5JDGA

Structural mechanisms of extracellular ion exchange and induced binding-site occlusion in the sodium-calcium exchanger ncx_mj soaked with 2.5 mm na+ and 0.1mm ca2+
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
301
structure length
294
Chain Sequence
MVILGVGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGATVMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIIVDKNLQKNILVYLLFVIFAAVIGIDGFSWIDGVVLLILFIIYLRWTVKNGSAKNNPSVVFSLVLLIIGLIGVLVGAELFVDGAKKIALALDISDKVIGFTLVAFGTSLPELMVSLAAAKRNLGGMVLGNVIGSNIADIGGALAVGSLFMHLPAENVQMAVLVIMSLLLYLFAKYSKIGRWQGILFLALYIIAIASLRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of extracellular ion exchange and binding-site occlusion in a sodium/calcium exchanger.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Membrane protein
molecule keywords sodium-calcium exchanger NCX_Mj
total genus 120
structure length 294
sequence length 301
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01699 Na_Ca_ex Sodium/calcium exchanger protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1130 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jdgA01
1.20.1420.30 Mainly Alpha Up-down Bundle A middle domain of Talin 1 A middle domain of Talin 1 5jdgA02
5HXCA 5HXRA 5HXHA 3V5SA 5JDLA 5JDMA 5JDQA 5JDHA 5JDNA 5HYAA 5HXEA 5JDGA 5JDFA 5HXSA 5HWYA 5HWXA 3V5UA
chains in the Genus database with same CATH superfamily
2LM9A 2V26A 3B5MA 3AEDA 3AXJA 2X51A 4I4TE 2CXDA 4O4JE 3SFDA 1MNEA 2OA5A 3TKLB 1ZOYA 2GK9A 2CM0A 2ZLYA 2DWGA 5LOVE 3NRYA 5HCMA 5F8PA 2K3WA 1E7PA 4IDOA 3MK7C 3ZJ1A 4ZI7E 4GYSA 2IW5B 3DTOA 4ONRA 2VKHA 3KBTA 3OJAA 5L3EB 4IDZA 4C90A 5LCYA 4EGWA 4G2AA 4PFPA 2YOEA 2E9XB 3H37A 3RYFE 2ACZA 2EHOA 2ZM8A 3EAMA 4DBRA 3UFGA 4P0AA 4ISTA 5KX5E 2Q9QA 3Q5DA 1M62A 3CX6B 4L0RA 1KF6A 3SOLA 4X62T 3PHF1 1HG5A 5AQJB 3AE7A 2G0UA 2MOZA 3G06A 2WDRA 3Q9DA 4IT4A 4QX8B 1VRBA 3L39A 2W62A 2EHOC 4XAXB 4DUZT 5JRCA 4K0UA 3ZJ2A 4PNIA 2EHOD 2VQFT 3K3NA 3AE9A 1HX8A 2DCFA 3AA7B 2SPCA 2M6IA 3RIFA 3P4WA 2WAUA 3AE4A 4KX6A 4H9OC 3JAFA 3N2KE 3ZC1A 4EYYR 2DL1A 4TN7B 1DU2A 3VJZA 