5JDGA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 0.1mm ca2+
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sodium-calcium exchanger NCX_Mj
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
total genus 120
structure length 294
sequence length 301
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdgA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdgA02
3V5SA 5JDFA 5HXEA 5JDQA 5JDGA 5JDHA 5HYAA 5HXHA 5HWXA 5JDLA 5JDMA 5HXCA 5HXSA 5HXRA 3V5UA 5JDNA 5HWYA
chains in the Genus database with same CATH superfamily
3ZT5A 3P7IA 4A97A 3P4QA 3R84B 2X67A 5HEUA 5LHIB 1OWAA 3AEAA 4I50E 3AVSA 5FY1A 3LBXA 3W15B 3P8CD 1XNQT 1BR4A 2LHNA 3L3PA 4YTMA 2W66A 5FXXA 2I6HA 1YKHB 2L8KA 4EIWA 4YHJA 3AY5A 4JI4T 3KDSE 4ZI3D 4LF6T 3N5LA 3KV6A 3KINB 2CLYB 1D1AA 2ZM2A 4ZOLE 3LG7A 1W09A 4ILUA 2WM9A 2QVAA 4JEHB 4PFPA 4PK6A 3N9LA 5FNVE 5LHHB 3WAJA 2VASA 3VJZA 3OKQA 5EZYE 4DR2T 1YQ3A 1W9RA 3AE5A 4JYAT 1N33T 1YKEB 2LKGA 3AA1B 2XQ4A 5L4EA 5J2UE 1KF6A 4O2BE 1IBKT 5FY0A 4IT4A 4TWDA 4X5TA 2CCQA 3PUVF 3E22E 1NWMX 1KNRA 2VVSA 3WI3A 5L47A 2XPKA 2XTLA 3AT7A 2E9XB 5EK4A 1JNRA 1QSDA 4HFHA 4Z91A 2LKHA 1LRZA 2JIWA 2DWGA 5JRCA 5AQHB 4EV6A 2MBGA 3JC6D 4XBFB 5JDLA 4XZCA 1FMVA 3ZYKA 1HF8A 2V1DB 2X9HA 3BQIA 3AXJB 3N9PA 1VOMA 3RHWA 2V7IA 4YFSA 4PAGA 4DMVA 3QB5A 3JC6C 2VKHA 2BKNA 5JR9B 1ZV4X 2V7MA 2K9AA 2CEAA 2XQ5A 5AQPB 2WWUA 4FI5A 2X68A 3AEEA 1HS7A 3EABA 3SOLA 1FJGT 2CWOA 1H7CA 2PG8A 4ZS2A 4TWFA 3ONLC 2MPKA 2XQYA 4DV1T 3CK6A 3RIFA 4JBWF 3PDYA 3K3QC 2NOXA 2KLQA 1HX1B 2UUCT 2KXPB 5AQFB 3N2KE 1IZNB 2K24A 5HXRA 1SJ7A 2MTCA 4HE8A 3RYFE 2PBIA 3TKLB 3OTOT 5HEGA 3VHLA 1V9DA 4L0RA 4LFCT 1D0XA 3P4WA 4PJNA 3FZFB 2V6XA 3FYQA 2CXDA 3S4UA 2YINA 4DO0A 2CMRA 3PU3A 3PTRB 4OK0A 3AAAB 4ZXLA 4QH4A 4LF5T 2C5KT 3B13A 4DR7T 1I94T 5HEOA 3HKBE 4UVCB 1IBLT 1DU2A 3N9QA 1D1CA 5JDQA 3ZSSA 1YQ4A 4ISSA 3PUAA 4TV8E 5DJQC 4C90A 5FKYA 1YXRA 2ODUA 3M3ZB 1KEYA 4A5XA 4OYJA 1HX8A 3ZKRA 1WYCA 2MOZA 3V5UA 2KVPA 3CX7B 3AEGA 2CXFA 1T7SA 2XAJB 2VKOA 1XNRT 1YD8G 3AEFA 2YN6A 2XQ9A 4GKJT 3NWIA 4EEBA 5FXWA 2BKOA 3I1AA 2ACXA 3RYHE 4A98A 2JRKA 3M65A 3BK9A 1XZYA 4WZXA 4OYKA 3TLWA 5HXSA 5H6RB 2UXDT 3E08A 1MNDA 2LSYA 3UQ7A 2FJAA 2BG9E 1OEDA 2J4GA 2DHRA 4YSYA 4B3RT 4JV5T 3F31A 3AE4A 2X0LB 2YU2A 4K0KT 3EVYA 4OX9T 3N9NA 2W61A 4AQFA 4AISA 3RPUA 5BMVE 1IJ6A 2VURA 4ZS3A 3FZLB 2LM9A 3Q5EA 5IHYA 1UCUA 4MBQA 4U72A 4ECGA 5DABA 3C4WA 5AQIB 2VK9A 3OJAA 4QXHB 4COFA 1O3XA 3AECA 4HFVA 4X20E 2Z6EA 3FBLA 5L4HA 3ZMTB 1I6ZA 5FVLA 3ABVA 3OPCA 5LGUB 2D9DA 1LKXA 3T8OA 5L3GB 4H9QC 4IDZA 1U5PA 3SWHA 4PJJA 3AE6A 4LMKA 1HG2A 3OVUA 4I0UA 2EHOC 2JQ9A 4U3CA 4AKRB 2K3WA 4ANJA 3I0OA 4WW0A 4IE4A 1J1JA 4O4HE 3WAKA 2IW5B 3VRBA 5LYJE 2D0UA 3UULA 3RGLA 3CQCB 3AVRA 1QLBA 2V6YA 2V8SV 1E7PA 5FP3A 2HN1A 3ZCJA 4TUYE 4H63H 4P0BA 5AQRB 5FZTA 2WAUA 3P4SA 3UTKA 4JI2T 2XQ3A 4NXMT 2GK9A 2W00A 4WYVA 4EYUA 4F6RC 3UU8A 3U78A 3ZMUB 5ABFB 1BR0A 1S94A 2PJQA 3ZMSB 4EYYR 3EAMA 2C5IT 5LGTB 4NPPA 5L2LA 3FZHB 2YDSA 4HWDA 1MMAA 2M67A 3EHZA 5FL1A 4AQFC 2NP9A 3WURA 2NW7A 3UQ4A 3TLSA 5LXTE 4UXNB 5HEHA 5LMUT 2WDVA 4GYRA 4U7YA 5AQJB 4OFZA 3LK2B 4KP3C 4YSXA 2R6GF 5HCJA 1WRDA 2RP4A 1FMWA 2ACZA 2WZHA 3PUQA 2VWAA 3K3NA 3GMIA 4UELA 2JMKA 2XASB 5JDGA 5KXJA 3P4RA 4GKKT 2E8IA 4A56A 1QUUA 3Q5DA 3PHF1 3I9WA 4TV9E 3FXDB 4DNDA 3BQLA 2YDRA 3FB2A 4HGAA 3PF0A 2MAWA 4X64T 1D1BA 5HXCA 3RIUA 4O4LE 3TLVA 4DV7T 2L10A 1AJ3A 4PK5A 3RC8A 4X1IE 2B76A 1IBMT 3WSCA 2A9UA 2UXCT 4IDPA 4P09A 4MFRA 3SS1A 5DQVA 4L9IA 4JEUB 5AQTB 1Y64B 2XAFB 2NW8A 4LF4T 5IYZE 2Q9QD 4HTEA 3C4XA 4TZ4C 3ZN0B 4ZI7E 5CA0E 4YHHT 4QXBB 2KT9A 1MIVA 5E0OA 3RLFF 2WP9A 2LOPA 2XAGB 3L8RA 4ZI3C 1NEKA 4IHJE 1L0VA 3HL6A 2CHNA 4O4IE 2Q9QC 2E5VA 3RIAA 4GK5E 4MLKA 3UU4A 4U74A 4O8SA 4DV0T 4IIJE 3NRXA 1XWMA 4H9NC 2WU5A 3AE9A 2YU1A 1T98A 3UU6A 3UUXB 4AIUA 3UFEA 3OBVE 2OA5A 3PV0F 3ZMVB 4JI3T 1MIWA 3B57A 4PW8A 2IDOB 4WBNE 2WMOA 1HFAA 3A7MA 2BG9A 3T1HT 1FIOA 4ZHQE 2OLTA 5FL0A 5JREA 5C2TA 4DV2T 2XHEB 3UFGA 1M62A 2XJ7A 1WR6A 2LRLA 4ONRA 2NWBA 2X9WA 3ONXA 4WNKA 3FBZA 4ZI2D 2H89A 1KNPA 2LM2A 1XDPA 2CA5A 1MMGA 5IUXA 1D0YA 3MZKB 4QH1A 3H3MA 3J9X1 2CBIA 2LSIA 3MACA 3H3AA 5LMNT 4UF0A 4YJ2E 4QXCB 3AE7A 5AQUB 3QUJA 2BS3A 3VU7H 2BDEA 2Y48B 5T1DA 1G8XA 2D0TA 3EDVA 4V1Av 5ABHA 2KWIB 2XSAA 2UUAT 5ADXL 2H3RA 1XMOT 2WQYA 1LVKA 3RIUC 2W4XA 2J62A 2Y6XA 3IBPA 2E9XA 2KINB 3ONJA 2CWYA 