5JD6A

Crystal structure of mgs-mche2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of mar chica, morocco
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
252
structure length
219
Chain Sequence
DHLKQEGKFTYLEKGEGTPIVILHGLMGGLSNFDGVIDYFPEKGYKVLIPELPLYSMSLLKTSVGTFARYLKEFVDFKGYENVILLGNSLGGHIALLATKMFPEIVQALVITGSSGLKEIVDEVYETVSDRNKLVKTLAIAKSAIRHNMAKDLPKMKTPTCIIWGKNDNVTPPEVAEDFKRLLPDADLYWIDKCGHAAMMEHPEEFNQLLHEWFKERDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MGS-MChE2
publication title Crystal structure of MGS-MChE2, an alpha/beta hydrolase enzyme from the metagenome of sediments from the lagoon of Mar Chica, Morocco
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 68
structure length 219
sequence length 252
ec nomenclature
pdb deposition date 2016-04-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jd6A00
2WTMA 4WFJA 1X2EA 2H9YA 2Y6UA 1YASA 4KAAA 3AIOA 3B5EA 3IDAA 1WCYA 3N2ZB 4MYDA 2V97A 3U1TA 1SC9A 3T4UA 1LPMA 4FBMA 3C70A 3NWOA 5ALMA 1XKTA 5DLPA 1XLVA 1ZI6A 1XQXA 3OOSA 3OURA 3QVMA 1XRRA 1K63A 3DYVA 3TJMA 4BAUA 2PBLA 1DINA 3BJRA 2AJLI 5FXMA 1KU6A 3UUEA 4ARBA 2WLSA 1ZOIA 3S2ZA 1JFRA 1FFBA 2ZYIA 3NUZA 5LKRA 1QO9A 4WDRA 2Z3WA 4K6GA 3M81A 4KYVA 5KWIA 3IURA 5JADA 2JEYA 3HXKA 1RWQA 5EIAA 3TEJA 1HDEA 4Q34A 3ILSA 5AI0A 4UHCA 3R3VA 2OGSA 3K2IA 3L1HA 2RHWA 5JZ9A 3KSRA 2J3DA 4PV7A 2PVSA 4BP8A 3FSGA 1YR2A 4UUQA 1XZEA 4KEAA 1NU6A 1FFEA 4FTWA 3P2MA 1N5MA 4UHFA 5FOQA 4KR0A 2XMSA 1UKAA 4UHDA 1ZIXA 3DL7A 2PSHA 4OSEA 3W05A 4X71A 2ONCA 5LKAA 1EVQA 1BCRA 3V1MA 1UK9A 5E4TA 4FMPA 5AI4A 1BCSA 1EINA 4B85A 4TPKA 3STVA 5ALQA 4BATA 4IHAA 3A70A 5ALJA 1VE6A 3RK4A 4XJVA 2HU7A 3AFIA 3X3HA 4C6HA 5ESRA 3H17A 3S8YA 2BGNA 4LXGA 3PUHA 3ZI7A 4IH4A 3G9UA 2FJPA 2JGMA 2OQIA 3ICWA 4UBKA 2JBWA 4BCCA 4XX1A 2JF0A 4GI1A 3EQ9A 4X6YA 2JEZA 3O4IA 1GPNA 4AO7A 3VVMA 1QOZA 3AZPA 1JJBA 1XQYA 3D2CA 1W1IA 5FUMA 4HS9A 2W22A 3G02A 3CCCA 1LPBB 4W1SA 1OCEA 4PSUA 4G4IA 4LXIA 3WLAA 3ESBA 4BDTA 1MO2A 3EQ7A 4TGLA 4IQ4A 4AO8A 1F8UA 3IIIA 5ALOA 5ALGA 1VXRA 1WHTA 2DSNA 2XUHA 1ODSA 4JYMA 2RAUA 4YX9A 4Q3OA 2BFNA 2PSDA 1N5RA 5D3KA 3QMWA 4TVKA 2DQYA 3WI7A 5CBKA 5AK3A 3WL7A 3PE6A 5ALSA 3NGMA 4ROTA 2BUBA 1GGVA 2WUDA 4UBIA 4Y2XA 5AK4A 5I9IA 1L7RA 5AIBA 1JKMA 4X92A 4U2CA 1XZAA 3WKAA 1K8QA 4Y2TA 5BV7A 2WKWA 4B80A 3DYIA 5IVIA 4Q3KA 1Y37A 5C8VA 1VOTA 2XQGA 1U8EA 2PX6A 4OB6A 1YSCA 4H77A 1CUCA 2QVBA 3O0DA 3WL6A 4P08A 1LPNA 1DT3A 4LHEA 3DS8A 5AM4A 2HA4A 5FV4A 3WJ2A 4BTVA 3E4DA 4OU5A 4M0FA 5D6OA 3WL8A 1EHYA 3HZOA 4J0KA 3LLCA 3FLAA 4CG2A 1Q84A 2Z3ZA 3WKEA 3FVTA 1XLUA 4X93A 4Y2VA 2YXPX 2VJCA 3DDUA 2ZSIA 4UBLA 5I7UA 1R88A 3F67A 1GKKA 4JEIA 4J0CA 4N8DA 5ALHA 3SC2A 3A6ZA 5ALUA 1RP1A 4QLOA 3WWCA 4W63A 5D7BA 1LZLA 4X94A 3V48A 4AO6A 2X76A 1VE7A 4EHBA 4OYLA 1O6FA 3RARA 3VJLA 4C4YA 2G5TA 2IITA 1C7JA 1FFDA 4Y9SA 2PU5A 1G4HA 5AK6A 5T4EA 3D5EA 2CZQA 4EY4A 3V1NA 4ZXFA 2O2HA 3WK5A 3G0CA 4BZWA 4MWTA 5LIPA 3C43A 1U4NA 1AGYA 2I78A 1SOMA 4Y2RA 1AMNA 4J0DA 5AICA 4EZIA 1JU4A 4H35A 2XUQA 3KDAA 5EIEA 3WK6A 4GBGA 4GW3A 4HAIA 5AP9A 1U65A 1ZICA 4BRZA 4EBBA 1C4XA 4EY7A 4FNGA 1ODTC 1QIHA 1WHSA 1WPRA 2W6CX 3PI6A 5EFZA 1ZD3A 3C6ZA 3KWFA 3HACA 2XT0A 2OGZA 2WTNA 2H7XA 3BIWA 1XRMA 1ZI8A 4U2EA 2R8BA 4Y2YA 2IX9A 2OCLA 3ICVA 3O9VA 3O95A 3WKCA 4DIUA 1E8MA 4FFWA 3A2LA 2J4FA 1R9NA 3WKDA 1R9MA 4CCWA 4HZGA 3D2BA 1IUNA 3Q8WA 5A7GA 2HFKA 2XMGA 3G9TA 1ZIYA 5ALYA 5D3ZA 1TKRA 3E0XA 5CH8A 3BF7A 4X91A 1TK3A 4H7JA 3FNBA 4GEGA 5DNUA 3YASA 4PQEA 1EI9A 4GHWA 2XUOA 1TCBA 4X7BA 2BUCA 2V98A 4Q3LA 2VA9A 3FYUB 3MVEA 3KWJA 1CUVA 1DQYA 3DD5A 2YYSA 4WY5A 4DYHA 1H2WA 1MAHA 3DOIA 3EQ8A 3H0CA 2CKMA 2EDAA 1K5PA 1Q0RA 2ZVDA 4YASA 1M33A 1XZDA 3CCBA 3V1LA 2QTBA 2XMRA 3OM8A 3LCRA 2AJCA 2PSEA 1CLEA 2CB9A 3WK7A 3QMMA 1BROA 4FHZA 5JAHA 4GXNA 2HA2A 2RGUA 3RM3A 1WB5A 4HXFB 4IO0A 1CFJA 3QBJA 1PFQA 3H2KA 2CMFA 3ED1A 4W9RA 1AX9A 4WDQA 1FFCA 4DNFA 4JNCA 1XQWA 3WL5A 4M0EA 4HRYA 3AILA 1XROA 4LIPD 3I1IA 4ETWA 2VJBA 1YS2X 2GBCA 2C5FA 3K6KA 1FFAA 4F60A 2HU5A 3CN7A 4DMKA 1EVEA 3EBLA 4QEKA 1DWOA 3W2TA 1AURA 3C6BA 3QMVA 3ZLUA 5CRIA 1K4YA 3R3UA 5AI9A 5CURA 2V9ZA 2PPLA 2XQKA 5JYCA 1QGED 4H0CA 3RKSA 1W6RA 3FWHA 3R3ZA 3C6YA 4QNNA 1LPPA 4ZRDA 1LNSA 1EX9A 4UBNA 4G9EA 4CG3A 3FOBA 3E1GA 2OPHA 4UBJA 4V2IA 2UZ0A 2PL5A 1T4MA 7YASA 2WHQA 3DLTA 1ZI9A 2VT6A 5JD6A 5KREA 2HA0A 5BWCA 5FPPA 2HHAA 1XZFA 5HF5A 4QE3A 1QIKA 3M3DA 1GPKA 1QIMA 4BCBA 4K5QA 4YPVA 2RONA 4BDSA 1LPOA 1CUUA 2NW6A 4QZVA 5AKLA 2AJBA 1UOOA 1KEZA 4B82A 2AJ8A 4A16A 5DWDA 3IUMA 5AHXA 4IH1A 1A7UA 5AM1A 3C8DA 4AQDA 2B9VA 1D07A 3H1BA 1G42A 2ZJ7A 2EEPA 2O2IA 3HJUA 1SCQA 1SCKA 4N5IX 1VA4A 2ACEA 2XUAA 1JMKC 3IVMA 4BVJA 1MAAA 3DEAA 1CVLA 3H1AA 2FUKA 2GBIA 4DMHA 5DTIA 4X00A 4KAFA 3WK9A 3L1JA 4L72A 1IUOA 2HIHA 4Y2JA 4QA9A 5ALVA 4DSZA 3I2HA 1MNQA 5JALA 3MUOA 5K3AA 2Y2UA 4X6XA 3FLBA 5ALEA 4EY8A 4DLNA 1QFSA 3MGAA 1XZCA 2ZYHA 1IUPA 2H1IA 4AB1A 2QOEA 4U2DA 5KBYA 5C81A 4BBZA 2Z5GA 5LZ4A 2D5LA 2WG2A 4UHHA 3F97A 4MYSA 3AIKA 5FKJA 3DJYA 2PUHA 4ZV7A 2J4CA 5A6VA 1OXMA 4DMCA 5AI6A 4NMWA 4KJXA 2B4KA 4C89A 4FBLA 4N8SA 1VLQA 1AKNA 4Q82A 4RE6A 1J2EA 4OCZA 1VKHA 4DNOA 2VJAA 5KWJA 3TGLA 