LNT A;  2C0G A;  1I9D A;  3H79 A;  3IC8 A;  4QQ7 A;  4RUV A;  3EU3 A;  4JR4 A;  5KN0 A;  3A5W A;  1Z9H A;  1XVQ A;  4HJ2 A;  2C1Y A;  3D0Z A;  1AQW A;  2WZS A;  3S9F A;  1AQV A;  4K7I A;  1ZYE A;  3QAW A;  4OFT A;  1YY7 A;  2UV8 G;  1EOH A;  3LYK A;  4X43 A;  4JED A;  4K9Z A;  1AW9 A;  2CT6 A;  2P31 A;  4K2D A;  5KN2 A;  2PN8 A;  3DXB A;  5J4U A;  3CXG A;  4GDF A;  2HLS A;  5J4Y A;  5DAL B;  1V57 A;  5FHI A;  2H1D A;  4TR0 A;  1SJ6 A;  2IIY A;  1ACV A;  4QL7 A;  4HJM A;  2NPB A;  4ECJ A;  2A4H A;  5G5F A;  5G2Z A;  4OCF A;  4HOJ A;  2GSQ A;  4D73 B;  2DJK A;  2DLX A;  3F8U A;  5BMU A;  3J7Y b;  4FYC A;  2V6O A;  1YDK A;  2YV7 A;  4ICY A;  3ZLP A;  2X49 A;  4KSO A;  4WET A;  4HU9 A;  3K8N A;  1CQG A;  4L0W A;  4XS4 B;  3MAK A;  4TN8 A;  3A2W A;  4TXV A;  2YOI A;  3F9U A;  4G19 A;  9GSS A;  4DSR A;  4KND A;  2C8U A;  3HJO A;  2RII A;  1JLV A;  1Z7R A;  2H30 A;  3TOU A;  2IMF A;  5D8I A;  1B9Y C;  2CQ9 A;  1EGO A;  3LXT A;  2FCH A;  2VD0 A;  3M0F A;  4L5O A;  2VCW A;  3KH9 A;  4K0N A;  2K6V A;  1T4Y A;  2CV4 A;  2LRC A;  2HYX A;  2N5F A;  3APS A;  2A4V A;  4TXO B;  3P2A A;  4ZB6 A;  2HT9 A;  1M7T A;  1SL0 B;  2GDR A;  2M80 A;  1THO A;  2VCZ A;  1LU4 A;  3QFA C;  3FMW A;  2H8L A;  4QMK A;  3ZIT A;  1HYU A;  2MYG A;  2WRT A;  1A23 A;  2IJY A;  3M8N A;  3KTL A;  4MF6 A;  4L8E A;  2LRN A;  2F8A A;  2F3M A;  1XWB A;  3RPP A;  3GN3 A;  3ZFB A;  5ECP B;  2L4C A;  2I4A A;  3TOT A;  4MA9 A;  2YV9 A;  2DMM A;  2XBI A;  6GSU A;  4HUA A;  2WZ9 A;  3P7X A;  4KX4 A;  2VUP A;  1FHE A;  2YCD A;  5ID2 B;  2H0G A;  2GQM A;  3GSS A;  2WFC A;  5ECN B;  4MLY A;  3CHX C;  2IWT A;  4AJ8 A;  2EIR A;  2EIQ A;  1SL2 B;  4F0C A;  3VPQ A;  1EV9 A;  2NDO A;  2TRC P;  1S4B P;  2K8V A;  2ZUP A;  5DCH A;  4Q5R A;  2WB9 A;  4GLT A;  2R0P A;  4QL9 A;  2P5Q A;  3FZ5 A;  3WT1 A;  4YH2 A;  4BPY A;  4PUA A;  5HQP A;  2WJU A;  2HRK B;  2MBS A;  2LKU A;  1O8X A;  1GL8 A;  3H4K A;  3LGC A;  2QGV A;  2X8G A;  3RBT A;  3HHV A;  2L6D A;  5C04 A;  5A1N A;  1VF4 A;  2OKA A;  2TRX A;  3IDV A;  4IQA A;  3C8E A;  4DSQ A;  2K18 A;  5IOW A;  3GTU A;  4CDO A;  4EDY A;  5KOW A;  2O89 A;  3F63 A;  3GL3 A;  4N3Z A;  4GCI A;  3FKF A;  4JZQ A;  2JZT A;  4PUR A;  4KDY A;  3JCM L;  1GNE A;  3VK9 A;  4J57 E;  4POB A;  1UVZ A;  1XVW A;  2H1G A;  5DAK B;  3FW2 A;  5D9W A;  4AKH A;  3FYG A;  1A2M A;  3CQF A;  2A2S A;  3FK8 A;  3UMA A;  4N0V A;  3ZMK A;  4V2N A;  4TR1 A;  2CZ3 A;  4Z2R A;  5D9X A;  2YNX A;  2C0F A;  4XS1 A;  4EVM A;  4YAP A;  4X0X A;  1BG5 A;  6GSV A;  1A8Y A;  3DYR A;  1K0B A;  5B8B A;  3GKN A;  2VAF A;  1ZZY A;  4MMM A;  4I2T A;  4I2U A;  4POM A;  4NAX A;  4YQM A;  4PI2 C;  6GST A;  1TDI A;  4EDZ A;  1A2J A;  3F6D A;  1WIK A;  1YF0 A;  2WVX A;  5EL8 A;  4PQH A;  2H71 A;  2HZE B;  2VM1 A;  5D73 A;  1PFO A;  3DML A;  3UVT A;  2LS5 A;  1GP1 A;  