2VQET 4W8PA 4QX8B 4AQGA 3KV4A 5TAOA 4TNWA 2VVNA 2XM1A 5ABGA 5EK2A 4K0UA 5IWAT 4PJMA 4C91A 2EHOB 2LSGA 1X79A 5JH7E 2L3LA 2XY8B 2HH7A 3FXEB 4DV5T 5JR9A 2BS2A 2LQUA 4B3TT 2WB5A 4EB6E 3TLTA 5CB4E 3JCFA 2NTXA 1T8BA 2P9BA 3N9MA 3C98B 3ESLA 2ZMAA 1LVFA 2V5CA 2H7VC 3RKOA 4CI1B 4HFEA 4EGWA 3V5SA 4DR4T 3M1CA 2XQ6A 4JI1T 1UX5A 2FJDA 4U2ZA 2DL1A 2I59A 3CIRA 3ZC0A 2BG9C 2C0SA 3VR8A 2WBLA 4G63A 5AQMB 1VRBA 4H9RC 3PU8A 4KMCA 2XM2A 3N2OA 2DWKA 5LHGB 4AKLA 4MALA 3RQWA 5BR8T 4G2AA 4E7ZA 1BR2A 4AQYT 2XQ8A 1W0AA 2Y8DA 2G0UA 3PUWF 1MIYA 2CBJA 2RPAA 2H7OA 3JADA 4XAXB 3CWZB 4IGUA 2X0YA 2IAKA 4JI0T 3NZQA 2LSJA 2JQKA 2K5BB 2E9XD 2L9QA 3SRZA 5KDMC 1IAPA 3C50A 4Q25A 4UVBB 4KI0F 2X0HA 2C5JA 2H88A 5KMGP 2WMNA 3ANWA 2YEVC 4LMLA 4PK4A 3PURA 5F8PA 3GN5A 4DBRA 1UK5A 2V5DA 3AE2A 4HFCA 3MA9A 2XSBA 5L3CB 4IDQA 4QX7B 3PE0A 5AFUL 4U33A 4IREA 1SE7A 3K3OA 3ZSTA 2ZLYA 4UV8B 4HWCA 3DJBA 2CRBA 1ZP0A 2CM0A 4B3MT 5EK3A 3CMLA 4IE6A 3RI5A 4DR1T 5C3JA 2CHOA 2LT3A 3IEEA 4Z8XA 3K1SA 5LG3A 3GWHA 2YK0A 4N78D 3CKDA 5LA6E 3PUSA 4IE7A 3SFEA 4ILBA 4DIDB 5JQGE 5AQVB 2LE8A 4CZZB 3O9XA 3RC3A 1B7TA 4CXXA 1WCRA 2VL8A 1XMQT 3PJAA 4CN6A 2YOEA 4H9PC 4HWHA 5FVKA 2V7JA 2Q9QB 4M1PA 2UXNB 1WYBA 1UGOA 2WS3A 5FY7A 2HPJA 5F5WA 4I43B 4CI3B 5L3EB 4L5GA 3RF1A 5HWYA 3ZLIA 3LFMA 3X1DA 1VCTA 2CE7A 3L09A 4HWFA 3N2GE 1R8IA 1CHUA 4U2YA 3RQUA 2L7NA 4NUVA 1KFYA 1WR0A 4NXNT 4HFIA 5LBMA 2IC9A 4F8HA 3CQGB 3KFWX 5LCYA 4IE5A 1OEDC 2BZBA 5LB7B 4WBOA 3MJXA 2AXDS 1M7KA 3HKCE 2XQ7A 3KBUA 5M4YA 2BKPA 3QNUA 3LSVA 3PUYF 1ZEEA 4BGOA 4ZEYA 5ABEA 2UXBT 3QK6A 1FEWA 3LK42 4GIWA 5L3FB 3O4XE 3UU3A 2D2SA 1J5WA 5CJ5A 1UX4A 2VKDA 1G73A 4AKIA 5LBQB 1EZ3A 2FJEA 3KVBA 1YW0A 2LSKA 5ABFA 3LBXB 5HXEA 1WLXA 4B6XA 4YY3T 1XDOA 4PNIA 3TLUA 2HN2A 3G06A 3U3IA 5CGMA 1Z0PA 3O1IA 4UV9B 4QWNB 4UEMA 3H37A 3B5MA 4KBMB 5LGNB 4DV4T 4ADZA 3J7Yq 2KNDA 2YKSA 3UUBA 3N9OA 1Z8UA 3IA3A 5AQLB 3SFDA 2VQFT 3FZKB 3KV9A 4KHPT 3P4PA 3ZC1A 3PUZF 4AI6A 4H9OC 3VKGA 3KV5A 4HFBA 4DR6T 2CPTA 3AA7B 3EUHA 4EAHA 2X51A 4FJOA 3AEDA 5JDMA 3A8YC 5JDHA 2MTQA 4TX5A 2N2NA 2YDQA 5L3DB 2UUBT 2DNXA 3IHRA 2D5UA 1D0ZA 1HNXT 2BG9B 1X9BA 5J1GA 1E1HB 2XUEA 5LNKA 1N32T 2V7KA 1BR1A 4JI8T 4YJ3E 3NRYA 2W62A 3QC9A 2J47A 2JQQA 1HG5A 5JRCB 3A5XA 5CFBA 5LOVE 5JVDE 2VKJA 1W0BA 4U31A 4UF0B 3UU5A 4ASKA 1IJ5A 3P50A 2WWVA 4HFDA 2VB6A 2WU2A 4EZ4A 3VRAA 1MNEA 3RH3A 3PUXF 2BBJA 4P0AA 2SPCA 4F7GB 4X65T 1ZHCA 3RYIE 2DCFA 2X0CA 2A3DA 2RA1A 2V26A 4TNVA 5AQQB 2HHHT 2OV9A 3RYCE 2M6IA 4YT0A 3QB5K 4KX6A 4DR5T 3CX8B 4QKNA 5C8YE 2KWHA 2WZIA 4ZI2C 4DR3T 3Q2MA 2E5LT 2WDRA 5HCMA 4OHFA 1T72A 3R6NA 3ZT6A 3DYJA 2WCAA 3KBTA 3LJCA 3I9YA 2FUPA 1MMDA 1ZKEA 3NVOA 3UUNA 4BA9A 2MYSA 4QHOA 1U4QA 2WDQA 4HEAA 4DV6T 2JPFA 4I55E 2BVMA 4YTPA 4PFOA 3HKEE 4KHZF 2B1EA 3CQXC 3AAEB 5FMNA 5J0ZA 3AEBA 2K48A 3MK7C 3Q5WA 4TWHA 1HNWT 1NENA 2ODVA 3KVAA 1HTJF 3AXJA 3NKZA 2LEHA 4YSZA 4DV3T 4HN9A 2LOSA 5LJMA 4O2AE 4UVAB 2KMFA 1S35A 4AKHA 1HCIA 2IMLA 4B3ST 5FXVA 2IIUA 4X1KE 5F3JA 2M6BA 4JI7T 2QYWA 3RX6A 2KZ7B 3RRWA 4UR9A 2X9YA 5AQKB 3F2EA 4QH5A 3D0TA 2KGXA 2CLYC 2JMHA 5DQWA 5AQGB 4IDOA 2KBBA 3JAFA 2XZEA 1J5ET 1JNZA 4DMWA 3MKDA 4YXDA 2EHOA 4DVDA 4EZHA 3ZT7A 3AA0B 4LF8T 3ZEFB 2LHRA 3IF8B 4EXTA 3AE8A 4GK0E 4Z90A 5J2TE 3AE3A 4BJMA 3ZJ1A 2LRKA 2W67A 5FYMA 1OXZA 3L39A 1OEDB 2BVLA 4LFBT 5A1LA 3CX6B 4CXYA 3HR0A 3ANWB 3O1JA 2W0GA 2ZM8A 3ZPOA 3AA6B 4BAYB 4ZZBA 3GN5B 1HNZT 2F4VT 2FJBA 2A72A 2I0MA 4AXPA 1GQEA 3HKDE 3NZPA 2QGSA 3T1YT 2JQHA 4X66T 4GOUA 5JDNA 2E9XC 5HXHA 3JAEA 2ZM6T 2PTFA 3HI2A 1VCSA 1Y01A 3C4ZA 2N1GA 4U7IA 3ZN1B 2ZM0A 3FZMB 4GYSA 2A2FX 3ZYLA 4CI2B 2IUBA 4X62T 4IDNA 4UIGA 2NW9A 1N36T 4LF7T 2NR4A 3VR9A 4E7SA 5AQNB 3K8PC 4YLHA 4EOZB 5CA1E 4ERRA 5JR9C 2E2AA 2UXXB 2QRXA 2J1DG 4X1YE 2NTYA 4J2CA 1MMNA 2DI4A 4ILAA 2X9XA 1CUNA 3ETVA 3DTOA 1SHZC 4O4JE 2X66A 5HYAA 4DUZT 3Q9DA 4LFAT 2EHOD 3FHNA 2ES0A 2V6YB 3RRCA 3ETUA 3DP7A 3UT5E 2VL0A 5LG4A 3HA4A 2W2UA 3C64A 2AE9A 4JUYA 5H6QB 4IL9A 5LP6E 3BQKA 4NUUA 3AE1A 4YTNA 3O1HA 4JI6T 4DUYT 4HKAA 1US7B 3PJAJ 1KK7A 3CPZA 5HWXA 1UURA 3ZCIA 2W63A 3C51A 4IE0A 2PFVA 1UUSA 5AQOB 3EDUA 1SJ8A 3AB3B 5AQSB 2WY2A 4P1NA 2CXLA 4JLEA 2LJLA 3RKGA 5JDFA 4I4TE 1HR0T 4IL4A 5KX5E 3OYZA 2DLRA 3I0QA 4KUMB 4ZZCA 4AKGA 3LDQB 4BJNA 2QA7A 4PJLA 3ZJ2A 4CN4A 2HPLA 2Q9QA 2IC6A 4DBQA 3EI0A 2KSRA 4MHCA 3UUMA 3OYXA 5HAXA 5GONE 3ZMZB 3ZYMA 1KNZA 1E2AA 1SA0E 3F57A 5FXZA 4HWIB 2LLYA 5ETWA 2WSSV 2N9DA 4JI5T 4LF9T 3LK3B 4TN7B 2V7LA 4ISTA 3PUGA 1ZOYA 4H9SE 4H63V 2FBWA 4CQIA 4CXWA 3E0ZA 1WFDA 3AAIA 3QOFA 2UU9T 3VKHA 4ILCA 4EEDA 2JJ9A 3NBXX 4NIQA 2IHR1 4LMJA 5JTGA 3CVRA 3MXZA 2BS4A 2XAHB 1SUMB 2XQAA 3GA8A 1N34T 5HEJA 1OEDE 4CN1A 5L3BB 5LJNA 2XAQB 1NAFA 2BBHA 3Q5XA