3BJMA 1EDEA 2BUAA 1XKLA 2BAGA 3PFBA 5ISMA 2O2GA 5AOCA 1I6WA 2XUDA 1YA4A 1CUDA 3MUNA 4ZREA 4B83A 1X70A 2WU4A 2JGKA 2XMDA 3ANSA 4DNQA 2VJDA 1QO7A 1X2BA 3STYA 1W52X 5E4JA 4X85A 2VEOA 1LPAB 1LGYA 5HF8A 4B0OA 1CR6A 4B9EA 3C6XA 1CUSA 5AM5A 3DQZA 1N1MA 2HM7A 3HC7A 2HU8A 5JAOA 1W4LA 1UFOA 4ARAA 1CUBA 3FYUC 5EHXA 1J1IA 3ESCA 5H3HA 4XVCA 4QWWA 5ALLA 3ESAA 2JGLA 1XZMA 4Q05A 3QPCA 2HADA 2ZJ6A 1GZ7A 3EIOA 1LZKA 1Q0ZA 4ZV9A 3KD2A 4H7FA 2ZYSA 2RIPA 3ANTA 4F21A 3H2JA 4DTCA 4YK7A 3ZLTA 4X90A 1XZLA 1H23A 1DQZA 2QT9A 1CUFA 3HRHA 3WK4A 1CPYA 4CI9A 1AQLA 1HLGA 4ZWNA 2XMCA 4F5ZA 3D59A 4RGYA 2QZPA 1VZ2A 3QYJA 4NS4A 2ROQA 4G5XA 3GZJA 2QJRA 1A88A 3AZOA 3FLEA 2XQIA 3V1KA 4Y2SA 1YCDA 1TAHA 2QM0A 4WFIA 1XZJA 1ORWA 3VJMA 1CUYA 1ISPA 1MN6A 5ALZA 3KOOA 5HK9A 3WKBA 2QS9A 1VJ5A 5AM2A 3I2FA 4WCVA 1XQVA 4CIAA 1QFMA 4F0JA 2XMQA 1G66A 4B84A 2XUJA 4B6GA 2XE4A 1RYYA 5AM0A 3OTQA 2K2QB 1CQWA 1BEEA 2BCEA 3GELA 2VATA 3G9ZA 1MNAA 1ORVA 3AJAA 3OG9A 3STUA 4FOLA 1TQHA 4W1RA 5K3EA 4BAZA 3HYSA 2GBGA 3V9AA 4G9GA 3FCYA 5AKXA 2QKYA 4LYDA 2DHEA 2VAXA 1E8DA 3C87A 3PICA 3OPMA 1CUJA 2FX5A 5T4BA 1Q83A 3I2IA 5CT8A 1Y7HA 3UUFA 4GWLA 3I6ZA 3O4GA 3F9CA 5T4HA 1TCCA 1CRLA 2QUAA 3D0KA 3DCNA 1MX1A 4BB0A 4P92A 4E14A 3IB3A 4H7EA 5CW2A 4PF1A 4B9AA 4U2FA 4BRSA 1XZKA 4J03A 1MPXA 2CUTA 3G0DA 2OCGA 5C8ZA 2WFZA 1BE0A 1QIJA 2HRRA 3STXA 2VAVA 3IUJA 4HRXA 2H7YA 1DX4A 3GUUA 3AZQA 1F0PA 2B20A 3I2JA 3ZPXA 4IH9A 4J0IA 4G4GA 4QDZA 1DT5A 2WFLA 4NVRA 4FKBA 3F98A 2HRQA 1CUEA 3CXUA 1UK7A 4N5HX 3QZUA 4Z49A 5FRDA 3G8YA 2QXUA 1R3DA 4QWMA 2WG1A 3LS2A 4JH0A 4U2BA 5HKAA 2DHDA 3WQHA 5E4YA 3E3AA 1EDBA 1GPLA 4QDXA 4G8CA 4CCYA 1BN7A 2ACKA 1JJFA 1GXSA 2OG1A 4C4XA 4I3FA 2WUEA 4DGQA 4AZ3A 1MU0A 3N0TA 1QJ4A 3TRDA 1P0IA 2WQZA 3I2KA 4MEBA 2WFMA 3A2MA 4EY6A 1A8UA 2ZYRA 5JASA 4J7AA 1JI3A 3VISA 2XLCA 4Y7DA 3VXKA 4H7HA 4Y2QA 3DKKA 4C01A 2X8BA 1Z68A 1PV1A 3H2HA 3JYHA 5CT4A 2WJ4A 3PDCA 5A71A 5LZ7A 5A2GA 2BGRA 1HBJA 2GYUA 5ALKA 4UPDA 5DYTA 1QLWA 4A5SA 5AK5A 5CT6A 4PW0A 4UFNA 2C5GA 3ESDA 4KAJA 3PUIA 1QIFA 2VQ6A 1EDDA 4H7DA 4Y2PA 1QIDA 1JMYA 3QH4A 3IULA 4B0PA 2JGIA 4K6KA 2OCKA 1CUGA 5AIAA 4MWSA 4BE4A 1DTEA 3M82A 1DWQA 1HKHA 1ZD5A 3HEAA 2GZSA 5FDFA 1ETHA 2Q0XA 5EI5A 4AMZA 1R50A 5JZSA 4GECA 4FLMA 3BXPA 5AKKA 2X5XA 2GYVA 3FYTA 1LPSA 4WY8A 2DQZA 2FJ0A 4WFKA 1MJ5A 2G63A 4EA6A 5T4FA 1T2NA 5K3BA 5SYNA 4ZI5A 1AUOA 1B6GA 3G9XA 1PJAA 1K6EA 1N8SA 4MXDA 4C87A 4DMFA 2OXEA 1OILA 4BE9A 3STWA 1F0NA 2OLEA 3R40A 1NX9A 5EIHA 4OUKX 5AOBA 3I6YA 1UK8A 4KRXA 4G4JA 3PF8A 2GBFA 3WIBA 2CEKA 2WIFA 3GA7A 1VXOA 3FBWA 4L9AA 4CFSA 4W1QA 5IKXA 4KE6A 5JZBA 5JAPA 3SWWA 3BDVA 3D3NA 1HQDA 5ALRA 4U2GA 2PSJA 1EXWA 1UOQA 2XLBA 2WIGA 1UZAA 2WSLA 5ALIA 2OAGA 2I3DA 5JARA 3HI4A 4BTLA 1EB9A 5DYYA 3WZMA 3T52A 1E5TA 1WOMA 3DOHA 3WJ1A 4KACA 1GT6A 4Y2UA 4BYMA 4OYYA 3O9MA 3DKRA 2QUBA 1QZ3A 2G5PA 4QDTA 4K6HA 2ZJFA 5CT9A 1MTZA 5JANA 3JWEA 2BJHA 1MX9A 5JIBA 2P8SA 4JYPA 3JW8A 5A7FA 3CN9A 3LIPA 3G7NA 5LYYA 3R3XA 4EY5A 2QRUA 4UFOA 3AIMA 4X95A 3WIOA 3KXPA 4G8BA 3VJKA 1C7IA 2DR0A 4X97A 2AJDA 5AOAA 1XFDA 1J07A 1LLFA 3R3WA 3A2NA 3H18A 1ODCA 4INZA 2LIPA 3O4JA 4KRYA 1EB8A 2XQFA 1IZ8A 3QITA 5AKYA 1ACJA 1ACLA 4CIBA 1CV2A 2VTVA 1B41A 1NU8A 5JATA 1UXOA 3HABA 2QR5A 4AX4A 1R4ZA 5K3FB 1CQZA 4EUSA 2VT7A 2Y6VA 1IVYA 3W9UA 1G5FA 5LP1A 1VA5A 3UMJA 2WILA 1ZJ5A 2WM2A 1JT2A 3H2IA 1CEXA 2ZSHA 2CJPA 3L1IA 3M83A 5K3FA 2JIDA 1F6WA 2WJ6A 4L3WA 4DNPA 2C58A 5AKJA 5ALPA 1P0MA 3R41A 1WB4A 4HXGA 5AI8A 4B81A 5AO9A 4MEAA 5JAUA 5FPQA 3G0GA 3AINA 2AXEA 1GQSA 5HF6A 1CUAA 5IH7A 4QDOA 2Z8XA 5AKEA 2VF2A 1A8SA 5F4ZA 3C5VA 3GFFA 3BF8A 4BCDA 5EHNA 1O6GA 3FAKA 1AC5A 5C7YA 2B61A 5HF9A 5HFNA 4RPCA 2DCMA 1R1DA 3SK0A 1ZD4A 2WIKA 4AZ0A 1H2YA 2VSQA 5A62A 1S8OA 5JD4A 4XIIA 5DNWA 1TCAA 4B7ZA 2JGFA 2O7VA 3IUQA 1QE3A 2JGJA 5EHQA 5AKZA 3ZV7A 2O7RA 4P93A 2HFJA 3D2AA 3LP5A 2HA7A 3IA2A 3BE8A 1UK6A 3FVRA 3SX4A 4PSCA 3QPDA 4UHEA 3WA7A 1UKCA 4LKOA 3I1YA 1DU4A 5HFAA 2J3QA 5FP0A 4DSAA 3D7RA 4X3CA 5LZ9A 4LYEA 3ZLVA 5DJ5A 3WYDA 1E3QA 2ECFA 4BZZA 3DL4A 2Z8ZA 1UKBA 2WHPB 1BRTA 4L0CA 3GROA 5HK8A 3GBSA 5LZ2A 1EA5A 4C4ZA 5AKHA 4G1FA 5AJHA 1BN6A 1QONA 2D0DA 5CH5A 3WWPA 1BU8A 3B3QA 4QLAA 5LZ5A 3G0BA 4M0MA 1GKLA 1CUHA 2XI4A 4BVKA 4EB0A 3D4LA 4FNMA 1L7AA 2RHTA 2WHPA 3PF9A 2XUPA 2QXTA 1ZJ4A 4J0HA 4BC0A 1UOPA 5HZGA 3G0IA 3QPAA 2HA3A 5DTJA 2GZRA 5CH3A 1BS9A 4LXHA 5JD5A 1TIBA 2PU7A 3FSGD 4NZZA 5BWBA 1EK1A 5CXXA 1P0PA 4BP9A 3IBTA 5ALXA 1FJ2A 2DHCA 2OAEA 4DM7A 3BL8A 1AZWA 1YAJA 2WIDA 3H04A 1XRPA 1DWPA 4J3JA 4GDMA 4P9NA 5ALDA 2C0PA 2HL6A 4N8EA 4OB8A 4PSDA 4X6UA 2CBGA 2XMZA 2WUGA 1CUXA 3F96A 4K2AA 4OB7A 2PUJA 4RE5A 4UBOA 5K3DA 1THTA 4GLBA 4I19A 2PKYX 1E66A 5EGNA 1ZGCA 1QTIA 4H18A 4KE8A 4I4CA 4HVTA 3VKFA 5AM3A 2V96A 4FFVA 4PO3X 1CUWA 2PSFA 5CMLA 2EDCA 2PM8A 1XZHA 3O4HA 1EK2A 1XZGA 3VVLA 4BC1A 2WFLB 2RI6A 3W9BA 5ALNA 6YASA 2H7CA 3C8HA 2XDWA 2R11A 1J06A 3BWXA 3I28A 2OGTA 1BEZA 1H2ZA 1YS1X 4MJ3A 2YH2A 5YASA 1YB7A 3R3YA 4HTAA 2YASA 1THGA 2WHRA 4HXEB 4KE9A 5ALTA 3WZLA 1IMJA 4CCYB 3U0VA 1JU3A 1CUIA 2I03A 3STTA 4UHBA 4OD0A 4BVLA 1TRHA 3ZWQA 2I3ZA 2E3JA 3FCXA 4WJLA 1QIGA 1E89A 1H2XA 5LZ8A 3WYNA 1QIEA 5K5EA 4ITVA 2XUIA 3HSSA 