3RFR C;  4FYU A;  3RHB A;  5FT3 A;  5F07 A;  1IYH A;  3GST A;  1GSU A;  3G9B A;  10GS A;  4G0K A;  2JZR A;  4OFN A;  2OE0 A;  4LL4 B;  4W66 A;  3MDK A;  3Q74 A;  3D5J A;  2C3N A;  2WUL A;  2VL9 A;  3IOS A;  1ZGN A;  2OE3 A;  3BBY A;  1R26 A;  1F37 A;  4IHU A;  4V1A p;  1EP8 A;  5J5N A;  1ERU A;  1URM A;  3PH9 A;  4ZB7 A;  3A5I A;  1V2A A;  5DAL A;  3UVH A;  4DEJ A;  1FVK A;  2LNS A;  3L9U A;  1Z6N A;  4IS0 A;  2VM2 A;  3APO A;  2HNL A;  3A3T A;  1YF1 A;  1FAA A;  2E2M A;  2H72 A;  1Q98 A;  3J7Y k;  2GS3 A;  1BQ7 A;  4D73 A;  2QC7 A;  1OC9 B;  3G7Y A;  2FWG A;  2MMZ A;  1B9X C;  2HRN A;  3IHQ A;  1GTA A;  4TR3 A;  5J41 A;  3LEF A;  1H75 A;  3D6I A;  1GH2 A;  2X99 A;  5DJL A;  3U5R E;  3FY7 A;  1ST9 A;  4LA1 A;  2FD3 A;  4GQF A;  2VCT A;  1JZD A;  4XS4 A;  3DVX A;  5JCU A;  3ZML A;  1M3J A;  1R4W A;  2QSI A;  5ECH B;  2OBI A;  3DD3 A;  1V98 A;  4YKF A;  3DEX A;  3CYN A;  2OT3 A;  3VI7 A;  3TKQ A;  3WGE A;  1GTU A;  2A2R A;  1WE0 A;  2N5B A;  2VLV A;  2M46 A;  4IBP A;  2V1M A;  4TXO A;  14GS A;  4MF7 A;  3GNJ A;  1EGR A;  1X5C A;  1XG8 A;  1BAY A;  4JE1 A;  4OFM A;  4TR4 A;  1OC8 A;  1TRU A;  3LFL A;  2RM5 A;  3SBC A;  4USS A;  4MJE A;  4RQR A;  5J9B A;  1IYI A;  2O8V B;  2GVP A;  3NOF A;  5AIX A;  3LG6 A;  5G5E A;  2KUC A;  4MP4 A;  3P8W A;  4CHS A;  4E68 A;  5IMF A;  1XWA A;  3MIX A;  4O5U A;  2PVQ A;  5ID2 A;  1JZR A;  3Q19 A;  5AGY A;  2L4Q A;  1SK0 A;  4EIQ A;  1DE1 A;  6GSX A;  2WGR A;  3HA9 A;  5E4W A;  2HZF A;  1N2A A;  12GS A;  3TGZ A;  5INY A;  1AAZ A;  4HEA 2;  5EPF A;  5H5S A;  1EP7 A;  5GAP D;  2PMT A;  3D4T A;  2P0G A;  4HS1 A;  1XBS A;  2CVK A;  4PNF A;  2LV3 A;  3UAP A;  6GSS A;  4MAB A;  1T3B A;  4X4J A;  1QUW A;  3CRU A;  2HRK A;  1QGV A;  1ZOF A;  3UJ1 A;  5KN3 A;  1LJR A;  6GSY A;  3E9J B;  2CAI A;  2GT5 A;  1XW9 A;  4AF2 A;  1M2B A;  1ABA A;  1GLQ A;  2ZCT A;  4FO5 A;  4KCA A;  1PX6 A;  3Q18 A;  5H5Q A;  1TJD A;  2VCQ A;  2B6M A;  3A2X A;  4OMV A;  5EVO A;  1PD2 1;  2H6Y A;  1S3R A;  3ZTL A;  2R0C A;  3HVV A;  1S3A A;  1E6B A;  3IE3 A;  4O5R A;  4PTS A;  3EUR A;  3HYP A;  3ZVJ A;  2C0E A;  1F9M A;  1TK5 B;  5DAK A;  1WWJ A;  22GS A;  1C72 A;  4N10 A;  2H6X A;  5ECI B;  1QQ2 A;  1SVL A;  3ED3 A;  2GLR A;  4F03 A;  4I8B A;  2WVZ A;  3M9K A;  4KW6 A;  5F06 A;  3NZN A;  1TI3 A;  4WR5 A;  2V6K A;  4JR6 A;  4KA0 A;  3TJB A;  3EU4 A;  5HR1 A;  2R5G A;  1WRY A;  1ON4 A;  1JLW A;  3HY2 A;  3GUS A;  2IPA A;  2QA2 A;  3RGB C;  1PA3 A;  5AN1 A;  2PVO C;  1SD9 A;  3BJ5 A;  1M2D A;  2DSA A;  4RI6 A;  2HZE A;  4NHZ A;  4OO5 A;  2WW2 A;  4POK A;  2QKE A;  3H93 A;  20GS A;  3GUR A;  4HI7 A;  3HDC A;  4ML1 A;  1WP0 A;  3G7I A;  2GSS A;  2FA4 A;  1PX7 A;  2MZC A;  2IMI A;  2VCX A;  3KJY A;  5IPH A;  5J40 A;  2PBJ A;  5JCG A;  2HSH A;  2WVY A;  4O7H A;  5CRE A;  3KIJ A;  2O3E A;  5DJM A;  2A2P