chains in the Genus database with same CATH topology
4O4HE 3WAKA 3CX8B 4QKNA 5C8YE 2IW5B 4G2AA 2KWHA 4E7ZA 4ZI2C 1BR2A 5LYJE 3Q2MA 3P7IA 2D0UA 3UULA 2Y8DA 2G0UA 4OHFA 3CQCB 2X67A 3R6NA 1MIYA 3R84B 3KBTA 5LHIB 3LJCA 1OWAA 4I50E 3AVSA 2H7OA 3I9YA 5FY1A 3AVRA 4XAXB 1MMDA 3CWZB 3LBXA 4IGUA 1ZKEA 3W15B 3P8CD 2IAKA 3UUNA 4BA9A 3NZQA 2LSJA 1BR4A 2K5BB 2E9XD 2LHNA 2L9QA 2MYSA 3L3PA 3SRZA 5KDMC 4QHOA 1U4QA 5FXXA 3C50A 1IAPA 5FP3A 4HEAA 3ZCJA 2JPFA 4I55E 4UVBB 1YKHB 2BVMA 2L8KA 4TUYE 4EIWA 4H63H 4YHJA 4P0BA 3KDSE 2WAUA 4PFOA 3HKEE 3UTKA 4ZI3D 2B1EA 3N5LA 3CQXC 2C5JA 3AAEB 3KV6A 2GK9A 3KINB 2CLYB 5KMGP 5FMNA 1D1AA 2K48A 2W00A 3MK7C 3Q5WA 2ZM2A 2WMNA 3ANWA 2YEVC 4ZOLE 3LG7A 4EYUA 4F6RC 2ODVA 3KVAA 1HTJF 4ILUA 2WM9A 3U78A 2LEHA 3ZMUB 4PK4A 3PURA 4JEHB 4PFPA 4PK6A 3N9LA 5FNVE 5F8PA 5LHHB 3GN5A 4DBRA 3WAJA 1BR0A 2VASA 3VJZA 4HN9A 2LOSA 3OKQA 5EZYE 1S94A 2PJQA 3ZMSB 4EYYR 5LJMA 4O2AE 3MA9A 4UVAB 2KMFA 2C5IT 5L3CB 1S35A 5LGTB 4AKHA 4QX7B 3PE0A 1YKEB 5L2LA 1HCIA 5AFUL 1MMAA 5FXVA 2M67A 3AA1B 4X1KE 5F3JA 5J2UE 3K3OA 4AQFC 2ZLYA 4O2BE 4UV8B 2NP9A 3WURA 2NW7A 5FY0A 3DJBA 5LXTE 3RX6A 4UXNB 2KZ7B 2CCQA 3RRWA 2CM0A 2X9YA 3E22E 5EK3A 4GYRA 3CMLA 3F2EA 4IE6A 3D0TA 1NWMX 2CLYC 2LT3A 3IEEA 4Z8XA 4OFZA 2JMHA 5DQWA 3GWHA 2YK0A 3LK2B 4KP3C 3WI3A 4N78D 1WRDA 2RP4A 4DMWA 3CKDA 1FMWA 3MKDA 5LA6E 3PUSA 2EHOA 3PUQA 4DVDA 4EZHA 4IE7A 3AA0B 2VWAA 3K3NA 3GMIA 3ZEFB 2LHRA 4UELA 2JMKA 2XTLA 3AT7A 5JQGE 3IF8B 4EXTA 2E9XB 2LE8A 2XASB 4GK0E 5EK4A 5JDGA 1QSDA 4CZZB 5J2TE 1LRZA 3O9XA 3RC3A 2E8IA 4A56A 1B7TA 1QUUA 2DWGA 4CXXA 2VL8A 3ZJ1A 4BJMA 5JRCA 5FYMA 3PHF1 1OXZA 3I9WA 2MBGA 2BVLA 4TV9E 3JC6D 3FXDB 5A1LA 4XBFB 5JDLA 3CX6B 4DNDA 3BQLA 4H9PC 3FB2A 2V7JA 4XZCA 4HGAA 4CXYA 1FMVA 3PF0A 2Q9QB 3ZYKA 3HR0A 1D1BA 3ANWB 3O1JA 1HF8A 2W0GA 5HXCA 4O4LE 4M1PA 2V1DB 2X9HA 1AJ3A 2UXNB 2ZM8A 1WYBA 3BQIA 3ZPOA 4PK5A 3RC8A 3AA6B 4X1IE 5FY7A 3N9PA 2HPJA 3WSCA 1VOMA 4BAYB 4I43B 4CI3B 5L3EB 4L5GA 2V7IA 4YFSA 3GN5B 4PAGA 4P09A 2A72A 4DMVA 5HWYA 3ZLIA 3LFMA 4MFRA 4AXPA 3HKDE 3NZPA 3JC6C 2VKHA 5DQVA 4L9IA 3SS1A 4JEUB 5JR9B 1ZV4X 2V7MA 1Y64B 2QGSA 2K9AA 2CE7A 3L09A 2CEAA 2XAFB 3N2GE 2NW8A 5IYZE 2WWUA 4GOUA 4FI5A 2Q9QD 4HTEA 3C4XA 2X68A 4NUVA 5JDNA 4TZ4C 3ZN0B 4ZI7E 5CA0E 2E9XC 1HS7A 5HXHA 4QXBB 3SOLA 2KT9A 1MIVA 2CWOA 1H7CA 2PG8A 3HI2A 5E0OA 5LBMA 4ZS2A 2IC9A 3C4ZA 2LOPA 2N1GA 2XAGB 3CQGB 3ZN1B 3KFWX 2ZM0A 5LCYA 4GYSA 4IE5A 4ZI3C 2A2FX 3ZYLA 2BZBA 4IHJE 3HL6A 4O4IE 2XQYA 4CI2B 4WBOA 3MJXA 2Q9QC 3HKCE 4GK5E 4UIGA 2NW9A 3KBUA 3PDYA 4MLKA 5M4YA 3K3QC 2NOXA 4U74A 4O8SA 4IIJE 2KLQA 3NRXA 2KXPB 4H9NC 2YU1A 3N2KE 1T98A 1IZNB 2K24A 4E7SA 5HXRA 3UUXB 1ZEEA 3UFEA 3K8PC 2MTCA 4YLHA 3OBVE 2OA5A 4BGOA 4HE8A 3ZMVB 1MIWA 4EOZB 3B57A 3QK6A 4PW8A 5CA1E 1FEWA 3LK42 2PBIA 3RYFE 3TKLB 4ERRA 3VHLA 5JR9C 4WBNE 2WMOA 1V9DA 4L0RA 2UXXB 4GIWA 2J1DG 4X1YE 5L3FB 1D0XA 2NTYA 3O4XE 2D2SA 4J2CA 1HFAA 1MMNA 2DI4A 4PJNA 2X9XA 1CUNA 1UX4A 2VKDA 3ETVA 3DTOA 1G73A 4AKIA 5LBQB 1SHZC 1EZ3A 4O4JE 2CXDA 2X66A 2YINA 3KVBA 3S4UA 1FIOA 4DO0A 5HYAA 1YW0A 2LSKA 2CMRA 3PU3A 3PTRB 3Q9DA 4OK0A 3AAAB 4ZHQE 2EHOD 3LBXB 5HXEA 5JREA 2C5KT 3B13A 2ES0A 3FHNA 2XHEB 1WLXA 3RRCA 3ETUA 3HKBE 4B6XA 3DP7A 1WR6A 4UVCB 4PNIA 4ONRA 3N9QA 2NWBA 3UT5E 3U3IA 2X9WA 1D1CA 5JDQA 3ONXA 4WNKA 3FBZA 4ZI2D 5LG4A 3HA4A 4ISSA 3PUAA 4TV8E 2CA5A 5DJQC 1Z0PA 3O1IA 1MMGA 4C90A 1D0YA 3C64A 3MZKB 2ODUA 3J9X1 4UV9B 4QWNB 4UEMA 4OYJA 1HX8A 2LSIA 4JUYA 3MACA 3H3AA 1WYCA 3H37A 5H6QB 4KBMB 5LGNB 4ADZA 4UF0A 5LP6E 2KNDA 2MOZA 4YJ2E 3J7Yq 3V5UA 3BQKA 4NUUA 3N9OA 3CX7B 4QXCB 3O1HA 4HKAA 2CXFA 1US7B 3QUJA 2XAJB 1KK7A 2VKOA 1YD8G 3VU7H 3CPZA 5HWXA 3KV9A 2BDEA 2Y48B 3ZCIA 5T1DA 5FXWA 2W63A 3C51A 4IE0A 3I1AA 2PFVA 1G8XA 2ACXA 2D0TA 3EDUA 3EDVA 3RYHE 3ZC1A 4V1Av 3AB3B 2KWIB 5ADXL 2H3RA 2JRKA 2CXLA 3M65A 4AI6A 1LVKA 4H9OC 3VKGA 3BK9A 4OYKA 2Y6XA 4JLEA 3KV5A 5HXSA 3IBPA 2E9XA 2KINB 2CWYA 3AA7B 2LJLA 3EUHA 5H6RB 5JDFA 4EAHA 4I4TE 2X51A 3E08A 4FJOA 5JDMA 5KX5E 1MNDA 2LSYA 3OYZA 2DLRA 4QX8B 4AQGA 3KV4A 5JDHA 3I0QA 4KUMB 5TAOA 4AKGA 