3NOXA 4E46A 1IZ7A 1W76A 3WWOA 1XLWA 3QM1A 3C45A 5HKBA 4C88A 5DNVA 1YA8A 5FLKA 2HDWA 4FLEA 2XUFA 2HA5A 4PNZA 1UT6A 3C5WP 3W06A 1YAHA 5BOVA 5I8PA 3H19A 5HQ3B 3WK8A 5IVDA 3EF3A 2IIVA 2GYWA 1YB6A 4J0GA 3WA6A 2BKLA 3WMRA 5J3JA 4H7KA 4UBMA 5AKIA 1LBSA 4RNCA 5HQ3A 4W1PA 2C4HA 1XZIA 3R0VA 4MQMA 4AXBA 1L7QA 2C0QA 1ZD2P 1XRLA 1SCIA 5DYWA 2QMQA 2WUFA 4E15A 3FYUA 5E2IA 3LIIA 5K3CA 1W75A 4J0JA 2Y1KA 2WU3A 3BIXA 1H22A 1CIJA 5CT5A 4QDUA 1P0QA 1HPLA 1Y7IA 4JUIA 5SYMA 2WIJA 2WJ3A 1QTRA 3W04A 3PFCA 4OPMA 2G4LA 2JGEA 4A23A 4FWBA 3OC0A 5AI5A 3WWEA 1XZBA 1GQRA 5AH0A 5CTAA 1EH5A 1XRNA 1JJIA 1U2EA 2XQJA 5ALWA 1HL7A 5IVKA 1ZGBA 1KU0A 2OQVA 3H2GA 1WM1A 4KE7A 1LBTA 3WWDA 5CXUA 2OCIA 4FLFA 4O08A 2QJWA 4AMYA 5EHZA 5AKGA 4BAGA 3BDIA 1VZ3A 4UFPA 1CUZA 3VDXA 1WB6A 2C7BA 3F8SA 2XUGA 4OU4A 3RLIA 4MQLA 1MT3A 1USWA 4G8DA 2HA6A 4H7IA 3DNMA 1FSSA 2XB6A 4AN1A 2XUKA 1A8QA 2XMBA 3B12A 3K9BA 4AN0A 1MX5A 1QIIA 1XRQA 1UWCA 1DX6A 3I2GA 5IVHA 4E11A 4D9JA 1SFRA 1WPXA 3AUKA 4FDMA 2DFPA 2ES4A 4Q1VA 4S0XA 5HCUA 5A7HA 5C8XA 4ZGBA 2ORYA 5LLSA 1E8NA 4XWGA 3HLKA 2WG0A 4CG1A 2Y2VA 5ALFA 3I6MA 3Q0TA 3IUNA
chains in the Genus database with same CATH superfamily
4QDJA 4MZDA 3VSBA 4EIWA 3WHIA 1UAYA 5LNK6 1CVIA 2V7UA 1GNQA 1QK5A 2H9YA 2Y6UA 3FRIA 1D1TA 1Y9DA 3ZE0B 1KZYC 2R48A 1BDBA 2Z3VA 1SUDA 1SELA 3F5SA 3IUPA 3PNSA 4G5HA 4YI3A 1WCYA 4ENSA 4RY0A 4D43A 3A7DA 3IDQA 4BLOA 1Y3HA 4MYDA 2QMUA 4KB5A 4WK6A 1IEXA 1MVOA 1NF3A 4CM9D 3ELBA 4U0JA 1I7NA 2E9SA 4PWZA 5B7PA 4FBMA 5FORA 4BEVA 1ENZA 1RYZA 3CH5A 2G40A 2PCLA 3EGXB 4QYIA 5E3IA 5DLPA 3G59A 3MMNA 3REOA 4E22A 4B44A 1IYZA 3RE1A 5HOQA 4KO1S 3ZHOA 3LVFO 3OOSA 3I45A 2HPVA 2PLFA 3CVUA 2GPNA 4X1OA 3T3OA 2P77A 4Q24A 1D7OA 3OURA 2P67A 3BMQB 3CZCA 4BO7A 3QVMA 3TZCA 1IPHA 2P91A 3SF0A 4JSRA 1XRRA 3W7AA 1QGUB 1OXTA 4AT1A 1IBRA 2K2WA 3T41A 4MYTA 2Y0DA 1Y5MA 2WWFA 2ZAGA 1QPGA 3E48A 3UUEA 1AQIA 1KU6A 4Z1OA 5K0CA 1I1OA 3AHHA 3NXSA 1QWSA 2P41A 1QB7A 2WLSA 3GIDA 5CYFA 1D3AA 1ZOIA 3PLAE 1W5AA 5B1DA 5IT9A 4O1IA 4GI7A 4ZKEA 1G3MA 1P1FA 4MCJA 2V6BA 5HZHA 1O97D 1PHPA 4W5JA 2I1VB 4KVFA 5EE9A 3CJTA 3FOZA 1MX3A 2JJ2D 3AV0B 4DIOA 5BQ3A 2BHNA 2ANBA 1FFXA 4I9GA 4TYQA 1OWLA 2J85A 4IKOA 3L0YA 4R7GA 4HWSA 4RGBA 4FOTA 2FN3A 1TTQB 2VDRB 4UXHA 4ZVNA 1R2QA 4KYTA 2RGBA 4CTNA 2WABA 3NM4A 5F7JA 2QY6A 3LUPA 1C1XA 4RS3A 5IX8A 5LP6C 3W2GA 2JEYA 2WM3A 5EMLA 3DZJA 3TD9A 1EP2B 1OBOA 4RUKA 3VVCA 5JNTA 3ILSA 3JQGA 1QH1B 3ZWKA 5AI0A 4UHCA 2ZIZA 4L73A 4YP1A 3SZGA 1EFPA 2BF7A 2WI8A 1PCXA 2GJAA 2ZAOA 1ZINA 2B99A 2Z8YA 3K2IA 1NY6A 3WGZA 2RMKA 4EK9A 3L1HA 2RHWA 2XGJA 4CL3A 4KX3A 1FFYA 2YINC 4D8TA 1W5EA 4GG1A 3N87A 4MUGA 5K0LA 1NBAA 2J3DA 3R8CA 4ZPJA 2NUAA 2IU3A 3O2QB 2OHJA 3QVVA 4PV7A 1B8OA 4V3BA 4A5OA 2TRSB 3ZHYA 1GIAA 2BSAA 2H1WA 3GLSA 4QT4A 3MM4A 3MB8A 4HFJA 4AUEA 3GRKA 1NL3A 1XVIA 3PTLA 3AJRA 1TO1E 3ROEA 3QFFA 3PQCA 4H3VA 2ZRNA 4L75A 3PBKA 1L4YA 5FPHA 3PT5A 2R86A 1XBTA 3ILXA 2VPQA 3QLVC 1Z0AA 3QPUA 4OA5A 4FTWA 1XLTA 3K0FB 2GKSA 3NW9A 3GEMA 4RD2A 4HNTA 4WXMA 4UHFA 4LKRA 5FOQA 2B6HA 4DUGA 1V1MB 1WZIA 3ZHQA 2B30A 2GJKA 1UKAA 3MRTA 5ECWA 4BUJA 1BHQ1 3CB4A 1U2DA 2D8AA 2XBUA 3M49A 1ZIXA 5J63A 4DCGA 5CDGA 3OQJA 4ZYYA 5IT4A 2QPAA 4Y2PA 1VECA 3MLAA 1FRQA 2NACA 3K0HA 1YR8A 2QD5A 3L1UA 1USVA 1MZPA 1UAGA 2D8MA 3NI2A 1NVVQ 1T3GA 3OMLA 4J0QA 2Y4OA 2F00A 3KQKA 5L7TA 5E4TA 4AZ0B 1XXLA 1E4OA 2NQTA 2BEVA 3CRMA 4FMPA 5J47A 1BCSA 2MSDB 1YDWA 4R83A 2B69A 1GSOA 3NTXA 3SZLA 4BATA 5JS6A 1TVEA 5IEBA 1CHNA 1TYAE 3MTQA 4EFNA 1RI4A 4NJOA 4HB0A 5JVDF 2AHRA 4PX9A 4P82A 1A9OA 1QRTA 3H17A 4KQ6A 2ZB4A 3C0KA 2V45A 3E5NA 4HN2A 4RH3A 4BLWA 3P27A 3C74A 1WW2A 1GEEA 2DFDA 3MMPA 4XD2A 1XHFA 3D5TA 3FMOB 3V1UA 5HM6A 4ENVA 3GMTA 3G9UA 1IEWA 2R6CA 4QPZA 2Y76A 4NCAA 1SUSA 3GXBA 4HEHA 1Z0UA 1Z0FA 1Z7WA 2C03A 5ED0A 4B74A 5F77A 3WNVA 2ET6A 2GPAA 2JBWA 3E84A 4EPRA 2JKYA 2UVDA 3AFOA 3MT8A 4BCCA 2BGUA 1L7DA 1ZN8A 2GLXA 1TAQA 3ANXA 2PRKA 4GI1A 2CY0A 3IX7A 1B42A 4HLUA 4QBFA 3TRJA 4BFTA 1T9AA 4Z51A 1BIFA 2PEYA 1RKXA 2I4IA 3OLVA 1E2MA 1E18A 4AO7A 1GVNB 5IJWA 3LKDA 1QOZA 1UL1X 2FYTA 5FD8A 2CVZA 3R5HA 2GXSA 4ZQIA 1NASA 1ACMA 2Q3HA 3P26A 4YRQA 4HFNA 3IIEA 4BO2A 3P52A 2IDKA 4HN9A 4BJ5A 4I99A 5IT5A 4JC0A 1ZNZA 1I1QB 1T36B 2HV9A 1NOKA 1UBFA 3CCCA 3KOZA 3OP1A 3RGWS 1HMYA 3PE4A 3A58B 4QXRA 3T5PA 4O3MA 3JYNA 3FTNA 4HOYA 1RJDA 3E3LA 1IL0A 1IDOA 1UBJS 2DHQA 4YRAA 1IJEA 4PSUA 5P8WA 3A05A 4RHCA 1T15A 3R8FA 3K0CA 2Q8QA 4V02A 3CURA 3BWVA 3RBXA 2YHIB 3HJGA 1T4DA 1O0BA 1O08A 3CLUC 3RRBA 2AOTA 1EGHA 5ALOA 4N7JA 1WIWA 2P8JA 4IDDA 4FWTA 1HDZA 1BZYA 1BJTA 3KR0A 1IY1A 2OTCA 1N9KA 1DEOA 1Y9EA 3AO0B 5ALGA 4HBZA 1KY4A 2DSNA 2XUHA 2ZYGA 1KWKA 1ODSA 4Z7NB 3IBSA 4RJTA 4UHJA 4AD8A 4JYMA 2H1FA 1EE9A 3BS4A 4KV7A 3W5UA 1CZNA 4I4NA 1FS5A 2C9OA 2GNPA 2PSDA 1N5RA 3T3EA 4TVKA 3R7DA 4EMBA 1PE0A 4P4NA 4ASUA 3WLQA 3AK4A 3JAWA 3KX2A 2EX4A 3DV9A 4O2AF 5AK3A 1UWKA 3PE6A 3I73A 4NXNB 2V9CA 1U04A 4MLDA 5ALSA 2RGRA 3I58A 3OZGA 3C3MA 3UXYA 1JHPA 4ROTA 4ZAXA 1UEXC 2BUBA 1GGVA 2FWNA 4UBIA 4DA0A 1JW9B 1TMKA 3OOJA 1JKMA 1PNVA 3CO5A 3WKAA 3JAKB 1KIFA 4EDFA 3FWZA 2G0TA 4DAOA 4CM8B 4L50A 1XU7A 3NKVA 3TI7A 4QHYA 3FTQA 3H5LA 1QXSA 1APBA 3EGCA 