A;  1F2E A;  2AAW A;  2E7P A;  2HSM B;  2HSY A;  2GST A;  2LEG A;  4AI6 A;  1K0A A;  1HNB A;  1MDI A;  1XFL A;  4AKG A;  4WXT A;  2B7J A;  1V40 A;  3TJF A;  2REM A;  1SKR B;  2X64 A;  5AIV A;  5KOX A;  4K6X A;  5G1L A;  1UA5 A;  1M0U A;  4F9Z A;  3EWL A;  3ZZX A;  2GQL A;  1SEN A;  3SWL A;  5DQY A;  1O6J A;  4E8H A;  1GSS A;  2VCV A;  2X8H A;  1YKC A;  1K0C A;  3QAV A;  2MMN A;  1O8W A;  1EOG A;  1OC9 A;  2CX4 A;  2CZ2 A;  4GWR A;  3I43 A;  2WW1 A;  1YKA A;  2C80 A;  3CRT A;  1XW5 A;  3GA4 A;  5CP1 A;  1PRX A;  2H1B A;  5BRT A;  1OC3 A;  3TJG A;  1DE2 A;  1TOF A;  3E0U A;  3H1N A;  5ECM B;  4IW9 A;  1GWC A;  1CQH A;  1OYJ A;  2H76 A;  1FW1 A;  2LRT A;  4ISD A;  4RQX A;  4F0B A;  2JSY A;  3VWV A;  2AV4 A;  3FR9 A;  4K7O A;  5D96 A;  3UOM A;  5GZZ B;  4G0L A;  5A4V A;  3GFK A;  4HDE A;  1TI1 A;  4DSS B;  4EO3 A;  1U87 A;  2XPD A;  3WYW A;  1U88 A;  1DBY A;  2KP1 A;  3ZRD A;  2YN1 A;  3FR6 A;  3IK7 A;  4JU5 A;  1SL1 B;  2O7K A;  1A24 A;  5B7C A;  3PIN A;  4TKY A;  4BA7 A;  1GSE A;  1YEP A;  2B7K A;  2RLI A;  2GQK A;  4JBB A;  3R2Q A;  2FA8 A;  2OAC A;  4YAV A;  4N30 A;  3IPZ A;  3L78 A;  4MH3 A;  3WGD A;  1N25 A;  1PSQ A;  3HKR A;  2IFQ B;  3GMF A;  5ECR B;  2CX3 A;  2L57 A;  3TB2 A;  4XCS A;  1ZYN A;  5LD0 A;  5IMA A;  3GV1 A;  5ECQ B;  1PN9 A;  4WR4 A;  3VFI A;  4Z2T A;  3CSJ A;  2NBS A;  4J56 E;  3EPT A;  3PR8 A;  3LQ7 A;  1TRV A;  3L0H A;  1UN2 A;  17GS A;  1Y1U A;  2QA1 A;  3LYP A;  2J9H A;  2V2G A;  3R3E A;  5CNW A;  3WT2 A;  1BYE A;  5IO2 A;  2LST A;  2M72 A;  3QD9 A;  5G30 A;  1KBN A;  1GSY A;  4K1F A;  3FZA A;  1O73 A;  2UZ8 A;  2WW0 A;  5IOX A;  3CTF A;  2NVL A;  5HR3 A;  3LW9 A;  3VWU A;  3TJJ A;  1DSB A;  3IV4 A;  3F4R A;  3M1G A;  2O5V A;  5ECO B;  5COH A;  2R2J A;  1GLP A;  2H1A A;  1TRW A;  2RM6 A;  3A2V A;  2H6Z A;  2JAD A;  1ERW A;  3ME8 A;  1TTZ A; 
#chains in the Genus database with same CATH homology
 2FNO A;  2F8F A;  1G7E A;  1OKD A;  1FOH A;  5GST A;  2H74 A;  3C1R A;  1VF1 A;  4LMV A;  4PNG A;  2OAD A;  4MJB A;  4N11 A;  4MCU A;  2VL2 C;  2G2Q A;  5D9V A;  1GUL A;  4ECI A;  3QR6 A;  4GF0 A;  4IP1 A;  2LTK A;  2I9H A;  3KXO A;  2NTO A;  2I3Y A;  4G10 A;  1TK8 B;  3CSI A;  3LOR A;  1GTB A;  2G0F A;  2XC2 A;  1SK1 A;  5IMC A;  4XHM A;  2C3Q A;  1AUC A;  2R6K A;  4K5S A;  3HVS A;  4G01 A;  3OR5 A;  3M3M A;  4KDX A;  3L9V A;  2KOK A;  1T00 A;  3DVW A;  3KP8 A;  4WKW A;  4IGJ A;  5B8A A;  5L71 A;  1XOA A;  2L6C A;  4ILF A;  4XIH A;  4XRA A;  1XPV A;  4ECC A;  4HZ2 A;  1PL1 A;  2VO4 A;  4F2I A;  4YKG A;  2B3S A;  3KMN A;  3IHG A;  1ERV A;  3MNG A;  3VPT A;  1SU9 A;  3MSZ A;  3BCK A;  5J9C A;  4Q5Q A;  4P3Y B;  2HFD A;  4ZIL A;  3EMP A;  16GS A;  5DCG A;  4IP6 A;  2DKH A;  2LQO A;  3FEU A;  1TXX A;  2VL2 A;  2VLT A;  2D2Z A;  2E0Q A;  3F6F A;  2AYT A;  1U6T A;  1JFU A;  1JZW A;  1RQM