2MTQA 4BJNA 4TX5A 2N2NA 2QA7A 2DHRA 4PJLA 3ZJ2A 5L3DB 2DNXA 5EK2A 3IHRA 2HPLA 2Q9QA 2IC6A 2D5UA 3F31A 2X0LB 4DBQA 1D0ZA 4K0UA 2YU2A 3EVYA 4MHCA 3UUMA 3OYXA 3N9NA 5HAXA 2W61A 5J1GA 1E1HB 4PJMA 2XUEA 4AQFA 5LNKA 4C91A 2EHOB 5GONE 2V7KA 2LSGA 1X79A 1BR1A 3RPUA 5JH7E 2L3LA 5BMVE 3ZMZB 2HH7A 3ZYMA 1KNZA 1IJ6A 3FXEB 4ZS3A 5JR9A 2LM9A 1SA0E 5IHYA 3F57A 2LQUA 1UCUA 4MBQA 4YJ3E 5FXZA 3NRYA 2W62A 4U72A 3QC9A 5ETWA 4EB6E 2JQQA 1HG5A 5CB4E 2WSSV 4ECGA 5JRCB 3A5XA 2N9DA 5DABA 3C4WA 5LOVE 5JVDE 2VKJA 3LK3B 2NTXA 2V7LA 2VK9A 4ISTA 2P9BA 3OJAA 3PUGA 3N9MA 4QXHB 4TN7B 3C98B 1O3XA 2ZMAA 3ESLA 4HFVA 4UF0B 4H9SE 4X20E 4H63V 2Z6EA 3FBLA 4ASKA 1LVFA 1IJ5A 3ZMTB 4CQIA 2H7VC 3E0ZA 2VB6A 3RKOA 4CXWA 4EZ4A 4CI1B 5LGUB 1MNEA 3RH3A 3V5SA 3AAIA 3M1CA 3VKHA 1LKXA 1UX5A 3T8OA 2JJ9A 3NBXX 2SPCA 4P0AA 2I59A 3CVRA 5L3GB 4H9QC 4IDZA 3MXZA 2XAHB 1ZHCA 3ZC0A 3RYIE 1U5PA 2DCFA 3GA8A 3SWHA 4PJJA 2C0SA 2A3DA 2WBLA 4G63A 2RA1A 2V26A 1VRBA 4H9RC 3PU8A 1HG2A 5L3BB 2EHOC 5LJNA 4KMCA 2XAQB 1NAFA 4AKRB 3RYCE 4ANJA 3I0OA 3N2OA 2DWKA 4WW0A 3Q5XA 4IE4A 5LHGB 4AKLA 4MALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5S A;  5JDF A;  5HXE A;  5JDQ A;  5JDG A;  5JDH A;  5HYA A;  5HXH A;  5HWX A;  5JDL A;  5JDM A;  5HXC A;  5HXS A;  5HXR A;  3V5U A;  5JDN A;  5HWY A; 
#chains in the Genus database with same CATH topology
 3ZT5 A;  3P7I A;  4A97 A;  3P4Q A;  3R84 B;  2X67 A;  5HEU A;  5LHI B;  1OWA A;  3AEA A;  4I50 E;  3AVS A;  5FY1 A;  3LBX A;  3W15 B;  3P8C D;  1XNQ T;  1BR4 A;  2LHN A;  3L3P A;  4YTM A;  2W66 A;  5FXX A;  2I6H A;  1YKH B;  2L8K A;  4EIW A;  4YHJ A;  3AY5 A;  4JI4 T;  3KDS E;  4ZI3 D;  4LF6 T;  3N5L A;  3KV6 A;  3KIN B;  2CLY B;  1D1A A;  2ZM2 A;  4ZOL E;  3LG7 A;  1W09 A;  4ILU A;  2WM9 A;  2QVA A;  4JEH B;  4PFP A;  4PK6 A;  3N9L A;  5FNV E;  5LHH B;  3WAJ A;  2VAS A;  3VJZ A;  3OKQ A;  5EZY E;  4DR2 T;  1YQ3 A;  1W9R A;  3AE5 A;  4JYA T;  1N33 T;  1YKE B;  2LKG A;  3AA1 B;  2XQ4 A;  5L4E A;  5J2U E;  1KF6 A;  4O2B E;  1IBK T;  5FY0 A;  4IT4 A;  4TWD A;  4X5T A;  2CCQ A;  3PUV F;  3E22 E;  1NWM X;  1KNR A;  2VVS A;  3WI3 A;  5L47 A;  2XPK A;  2XTL A;  3AT7 A;  2E9X B;  5EK4 A;  1JNR A;  1QSD A;  4HFH A;  4Z91 A;  2LKH A;  1LRZ A;  2JIW A;  2DWG A;  5JRC A;  5AQH B;  4EV6 A;  2MBG A;  3JC6 D;  4XBF B;  5JDL A;  4XZC A;  1FMV A;  3ZYK A;  1HF8 A;  2V1D B;  2X9H A;  3BQI A;  3AXJ B;  3N9P A;  1VOM A;  3RHW A;  2V7I A;  4YFS A;  4PAG A;  4DMV A;  3QB5 A;  3JC6 C;  2VKH A;  2BKN A;  5JR9 B;  1ZV4 X;  2V7M A;  2K9A A;  2CEA A;  2XQ5 A;  5AQP B;  2WWU A;  4FI5 A;  2X68 A;  3AEE A;  1HS7 A;  3EAB A;  3SOL A;  1FJG T;  2CWO A;  1H7C A;  2PG8 A;  4ZS2 A;  4TWF A;  3ONL C;  2MPK A;  2XQY A;  4DV1 T;  3CK6 A;  3RIF A;  4JBW F;  3PDY A;  3K3Q C;  2NOX A;  2KLQ A;  1HX1 B;  2UUC T;  2KXP B;  5AQF B;  3N2K E;  1IZN B;  2K24 A;  5HXR A;  1SJ7 A;  2MTC A;  4HE8 A;  3RYF E;  2PBI A;  3TKL B;  3OTO T;  5HEG A;  3VHL A;  1V9D A;  4L0R A;  4LFC T;  1D0X A;  3P4W A;  4PJN A;  3FZF B;  2V6X A;  3FYQ A;  2CXD A;  3S4U A;  2YIN A;  4DO0 A;  2CMR A;  3PU3 A;  3PTR B;  4OK0 A;  3AAA B;  4ZXL A;  4QH4 A;  4LF5 T;  2C5K T;  3B13 A;  4DR7 T;  1I94 T;  5HEO A;  3HKB E;  4UVC B;  1IBL T;  1DU2 A;  3N9Q A;  1D1C A;  5JDQ A;  3ZSS A;  1YQ4 A;  4ISS A;  3PUA A;  4TV8 E;  5DJQ C;  4C90 A;  5FKY A;  1YXR A;  2ODU A;  3M3Z B;  1KEY A;  4A5X A;  4OYJ A;  1HX8 A;  3ZKR A;  1WYC A;  2MOZ A;  3V5U A;  2KVP A;  3CX7 B;  3AEG A;  2CXF A;  1T7S A;  2XAJ B;  2VKO A;  1XNR T;  1YD8 G;  3AEF A;  2YN6 A;  2XQ9 A;  4GKJ T;  3NWI A;  4EEB A;  5FXW A;  2BKO A;  3I1A A;  2ACX A;  3RYH E;  4A98 A;  2JRK A;  3M65 A;  3BK9 A;  1XZY A;  4WZX A;  4OYK A;  3TLW A;  5HXS A;  5H6R B;  2UXD T;  3E08 A;  1MND A;  2LSY A;  3UQ7 A;  2FJA A;  2BG9 E;  1OED A;  2J4G A;  2DHR A;  4YSY A;  4B3R T;  4JV5 T;  3F31 A;  3AE4 A;  2X0L B;  2YU2 A;  4K0K T;  3EVY A;  4OX9 T;  3N9N A;  2W61 A;  4AQF A;  4AIS A;  3RPU A;  5BMV E;  1IJ6 A;  2VUR A;  4ZS3 A;  3FZL B;  2LM9 A;  3Q5E A;  5IHY A;  1UCU A;  4MBQ A;  4U72 A;  4ECG A;  5DAB A;  3C4W A;  5AQI B;  2VK9 A;  3OJA A;  4QXH B;  4COF A;  1O3X A;  3AEC A;  4HFV A;  4X20 E;  2Z6E A;  3FBL A;  5L4H A;  3ZMT B;  1I6Z A;  5FVL A;  3ABV A;  3OPC A;  5LGU B;  2D9D A;  1LKX A;  3T8O A;  5L3G B;  4H9Q C;  4IDZ A;  