5FBHA 1Y3AA 1QQBA 4CV0A 3KEGA 2Z95A 4H08A 5DHQA 4KO2S 5H9WA 1GCUA 2H4XA 1LKZA 4LHYA 4E2XA 5AVJA 4ER7A 1NVTA 3CKYA 1CY4A 3QU2A 5C8VA 4OB6A 4WACA 1YMVA 4RSRA 3R2JA 4MUEA 5IUNC 4FZRA 1Z4QA 4HGQA 1J1UA 1SCAA 2B98A 5KOHA 1FFHA 2VLBA 5KYYB 1ZJYA 2QVBA 1JQEA 3A0UA 3WL6A 1LPNA 4CBVA 4HAYA 3K1YA 4ZCRA 3PEWA 3OVMA 4LHEA 4DANA 3RFXA 3FHCB 2LXNA 4DBLE 2FPPB 5J4LA 1XL1A 1NI4B 3A32A 1EQAA 1YRWA 4N0EA 1DC7A 2DUNA 1GNSA 3DVAB 1P4HA 4Z9BA 4BTVA 4A0FA 3NIFB 3CW8X 5D6OA 4HQ0A 4IPTA 1A50B 5LMZA 3F6EX 2X6RA 5CP8A 4HQRA 1UMDA 4C7KA 1JDUA 1U1GA 3IUYA 3RVRA 1FUIA 1CY1A 2GSDA 3FNHA 4FHCA 1HEIA 2YC2C 2AOWA 2PZBA 2Z3ZA 2Z0MA 2OV6A 1C7FA 1N0WA 1VM6A 4CKEB 3QEAZ 3KHUA 3SCZA 5MF6A 4MGYR 1MG0A 5TQ2A 1SY7A 3VO9A 3AI7A 3WBFA 3RI3A 2W2OA 2B8WA 5I7RA 1L7XA 4WOCA 1T8SA 3ND6A 4X93A 5JVDA 3LFTA 3NDIA 4HGYA 4KVZA 3P97A 2WVGA 4X24A 4Y2VA 5BO5A 4IMJB 2MSLA 4KXVA 2GM9A 3KVNA 4UBLA 2R9VA 3H99A 2P69A 3QEMA 2IS6A 1LBEA 1Z6GA 4XM1A 4UE6A 1ZZEA 5I7OA 1XTZA 2BMDA 4NP6A 4FEEA 4C2TA 1DJMA 2EG5A 1BSVA 3AP2A 1GKKA 4LTNA 2X8JA 4KSCA 4REQA 3H2SA 4OXQA 4BN5A 3D3KA 5GPBA 4MPJA 1EJ0A 3KWMA 4KQJA 4G1BA 4D9KA 2XOXA 2RH4A 3HFJA 1SIBE 4KR3A 3RTDA 1PYOA 2OK8A 2PGAA 1YBVA 1FJGB 2ARKA 1O58A 4MQEA 1W5BA 3MC1A 2AFIE 3A6ZA 5ALUA 3REQA 4B2LA 5LU9A 1Y5RA 2JFFA 1PT9A 4EVQA 3W7BA 1A9XA 1LZLA 4JBWA 1ST3A 4MKGA 1FK8A 2PEZA 1QH8B 3FJYA 5H16A 5HTKA 2I9KA 3WDLA 1X19A 2NAPA 2GM5A 1E1CB 1JH9A 3EXFB 2QL7A 2IOQA 3HDTA 1VE7A 2XA2A 5D5QA 3RARA 1LF0A 2OAP1 3UKJA 2IITA 5KNCH 1LSUA 2WZQA 3CNBA 3U3RA 3LFUA 4LSZA 4ATNA 4CLRA 5JNWA 2Z09A 1B14A 1DAKA 3S5UA 5ITWA 2VOEA 2A0XA 3Q6MA 1W9HA 4NBWA 3WXMA 3QNMA 2FR0A 1PQYA 5E0KB 4D80A 1RRCA 1EK6A 4FSXA 2PU5A 3OUZA 5FPSA 5AK6A 2NU9A 2H6EA 1J97A 4LEIA 3I9MA 4BX0A 3I4LA 3NVKI 1NSFA 1X38A 3QKRA 1EFHA 3LTEA 2FDXA 2JARA 4GXTA 2O5RA 5B1SA 5JJ5A 1OH6A 2F3UA 4INJA 1N2HA 5DULA 1Q6ZA 1T0JB 1XN1A 4RVGA 4B3MB 2GAJA 2GHQA 3I52A 4XCQA 3ZJ4A 4BNTA 2JCVA 4DCUA 2XTMA 5E1OA 3N7UA 2BH2A 2WB4A 3DE0X 3IPXA 3KAPA 1B8VA 1VIDA 4CQLB 4QD3A 2JGAA 1KY3A 5I3CA 5F73A 1M1NA 5TARA 1UOEA 4OBBA 4D8VA 1U4NA 1AGYA 3IPCA 5FPTA 2OV4A 4Y2RA 3OPQA 3ZBQA 4O2AA 2GR9A 3F7MA 1AMNA 3DOCA 4LY6A 2NO7A 3KYCA 3HDHA 3NATA 4WCFC 3OC6A 3FCSB 1KMIY 2Q6OA 5BYJA 3SKYA 3RYCB 2M6SA 4R0VA 4YJDA 3TLGA 5U4XA 4JSTA 1B0ZA 1NKVA 2CXHA 2YOFA 3WK6A 1SXJB 1V96A 4QOSA 4DLAA 4GW3A 2PYDA 1GPH1 4ND7A 4I1OA 4F8EA 4BRZA 5B53A 3EOZA 1I0LA 1E3MA 4HAUA 2A9VA 2XB4A 1QQTA 3M6AA 2QLJA 1HQKA 1SBIA 1XVAA 2A88A 4K6MA 1S2LA 1CNFA 2QW8A 1QIHA 3GPCA 2V8OA 5EKUA 4R6XA 1UDRA 1QSGA 1G60A 2ZE6A 1RXEA 3Q3JB 1ZD3A 4DLLA 3RAPR 1UPTA 1E3JA 1MKYA 3E9QA 5C5DA 2FSFA 5FO0A 1VSQA 4JLPA 4K46A 3TG8A 1R4NB 4X7MA 1ZI8A 3KQQA 3F2IA 1RDFA 4CM4A 2IX9A 1MBZA 2LKDA 4ES6A 2J9GA 2J0EA 4MUKA 4M8LA 2HH9A 3W9YA 2GJ4A 2G83A 2XKAA 3NIGB 4LHXA 1T2UA 4QTUB 2ATCA 3OKCA 4R3NA 4EYOA 4FFWA 1YZGA 4J1SA 3L0CA 1TM1E 2GKGA 4PN7A 2IV7A 2YN2A 3KG2A 4V0NA 2OXTA 3ZY2A 2X6TA 4IBOA 1IUNA 1AUXA 2CHEA 4DPLA 4L9SA 2HFKA 4X1KA 4KK3A 4BO6A 2CXPA 2QG9A 4FN5A 2QJTA 2UV8A 1L5MA 1U0EA 4H4CA 4XYGA 1RMYA 3GT7A 3SKVA 3WTBA 2WAAA 4ZTUB 4ZIRB 1QRDA 3R75A 3GA0A 3E22A 4PLYA 4XRRA 2ADMA 3SLKA 2BONA 1IY8A 1NR5A 2C9YA 1PWXA 3QVKA 5KYUA 5C1OA 1CR2A 2GD6A 4CR8A 4PBSA 2PAFA 1FS4A 5DNUA 5DLDA 3YASA 4HGZA 2PZMA 3SX0A 5KIAA 1L5NA 1UT5A 3EZ7A 2IH4A 5JI3E 5CAEB 2GESA 2FMXA 2G5GX 3LF2A 2XUOA 4GHWA 4MDYA 3LY5A 2ZKLA 4UUMA 3L8FA 1OWOA 1TRKA 4CIWA 1TUBA 4X64B 3R5SA 2G1KA 3C3KA 1E9CA 4QARA 4ZZ2A 3VR5A 1F2VA 2VHCA 2ZM6B 1FQOA 2Q5EA 4EL0A 2V98A 4DLTA 3MSXA 2IHVA 4DG8A 4MA5A 1YVEI 3LX6A 4IIVA 4AJ2A 3U7QA 3VPDA 3MWDA 4MQ6A 1Z73A 4RVCA 5B1EA 1VMIA 3KWJA 5BMOA 4D79A 4F4UA 3UJCA 5IAEA 2PTHA 3K30A 2F3SA 4WY5A 3ORHA 2WU1A 2FE1A 3ZY5A 2IXEA 2GWRA 3N7AA 3DOIA 3NHRA 4BKMA 2FLKA 3PNMA 3FB1A 3DXYA 2POCA 5EZYF 5LM3A 1VJDA 2EZ9A 1JAHA 1LVGA 2HU2A 4K0RA 4EPWA 1K5PA 1XHLA 1JKJA 2F8SA 2DERA 2YMPA 5DEIA 1Q0RA 4JB0A 5DMHA 1SBZA 2PE5A 2Q41A 4Q7LA 3V1LA 1ODKA 2QTBA 3R4VA 1RXCA 2R62A 3BD6A 4CFYA 1GQOA 2R96A 4OGWA 1E9VA 4R8KA 3O8QB 3KPYA 3JU3A 4GL4A 2C4UA 2HBQA 4YJFA 1GQFA 2M2IA 3HTXA 1BHJA 2FWJA 2HWUA 2ID4A 1KI8A 2UVPB 4Q5IA 3K9NA 1PUIA 4QELA 5BNTA 3DAYA 1L4MA 4WXHA 2J5QA 5JAHA 4D3YA 4DQLA 2ZVPX 4BQNA 5LD2B 3DWIA 1C4OA 2VUIB 2QPLA 2ZW9A 3LZDA 1BD3A 2D6FA 4HXFB 2GCOB 4IO0A 4DG5A 1A97A 3L0PA 3EIWA 3GN1A 1JFFB 1JXMA 1K6IA 1PFQA 3QBJA 3RS3A 2HRBA 4L16A 1NW4A 4MGIR 1E6UA 3U3JA 1Z08A 4JA0A 3LKVA 5FWXB 5KQRA 5KNDA 3TW6A 5KQSA 1SHZA 1E63A 2X0KA 4PCVA 4RULA 4GGOA 2Y9MB 3B89A 1HE8B 4YRFA 1AX9A 1Z45A 2VHYA 3PL5A 4HEQA 5LQSA 5EE3A 1LWNA 4XB1A 1G20E 1QKJA 3EQ6A 3VH2A 1YCGA 4EF5A 5C4MA 2BR4A 3NHLA 1GEGA 4DCNA 3S1AA 1MV5A 3L7JA 1GKIA 4GOMD 2AFRA 2F1HA 5HBGA 1ZS9A 4WZBB 2CL6X 1T29A 1TFUA 1ILWA 2ZJ4A 3AILA 4JQYA 1KJIA 2IE0A 4JGBA 3GLQA 2QN3A 3WGIA 1T9CA 3WAGA 2G67A 5EJAA 1L7BA 2W0MA 621PA 4GYJA 3TINA 3GD5A 1VCHA 5IMSA 3WLKX 3ZJYA 3RT1A 2HMSA 2ZUUA 3W4IA 3Q7QA 2P6OA 5A9SB 1OI7A 1NATA 3VHXB 1Y7TA 2C04A 3RSZA 1MRNA 1CRPA 1AH2A 3KTOA 1EVEA 5DYGA 3EBLA 5BPHA 4QEKA 3K1ZA 3W2HA 3MMXA 1E9DA 3BILA 2QPTA 1E1RA 1FXWF 4G36A 5KTTA 3WGJA 3FSJX 4UU0A 3A4MA 3OX4A 1JVSA 1UBEA 3PNBA 5CRIA 3NHZA 2H0QA 3QKIA 1BFKA 3G0OA 3JY6A 3H2ZA 