2C0SA 2LEHA 1H7CA 2W0GA 3AEGA 3ZYLA 3JAEA 4FJOA 3JCFA 4P0BA 1QLBA 4QH1A 1BR0A 1NAFA 1YXRA 2H88A 2CPTA 1OEDC 3O4XE 2WWVA 1WYBA 5H6RB 4DUYT 4JI8T 5FZTA 1M7KA 3KVBA 4X5TA 1LRZA 3X1DA 3MKDA 3MZKB 1R8IA 1NWMX 2VK9A 2WDQA 2X0HA 2X67A 4HFHA 4HGAA 5EK4A 5IYZE 3KVAA 3P4RA 3RLFF 3SWHA 4LF6T 4PJJA 3FBZA 4ZI3C 1YQ4A 2LJLA 3QOFA 1E2AA 3FZMB 2JQHA 3IHRA 4ZI3D 5ABFA 5LP6E 3UT5E 3OYZA 5L3CB 5JRCB 2N1GA 2JIWA 5JDHA 1U5PA 5JR9A 4ILBA 3K1SA 4IGUA 2UXCT 2PG8A 4X64T 3TLWA 4MLKA 3ZCJA 1KK7A 3AE8A 3EHZA 4ERRA 5HXHA 5JDQA 4U72A 4CXWA 2E9XA 2J47A 5ABEA 2DNXA 3VR8A 4X65T 1UGOA 2BKOA 4UELA 4ISSA 4B3ST 4LF5T 2MTCA 3PUYF 2V7LA 3PURA 4UVBB 4YSXA 1UURA 1UX5A 4IE4A 3K8PC 1N32T 2XQ6A 4ZEYA 4HWCA 4PAGA 4UV8B 2LLYA 2XQ9A 2V5DA 3AXJB 1J5ET 5L3GB 2ODUA 4AXPA 5J0ZA 2KXPB 5AQMB 2V6XA 3IEEA 3N9PA 4QH4A 2VL0A 3ZLIA 2J4GA 4DV3T 2YDRA 3C98B 2P9BA 3GN5B 3L8RA 2LSKA 3E0ZA 4I43B 4ZZCA 2QVAA 1OEDE 2E5VA 2D0TA 3CQCB 5EK3A 5AQKB 5J1GA 2V7KA 2A3DA 2KNDA 2YK0A 1W0BA 3M3ZB 3R6NA 4ASKA 3CKDA 2CHNA 4B3MT 2VURA 3LBXB 2E2AA 3OPCA 5HEJA 2XPKA 3PUGA 1X79A 4DMVA 4HEAA 3P4SA 3PDYA 4UVCB 5LHIB 5FXVA 4HFEA 4OYKA 1FMWA 4U7YA 3HI2A 2NP9A 4EXTA 4F8HA 4YTNA 2F4VT 1GQEA 2CBJA 2VVSA 4LF9T 3C4WA 5FVKA 3VRBA 3RIUA 2PFVA 3AA1B 3AVRA 4XZCA 4LFAT 3RQUA 2BG9C 5FL1A 1IJ5A 5AQLB 1I94T 1HNWT 2N9DA 3RQWA 1OEDA 3PU8A 4KI0F 2XQ8A 4HWHA 2XQ3A 5C8YE 2WWUA 5LA6E 3ZMTB 1W9RA 2BZBA 3N9QA 3WURA 4U31A 2BKPA 3UU6A 2XASB 2WBLA 2B1EA 3GA8A 1SUMB 2NW7A 4H9SE 1I6ZA 3KV6A 4PJLA 4E7SA 1KNZA 1W0AA 3ANWB 1J1JA 3KV9A 3UU5A 1MMNA 5IUXA 2BS2A 2YU1A 4IDQA 4DV6T 2L7NA 3RPUA 1UCUA 4IL9A 5FMNA 3F57A 4YTMA 4QXHB 3Q5XA 3UUNA 2W67A 3UUBA 2E5LT 3ZMSB 2HPLA 4AQFA 2V7IA 4CI1B 4B3TT 4EIWA 4IHJE 4IE6A 4X1YE 4DV7T 1OWAA 2CWYA 2MYSA 2V1DB 5AQGB 3VKHA 3UU4A 4O4HE 5HWXA 2H7OA 3QK6A 2YN6A 4ZHQE 3LSVA 5LG4A 1VCTA 3U78A 4HFBA 5EZYE 4BA9A 2PJQA 2XQ5A 5AQVB 3C51A 5FKYA 4JI5T 4WYVA 4BAYB 2NTYA 3N9MA 2YDQA 4JBWF 2IAKA 4ZI2D 5LGNB 4HE8A 4UIGA 1XDPA 5FNVE 4KHZF 4DNDA 2UUCT 1T98A 1G73A 3C50A 3CK6A 2WCAA 2LSYA 3HKDE 3P50A 4O2AE 2JPFA 3RH3A 5CGMA 3EDUA 4JLEA 1IAPA 5LGUB 5AQRB 1HTJF 2H3RA 4PK6A 4TV9E 5LNKA 