1U5P A;  3SWH A;  4PJJ A;  3AE6 A;  4LMK A;  1HG2 A;  3OVU A;  4I0U A;  2EHO C;  2JQ9 A;  4U3C A;  4AKR B;  2K3W A;  4ANJ A;  3I0O A;  4WW0 A;  4IE4 A;  1J1J A;  4O4H E;  3WAK A;  2IW5 B;  3VRB A;  5LYJ E;  2D0U A;  3UUL A;  3RGL A;  3CQC B;  3AVR A;  1QLB A;  2V6Y A;  2V8S V;  1E7P A;  5FP3 A;  2HN1 A;  3ZCJ A;  4TUY E;  4H63 H;  4P0B A;  5AQR B;  5FZT A;  2WAU A;  3P4S A;  3UTK A;  4JI2 T;  2XQ3 A;  4NXM T;  2GK9 A;  2W00 A;  4WYV A;  4EYU A;  4F6R C;  3UU8 A;  3U78 A;  3ZMU B;  5ABF B;  1BR0 A;  1S94 A;  2PJQ A;  3ZMS B;  4EYY R;  3EAM A;  2C5I T;  5LGT B;  4NPP A;  5L2L A;  3FZH B;  2YDS A;  4HWD A;  1MMA A;  2M67 A;  3EHZ A;  5FL1 A;  4AQF C;  2NP9 A;  3WUR A;  2NW7 A;  3UQ4 A;  3TLS A;  5LXT E;  4UXN B;  5HEH A;  5LMU T;  2WDV A;  4GYR A;  4U7Y A;  5AQJ B;  4OFZ A;  3LK2 B;  4KP3 C;  4YSX A;  2R6G F;  5HCJ A;  1WRD A;  2RP4 A;  1FMW A;  2ACZ A;  2WZH A;  3PUQ A;  2VWA A;  3K3N A;  3GMI A;  4UEL A;  2JMK A;  2XAS B;  5JDG A;  5KXJ A;  3P4R A;  4GKK T;  2E8I A;  4A56 A;  1QUU A;  3Q5D A;  3PHF 1;  3I9W A;  4TV9 E;  3FXD B;  4DND A;  3BQL A;  2YDR A;  3FB2 A;  4HGA A;  3PF0 A;  2MAW A;  4X64 T;  1D1B A;  5HXC A;  3RIU A;  4O4L E;  3TLV A;  4DV7 T;  2L10 A;  1AJ3 A;  4PK5 A;  3RC8 A;  4X1I E;  2B76 A;  1IBM T;  3WSC A;  2A9U A;  2UXC T;  4IDP A;  4P09 A;  4MFR A;  3SS1 A;  5DQV A;  4L9I A;  4JEU B;  5AQT B;  1Y64 B;  2XAF B;  2NW8 A;  4LF4 T;  5IYZ E;  2Q9Q D;  4HTE A;  3C4X A;  4TZ4 C;  3ZN0 B;  4ZI7 E;  5CA0 E;  4YHH T;  4QXB B;  2KT9 A;  1MIV A;  5E0O A;  3RLF F;  2WP9 A;  2LOP A;  2XAG B;  3L8R A;  4ZI3 C;  1NEK A;  4IHJ E;  1L0V A;  3HL6 A;  2CHN A;  4O4I E;  2Q9Q C;  2E5V A;  3RIA A;  4GK5 E;  4MLK A;  3UU4 A;  4U74 A;  4O8S A;  4DV0 T;  4IIJ E;  3NRX A;  1XWM A;  4H9N C;  2WU5 A;  3AE9 A;  2YU1 A;  1T98 A;  3UU6 A;  3UUX B;  4AIU A;  3UFE A;  3OBV E;  2OA5 A;  3PV0 F;  3ZMV B;  4JI3 T;  1MIW A;  3B57 A;  4PW8 A;  2IDO B;  4WBN E;  2WMO A;  1HFA A;  3A7M A;  2BG9 A;  3T1H T;  1FIO A;  4ZHQ E;  2OLT A;  5FL0 A;  5JRE A;  5C2T A;  4DV2 T;  2XHE B;  3UFG A;  1M62 A;  2XJ7 A;  1WR6 A;  2LRL A;  4ONR A;  2NWB A;  2X9W A;  3ONX A;  4WNK A;  3FBZ A;  4ZI2 D;  2H89 A;  1KNP A;  2LM2 A;  1XDP A;  2CA5 A;  1MMG A;  5IUX A;  1D0Y A;  3MZK B;  4QH1 A;  3H3M A;  3J9X 1;  2CBI A;  2LSI A;  3MAC A;  3H3A A;  5LMN T;  4UF0 A;  4YJ2 E;  4QXC B;  3AE7 A;  5AQU B;  3QUJ A;  2BS3 A;  3VU7 H;  2BDE A;  2Y48 B;  5T1D A;  1G8X A;  2D0T A;  3EDV A;  4V1A v;  5ABH A;  2KWI B;  2XSA A;  2UUA T;  5ADX L;  2H3R A;  1XMO T;  2WQY A;  1LVK A;  3RIU C;  2W4X A;  2J62 A;  2Y6X A;  3IBP A;  2E9X A;  2KIN B;  3ONJ A;  2CWY A;  2VQE T;  4W8P A;  4QX8 B;  4AQG A;  3KV4 A;  5TAO A;  4TNW A;  2VVN A;  2XM1 A;  5ABG A;  5EK2 A;  4K0U A;  5IWA T;  4PJM A;  4C91 A;  2EHO B;  2LSG A;  1X79 A;  5JH7 E;  2L3L A;  2XY8 B;  2HH7 A;  3FXE B;  4DV5 T;  5JR9 A;  2BS2 A;  2LQU A;  4B3T T;  2WB5 A;  4EB6 E;  3TLT A;  5CB4 E;  3JCF A;  2NTX A;  1T8B A;  2P9B A;  3N9M A;  3C98 B;  3ESL A;  2ZMA A;  1LVF A;  2V5C A;  2H7V C;  3RKO A;  4CI1 B;  4HFE A;  4EGW A;  3V5S A;  4DR4 T;  3M1C A;  2XQ6 A;  4JI1 T;  1UX5 A;  2FJD A;  4U2Z A;  2DL1 A;  2I59 A;  3CIR A;  3ZC0 A;  2BG9 C;  2C0S A;  3VR8 A;  2WBL A;  4G63 A;  5AQM B;  1VRB A;  4H9R C;  3PU8 A;  4KMC A;  2XM2 A;  3N2O A;  2DWK A;  5LHG B;  4AKL A;  4MAL A;  3RQW A;  5BR8 T;  4G2A A;  4E7Z A;  1BR2 A;  4AQY T;  2XQ8 A;  1W0A A;  2Y8D A;  2G0U A;  3PUW F;  1MIY A;  2CBJ A;  2RPA A;  2H7O A;  3JAD A;  4XAX B;  3CWZ B;  4IGU A;  2X0Y A;  2IAK A;  4JI0 T;  3NZQ A;  2LSJ A;  2JQK A;  2K5B B;  2E9X D;  2L9Q A;  3SRZ A;  5KDM C;  1IAP A;  3C50 A;  4Q25 A;  4UVB B;  4KI0 F;  2X0H A;  2C5J A;  2H88 A;  5KMG P;  2WMN A;  3ANW A;  2YEV C;  4LML A;  4PK4 A;  3PUR A;  5F8P A;  3GN5 A;  4DBR A;  1UK5 A;  2V5D A;  3AE2 A;  4HFC A;  3MA9 A;  2XSB A;  5L3C B;  4IDQ A;  4QX7 B;  3PE0 A;  5AFU L;  4U33 A;  4IRE A;  1SE7 A;  3K3O A;  3ZST A;  2ZLY A;  4UV8 B;  4HWC A;  3DJB A;  2CRB A;  1ZP0 A;  2CM0 A;  4B3M T;  5EK3 A;  3CML A;  4IE6 A;  3RI5 A;  4DR1 T;  5C3J A;  2CHO A;  2LT3 A;  3IEE A;  4Z8X A;  3K1S A;  5LG3 A;  3GWH A;  2YK0 A;  4N78 D;  3CKD A;  5LA6 E;  3PUS A;  4IE7 A;  3SFE A;  4ILB A;  4DID B;  5JQG E;  5AQV B;  2LE8 A;  4CZZ B;  3O9X A;  3RC3 A;  1B7T A;  