A;  1FB0 A;  1KTE A;  3GIX A;  4CW9 A;  1XW6 A;  2JL4 A;  4V2L A;  5B6M A;  1SJZ A;  2HSM A;  5DDL A;  2VL3 A;  4CY8 A;  3KD0 A;  1MD4 A;  2I81 A;  2L59 A;  5B6N A;  2B5Y A;  3KMO A;  4HZ4 A;  3N5O A;  5J47 A;  1J0F A;  2FWF A;  3WD6 A;  4AGS A;  5A5H B;  3CMI A;  3US3 A;  1GUM A;  4ZL8 A;  3EMX A;  2CVB A;  2K9F A;  5IO0 A;  2DIZ A;  5EY6 A;  3GKX A;  1S3C A;  2K8S A;  1THX A;  1X5E A;  3IA1 A;  3C1S A;  1Z3E A;  2VKZ G;  1EEJ A;  2WS2 A;  3BCI A;  3U6V A;  3C7M A;  5CRH A;  5LNK e;  3GHA A;  4MPG A;  2HRA A;  3KM6 A;  3VUR A;  1G0T A;  3TDG A;  1BG1 A;  2FUG 2;  1WOU A;  3ME7 A;  3RPN A;  3QPM A;  1Z6M A;  1OKT A;  2H75 A;  2DJ1 A;  2PGT A;  2B1K A;  4KH7 A;  1M9A A;  3DIE A;  4RI7 A;  5KEJ A;  3C73 A;  4DSS A;  3IAS 2;  4G2E A;  4ID0 A;  2VOC A;  1HNA A;  3UAR A;  3IK9 A;  4EUY A;  4X1U A;  5GAN D;  1HQO A;  4KCE A;  3TKP A;  2ZNM A;  4TOP A;  4ZXG A;  1XCC A;  4G0I A;  4A5P A;  4AJ7 A;  5DVB A;  2XHF A;  1E2Y A;  1Z7P A;  3IAM 2;  4EF0 A;  1PMT A;  3LJR A;  5AIS A;  1OE8 A;  4K7N A;  2VIM A;  5HR2 A;  4ACS A;  2OE1 A;  1VF3 A;  3EE2 A;  3TRX A;  3HD5 A;  2O87 A;  1B4P A;  2IFQ A;  4GXZ A;  5E59 A;  1SYX A;  3FZ9 A;  4OCE A;  19GS A;  2YZU A;  1H4O A;  2HI7 A;  1XWG A;  1V58 A;  4KB3 A;  3CBU A;  3RHC A;  2FGX A;  4XS6 A;  5A34 B;  1G6Y A;  2BMX A;  1G7O A;  3HJP A;  5ABR A;  1M9B A;  4LL1 B;  1M99 A;  1TXU A;  4EL1 A;  2YWO A;  1ZYQ B;  1T8E B;  3CSH A;  4BVY B;  4HU7 A;  1ERT A;  1BF5 A;  1EWX A;  2R37 A;  4AKI A;  1G6W A;  3GX0 A;  1F6M C;  5A4W A;  1BX9 A;  4H86 A;  2HRF A;  1GSQ A;  3EIN A;  2JAC A;  3MYD A;  2J23 A;  2IMD A;  1TU7 A;  3ZL5 A;  3Q6O A;  1SVM A;  5LCZ A;  1TKD B;  4Q5F A;  1RK4 A;  1T1V A;  1PGT A;  3KP9 A;  5JWQ B;  3RDW A;  3L4N A;  1V9W A;  1SK2 A;  2EFH A;  1T4Z A;  2B5E A;  2MMO A;  4ZB9 A;  3AY8 A;  3UBK A;  1I5G A;  1Z5Y E;  4NMU A;  2V32 A;  2YJH A;  2XBQ A;  2ES7 A;  4IVF A;  1EZK A;  1TRS A;  3ZIV A;  1W4V A;  1R7H A;  1TP9 A;  2LJR A;  1PL2 A;  2PWJ A;  1BJX A;  3HZ4 A;  2KHP A;  4EC0 A;  4GTU A;  1A0F A;  4LLR A;  4IJI A;  1SVO A;  2DJJ A;  3UEM A;  4WEY A;  1PKW A;  4NV2 A;  1TK0 B;  2KLX A;  1DUG A;  2B1L A;  4MDC A;  2H66 A;  1A2L A;  2YJ7 A;  4MZW A;  3GX8 A;  3RAZ A;  2KP2 A;  2X4A A;  1FVJ A;  2XPE A;  5D93 A;  5JWR B;  4ZL9 A;  4I5Q A;  2H19 A;  4PUF C;  5KN1 A;  2DC5 A;  1WMJ A;  3LXZ A;  3HMJ G;  1WPI A;  3IXR A;  1MD3 A;  4ZB8 A;  4WBR D;  2L5L A;  2CA8 A;  5CYY A;  5CRW A;  1XIY A;  4CY6 A;  1ZL9 A;  3UIW A;  1B8X A;  1HNC A;  1X9M B;  5DQS A;  3IR4 A;  4XTS A;  2WDU A;  2C0D A;  1XWC A;  1YVL A;  1YJ6 A;  2LQQ A;  4KF9 A;  2IMK A;  3QCP A;  3HXS A;  1S3D A;  2YPM A;  1KEB A;  2JZS A;  1TU8 A;  2H70 A;  2YP6 A;  3TJK A;  1FOV A;  3L9S A;  3FR3 A;  2MMA A;  3VI5 A;  2H1L A;  2GZY A;  4E8E A;  3IC4 A;  1YQ1 A;  3ISO A;  1GUK A;  3QOU A;  1ZCP A;  