4JJAA 2C59A 4FKZA 2Z08A 3GZTB 5LUAA 2XQKA 4BKUA 4H0CA 1IN8A 2F3RA 3GDWA 4U6QA 3KEQA 4QASA 4UEOA 3MCTA 2OBFA 3WHKA 3FWHA 4ZTZB 2XRMA 4PXAA 2QAGC 1P1KA 3B78A 5EJIA 3LOQA 5DRYA 5TJHA 3RSGA 1LNSA 3JQEA 1NM5C 4L2IB 5EE0A 4ALKA 4UBNA 1EIWA 2HPAA 3IV9A 2PO5A 4EM6A 4TMXA 4LSMA 4W8HA 2AZ4A 2M6KA 2F43A 3KJIA 4UBJA 1N6OA 3RC3A 3QE2A 4V2IA 2PL5A 2VTEA 3CRVA 1JTVA 2PKRA 4PRZA 2Q3FA 4MS3A 5FWNA 7YASA 2BVNA 1P80A 5E0OA 4FS3A 4KN9S 4ND2A 1Z0DA 2VF8A 2YV4A 1FVHA 2WYIA 1LX6A 4BFUA 5K0FA 2VQEB 1Z62A 1N5DA 1ZI9A 2TMYA 3LBNA 3HP1A 1ZK3A 3E4CA 4QQRA 3TJRA 1EUDA 1ULTA 4HQFA 3DFFA 4B3FX 3RLFA 5KREA 3MTEA 2HA0A 3TR5A 1JBKA 4H60A 1JDTA 4PYKA 1NUHA 3V4LA 1BX0A 2DH6A 2NWQA 1VLLA 1POXA 5EP2A 3BG5A 4NENA 5D3QA 2M32A 4LOLA 2QW1A 4LXUA 5K3SA 5L3RA 5JS2A 3OIWA 1GCIA 4RIHA 1QIKA 2BBSA 2GEBA 1EFTA 2GRUA 5D51S 1QH0A 3SR4A 1XWFA 2Q27A 4QYIB 3UV6A 2J6IA 4RZUA 2LWIA 3OUTA 5B37A 2ERCA 1QQAA 3I3OA 3QSYA 5EUCA 3GPDG 3NDJA 2QB5A 5AKLA 2GHRA 4BQEA 3ZZ0A 1KEZA 2FWIA 3CLSD 2FPXA 2F6RA 2W6MA 3NP7A 4WKBA 3TEMA 5DX8A 3NIBA 4QU0A 2PL9A 3E9CA 2AJ8A 2RKWA 2IXFA 3DD1A 3HVJA 1H2RS 4URVR 3A04A 1HO3A 5EZYA 4ZT6A 2FMIA 1HTTA 1LVHA 1MIOB 1JDJA 5AHXA 3K0SA 4IH1A 1A7UA 1NE2A 4PE5B 4AQDA 4D8WA 4R3WA 1D07A 2FQQA 3RFUA 3NGLA 3RBZA 3Q9UA 2ZJ7A 3GEGA 4LPSA 5CVJA 3AVVA 2O2IA 3IRVA 3VHQA 2PJRA 3A6EA 5B6PA 4X60A 4N5IX 4NU6A 4PAMA 1VA4A 4A1OA 1PX0A 2DAPA 3DLHA 4LRWA 5H70A 1JMKC 3IVMA 3RUCA 1RYBA 2FU5C 4HYQA 4XQ0A 4EHDA 4RX1A 1FFXB 4UNQA 4V1CA 4R71A 1V7PC 2FUKA 2GBIA 1BNCA 1YRQA 4FIZA 4MWDA 3LO5A 5L3SB 1RAHA 1AOXA 2Q7XA 3M6WA 2IHBA 3I9OA 4O29A 4XFKA 5ENZA 5IABA 1C1XB 2OBLA 2R8OA 5BVHA 1FRZA 3W5SA 2VT3A 1RKBA 4DUYB 1T9DA 2FSIA 3LI2A 4C7VA 2VXCA 4JENA 5JSKA 3JQGB 3EEOA 4I14A 1X86B 1QHIA 5ALVA 4C7OA 4DSZA 4V0OA 2ZIGA 4P83A 2V7TA 5SYAA 4I5EA 1CT9A 1NJ1A 1WWKA 4ZEWA 1PNQA 3I8OA 3KAKA 1AB6A 5K3AA 2X41A 1AO3A 2R5FA 2RK6A 3TB6A 1AQNA 2QI9C 2XVAA 1QFSA 4WHMA 4WZAA 5LUBA 1YZKA 1WZEA 2AZMA 4HDCA 4CETA 2V7BA 1USIA 2GB4A 2ZS9A 1F20A 2H1IA 4AB1A 3EUWA 3S4YA 2Q0QA 5F1PA 3EW7A 5BV0A 2DLCX 4AK9A 1EUCA 1Y9AA 4FC6A 4DIEA 3UK6A 5KYXA 1GUBA 1HDCA 2MIIA 1R0SA 4TYYA 3K8ZA 1P18A 5DTRA 2ZSBA 4EY3A 1FY2A 1UXKA 1U3FA 2XTJA 3CLUD 4IQFA 1KMQA 3UJ8A 4R0NA 4BBZA 1GR0A 2Z5GA 5ERGB 4AP6A 4N0QA 1D9ZA 1PFYA 4MRVA 3GJSA 3B8EA 2HRDA 2WG2A 3ETCA 4O2RA 4UHHA 4QUAA 3BHMA 3ZCRA 1QU2A 2P68A 1K9SA 1IEQA 1PJCA 1FXWA 4OGLA 3RIEA 3V7NA 1JLMA 1S8AA 3U4IA 1GTMA 3UK2A 1SN7A 3PGXA 2EFEB 3OBIA 3V00A 2ERXA 2IYLD 4TLAA 4ZA2A 3RD5A 1DKNA 3VDMA 2BEVB 5EJ7A 2E6KA 4U9UA 1OXMA 1HE3A 5IZCC 1HGXA 4DMCA 4N5NA 1WCIA 3ZX5A 5AI6A 1ABFA 3CU5A 4X6LA 1DUVG 4JV5B 1XD9A 3A1UA 5GJVC 1Q20A 4YRCA 4ID9A 2D59A 4OIMA 3UJ9A 3K0EA 1M66A 3LUFA 3P9CA 2AWOA 5H59A 5TMBA 2FWBA 1U2RA 2JK0A 3D7NA 4OMFG 2OV2A 4WWHA 4GYYA 1E1RD 1RYMA 2GZ1A 2HUPA 3CBQA 3IVRA 4LWQA 4NS1A 1F5NA 1CZHA 4F7DA 4E5VA 2DPGA 4Z6KA 4XXHA 3E15A 3TGLA 2Z5VA 4OJMX 5TEVA 3UXMA 4UULA 2DBYA 4B8ZA 4HEA1 3W90A 2EBFX 4CEHA 4RXTA 3ADKA 3LLMA 1QU3A 1FP1D 2IU6A 5EEGA 1XKLA 3UK0A 4EKNB 1XRJA 3PFBA 4XZ3A 4QPPA 1ZAKA 2INGX 3LQ2A 1FU8A 1Y42X 1V6AA 221PA 3VC7A 4B4DA 2XUDA 3EOBI 1YA4A 5ITZA 4G4SP 1U2ZA 4ZREA 3PYMA 4UW9A 4OKNA 3WIUA 2WU4A 3JD2A 4OLJA 4EO4A 3EEFA 3IE2A 3RF6A 1XF1A 2I6QA 3WIDA 4AF8A 4B1FA 2VJDA 4IUCS 5AW8A 1U0FA 4QLBA 3PC2A 4Q18A 3BTUA 1RM3A 1IM5A 2GEVA 3OT1A 1X2BA 4DNXA 2VC2B 1E2HA 4LHWA 3TLAA 4NZNA 3LCVB 3KQLA 1IRIA 3OT5A 2SICE 1U2QA 2EJBA 2H0RA 3G8AA 3ABQB 5KKAA 4LZNA 5E4JA 2GBLA 4X85A 4MV0A 3DNPA 4YCCA 3RT9A 2OV8A 1LGYA 3SLGA 3VU9B 3ZW9A 1NBOA 2POQX 2QLFA 3SICE 2WAMA 5EEHA 4EYEA 3JQFA 1XMJA 3DFKA 1G291 3RC7A 3C41J 4EZEA 2HM7A 4DV5B 4C4AA 3WMWA 3WRYC 1JQ3A 1BYUA 1Y82A 3RH0A 5LWQA 5EJ2A 1Q21A 3KEFA 4GRIA 4M6WA 3FYUC 3MJDA 3MJSA 5T5QA 5EHXA 3PZRA 4G01B 3LBFA 1NNSA 1S96A 3U3XA 3NHWA 3TG2A 1CXZA 4QBTA 4DR4B 4F5EA 1U0LA 2ATEA 2YV5A 2NSJA 4Q47A 5ILQA 1TLTA 3V4PB 3JAWB 1XZMA 3R24A 3DVRX 5B7GA 1D2RA 5DX0A 5FFNA 4R8RA 4UQPA 2VPWA 2WJVA 4ZT7A 5IBCA 1JVBA 2AA3A 3EIOA 2AR0A 1E9EA 1JEYA 3OKAA 3T9DA 3CVYA 1TF7A 2XR1A 4LZWA 5KJ6A 3EMVA 3O93A 4URFA 4D0RA 4A8JC 3EDYA 4DV6B 2RIPA 3IQEA 4KNVA 4F21A 3K70C 3N39C 4A4DA 2HMAA 1K06A 5T8KC 5JO9A 2Q5FA 2GM4A 1TK9A 1UMKA 2QGNA 3B5JA 3MQ2A 4IVRA 3DLIA 4JC8A 2CFRA 1KOGA 5CLQA 1CUFA 2DFNA 1PR1A 3EGVA 4CI9A 4B6PA 3KQOA 4Y30A 4F5ZA 4NE7A 2YN4A 4GKBA 1C3EA 1KAEA 3HVIA 3KB2A 3KSMA 3NQ41 3QLEA 3QYJA 2VDVE 2QF7A 4C1BA 5CIYA 1P91A 1PBTA 5KOHB 2BMJA 1P60A 2Y1DA 3K31A 2AD5A 2JJMA 3VPGA 4NMMA 1RPZA 2O8FA 1A88A 4NE9A 3H11A 3BN3A 3PT9A 4OGKA 5T64A 4DVJA 5JECA 2OQRA 2VYVA 2XQIA 2PKEA 1NN5A 1FVOA 2B1QA 2IOHA 4XIYA 1YCDA 2OLJA 5CLGA 1TB4A 4RYLA 3IFSA 3NHUA 5AVKA 4V1CI 1YS4A 1X9IA 1EFAA 3C1AA 3S1LA 4WFIA 3AHFA 4PYQA 4CLOA 1N7HA 1ADGA 2I29A 1XZJA 1DHRA 1N8KA 2C1ZA 4K9MA 4NJEB 4H59A 3AY6A 3VJMA 1RKUA 4QM6A 2GCGA 3HL4A 1UMDB 2WZCA 1L7NA 2KBFA 4FMDF 1CUYA 3VTZA 2FPGB 4HX2A 5TSDA 5LBTA 3OD5A 2WM8A 4IDFA 2VQ3A 4J1NA 2H5LA 4Q9IA 3ZXYA 3PPVA 2CWWA 4C7MA 1N5OX 4C76A 2Z43A 2V5UA 5MN4A 4ARIA 2J3HA 3JATA 3AHDA 1C5KA 2GAFA 1PZFA 3MOSA 1ZHFA 2WY2D 4BX8A 2Y0CA 1VJ5A 4YMIA 2GS9A 1KVSA 3HXTA 4M8NE 5AM2A 3OEHA 4IOKA 2D3WA 1OSNA 4IDGA 1NWHA 4ZQFA 5JU6A 3ZWMA 3EB9A 4I9HA 