4CXX A;  1WCR A;  2VL8 A;  1XMQ T;  3PJA A;  4CN6 A;  2YOE A;  4H9P C;  4HWH A;  5FVK A;  2V7J A;  2Q9Q B;  4M1P A;  2UXN B;  1WYB A;  1UGO A;  2WS3 A;  5FY7 A;  2HPJ A;  5F5W A;  4I43 B;  4CI3 B;  5L3E B;  4L5G A;  3RF1 A;  5HWY A;  3ZLI A;  3LFM A;  3X1D A;  1VCT A;  2CE7 A;  3L09 A;  4HWF A;  3N2G E;  1R8I A;  1CHU A;  4U2Y A;  3RQU A;  2L7N A;  4NUV A;  1KFY A;  1WR0 A;  4NXN T;  4HFI A;  5LBM A;  2IC9 A;  4F8H A;  3CQG B;  3KFW X;  5LCY A;  4IE5 A;  1OED C;  2BZB A;  5LB7 B;  4WBO A;  3MJX A;  2AXD S;  1M7K A;  3HKC E;  2XQ7 A;  3KBU A;  5M4Y A;  2BKP A;  3QNU A;  3LSV A;  3PUY F;  1ZEE A;  4BGO A;  4ZEY A;  5ABE A;  2UXB T;  3QK6 A;  1FEW A;  3LK4 2;  4GIW A;  5L3F B;  3O4X E;  3UU3 A;  2D2S A;  1J5W A;  5CJ5 A;  1UX4 A;  2VKD A;  1G73 A;  4AKI A;  5LBQ B;  1EZ3 A;  2FJE A;  3KVB A;  1YW0 A;  2LSK A;  5ABF A;  3LBX B;  5HXE A;  1WLX A;  4B6X A;  4YY3 T;  1XDO A;  4PNI A;  3TLU A;  2HN2 A;  3G06 A;  3U3I A;  5CGM A;  1Z0P A;  3O1I A;  4UV9 B;  4QWN B;  4UEM A;  3H37 A;  3B5M A;  4KBM B;  5LGN B;  4DV4 T;  4ADZ A;  3J7Y q;  2KND A;  2YKS A;  3UUB A;  3N9O A;  1Z8U A;  3IA3 A;  5AQL B;  3SFD A;  2VQF T;  3FZK B;  3KV9 A;  4KHP T;  3P4P A;  3ZC1 A;  3PUZ F;  4AI6 A;  4H9O C;  3VKG A;  3KV5 A;  4HFB A;  4DR6 T;  2CPT A;  3AA7 B;  3EUH A;  4EAH A;  2X51 A;  4FJO A;  3AED A;  5JDM A;  3A8Y C;  5JDH A;  2MTQ A;  4TX5 A;  2N2N A;  2YDQ A;  5L3D B;  2UUB T;  2DNX A;  3IHR A;  2D5U A;  1D0Z A;  1HNX T;  2BG9 B;  1X9B A;  5J1G A;  1E1H B;  2XUE A;  5LNK A;  1N32 T;  2V7K A;  1BR1 A;  4JI8 T;  4YJ3 E;  3NRY A;  2W62 A;  3QC9 A;  2J47 A;  2JQQ A;  1HG5 A;  5JRC B;  3A5X A;  5CFB A;  5LOV E;  5JVD E;  2VKJ A;  1W0B A;  4U31 A;  4UF0 B;  3UU5 A;  4ASK A;  1IJ5 A;  3P50 A;  2WWV A;  4HFD A;  2VB6 A;  2WU2 A;  4EZ4 A;  3VRA A;  1MNE A;  3RH3 A;  3PUX F;  2BBJ A;  4P0A A;  2SPC A;  4F7G B;  4X65 T;  1ZHC A;  3RYI E;  2DCF A;  2X0C A;  2A3D A;  2RA1 A;  2V26 A;  4TNV A;  5AQQ B;  2HHH T;  2OV9 A;  3RYC E;  2M6I A;  4YT0 A;  3QB5 K;  4KX6 A;  4DR5 T;  3CX8 B;  4QKN A;  5C8Y E;  2KWH A;  2WZI A;  4ZI2 C;  4DR3 T;  3Q2M A;  2E5L T;  2WDR A;  5HCM A;  4OHF A;  1T72 A;  3R6N A;  3ZT6 A;  3DYJ A;  2WCA A;  3KBT A;  3LJC A;  3I9Y A;  2FUP A;  1MMD A;  1ZKE A;  3NVO A;  3UUN A;  4BA9 A;  2MYS A;  4QHO A;  1U4Q A;  2WDQ A;  4HEA A;  4DV6 T;  2JPF A;  4I55 E;  2BVM A;  4YTP A;  4PFO A;  3HKE E;  4KHZ F;  2B1E A;  3CQX C;  3AAE B;  5FMN A;  5J0Z A;  3AEB A;  2K48 A;  3MK7 C;  3Q5W A;  4TWH A;  1HNW T;  1NEN A;  2ODV A;  3KVA A;  1HTJ F;  3AXJ A;  3NKZ A;  2LEH A;  4YSZ A;  4DV3 T;  4HN9 A;  2LOS A;  5LJM A;  4O2A E;  4UVA B;  2KMF A;  1S35 A;  4AKH A;  1HCI A;  2IML A;  4B3S T;  5FXV A;  2IIU A;  4X1K E;  5F3J A;  2M6B A;  4JI7 T;  2QYW A;  3RX6 A;  2KZ7 B;  3RRW A;  4UR9 A;  2X9Y A;  5AQK B;  3F2E A;  4QH5 A;  3D0T A;  2KGX A;  2CLY C;  2JMH A;  5DQW A;  5AQG B;  4IDO A;  2KBB A;  3JAF A;  2XZE A;  1J5E T;  1JNZ A;  4DMW A;  3MKD A;  4YXD A;  2EHO A;  4DVD A;  4EZH A;  3ZT7 A;  3AA0 B;  4LF8 T;  3ZEF B;  2LHR A;  3IF8 B;  4EXT A;  3AE8 A;  4GK0 E;  4Z90 A;  5J2T E;  3AE3 A;  4BJM A;  3ZJ1 A;  2LRK A;  2W67 A;  5FYM A;  1OXZ A;  3L39 A;  1OED B;  2BVL A;  4LFB T;  5A1L A;  3CX6 B;  4CXY A;  3HR0 A;  3ANW B;  3O1J A;  2W0G A;  2ZM8 A;  3ZPO A;  3AA6 B;  4BAY B;  4ZZB A;  3GN5 B;  1HNZ T;  2F4V T;  2FJB A;  2A72 A;  2I0M A;  4AXP A;  1GQE A;  3HKD E;  3NZP A;  2QGS A;  3T1Y T;  2JQH A;  4X66 T;  4GOU A;  5JDN A;  2E9X C;  5HXH A;  3JAE A;  2ZM6 T;  2PTF A;  3HI2 A;  1VCS A;  1Y01 A;  3C4Z A;  2N1G A;  4U7I A;  3ZN1 B;  2ZM0 A;  3FZM B;  4GYS A;  2A2F X;  3ZYL A;  4CI2 B;  2IUB A;  4X62 T;  4IDN A;  4UIG A;  2NW9 A;  1N36 T;  4LF7 T;  2NR4 A;  3VR9 A;  4E7S A;  5AQN B;  3K8P C;  4YLH A;  4EOZ B;  5CA1 E;  4ERR A;  5JR9 C;  2E2A A;  2UXX B;  2QRX A;  2J1D G;  4X1Y E;  2NTY A;  4J2C A;  1MMN A;  2DI4 A;  4ILA A;  2X9X A;  1CUN A;  3ETV A;  3DTO A;  1SHZ C;  4O4J E;  2X66 A;  5HYA A;  4DUZ T;  3Q9D A;  4LFA T;  2EHO D;  3FHN A;  2ES0 A;  2V6Y B;  3RRC A;  3ETU A;  3DP7 A;  3UT5 E;  2VL0 A;  5LG4 A;  3HA4 A;  2W2U A;  3C64 A;  2AE9 A;  4JUY A;  5H6Q B;  4IL9 A;  5LP6 E;  3BQK A;  4NUU A;  3AE1 A;  4YTN A;  3O1H A;  4JI6 T;  4DUY T;  4HKA A;  1US7 B;  3PJA J;  1KK7 A;  3CPZ A;  5HWX A;  