2AJQ B;  5IMD A;  4MPF A;  5A5H A;  4OWY A;  3TUE A;  2DJ2 A;  3FHK A;  1O81 A;  2PPT A;  3GL5 A;  1HD2 A;  2HQT A;  5C00 A;  4ZIJ A;  3GRX A;  5F05 A;  1K0O A;  4BL7 A;  4ML6 A;  3C71 A;  5IMV A;  1M2A A;  1X5D A;  1X0R A;  5ECK B;  4TW5 A;  2VD1 A;  2P5R A;  4NV5 A;  2GZZ A;  3IBH A;  1VRS D;  2GTU A;  2F9S A;  3TU3 B;  1KNG A;  4WBJ A;  2RUE A;  4G9H A;  1PN0 A;  3W8J A;  1O85 A;  3TKS C;  1GTI A;  3FZ4 A;  1AC1 A;  4OO4 A;  3TKR A;  2FWH A;  4Q5N A;  1AXD A;  2Z9S A;  5G31 A;  4L5L A;  4BWS A;  1K0M A;  3ZIJ A;  4PXO A;  4DVC A;  1OAZ A;  4EXJ A;  1R5P A;  3BD2 A;  2FHE A;  1Y25 A;  3APQ A;  2WCI A;  1FB6 A;  2HSN B;  4O5Q A;  2YAN A;  2I1U A;  4IQ1 A;  2DBC A;  2OBK A;  4LMW A;  4TRX A;  2HXK A;  2YZH A;  4NWY A;  3ERW A;  5F0G A;  3VWW A;  2PER A;  1ML6 A;  4BVX B;  2YWM A;  2IL3 A;  4PQ1 A;  5DBQ A;  2AHE A;  1J9B A;  1UC7 A;  4GSN A;  4KAE A;  5CRG A;  3TKS A;  1NM3 A;  1PKZ A;  2ALB A;  2C3T A;  4TVE A;  1SKW B;  5F8B A;  1JZO A;  3O76 A;  4WF4 A;  4YQV A;  1OE7 A;  5HFG A;  5A34 A;  2YWN A;  4EIP A;  2GGT A;  4KUN A;  5HR0 A;  2CVD A;  3I69 A;  1EEM A;  3D21 A;  4K8M A;  1LBK A;  4MH2 A;  3HVX A;  2GSR A;  2IN3 A;  1XWK A;  4BVY A;  1MDK A;  5IIZ A;  5IPG A;  18GS A;  5A5K A;  2BJX A;  3I9V 2;  2F51 A;  2EC4 A;  3F4T A;  4V2M A;  4MK3 A;  4WF5 A;  1FO5 A;  1F3B A;  2RUF A;  1X9W B;  4GRF A;  1USB A;  3IRA A;  4GSS A;  2LJK A;  5D9T A;  3ZYW A;  4MF5 A;  1QFN A;  3BOA A;  3GH6 A;  1SKS B;  4IEL A;  4PGT A;  4ZBA A;  3M9J A;  3V1W A;  5JWO B;  1W89 A;  4O32 A;  3QFB C;  1EV4 A;  3LSZ A;  4IN0 A;  2C4J A;  2R4V A;  3F3Q A;  4K0G A;  3O6T A;  1K3O A;  3G7J A;  3TCO A;  3DKS A;  1YEX A;  3DWV A;  3KCM A;  3W6G A;  1VGL A;  5FWG A;  2DIY A;  4POL A;  4HQZ A;  4OD7 A;  2DML A;  4N0Z A;  3KEB A;  1VF2 A;  1U3A A;  4ULX A;  3KH7 A;  4Z7X A;  3VWX A;  1X9S B;  3NIV A;  1R5A A;  5ELG A;  5CAX A;  3GH9 A;  4ECB A;  1MTC A;  1GSF A;  4J2F A;  3UL3 A;  2LJA A;  3F0I A;  4EE0 A;  1SJI A;  1NW2 A;  2EFC A;  3GYK A;  1A0R P;  1XXU A;  3EYT A;  3QAG A;  2PUK C;  2BTO T;  2B5X A;  1Q4J A;  3I6A A;  5BMU B;  1B4Q A;  1U3I A;  1GNW A;  3DGQ A;  1ZYP A;  5ECS A;  5ENU A;  2CAQ A;  5HFK A;  1O7U A;  3DRN A;  4EKZ A;  4KE3 A;  3HZ8 A;  2V41 A;  1TW9 A;  4K5R A;  4MZB A;  1T7P B;  1NHY A;  3KGK A;  7GSS A;  13GS A;  4L0U A;  4AKX B;  4ZBD A;  3GKM A;  5IQY A;  1K0D A;  2GZP A;  3FRC A;  3VLN A;  1RW1 A;  1QXH A;  4IJ3 A;  4BL7 B;  1SYR A;  2X8C A;  3KZQ A;  5CRD A;  1OVN A;  4NHW A;  1BED A;  2R0G A;  4V1A g;  2OJL A;  1K3Y A;  1MDJ A;  4GST A;  3MWH A;  2JSZ A;  2H01 A;  4AJ6 A;  3TKS E;  4PX1 A;  3O3T A;  1J08 A;  1F3A A;  3ZRE A;  3KTB A;  1GUH A;  2N5A A;  3QDN A;  5G1K A;  4YQU A;  4MZC A;  3D4M A;  1B48 A;  3CTG A;  4GQC A;  3PGT A;  1GRX A;  1QK8 A;  2DJ3 A;  3QMX A;  4XRD A;  6GSW A;  11GS A;  5A4U A;  