4GVLA 3RADC 3RIYA 4B43A 4EVSA 2OV1A 4CTMA 1N77A 3QEMB 4G1VA 1W9MA 1KYIA 4OQYA 1D4AA 4YJGA 1L5YA 5BSEA 2GTIA 2X8JB 3FUTA 1M34A 1CQWA 1S2NA 2LE0A 4REQB 4WA8A 5CB4F 2ZYAA 3AI1A 2C7VA 3GLTA 4PGGA 1RZRA 3V34A 3QLTA 2JFPA 3EFOA 1MNAA 2WFAA 4ZYXA 4RD6A 1ORVA 4XGKA 3AJAA 1DBIA 2QQ5A 4MQEB 1DCMA 5DTQA 3F6CA 2Y05A 1ECLA 3FPAA 4QEZA 4DCJA 1P2BA 2EARA 4Y18A 4GR4A 4NCKA 1OVGA 1TQHA 4EUHA 2VTDA 5KQMA 4QREA 3N0VA 3KVYA 4F56A 2Q28A 1SVUA 1TQ2A 2GBGA 5LMUB 1NW9B 1AB5A 5FBWB 3RAFC 3OM0A 4KH1A 4ZODA 3RF7A 3HP7A 2ZYUX 4HH0A 4LYDA 1M1YE 4OQEA 3UO8B 1T13A 3NBYC 5MGBA 2G88A 2Q8PA 1QTNA 2DHEA 2X7XA 3OZAA 1VHDA 4G63A 4CLRB 1JIUA 3PICA 2GO1A 1LXCA 3SVLA 3UGTA 4TV9B 2IF0A 1Q83A 5T4BA 1OAAA 1KO7A 2MYNA 5FLXA 2ONYA 5JBNA 2IXBA 4BO9A 2B82A 1GGHA 1Y8RB 3A6KA 2NU9B 2W6JA 1OGYA 3UUFA 1TGVA 1VCOA 3GDHA 3LPAA 4FQ5A 4GWLA 1K4KA 3S8EA 2QENA 3I6ZA 3QKRB 1YVUA 1TQ8A 2W00A 2X0EA 3UJPA 3QA9A 5CU7A 2IWRA 4GXRA 5AVVA 5TMDA 2C2OA 1Q0PA 1WX1A 2FZWA 3OOWA 2GPBA 1VCNA 5GVRA 1A71A 3HPRA 2AMVA 2PRIA 3DCNA 4FCTA 2XCSB 1WV1A 5TT0A 1K27A 1HQCA 2I3AA 2W4IA 3ILYA 5F9MA 1BVHA 4MR9B 4Z0NA 4Y2HA 3CNEA 3AVUA 4GOJA 5CJJA 4UMEA 4H7EA 4PGHA 3A7EA 4Q3DA 1DWUA 2PWPA 4UM8B 2B9EA 1VL6A 1P2FA 2FCAA 4J03A 4MR8A 4GPIB 4RWEA 4AYWA 2AYXA 2JLCA 4MB0A 5JNVA 3HV0A 2JNWA 1SHTX 1XYYA 2HDNB 2P4UA 3S2GA 3WL4A 4AG3A 4DS3A 4K28A 4G0YA 4YLYA 5C8ZA 5BR8B 3G1WA 3HKCA 3TX2A 3TLGB 1K5DA 2PNFA 4U0KA 4BEBA 1N9GA 2HRRA 4BFZA 1LD3A 3BAFA 4KQ9A 5AESA 1JUDA 1GUZA 5AWFC 4TXMA 1L6IA 4JYAB 3OLZA 2EATA 4TWZA 3JV7A 2VUUA 4R98A 4YQZA 1F8XA 3VPFA 3ZLJA 3KKNA 3HWX1 1QV6A 2XE8A 2EW1A 3IUJA 4HRXA 2G1PA 1DX4A 3ZW7A 2G77B 2JJ8A 4HTFA 3GUUA 3AZQA 1F0PA 4GOND 1BDHA 1G5IA 2NO6A 4XYMA 3GFSA 1ZOPA 4JMLA 4IH9A 3VPXA 5FBKA 3E7WA 5K8CA 1J8MF 1YGPA 1HYGA 3IHLA 4QDZA 3VYVA 2H2AA 3D8TA 1XEFA 2G9RA 4CM4B 4MUFA 4G5GA 3FVQA 1IN6A 2AXQA 4R2XA 4JBNA 8MHTA 1FYXA 4P7JA 4A2QA 2F8TA 1Z07A 1VPVA 3F5DA 1L5KA 4U39A 3A10A 4L07A 3FHOA 3BBPA 5KPDA 3MPUA 4ZI7B 5EXXA 2GDJA 4KDEA 4LF5B 2P78A 2ZZKA 3WZ2A 2AZDA 4Z49A 2PUAA 4D8XA 3OFSA 5FRDA 1TAGA 1CJUC 1KEVA 2ONZA 3JR7A 1PGQA 3CZQA 1GL9B 2CFOA 4L8YA 2QXUA 3P2IA 1U7DA 2B7CA 3RPEA 4PY2A 3UB2A 4MUXA 3BPSA 3JTEA 3LHFA 3P9KA 3R7WA 4RTSA 3N0RA 3PPXA 1Z4OA 1FBNA 2VYVD 2WNSA 1AS3A 2NSYA 4GMDA 4JT2A 4MGKR 4ACBA 3L4KA 2WG1A 4E5NA 5GJBA 8ABPA 3LS2A 2HTFA 1KDPA 2PKXA 2DHDA 3E22B 5E4YA 2ZWVA 4AY3A 4E4RA 4NZMA 1OB5A 1J8QA 4GGMX 3W34A 2QRMA 3ECSA 1BN7A 3RUDA 2ACKA 4C7BA 3E9ZA 3AJ8A 5LDHA 1C41A 5JNSA 2VRBA 1JE0A 3BICA 1KH1A 4Z7JA 5DIFA 3MTIA 3VKVA 1TUBB 3B7PA 3AF6A 3IT2A 3TTXA 2PN1A 5C53B 2F9LA 2CWDA 3DCJA 2QDKA 3M6MD 3PUJA 3Q7RA 4MQFA 2G9VA 1P0IA 1N7JA 2A9QA 1V25A 2RSLA 1P5ZB 3OEHD 1TYCA 3MWDB 3Q1KA 4KIWA 3D8RA 4R1OA 3M2TA 4YTEA 3VHLB 1G1MA 1OC2A 3MJHA 3V3KA 3L04A 2BR3A 2ENWA 2H4FA 2JH9A 3R7SA 4CTOA 1GFIA 3A2MA 3FRJA 4A92A 1R7RA 1QRRA 4BZXA 3S3TA 4EY6A 5KVAA 3O83A 1W25A 2ODAA 1AVTA 4R2HA 3RT7A 4EAAA 3WBKA 2OYRA 4D3DA 3NAQA 4J7AA 1P1HA 3E82A 5CVCA 1JI3A 4B5LA 3D1JA 3LRPA 3WVNA 1UMCA 2CBXA 4R7TA 4O3FA 1RZRD 1YQWA 4Q7KA 1IN5A 2DQKA 3DKKA 2CV2A 1QB8A 3FYCA 2H2DA 4CV1A 3I34X 3PZBA 1U6JA 2ZUEA 5JPDA 2X40A 4QFMA 3O8DA 1RBMA 2QGZA 1FUUA 2ZJ3A 3H4TA 4HNRA 2CF5A 4II2A 5BSUA 4EB6A 1SR8A 4QGSA 5IHPA 1DOZA 5LZ7A 3GLHB 1BMTA 2JHGA 2HCBA 1ADYA 1PHRA 3U17A 1W4ZA 1E77A 1A04A 1HBJA 1SD2A 3NBMA 1AT1A 4DCSA 4BO0A 1E0DA 3L4EA 3N0XA 4LDJA 1SVWA 5ADUS 4XRGA 1MQAA 4KGVA 2QIOA 4Z4HA 3GGDA 2BJWA 4PM4A 2QNRA 3SQXA 3A2KA 2Q4DA 3KQYA 2C98A 4YIKA 2C5GA 1C50A 1DIAA 1PR3A 1Z16A 2D1SA 5DNCA 2GETA 3TTYA 3UWPA 1Z13A 1MG5A 3ZCQA 1JGTA 2Z04A 3HEBA 3FCAA 3V32A 2W6JD 4D4IA 4FX2A 1QIDA 1KZ4A 3F7TA 1GDDA 4J29A 4K88A 4KMRA 4XIGS 3RCBA 1OLUA 2DWUA 3S8MA 4AS3A 3D6HA 4K87A 1KOFA 3QXSA 1R0LA 1DXOA 5FL7A 4B2PA 3U7HB 3WIVA 2C2BA 3S1AB 1NC3A 1Z82A 4OXIA 4WE3A 1JMYA 3T7AA 1YC2A 1DAMA 1OFHA 3IULA 2OCKA 4N6GA 3NAMA 1SIWA 5EXPA 2I6UA 1JA0A 2ZATA 4XSHA 2J5XA 4G89A 1II8A 3MD9A 2XNSA 3MERA 2HK7A 4MGZR 1DWQA 2DCUA 1C8LA 1HKHA 2D5AA 3DT9A 2IFTA 2IOFK 3FPSA 6REQA 4YIHA 2CV0A 4K26A 1MVNA 5FDFA 1NLFA 4QFBA 4HDSA 3FOWA 3HUUA 4TKLA 2Q0XA 5HIJA 1Y8ZA 2PZFA 1TF2A 3PYXA 4UTPA 3S28A 3NTVA 4QPJC 2A1UA 2X8LA 5LB2A 1F8GA 1O89A 3BKXA 1NMSA 4UE3S 1M72A 1CDDA 1CRZA 1U1EA 1O95C 2IY7A 2W2QA 1PNTA 4FLMA 2VFAA 1HTWA 1TKCA 1BOOA 2CLEB 5ADWA 1E7SA 3GLGE 3PGVA 5LL6P 2DH5A 2Z9BA 1HYQA 4WFKA 4CLXA 3AH8A 5BWNA 2XEDA 2J67A 4HB2A 3F7OA 1OFGA 4EI2A 2YIVX 3N1UA 2PJUA 3PC4A 1NDUA 3H7AA 5E1DA 1NLYA 2F8LA 4TMZA 3Q8XB 4FNAA 3ADCA 4YMGA 4JJ8A 5SY6A 1I10A 5C5CA 2XE6A 5EZ5A 4O0LA 1B6GA 1OA0A 2DT8A 2X3UA 2GTPA 1HFJA 4N49A 3X1KA 3ZEIA 2I1WA 5JAZA 3ZU2A 1F2DA 4HH1A 2N1MA 3WP1B 4MS3B 4RQBA 4DMFA 2ECQA 3HO1A 2YS7A 2RI1A 1M2WA 1KVQA 1OILA 3SHFA 4P5PA 4PC6A 3U3ZA 3VC2A 3RRZA 3DEZA 5DTMA 4BE9A 3Q15C 3TDMA 5I4KA 4GM1A 2Q07A 4ER5A 2DU8A 3OO1A 1W5FA 3EODA 1DB3A 1EUDB 2Q2OA 2YXBA 3MJEA 2AUTA 1DBVO 3LXRA 1R0ZA 5ETJA 4OUDB 3SEAA 3V2GA 5EIHA 3HCBA 1UPAA 2RKOA 4OUKX 4RORA 4C3OB 4K0KB 4ACAA 1F60A 2RJOA 1N3LA 4ZZ3A 2JAHA 2YIDA 3O75A 1XQ6A 4L08A 4UEQA 4OHRA 1UDAA 1IXYA 2FRDC 5EMHA 1AA6A 4W7HA 2XAAA 2BMFA 3EVBA 4MS1B 1L5SA 2FQXA 4IVNA 5AXAA 3UB3A 3JQPA 1J0DA 2EP8A 3ER6A 2M6RA 