1UUR A;  3ZCI A;  2W63 A;  3C51 A;  4IE0 A;  2PFV A;  1UUS A;  5AQO B;  3EDU A;  1SJ8 A;  3AB3 B;  5AQS B;  2WY2 A;  4P1N A;  2CXL A;  4JLE A;  2LJL A;  3RKG A;  5JDF A;  4I4T E;  1HR0 T;  4IL4 A;  5KX5 E;  3OYZ A;  2DLR A;  3I0Q A;  4KUM B;  4ZZC A;  4AKG A;  3LDQ B;  4BJN A;  2QA7 A;  4PJL A;  3ZJ2 A;  4CN4 A;  2HPL A;  2Q9Q A;  2IC6 A;  4DBQ A;  3EI0 A;  2KSR A;  4MHC A;  3UUM A;  3OYX A;  5HAX A;  5GON E;  3ZMZ B;  3ZYM A;  1KNZ A;  1E2A A;  1SA0 E;  3F57 A;  5FXZ A;  4HWI B;  2LLY A;  5ETW A;  2WSS V;  2N9D A;  4JI5 T;  4LF9 T;  3LK3 B;  4TN7 B;  2V7L A;  4IST A;  3PUG A;  1ZOY A;  4H9S E;  4H63 V;  2FBW A;  4CQI A;  4CXW A;  3E0Z A;  1WFD A;  3AAI A;  3QOF A;  2UU9 T;  3VKH A;  4ILC A;  4EED A;  2JJ9 A;  3NBX X;  4NIQ A;  2IHR 1;  4LMJ A;  5JTG A;  3CVR A;  3MXZ A;  2BS4 A;  2XAH B;  1SUM B;  2XQA A;  3GA8 A;  1N34 T;  5HEJ A;  1OED E;  4CN1 A;  5L3B B;  5LJN A;  2XAQ B;  1NAF A;  2BBH A;  3Q5X A; 
#chains in the Genus database with same CATH homology
 4O4H E;  3WAK A;  3CX8 B;  4QKN A;  5C8Y E;  2IW5 B;  4G2A A;  2KWH A;  4E7Z A;  4ZI2 C;  1BR2 A;  5LYJ E;  3Q2M A;  3P7I A;  2D0U A;  3UUL A;  2Y8D A;  2G0U A;  4OHF A;  3CQC B;  2X67 A;  3R6N A;  1MIY A;  3R84 B;  3KBT A;  5LHI B;  3LJC A;  1OWA A;  4I50 E;  3AVS A;  2H7O A;  3I9Y A;  5FY1 A;  3AVR A;  4XAX B;  1MMD A;  3CWZ B;  3LBX A;  4IGU A;  1ZKE A;  3W15 B;  3P8C D;  2IAK A;  3UUN A;  4BA9 A;  3NZQ A;  2LSJ A;  1BR4 A;  2K5B B;  2E9X D;  2LHN A;  2L9Q A;  2MYS A;  3L3P A;  3SRZ A;  5KDM C;  4QHO A;  1U4Q A;  5FXX A;  3C50 A;  1IAP A;  5FP3 A;  4HEA A;  3ZCJ A;  2JPF A;  4I55 E;  4UVB B;  1YKH B;  2BVM A;  2L8K A;  4TUY E;  4EIW A;  4H63 H;  4YHJ A;  4P0B A;  3KDS E;  2WAU A;  4PFO A;  3HKE E;  3UTK A;  4ZI3 D;  2B1E A;  3N5L A;  3CQX C;  2C5J A;  3AAE B;  3KV6 A;  2GK9 A;  3KIN B;  2CLY B;  5KMG P;  5FMN A;  1D1A A;  2K48 A;  2W00 A;  3MK7 C;  3Q5W A;  2ZM2 A;  2WMN A;  3ANW A;  2YEV C;  4ZOL E;  3LG7 A;  4EYU A;  4F6R C;  2ODV A;  3KVA A;  1HTJ F;  4ILU A;  2WM9 A;  3U78 A;  2LEH A;  3ZMU B;  4PK4 A;  3PUR A;  4JEH B;  4PFP A;  4PK6 A;  3N9L A;  5FNV E;  5F8P A;  5LHH B;  3GN5 A;  4DBR A;  3WAJ A;  1BR0 A;  2VAS A;  3VJZ A;  4HN9 A;  2LOS A;  3OKQ A;  5EZY E;  1S94 A;  2PJQ A;  3ZMS B;  4EYY R;  5LJM A;  4O2A E;  3MA9 A;  4UVA B;  2KMF A;  2C5I T;  5L3C B;  1S35 A;  5LGT B;  4AKH A;  4QX7 B;  3PE0 A;  1YKE B;  5L2L A;  1HCI A;  5AFU L;  1MMA A;  5FXV A;  2M67 A;  3AA1 B;  4X1K E;  5F3J A;  5J2U E;  3K3O A;  4AQF C;  2ZLY A;  4O2B E;  4UV8 B;  2NP9 A;  3WUR A;  2NW7 A;  5FY0 A;  3DJB A;  5LXT E;  3RX6 A;  4UXN B;  2KZ7 B;  2CCQ A;  3RRW A;  2CM0 A;  2X9Y A;  3E22 E;  5EK3 A;  4GYR A;  3CML A;  3F2E A;  4IE6 A;  3D0T A;  1NWM X;  2CLY C;  2LT3 A;  3IEE A;  4Z8X A;  4OFZ A;  2JMH A;  5DQW A;  3GWH A;  2YK0 A;  3LK2 B;  4KP3 C;  3WI3 A;  4N78 D;  1WRD A;  2RP4 A;  4DMW A;  3CKD A;  1FMW A;  3MKD A;  5LA6 E;  3PUS A;  2EHO A;  3PUQ A;  4DVD A;  4EZH A;  4IE7 A;  3AA0 B;  2VWA A;  3K3N A;  3GMI A;  3ZEF B;  2LHR A;  4UEL A;  2JMK A;  2XTL A;  3AT7 A;  5JQG E;  3IF8 B;  4EXT A;  2E9X B;  2LE8 A;  2XAS B;  4GK0 E;  5EK4 A;  5JDG A;  1QSD A;  4CZZ B;  5J2T E;  1LRZ A;  3O9X A;  3RC3 A;  2E8I A;  4A56 A;  1B7T A;  1QUU A;  2DWG A;  4CXX A;  2VL8 A;  3ZJ1 A;  4BJM A;  5JRC A;  5FYM A;  3PHF 1;  1OXZ A;  3I9W A;  2MBG A;  2BVL A;  4TV9 E;  3JC6 D;  3FXD B;  5A1L A;  4XBF B;  5JDL A;  3CX6 B;  4DND A;  3BQL A;  4H9P C;  3FB2 A;  2V7J A;  4XZC A;  4HGA A;  4CXY A;  1FMV A;  3PF0 A;  2Q9Q B;  3ZYK A;  3HR0 A;  1D1B A;  3ANW B;  3O1J A;  1HF8 A;  2W0G A;  5HXC A;  4O4L E;  4M1P A;  2V1D B;  2X9H A;  1AJ3 A;  2UXN B;  2ZM8 A;  1WYB A;  3BQI A;  3ZPO A;  4PK5 A;  3RC8 A;  3AA6 B;  4X1I E;  5FY7 A;  3N9P A;  2HPJ A;  3WSC A;  1VOM A;  4BAY B;  4I43 B;  4CI3 B;  5L3E B;  4L5G A;  2V7I A;  4YFS A;  3GN5 B;  4PAG A;  4P09 A;  2A72 A;  4DMV A;  5HWY A;  3ZLI A;  3LFM A;  4MFR A;  4AXP A;  3HKD E;  3NZP A;  3JC6 C;  2VKH A;  5DQV A;  4L9I A;  3SS1 A;  4JEU B;  5JR9 B;  1ZV4 X;  2V7M A;  1Y64 B;  2QGS A;  2K9A A;  2CE7 A;  3L09 A;  2CEA A;  2XAF B;  3N2G E;  2NW8 A;  5IYZ E;  2WWU A;  4GOU A;  4FI5 A;  2Q9Q D;  4HTE A;  3C4X A;  2X68 A;  4NUV A;  5JDN A;  4TZ4 C;  3ZN0 B;  4ZI7 E;  5CA0 E;  2E9X C;  1HS7 A;  5HXH