4JRR A;  3N9J A;  4MJC A;  3E3E A;  3WGX A;  3ZFL A;  1XZO A;  2ON5 A;  3ERG A;  2ON7 A;  1Y6E A;  4IKH A;  3EVI A;  1A8L A;  1ZMA A;  4NPB A;  3CWG A;  4MJA A;  4ZL7 A;  1MEK A;  2O85 A;  5H5R A;  2AUV A;  2EIO A;  2PU9 C;  2EFE A;  3ZVJ D;  2H0H A;  3GKK A;  5GSS A;  3TRQ A;  3UBL A;  2L5O A;  1WJK A;  4F82 A;  2HE3 A;  2GT6 A;  5CO3 A;  2JU5 A;  2E2G A;  2OA7 A;  3HJM A;  2IME A;  5IMZ A;  4I6X A;  2HSN A;  4MNN A;  1QMV A;  5A1N B;  3F4S A;  3ERF A;  1YZX A;  4KSM A;  1PQN A;  2H0I A;  1NSW A;  1K0N A;  3EC3 A;  2EFD A;  1K3L A;  3GTU B;  2YWI A;  3W8S A;  3LWA A;  1N8J A;  4BWQ A;  4BVX A;  5ELA A;  2FLS A;  1ILO A;  1JHB A;  4KDU A;  4PQI A;  2DJ0 A;  2R3X A;  3P90 A;  3HCZ A;  4FQU A;  5ECL B;  4TR1 B;  2MBT A;  4I97 A;  1NHO A;  3H8Q A;  4Z2U A;  4HQS A;  5J3R A;  2FWE A;  5J4V A;  4FYB A;  4KGI A;  2TIR A;  1AQX A;  4NXI A;  1FG4 A;  4FIW A;  1XOB A;  5IM9 A;  2FY6 A;  4K2X A;  2DKI A;  4O92 A;  4ZBB A;  5JCW A;  3TRP A;  2AB6 A;  2VLU A;  3F3R A;  4FH8 A;  1GSD A;  1AIU A;  8GSS A;  3PPU A;  5HFI A;  1SD8 A;  2LUS A;  2H73 A;  3D22 A;  2LNT A;  2C0G A;  1I9D A;  3H79 A;  3IC8 A;  4QQ7 A;  4RUV A;  3EU3 A;  4JR4 A;  5KN0 A;  3A5W A;  1Z9H A;  1XVQ A;  4HJ2 A;  2C1Y A;  3D0Z A;  1AQW A;  3S9F A;  1AQV A;  4K7I A;  1ZYE A;  3QAW A;  4OFT A;  1YY7 A;  2UV8 G;  1EOH A;  3LYK A;  4X43 A;  4JED A;  4K9Z A;  1AW9 A;  2CT6 A;  2P31 A;  4K2D A;  5KN2 A;  2PN8 A;  3DXB A;  5J4U A;  3CXG A;  4GDF A;  2HLS A;  5J4Y A;  5DAL B;  1V57 A;  5FHI A;  2H1D A;  4TR0 A;  1SJ6 A;  2IIY A;  1ACV A;  4QL7 A;  4HJM A;  2NPB A;  4ECJ A;  2A4H A;  5G5F A;  5G2Z A;  4OCF A;  4HOJ A;  2GSQ A;  4D73 B;  2DJK A;  2DLX A;  3F8U A;  5BMU A;  3J7Y b;  4FYC A;  2V6O A;  1YDK A;  2YV7 A;  4ICY A;  3ZLP A;  2X49 A;  4KSO A;  4WET A;  4HU9 A;  3K8N A;  1CQG A;  4L0W A;  4XS4 B;  3MAK A;  4TN8 A;  3A2W A;  4TXV A;  2YOI A;  3F9U A;  4G19 A;  9GSS A;  4DSR A;  4KND A;  2C8U A;  3HJO A;  2RII A;  1JLV A;  1Z7R A;  2H30 A;  3TOU A;  2IMF A;  5D8I A;  1B9Y C;  2CQ9 A;  1EGO A;  3LXT A;  2FCH A;  2VD0 A;  3M0F A;  4L5O A;  2VCW A;  3KH9 A;  4K0N A;  2K6V A;  1T4Y A;  2CV4 A;  2LRC A;  2HYX A;  2N5F A;  3APS A;  2A4V A;  4TXO B;  3P2A A;  4ZB6 A;  2HT9 A;  1M7T A;  1SL0 B;  2GDR A;  2M80 A;  1THO A;  2VCZ A;  1LU4 A;  3QFA C;  3FMW A;  2H8L A;  4QMK A;  3ZIT A;  1HYU A;  2MYG A;  2WRT A;  1A23 A;  2IJY A;  3M8N A;  3KTL A;  4MF6 A;  4L8E A;  2LRN A;  2F8A A;  2F3M A;  1XWB A;  3RPP A;  3GN3 A;  3ZFB A;  5ECP B;  2L4C A;  2I4A A;  3TOT A;  4MA9 A;  2YV9 A;  2DMM A;  2XBI A;  6GSU A;  4HUA A;  2WZ9 A;  3P7X A;  4KX4 A;  2VUP A;  1FHE A;  2YCD A;  5ID2 B;  2H0G A;  2GQM A;  3GSS A;  2WFC A;  5ECN B;  4MLY A;  2IWT A;  4AJ8 A;  2EIR A;  2EIQ A;  1SL2 B;  4F0C A;  3VPQ A;  1EV9 A;  2NDO A;  2TRC P;  2K8V A;  2ZUP A;  5DCH A;  4Q5R A;  