1MIYA 2R6GF 4UXNB 2CLYC 3AE5A 2CLYB 4H63V 2E9XC 3PJAJ 4AQFC 5FXZA 2D0UA 4PW8A 3OBVE 2XQ4A 4NUUA 4GK5E 4Z90A 4CN4A 5IWAT 3RC8A 2AE9A 3NRXA 4DMWA 4YHJA 3RKOA 5FXXA 2J62A 2LSIA 4HN9A 2V6YB 1IBLT 3MJXA 3GWHA 3PTRB 4IE0A 2LOSA 5JVDE 2XSBA 2AXDS 3HA4A 1T8BA 2XAGB 3IF8B 1HS7A 4WBOA 1QSDA 2Q9QC 5FXWA 4B3RT 5JDMA 2BG9B 3KINB 1WYCA 1L0VA 1ZP0A 4O4IE 2YINA 4MBQA 5HEUA 2WP9A 5CJ5A 5JDGA 2IC9A 1NENA 3UUXB 4LFBT 1KNRA 4TZ4C 3PU3A 5J2UE 2KBBA 2BG9A 3UTKA 1LVFA 2L3LA 2D5UA 3D0TA 3HKCE 2VB6A 3HKBE 3W15B 3AECA 5FY0A 4EOZB 2LSJA 4OHFA 1W09A 3RC3A 3ZMUB 5KMGP 4YY3T 2WU5A 4HWDA 4COFA 1HFAA 4OK0A 3DYJA 3AAEB 2KVPA 3PUSA 1VCSA 3PJAA 3U3IA 2I59A 1CHUA 1HG2A 3UFEA 3ZYKA 4CZZB 4DV0T 4NXMT 5DQVA 2A2FX 3LK3B 2ACXA 4M1PA 3ZEFB 2YKSA 4YSZA 5LYJE 3FB2A 4X66T 4GOUA 2IHR1 3N2OA 2DLRA 3ZSTA 2YU2A 2FBWA 3N9NA 1E1HB 4LMLA 2ZM2A 3I9YA 3NZPA 3NVOA 2CMRA 3ONLC 5KDMC 2PBIA 3F2EA 3LG7A 4LF4T 4YHHT 2KMFA 3FYQA 4O4LE 4KUMB 5JR9B 4GKKT 2Y8DA 5H6QB 3MXZA 1BR2A 2WQYA 3PUZF 4J2CA 3RI5A 1HX1B 2LHNA 2PTFA 3UULA 3AE3A 5JQGE 1SA0E 4QX7B 2NW9A 4AQGA 3E08A 2Y6XA 2D2SA 3UQ4A 2X9XA 2DWKA 3OVUA 5BMVE 1D1BA 1Z8UA 4ZXLA 3ETUA 4I55E 5AQQB 1ZKEA 3PUQA 5L4HA 5LMNT 3ONXA 4JI2T 4GK0E 5ADXL 4KHPT 2CCQA 1ZV4X 2JJ9A 4MHCA 2XHEB 4TWDA 2FUPA 2FJDA 3A7MA 4AKLA 2FJBA 1HCIA 3BK9A 3GN5A 2LSGA 4IL4A 3JC6D 2HPJA 4P09A 4Z91A 4I0UA 3J9X1 4V1Av 5AQNB 4EZHA 2K9AA 2VKOA 2VKDA 3A5XA 1JNRA 4DV1T 2H7VC 3VRAA 5L3FB 2JMHA 3KDSE 2B76A 2WMNA 3IA3A 3WSCA 2XSAA 2VASA 3N9OA 4AKIA 1MMAA 2Z6EA 2WU2A 4AKRB 3NBXX 5CB4E 3AB3B 3CQGB 1UK5A 4PK5A 1D1CA 2WSSV 4WNKA 3QB5K 1ZHCA 3AE2A 4IDPA 5CA1E 1ZEEA 2ZM0A 3R84B 2Q9QB 1WFDA 2VL8A 4ZS3A 3C64A 4Q25A 3O1JA 3V5UA 5J2TE 1T72A 5L2LA 1KFYA 2VKJA 1O3XA 4E7ZA 3PUAA 3QB5A 4IDNA 5CA0E 3B13A 5HXEA 5LMUT 1XNRT 4HWFA 4JV5T 1XMOT 3P4QA 1S94A 3N5LA 2E8IA 5ABGA 3V5SA 2CXFA 2DI4A 2UXNB 3EDVA 4JI7T 1SJ7A 2VQET 3ZC0A 3ABVA 3UU8A 3OTOT 4GKJT 4G63A 5HXCA 2W2UA 2X0YA 4X1IE 5LB7B 2MPKA 4A5XA 4ILAA 4YSYA 2JQKA 5LG3A 1SE7A 2A72A 3BQIA 3PUXF 4IREA 5ABFB 3KV4A 4QWNB 4U74A 3WAKA 3RF1A 3I1AA 2LHRA 4UF0A 4ZZBA 2E9XD 1N34T 2VWAA 4O8SA 4A97A 2JQQA 3RX6A 3ZPOA 