A;  4QXB B;  3SOL A;  2KT9 A;  1MIV A;  2CWO A;  1H7C A;  2PG8 A;  3HI2 A;  5E0O A;  5LBM A;  4ZS2 A;  2IC9 A;  3C4Z A;  2LOP A;  2N1G A;  2XAG B;  3CQG B;  3ZN1 B;  3KFW X;  2ZM0 A;  5LCY A;  4GYS A;  4IE5 A;  4ZI3 C;  2A2F X;  3ZYL A;  2BZB A;  4IHJ E;  3HL6 A;  4O4I E;  2XQY A;  4CI2 B;  4WBO A;  3MJX A;  2Q9Q C;  3HKC E;  4GK5 E;  4UIG A;  2NW9 A;  3KBU A;  3PDY A;  4MLK A;  5M4Y A;  3K3Q C;  2NOX A;  4U74 A;  4O8S A;  4IIJ E;  2KLQ A;  3NRX A;  2KXP B;  4H9N C;  2YU1 A;  3N2K E;  1T98 A;  1IZN B;  2K24 A;  4E7S A;  5HXR A;  3UUX B;  1ZEE A;  3UFE A;  3K8P C;  2MTC A;  4YLH A;  3OBV E;  2OA5 A;  4BGO A;  4HE8 A;  3ZMV B;  1MIW A;  4EOZ B;  3B57 A;  3QK6 A;  4PW8 A;  5CA1 E;  1FEW A;  3LK4 2;  2PBI A;  3RYF E;  3TKL B;  4ERR A;  3VHL A;  5JR9 C;  4WBN E;  2WMO A;  1V9D A;  4L0R A;  2UXX B;  4GIW A;  2J1D G;  4X1Y E;  5L3F B;  1D0X A;  2NTY A;  3O4X E;  2D2S A;  4J2C A;  1HFA A;  1MMN A;  2DI4 A;  4PJN A;  2X9X A;  1CUN A;  1UX4 A;  2VKD A;  3ETV A;  3DTO A;  1G73 A;  4AKI A;  5LBQ B;  1SHZ C;  1EZ3 A;  4O4J E;  2CXD A;  2X66 A;  2YIN A;  3KVB A;  3S4U A;  1FIO A;  4DO0 A;  5HYA A;  1YW0 A;  2LSK A;  2CMR A;  3PU3 A;  3PTR B;  3Q9D A;  4OK0 A;  3AAA B;  4ZHQ E;  2EHO D;  3LBX B;  5HXE A;  5JRE A;  2C5K T;  3B13 A;  2ES0 A;  3FHN A;  2XHE B;  1WLX A;  3RRC A;  3ETU A;  3HKB E;  4B6X A;  3DP7 A;  1WR6 A;  4UVC B;  4PNI A;  4ONR A;  3N9Q A;  2NWB A;  3UT5 E;  3U3I A;  2X9W A;  1D1C A;  5JDQ A;  3ONX A;  4WNK A;  3FBZ A;  4ZI2 D;  5LG4 A;  3HA4 A;  4ISS A;  3PUA A;  4TV8 E;  2CA5 A;  5DJQ C;  1Z0P A;  3O1I A;  1MMG A;  4C90 A;  1D0Y A;  3C64 A;  3MZK B;  2ODU A;  3J9X 1;  4UV9 B;  4QWN B;  4UEM A;  4OYJ A;  1HX8 A;  2LSI A;  4JUY A;  3MAC A;  3H3A A;  1WYC A;  3H37 A;  5H6Q B;  4KBM B;  5LGN B;  4ADZ A;  4UF0 A;  5LP6 E;  2KND A;  2MOZ A;  4YJ2 E;  3J7Y q;  3V5U A;  3BQK A;  4NUU A;  3N9O A;  3CX7 B;  4QXC B;  3O1H A;  4HKA A;  2CXF A;  1US7 B;  3QUJ A;  2XAJ B;  1KK7 A;  2VKO A;  1YD8 G;  3VU7 H;  3CPZ A;  5HWX A;  3KV9 A;  2BDE A;  2Y48 B;  3ZCI A;  5T1D A;  5FXW A;  2W63 A;  3C51 A;  4IE0 A;  3I1A A;  2PFV A;  1G8X A;  2ACX A;  2D0T A;  3EDU A;  3EDV A;  3RYH E;  3ZC1 A;  4V1A v;  3AB3 B;  2KWI B;  5ADX L;  2H3R A;  2JRK A;  2CXL A;  3M65 A;  4AI6 A;  1LVK A;  4H9O C;  3VKG A;  3BK9 A;  4OYK A;  2Y6X A;  4JLE A;  3KV5 A;  5HXS A;  3IBP A;  2E9X A;  2KIN B;  2CWY A;  3AA7 B;  2LJL A;  3EUH A;  5H6R B;  5JDF A;  4EAH A;  4I4T E;  2X51 A;  3E08 A;  4FJO A;  5JDM A;  5KX5 E;  1MND A;  2LSY A;  3OYZ A;  2DLR A;  4QX8 B;  4AQG A;  3KV4 A;  5JDH A;  3I0Q A;  4KUM B;  5TAO A;  4AKG A;  2MTQ A;  4BJN A;  4TX5 A;  2N2N A;  2QA7 A;  2DHR A;  4PJL A;  3ZJ2 A;  5L3D B;  2DNX A;  5EK2 A;  3IHR A;  2HPL A;  2Q9Q A;  2IC6 A;  2D5U A;  3F31 A;  2X0L B;  4DBQ A;  1D0Z A;  4K0U A;  2YU2 A;  3EVY A;  4MHC A;  3UUM A;  3OYX A;  3N9N A;  5HAX A;  2W61 A;  5J1G A;  1E1H B;  4PJM A;  2XUE A;  4AQF A;  5LNK A;  4C91 A;  2EHO B;  5GON E;  2V7K A;  2LSG A;  1X79 A;  1BR1 A;  3RPU A;  5JH7 E;  2L3L A;  5BMV E;  3ZMZ B;  2HH7 A;  3ZYM A;  1KNZ A;  1IJ6 A;  3FXE B;  4ZS3 A;  5JR9 A;  2LM9 A;  1SA0 E;  5IHY A;  3F57 A;  2LQU A;  1UCU A;  4MBQ A;  4YJ3 E;  5FXZ A;  3NRY A;  2W62 A;  4U72 A;  3QC9 A;  5ETW A;  4EB6 E;  2JQQ A;  1HG5 A;  5CB4 E;  2WSS V;  4ECG A;  5JRC B;  3A5X A;  2N9D A;  5DAB A;  3C4W A;  5LOV E;  5JVD E;  2VKJ A;  3LK3 B;  2NTX A;  2V7L A;  2VK9 A;  4IST A;  2P9B A;  3OJA A;  3PUG A;  3N9M A;  4QXH B;  4TN7 B;  3C98 B;  1O3X A;  2ZMA A;  3ESL A;  4HFV A;  4UF0 B;  4H9S E;  4X20 E;  4H63 V;  2Z6E A;  3FBL A;  4ASK A;  1LVF A;  1IJ5 A;  3ZMT B;  4CQI A;  2H7V C;  3E0Z A;  2VB6 A;  3RKO A;  4CXW A;  4EZ4 A;  4CI1 B;  5LGU B;  1MNE A;  3RH3 A;  3V5S A;  3AAI A;  3M1C A;  3VKH A;  1LKX A;  1UX5 A;  3T8O A;  2JJ9 A;  3NBX X;  2SPC A;  4P0A A;  2I59 A;  3CVR A;  5L3G B;  4H9Q C;  4IDZ A;  3MXZ A;  2XAH B;  1ZHC A;  3ZC0 A;  3RYI E;  1U5P A;  2DCF A;  3GA8 A;  3SWH A;  4PJJ A;  2C0S A;  2A3D A;  2WBL A;  4G63 A;  2RA1 A;  2V26 A;  1VRB A;  4H9R C;  3PU8 A;  1HG2 A;  5L3B B;  2EHO C;  5LJN A;  4KMC A;  2XAQ B;  1NAF A;  4AKR B;  3RYC E;  4ANJ A;  3I0O A;  3N2O A;  2DWK A;  4WW0 A;  3Q5X A;  4IE4 A;  5LHG B;  4AKL A;  4MAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...