2WB9 A;  4GLT A;  2R0P A;  4QL9 A;  2P5Q A;  3FZ5 A;  3WT1 A;  4YH2 A;  4BPY A;  4PUA A;  5HQP A;  2WJU A;  2HRK B;  2MBS A;  2LKU A;  1O8X A;  1GL8 A;  3H4K A;  3LGC A;  2QGV A;  2X8G A;  3RBT A;  3HHV A;  2L6D A;  5C04 A;  5A1N A;  1VF4 A;  2OKA A;  2TRX A;  3IDV A;  4IQA A;  3C8E A;  4DSQ A;  2K18 A;  5IOW A;  3GTU A;  4CDO A;  4EDY A;  5KOW A;  2O89 A;  3F63 A;  3GL3 A;  4N3Z A;  4GCI A;  3FKF A;  4JZQ A;  2JZT A;  4PUR A;  4KDY A;  3JCM L;  1GNE A;  3VK9 A;  4J57 E;  4POB A;  1UVZ A;  1XVW A;  2H1G A;  5DAK B;  3FW2 A;  5D9W A;  4AKH A;  3FYG A;  1A2M A;  2A2S A;  3FK8 A;  3UMA A;  4N0V A;  3ZMK A;  4V2N A;  4TR1 A;  2CZ3 A;  4Z2R A;  5D9X A;  2YNX A;  2C0F A;  4XS1 A;  4EVM A;  4YAP A;  4X0X A;  1BG5 A;  6GSV A;  1A8Y A;  3DYR A;  1K0B A;  5B8B A;  3GKN A;  2VAF A;  1ZZY A;  4MMM A;  4I2T A;  4I2U A;  4POM A;  4NAX A;  4YQM A;  6GST A;  1TDI A;  4EDZ A;  1A2J A;  3F6D A;  1WIK A;  1YF0 A;  5EL8 A;  4PQH A;  2H71 A;  2HZE B;  2VM1 A;  5D73 A;  3DML A;  3UVT A;  2LS5 A;  1GP1 A;  4FYU A;  3RHB A;  5FT3 A;  5F07 A;  1IYH A;  3GST A;  1GSU A;  3G9B A;  10GS A;  4G0K A;  2JZR A;  4OFN A;  2OE0 A;  4LL4 B;  4W66 A;  3MDK A;  3Q74 A;  3D5J A;  2C3N A;  2WUL A;  2VL9 A;  3IOS A;  1ZGN A;  2OE3 A;  3BBY A;  1R26 A;  1F37 A;  4IHU A;  4V1A p;  1EP8 A;  5J5N A;  1ERU A;  1URM A;  3PH9 A;  4ZB7 A;  3A5I A;  1V2A A;  5DAL A;  3UVH A;  4DEJ A;  1FVK A;  2LNS A;  3L9U A;  1Z6N A;  4IS0 A;  2VM2 A;  3APO A;  2HNL A;  3A3T A;  1YF1 A;  1FAA A;  2E2M A;  2H72 A;  1Q98 A;  3J7Y k;  2GS3 A;  1BQ7 A;  4D73 A;  2QC7 A;  1OC9 B;  3G7Y A;  2FWG A;  2MMZ A;  1B9X C;  2HRN A;  3IHQ A;  1GTA A;  4TR3 A;  5J41 A;  3LEF A;  1H75 A;  3D6I A;  1GH2 A;  2X99 A;  5DJL A;  3U5R E;  3FY7 A;  1ST9 A;  4LA1 A;  2FD3 A;  4GQF A;  2VCT A;  1JZD A;  4XS4 A;  3DVX A;  5JCU A;  3ZML A;  1R4W A;  2QSI A;  5ECH B;  2OBI A;  3DD3 A;  1V98 A;  4YKF A;  3DEX A;  3CYN A;  2OT3 A;  3VI7 A;  3TKQ A;  3WGE A;  1GTU A;  2A2R A;  1WE0 A;  2N5B A;  2VLV A;  2M46 A;  4IBP A;  2V1M A;  4TXO A;  14GS A;  4MF7 A;  3GNJ A;  1EGR A;  1X5C A;  1BAY A;  4JE1 A;  4OFM A;  4TR4 A;  1OC8 A;  1TRU A;  3LFL A;  2RM5 A;  3SBC A;  4USS A;  4MJE A;  4RQR A;  5J9B A;  1IYI A;  2O8V B;  2GVP A;  3NOF A;  5AIX A;  3LG6 A;  5G5E A;  2KUC A;  4MP4 A;  3P8W A;  4CHS A;  4E68 A;  5IMF A;  1XWA A;  3MIX A;  4O5U A;  2PVQ A;  5ID2 A;  1JZR A;  3Q19 A;  5AGY A;  2L4Q A;  1SK0 A;  4EIQ A;  1DE1 A;  6GSX A;  2WGR A;  3HA9 A;  5E4W A;  2HZF A;  1N2A A;  12GS A;  3TGZ A;  5INY A;  1AAZ A;  4HEA 2;  5EPF A;  5H5S A;  1EP7 A;  5GAP D;  2PMT A;  3D4T A;  2P0G A;  4HS1 A;  1XBS A;  2CVK A;  4PNF A;  2LV3 A;  3UAP A;  6GSS A;  4MAB A;  1T3B A;  4X4J A;  1QUW A;  3CRU A;  2HRK A;  1QGV A;  1ZOF A;  3UJ1 A;  5KN3 A;  1LJR A;  6GSY A;  3E9J B;  2CAI A;  2GT5 A;  1XW9 A;  4AF2 