4J1QA 3AJ9A 1L5OA 3FPHA 2EXXA 2GZDA 1JQKA 1ZDMA 3PX3A 4Q1AA 1X1BA 3SJ7A 3ADOA 1FA9A 4IEIA 2KSQA 3BGOS 4G1EB 1M74A 2B8EA 4WN9B 5JAPA 3SWWA 1ONNA 2ZVJA 2RGCA 3O1HB 4AAYA 5ARCA 1FYEA 1GZSA 1MF7A 5EZYB 3G7UA 2PGIA 3KUKA 3N2GA 4IX9A 4L6IA 1Q1BA 3PXEA 2NLOA 3TR6A 5ALRA 1KI6A 1R0WA 2A1IA 5K8JB 1FSPA 1T6YA 4GICA 4D4HA 4NCNA 3IAAA 1J0XO 2ZG6A 1B73A 2FWRA 5A05A 4BN4A 2WD7A 3B9BA 1BXKA 5FAKA 5BURA 5JFTA 4X65B 3ADBA 3EC2A 4C1NA 4G85A 1SVOA 2WSLA 4FGJA 5JEDA 4PFJA 5EKXA 2ECOA 3QOWA 1CG6A 3KXDA 3HI4A 3NTRA 4RACA 1ZOLA 3ASVA 4V1CB 5HS4A 2MSCB 5JARA 4D1YA 4NXMB 2HLNA 2JD2A 3U4QB 3T52A 1E5TA 3TO5A 3EZNA 2FW1A 4BGUA 1RYDA 2HK6A 3GPLA 3WJ1A 4TKVB 2GF0A 5BVHB 5E7JA 3N58A 3LXUX 4Z0TA 1QZ3A 2G5PA 3A1NA 1P6UA 2QL6A 4QDTA 4CLDA 1V71A 2OORA 2CDRA 3FH0A 5E1BA 4LRYA 3T1OA 5CT9A 1O94C 1MTZA 3QE4A 5L95A 3F0TA 4P4SA 5CNMA 1JE1A 4Q15A 5EY5B 1VB5A 1MX9A 4DIKA 3H65A 3ND5A 3OF2A 3B3FA 4MV6A 1X1TA 3FKSA 2P8SA 3B6EA 3C7AA 4LYHA 3TGWA 3NTOA 1YHYA 1E79A 5BV2P 3PR2B 4U9IS 3FETA 4A6EA 5A7FA 2Q7OE 3F1LA 5EL0A 5FLEX 3OOHA 1U99A 4ZV4A 1FCJA 1LDNA 4LQCA 1N0HA 4GNRA 5ICEA 5EE5B 3G7NA 1UBRS 2WMOB 3MAGA 4M8IA 4NC9A 2P79A 3KR9A 5JUWA 2UYYA 3ROPA 4YJHA 1Z6QA 1ZEJA 2AIRA 4PZEA 4IWYA 3B9PA 3E3MA 5KYXB 2ESRA 3JRWA 4RKWA 3RK1A 4UFOA 4OP1A 3AIMA 4X95A 3WIOA 3KXPA 4FK8A 3DWFA 1ZHHA 1OV4A 2FPWA 3KPJA 4IDQA 9ATCA 4C6TA 5JXIA 1IBCA 4G8BA 1NG9A 4YV2A 3VJKA 2C3MA 2ZBPA 5DH9A 5FL7D 2DR0A 3M6XA 3PWZA 2ZYDA 3ZDXB 2O59A 4YRSA 4QJIA 1J07A 1QCZA 3I6BA 3FFBA 2CLDX 1PR9A 1LLFA 1XDWA 2G8LA 2JFBA 5DU2A 5JJKA 1T4CB 3I1JA 1CJCA 1MA3A 1YBFA 1CW2B 3ZE1B 4YRGA 4O2BF 3KNZA 4ARSA 3S2UA 5K7SA 4RHFA 1XYVA 5KVSA 1CF4A 2EW8A 2H85A 2LIPA 1US8B 3DE4X 4AG6A 3IAM1 3O4JA 4KRYA 4OHYA 1RWVA 2F1RA 1PQ4A 2XQFA 3AB7A 1WCIB 1V2HE 1CR1A 3AETB 4LCJA 4UXJA 1Z28A 2FPUA 3QITA 5AKYA 3ZCVA 2LW7A 4YAOA 2GZHA 4NAHA 4JVSB 4WZAE 3DYBA 4J91A 1Y8QB 1HH4A 2VTVA 2C61A 4FW9A 4M46A 4Y6RA 4YACA 1NU8A 4YRPA 3FBGA 1DADA 3FIJA 3QBDA 3DAFA 1UXOA 2FZKA 3DE5X 2QQ0A 3C8ZA 3HABA 3NBKA 2V0GA 3ZJTA 1II0A 4JB2A 3VOTA 3C1TA 1XEWX 4O0MA 4Q48A 3IGFA 5DT2A 1Y6RA 4BJ3A 4JLBA 2W6PA 1E9FA 2QM3A 1V26A 1E1QA 1Q7BA 2X7JA 4QGFA 3I8XA 3L4JA 4HMQA 4M0DA 4D6YA 2XYHA 3BWCA 4IDOA 4TVSA 5COQA 2G70A 2ZAMA 4ZEXA 1IBSA 2ZCUA 4R0MA 3LQYA 3W9SA 5LP1A 3DTVA 4GLFA 1M67A 1Z4IA 3E2IA 3FXAA 1KTIA 2DY1A 5LNK1 1KJJA 3PHLA 1AZTA 4HD8A 5EMKA 1JT2A 1G8FA 1NKSA 3LBYA 4L8WB 5B6JA 3LUHA 4RLSA 4FE7A 1BFDA 1YOBA 4GSLA 2EL7A 3MCUA 1NFRA 3AB8A 3C6QA 4N3BA 2GRJA 2A92A 1ONPA 5K3FA 4NAVA 2JFZA 3ST7A 3PJRA 4DNPA 3ONVA 2I4NA 2ZVQX 4OQPA 2M98A 2C58A 1CQJB 1SKYE 3C15C 4RYDA 5ALPA 4Q03A 1P9NA 2UUOA 2EG9A 2GN8A 1Q1GA 1P0MA 2IW3A 2ZYWX 4YMUA 3R9XA 2BCJQ 3MFYA 5B58T 4NFSA 3TLCA 1WMDA 1EDOA 4FINA 4BGVA 1H42A 5AXBA 3PV0A 1M6WA 2MWMA 1PG5A 4YT5A 5FX2A 4FEAA 3TE7A 2ZDQA 5FPQA 9ABPA 3T1HB 1AO0A 5TB5A 4F3CA 3GH1A 1U7TA 1K3TA 4K05A 1IK4A 2B94A 4JI6B 4QDOA 2GJ9A 5CDTA 2G28A 1N0UA 5BPFA 1F17A 2WICA 4JFRA 1GZ4A 3SOZA 1D2AA 4P53A 5AD1A 4RY2A 1GU0A 1LB1B 4K9OA 1SHLA 1C8BA 4M6WB 5DCUA 2ONJA 5B4TA 2R6JA 3R5JA 4A0RA 4ETMA 4BCDA 4AJNA 1G6OA 3DZBA 5EHNA 4JOQA 2XDAA 4P80A 4FR2A 1RMQA 3BULA 2OXFA 1LV7A 1AC5A 1VMDA 2PZKA 3F8TA 1PSWA 4LZAA 4EF4A 4F4JA 4RVHA 1DMRA 4TLMB 5HF9A 4LFCB 3DGFC 4GE3A 5I7FA 1NNI1 4KXMA 4BWVA 4RQTA 2OEPA 3GCZA 1LC3A 1XHEA 1XP8A 3B1FA 3UQZA 2XYGA 2F59A 2VSQA 4YT8A 3NJRA 1TM4E 4KMOA 5K0SA 1D4ZA 1JEYB 5F52A 4XIIA 3ZVNA 4DBVO 4AIRA 3G8DA 5E2BA 1P1IA 2IW1A 5F2KA 3UJBA 4IG4A 2D1FA 3GARA 5D1NA 5FO1A 4AY4A 1KKLA 1PJLA 4M9RA 1FXUA 2O7VA 4AJPA 4FJ0A 3ENKA 5I7HA 3C7CB 4E1BA 1WQ4A 4LI3X 4UKDA 3NDRA 3TSWA 2DE0X 1ZMOA 4HFMA 3KOWA 1XZPA 5JQWA 2CNWA 4DLRA 1E94E 1OZFA 4H6WA 5DB4A 4CMAA 2C84A 1KAOA 2JIRA 2W6OA 1Z5PA 3MBIA 3NV7A 3TQFA 3BE8A 1NP3A 4Q3BA 4L9WA 3S0JA 3G2KA 4MRSA 2BZ0A 3P9PA 4OQMA 4WV3A 3TDNA 1K7SN 2IY9A 4C04A 3H11B 4D42A 1G21A 1MEEA 2BKXA 2CE7A 4H31A 2LNDA 3FZNA 1IHXA 1I3NA 2O2XA 2QTNA 4KDCA 4Q1BA 3QPWA 4UUAA 5C80A 1ECJA 1UKCA 1E79D 2JA1A 3AF4A 3I1YA 1DU4A 4PNPA 5KSWB 1FNCA 2VNKA 5DXFA 1PQWA 5GWXA 3ZH9B 1ZVVA 4X45A 1KYWA 4NPHA 3AEQA 1KZHA 4DV7B 2O8EA 1F0KA 1QX4A 1T8RA 2R8YA 3ELDA 3H9EO 4S24A 3DFUA 5DTEA 3UMGA 4LF4B 3ZWXA 3ESXA 1QFZA 3IP1A 4G5SA 1UMBB 2I2DA 3DFMA 4GO1A 4BASA 4O2BA 2YKGA 3R20A 3L6UA 4AC9A 4N5DA 5G4KB 3LX8A 1S8NA 5TF0A 4TQUS 1L5FA 1U0RA 2PL3A 4PRLA 1C9DB 2PS0A 2NXNA 3DL4A 2Z8ZA 4TTPA 4POOA 3RAEC 4RDIA 3L0OA 2PS1A 4Z86A 1NVMB 1P2SA 5HJ5A 3P9ZA 2V6JA 1BRTA 2GA8A 3DXFA 3HY4A 5A5EA 2NT3A 2CNOA 4V0KA 4JYZA 1P9WA 4ZT3A 5LZ2A 2FPMA 1EA5A 1XDBA 3HXLA 5TV2A 1I30A 3KALA 3NX4A 3CPJB 5AKHA 2VRNA 1DFIA 5LDDC 1RYEA 2BKVA 1CB7A 3L6RA 1IXRC 1RHQA 2WJGA 4HDOB 1BXGA 1M34B 4KXYA 4Y9DA 3WWPA 5KDDA 3THXB 4QLAA 5LZ5A 5JS8A 5EJGA 2UUPA 3EFOB 1E3SA 4D74A 2Z1NA 3CR3C 3SQMA 4BVKA 4HUJA 2Q3CA 2BYTA 3C5EA 3GQBA 3MT7A 4N4AA 5K0JA 5IS2A 2C3PA 2WHPA 1NUTA 3PF9A 1A3CA 3IOYA 4TXHA 1YFKA 4V0ME 4ECEA 4ZQGA 4QVIA 2C78A 3L49A 1A5AB 1J33A 1HT1E 1S2OA 2ZJOA 3QF4A 4UATA 1E2NA 5K0GA 1BDJA 1E1QD 3NZEA 1RWOA 5EJ9A 3G0IA 5K9ZA 3HDGA 2XW6A 3EZXA 1DUSA 4RM3A 4QO7A 3D4NA 1GO2A 3QPAA 3IMFA 1A4UA 2G1JA 3DTVD 4GVXA 1P7PA 1PGPA 3A9RA 3HE3A 5BN4A 4LXHA 3VZDA 1P29A 4NZZA 4B87A 