A;  1M2B A;  1ABA A;  1GLQ A;  2ZCT A;  4FO5 A;  4KCA A;  1PX6 A;  3Q18 A;  5H5Q A;  1TJD A;  2VCQ A;  2B6M A;  3A2X A;  4OMV A;  5EVO A;  1PD2 1;  2H6Y A;  3ZTL A;  2R0C A;  3HVV A;  1S3A A;  1E6B A;  3IE3 A;  4O5R A;  4PTS A;  3EUR A;  3HYP A;  3ZVJ A;  2C0E A;  1F9M A;  1TK5 B;  5DAK A;  1WWJ A;  22GS A;  1C72 A;  4N10 A;  2H6X A;  5ECI B;  1QQ2 A;  1SVL A;  3ED3 A;  2GLR A;  4F03 A;  4I8B A;  3M9K A;  4KW6 A;  5F06 A;  3NZN A;  1TI3 A;  4WR5 A;  2V6K A;  4JR6 A;  4KA0 A;  3TJB A;  3EU4 A;  5HR1 A;  2R5G A;  1WRY A;  1ON4 A;  1JLW A;  3HY2 A;  3GUS A;  2IPA A;  2QA2 A;  1PA3 A;  5AN1 A;  2PVO C;  1SD9 A;  3BJ5 A;  1M2D A;  2DSA A;  4RI6 A;  2HZE A;  4NHZ A;  4OO5 A;  4POK A;  2QKE A;  3H93 A;  20GS A;  3GUR A;  4HI7 A;  3HDC A;  4ML1 A;  1WP0 A;  3G7I A;  2GSS A;  2FA4 A;  1PX7 A;  2MZC A;  2IMI A;  2VCX A;  3KJY A;  5IPH A;  5J40 A;  2PBJ A;  5JCG A;  2HSH A;  4O7H A;  5CRE A;  3KIJ A;  5DJM A;  2A2P A;  1F2E A;  2AAW A;  2E7P A;  2HSM B;  2HSY A;  2GST A;  2LEG A;  4AI6 A;  1K0A A;  1HNB A;  1MDI A;  1XFL A;  4AKG A;  4WXT A;  2B7J A;  1V40 A;  3TJF A;  2REM A;  1SKR B;  2X64 A;  5AIV A;  5KOX A;  4K6X A;  5G1L A;  1UA5 A;  1M0U A;  4F9Z A;  3EWL A;  3ZZX A;  2GQL A;  1SEN A;  3SWL A;  5DQY A;  1O6J A;  4E8H A;  1GSS A;  2VCV A;  2X8H A;  1YKC A;  1K0C A;  3QAV A;  2MMN A;  1O8W A;  1EOG A;  1OC9 A;  2CX4 A;  2CZ2 A;  4GWR A;  3I43 A;  1YKA A;  2C80 A;  3CRT A;  1XW5 A;  3GA4 A;  5CP1 A;  1PRX A;  2H1B A;  5BRT A;  1OC3 A;  3TJG A;  1DE2 A;  1TOF A;  3E0U A;  3H1N A;  5ECM B;  4IW9 A;  1GWC A;  1CQH A;  1OYJ A;  2H76 A;  1FW1 A;  2LRT A;  4ISD A;  4RQX A;  4F0B A;  2JSY A;  3VWV A;  2AV4 A;  3FR9 A;  4K7O A;  5D96 A;  3UOM A;  5GZZ B;  4G0L A;  5A4V A;  3GFK A;  4HDE A;  1TI1 A;  4DSS B;  4EO3 A;  1U87 A;  2XPD A;  3WYW A;  1U88 A;  1DBY A;  2KP1 A;  3ZRD A;  2YN1 A;  3FR6 A;  3IK7 A;  4JU5 A;  1SL1 B;  2O7K A;  1A24 A;  5B7C A;  3PIN A;  4TKY A;  4BA7 A;  1GSE A;  1YEP A;  2B7K A;  2RLI A;  2GQK A;  4JBB A;  3R2Q A;  2FA8 A;  2OAC A;  4YAV A;  4N30 A;  3IPZ A;  3L78 A;  4MH3 A;  3WGD A;  1N25 A;  1PSQ A;  3HKR A;  2IFQ B;  3GMF A;  5ECR B;  2CX3 A;  2L57 A;  3TB2 A;  4XCS A;  1ZYN A;  5LD0 A;  5IMA A;  3GV1 A;  5ECQ B;  1PN9 A;  4WR4 A;  3VFI A;  4Z2T A;  3CSJ A;  2NBS A;  4J56 E;  3EPT A;  3PR8 A;  3LQ7 A;  1TRV A;  3L0H A;  1UN2 A;  17GS A;  1Y1U A;  2QA1 A;  3LYP A;  2J9H A;  2V2G A;  3R3E A;  5CNW A;  3WT2 A;  1BYE A;  5IO2 A;  2LST A;  2M72 A;  3QD9 A;  5G30 A;  1KBN A;  1GSY A;  4K1F A;  3FZA A;  1O73 A;  2UZ8 A;  5IOX A;  3CTF A;  2NVL A;  5HR3 A;  3LW9 A;  3VWU A;  3TJJ A;  1DSB A;  3IV4 A;  3F4R A;  3M1G A;  2O5V A;  5ECO B;  5COH A;  2R2J A;  1GLP A;  2H1A A;  1TRW A;  2RM6 A;  3A2V A;  2H6Z A;  2JAD A;  3ME8 A;  1ERW A;  1TTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...