2O8BA 1T34A 3KUUA 4PX3A 3C8MA 1PUXA 1P0PA 1GITA 4PPGA 3L6OO 5IM5A 5IEJA 4QYMA 4YAFA 3W5CA 1AA9A 2CVOA 3IBTA 2RH8A 4ZO8A 3RB8A 3WNQA 2H2IA 3N8GA 5CFMA 2BTEA 1XFAA 1PT8A 1UBGA 4MYUA 4DM4A 2BGKA 1K7FB 2WTAA 5HEKA 4BVGA 1RI3A 1MAVA 1XU4A 3WQQA 2P9ZA 3C3JA 3ASUA 2C9ZA 1RCFA 3SQOA 2I6FA 2BPOA 4XPIA 1FDOA 2IUFA 3H16A 2RE8A 4JI8B 3FPFA 4WOJA 3OZCA 1YAJA 3PITA 1WP9A 3O74A 1ORHA 4L4XA 3LUCA 3CRRA 3H04A 3TKLA 1KHTA 2QYHA 3U31A 4LBYA 4KWEA 1I13A 5FJJA 1LRJA 3ULKA 2HL6A 2UKDA 3ZXUB 5FEMA 4RKRA 2J0UB 4NIMA 3QW2A 4RJIA 5AJVB 4E4YA 3QKTA 4MR8B 2QP4A 4OB8A 4OM7A 4PSDA 1OXVA 4PTYA 3RC1A 3W5AA 1NA5A 4ZCTA 2OFWA 1T0PA 2WUGA 3DSRA 3X1WA 3HKCB 3F96A 3SVZA 3HU2A 3LPMA 4OB7A 2PUJA 2I9PA 3K2EA 1N9GB 4UBOA 1GG9A 1LDYA 2CNBA 5I5GA 1MC8A 3QBEA 3RANA 3VOAA 1EVLA 4YDSA 5HE9A 5BUSA 1QTIA 2E37A 4NU0A 3WADA 3OTGA 1I7LA 3Q7TA 1OIXA 3EBPA 2VP6A 3K0AA 2V96A 1BMDA 2O6LA 5GV8A 4B09A 3VAZA 3I01A 5ARBA 3HMKA 2PH3A 4AKSA 3B1XA 1E4YA 3NHYA 1OXSC 5E8RA 1SVNA 4I1YA 3OFNA 2C07A 1XCPA 3RHFA 5J4KA 2JD0A 4GLOA 5F3DA 4S12A 1XZGA 3DUFA 5CCXA 4BC1A 1SCJA 4TZ6A 4ZO7A 2XCRB 3PC8C 5HA5A 2V4ZA 2CW5A 3L4BC 1G8YA 4GDFA 3JVIA 3VX4A 4JI3B 4IMRA 3VNBA 4DQ0A 6YASA 1RXYA 3RTGA 1Q44A 4Q16A 4EG7A 4DR1B 1BGXT 3BXXA 3NH9A 2R11A 1JEAA 3BWXA 4BMCA 3HVHA 5F7ZA 2AKAB 2AN3A 3I28A 3WAJA 4DFDA 2CNWD 1X6VA 3B5IA 3B9QA 3I9NA 4GAEA 1BU5A 4B76A 2VAPA 2FG7C 3V5NA 1R64A 4ZALA 1NNLA 1BEZA 3R7BA 3TPZA 4ESOA 4OMCA 1H2ZA 3I1FA 1ITZA 2A9PA 5JZVA 1X80B 3BJIC 2YH2A 1FW8A 1P45A 3AHCA 4NHEA 2QX7A 4K6OA 3R7WB 3SN6A 3F47A 3TZLA 3VFDA 2J31A 4KNWA 4JJGA 1KAMA 5DN6D 3ACDA 4L7VA 4QU8A 4CEIA 1YDEA 1Y9JA 4DHWA 5JH7B 4NESA 1BGVA 1QVAA 2VWQA 1KO1A 5HR5A 1CQXA 3EOAI 4NBVA 1NQUA 1P2GA 4PXYA 4KYUA 5JTTA 1PBNA 1P7VA 1NJ6A 5FR1A 2O2CA 1XTSA 3U0VA 1JU3A 1K89A 3WYBA 1HDGO 1LLDA 3UWSA 1L7VC 4P36A 4YQYA 1L5GB 2ZCVA 2GGSA 3U80A 4EZBA 1K66A 3STTA 3DB1A 3PXBA 2PGDA 1YNSA 4MICA 4RV4A 3D8NA 4GE0A 4EI8A 3PUKA 3JQAA 2P2DA 1ZXBA 2H2HA 3PNLA 5AJYA 4PYOA 1TRHA 2KJQA 1YJXA 5FNVF 1X7YA 3LQ1A 4PLGA 3ETLA 1XPUA 3ZQ6A 3IT1A 2B3TA 4TTAA 3VSAA 4WJLA 1QIGA 5A0VA 3T61A 1UFKA 5L7WA 1U28C 4M1SA 1QCCA 1HZJA 4P4TA 1O95D 2J30A 1SXJE 4O4IF 3NWJA 2YBEA 5B1YA 3MB5A 3PDIA 1IZZA 4MJXA 2G9ZA 1Z5WA 2Q2NA 5U4QA 3VNAA 2EKLA 4YAKA 2V74B 5B58C 3H1FA 3EVZA 5CR9A 2J9XB 1K6MA 4YAEA 2WWXA 3FZQA 3GIWA 3HA7A 1IZ7A 1QVZA 2HTEA 1UJBA 2ID9A 1NBWB 3OQVA 3QPVA 4LXQA 4MVWA 3L1KA 4X3OA 4D4LA 4UJ3A 4ZARA 5J1SB 4FWIB 1SBYA 4XM2A 5D3MA 5IU6A 1XEAA 4MINA 2RGEA 5DNVA 2W93A 1H4VB 2CNLA 2QT1A 1YA8A 4Z2YA 2O2EA 3GFRA 4KFTA 2JK1A 3NEJA 1FMCA 1YI1A 2HPHA 4GOOD 4JJ6A 1S1MA 2I1LA 3VPSA 5JJBA 2P9BA 1UT6A 721PA 4Z99A 1CR0A 2Q6IA 1G16A 3BIFA 1TO2E 4V38A 4CL8A 1WABA 3GAAA 4P86A 2AZXA 2YMLA 1K9VF 3DDSA 1YAHA 2HOQA 3DFIA 3IMGA 1ESDA 3GRZA 1PL8A 4FGZA 1WCV1 3ORYA 5IVDA 3DO5A 5MN6A 4H27A 2ZJAA 3EF3A 2IIVA 2Q50A 4MPPA 1R6XA 2ONKA 3DO8A 3JASB 5TPZA 1F9AA 3QGMA 2AXPA 4TZ0A 4PCUA 2FLVA 3ZZ1A 1AKMA 2W6IA 1M1XB 4MTCA 1HI9A 4J0GA 4GYKA 2B1IA 7MHTA 3D8SA 5CX1A 1IY0A 1PWHA 5C37A 3EXG1 1OLUB 2EP7A 4K9DA 1R74A 4MGEA 3T7TA 2X1LA 1DBPA 1RYHA 2XTAA 4BUCA 4RF3A 3ZDYB 5C35A 4HYEA 2QK4A 3CY6A 5A3VA 3IVGA 3WXBA 4UBMA 5G2OA 5AKIA 1LBSA 3SXPA 5HG0A 3K09C 3KLMX 5LXTB 3PHHA 1SUFA 4JITA 1VYHA 2ZI5A 1SOUA 5HM8A 2WWGA 4CM7A 3CZRA 4UPVA 5KQPA 4AXBA 1OWNA 1II8B 1JAIA 1R0BA 1L5HB 3A3PA 2DUWA 5F2OA 2M1XA 6REQB 1P1CA 2RDMA 3S27A 3FPEA 4YQEA 4C6SA 4HDSB 5DDIP 5DYWA 2WUFA 4KRFA 1FP4A 4DBZA 5KWEA 1X0XA 2FSUA 1H05A 3UH0A 3JTMA 1U5BA 2NUBA 3ROMA 1A82A 5JZMA 3M6VA 1Z0IA 4EEKA 2AFHA 3DMGA 4A8JB 3AI3A 2CDBA 3G2LA 4KLNA 1JTFA 1QYXA 3EASA 3EDQA 3VYUB 1NVWQ 3ENWA 3GO4A 1T2VA 1W75A 4IGIA 1L7EA 2V5VA 3N5CA 2IZ6A 5FV7A 5FTMA 5TEWA 1DSSG 2E4ZA 3Q98A 5ERXA 4TSKA 4QOIA 3HN6A 2C7PA 1ZMBA 1KQOA 1T6XA 1I0ZA 1DBWA 1IMOA 1MIHA 1DIGA 2HCJB 421PA 5HNKA 1SHUX 1T9ZA 1G17A 2I1QA 3IVAA 3BIXA 4G67A 1V11A 3MXOA 4KQMA 4YLGA 2OCDA 3SR3A 4DDHA 1XZQA 2EW2A 3OFND 2FZEA 1VIYA 2VQSA 1KYZA 5CTJA 5EXDA 3COJA 1O94D 3R6DA 4QDUA 4YRNA 4CLHA 5C9ZA 2HQ1A 1HPLA 2XXJA 3I9JA 3KDPA 2FPSA 4JUIA 3EK2A 1QAMA 2PH1A 5B3AA 1Y4SA 4DF3A 2ON6A 2XZOA 4LZLA 3W04A 4ZJZA 2HK9A 2COKA 5EJMA 2OM6A 4OPMA 1REQA 3OQIA 1X1RA 1F7UA 2PIAA 4EITA 1BS2A 1E62A 3LU1A 2IV3A 5LQAA 4FWBA 2FXIA 3JZIA 3SM3A 4QGBA 3OC0A 3TJZA 1C29B 5T7BA 1U11A 4OQQA 1JYEA 1JKXA 2VHXA 1M5UA 1SXHA 4LOJA 4TN5A 3JRNA 2VBCA 2FFRA 4JP8A 3VH1A 1LA2A 5FNVA 3HXQA 3ZV4A 1AG9A 2MINA 3PCRB 4BGEA 1JQ5A 3LWNA 1E2EA 1HL7A 3HY3A 1A2QA 1WF3A 1ZGBA 3BXOA 3L43A 3OI7A 1KU0A 2ISSD 4I6GA 2H4HA 1YZLA 4RAOA 5ECGC 5EXSA 5G4LA 3BFPA 4AN4A 2PFGA 1GQYA 1T4BA 4KE7A 4NMXB 3EIXA 1GDTA 1ND6A 2IYXA 1WA5A 4AKGA 1DRKA 1ZNYA 2N0SA 4IXTA 5CXUA 5HIAA 2AOXA 2M9MA 1ILEA 4P0PB 4O4IA 2PKQP 1WZNA 1SB8A 1EHIA 2FAXA 3L82B 2CGEA 2D5IA 3OQPA 3TIGA 1E7YA 2W6QA 3VC1A 3LC2O 1YDMA 3QY9A 1VZ3A 3JQAD 2FN9A 4E5KA 3ESRA 3GXOA 3Q12A 3TD6A 1KI6B 3UM9A 2EKQA 3KJNA 4HL6A 1EXVA 1RPTA 3LHDA 3OLCX 2WOJA 2GA9A 1M8JA 4KOEC 1CYEA 4FVTA 1Z12A 3CPSA 4OU4A 1GSAA 2QV0A 1D9XA 1SKUA 3EISA 3RK0A 3ZJ5A 1CY7A 1USWA 1Q95A 2ODBA 3OEWA 3T34A 1BWSA 3DULA 5CA0F 5IUJC 2PLRA 4J7CA 2ZS8A 1PWZA 2JAQA 2YWJA 3MXTA 2GPTA 2XMBA 3B12A 4OL0A 4AN0A 4B6QA 2BKUA