1D0ZA 3FZFB 3OKQA 4YXDA 1FIOA 5GONE 5AQFB 1BR4A 1HNZT 3RIAA 4DR4T 1YD8G 2BBJA 2KINB 2LRLA 1Y01A 1LVKA 5IHYA 4UVAB 3FXDB 4CI3B 3GMIA 4CXXA 3S4UA 3EI0A 4UF0B 4AQYT 2UUAT 2CEAA 2CHOA 5JR9C 1XNQT 4H9PC 3OYXA 3Q5EA 1SHZC 2IMLA 2WS3A 4IE5A 4ANJA 3LJCA 1JNZA 2MAWA 2W66A 5HAXA 4YLHA 2IUBA 4AKGA 2DHRA 2VVNA 4I50E 3FXEB 5LHHB 2LRKA 2XAHB 1XDOA 4CI2B 2KGXA 1OXZA 2XUEA 2Y48B 4UV9B 2BG9E 2CXLA 5HCJA 3ZT6A 3AA6B 2RP4A 5DJQC 4CN6A 2V8SV 1G8XA 1MMGA 3KBUA 2KWHA 4CQIA 3FZHB 2V5CA 2HH7A 4DO0A 1FMVA 2YEVC 5LJMA 2NOXA 3DP7A 5FYMA 2UU9T 4JYAT 3C4XA 3HKEE 3VHLA 4DIDB 4TNVA 2YDSA 2NWBA 4IE7A 1WRDA 4TWFA 4WBNE 4YJ2E 4YT0A 4A98A 2L9QA 4ZOLE 4BGOA 3ZN1B 4L5GA 2LKHA 3NWIA 5F3JA 2MBGA 3CWZB 3T1YT 4TX5A 5T1DA 2CA5A 2RA1A 5DQWA 1BR1A 4DVDA 3DJBA 3B57A 5LHGB 3PE0A 4Z8XA 2NTXA 4GYRA 3Q2MA 1YKEB 4WW0A 5C2TA 1X9BA 2BBHA 3Q5WA 4LFCT 2W4XA 4O2BE 2QGSA 4DR7T 3EUHA 4KMCA 4JI6T 2OV9A 2UXDT 2WZHA 4TUYE 4ZS2A 3C4ZA 2A9UA 3ZCIA 4GIWA 4KP3C 4LMKA 3ZYMA 3L3PA 2X9WA 2KSRA 2XAFB 4TV8E 2XAQB 4IIJE 4OX9T 2D9DA 1CUNA 4ZI2C 1YW0A 3F31A 4H9NC 5HWYA 5JDLA 3NZQA 3UUMA 4EB6E 3ZN0B 1YKHB 2FJEA 1IZNB 4QH5A 1WLXA 2XJ7A 5HEGA 4K0KT 3AAAB 2J1DG 2W61A 3PUWF 4ILCA 4DR3T 4XBFB 4QHOA 3M1CA 3AE1A 3NKZA 4DR1T 3EABA 1UX4A 4FI5A 1UUSA 4BJMA 2L10A 2KLQA 5ABHA 2CE7A 2NR4A 2UXXB 3P8CD 5LBMA 1SJ8A 4WZXA 2ES0A 1XZYA 4DV2T 4H9QC 3E22E 3ONJA 3VR9A 3T1HT 4JI3T 4ILUA 3L09A 3FHNA 2FJAA 2EHOB 3I0QA 2Q9QD 4U7IA 2KZ7B 3QUJA 1MIWA 1QUUA 5AQIB 5AQTB 2K48A 3ZKRA 2M67A 3RYIE 2WZIA 3M65A 2LE8A 3HR0A 3MA9A 4UR9A 2WB5A 1MNDA 3I9WA 2HHHT 1WR6A 2BVMA 4AI6A 4AIUA 4JEUB 2XAJB 3AA0B 4DR6T 2UUBT 2CWOA 2I0MA 1IJ6A 5AQOB 5L3BB 5JDFA 1Y64B 2N2NA 2X66A 3PUVF 2LM2A 5AFUL 3O9XA 4W8PA 3BQLA 2ZM6T 1J5WA 3HL6A 3CX8B 3SS1A 5L4EA 4QXCB 4LF7T 5TAOA 2BS3A 5M4YA 2BKNA 2LOPA 1D1AA 3AEAA 2WM9A 5AQSB 3TLVA 1XMQT 3FBLA 5E0OA 5CFBA 5JTGA 1WCRA 3AEFA 3I0OA 1B7TA 3CIRA 2XQAA 2CBIA 5DABA 2XM2A 2X9YA 1S35A 3CX7B 1YQ3A 3LDQB 1NEKA 4ECGA 3MACA 2IC6A 4X1KE 2V6YA 4YJ3E 5HEOA 3ETVA 4TWHA 3N9LA 2V7MA 4U2YA 5HXSA 1EZ3A 4HFIA 1XWMA 3RKGA 5LJNA 2I6HA 4JUYA 3TLTA 2JRKA 5BR8T 5JDNA 3J7Yq 2K24A 2X0CA 2LQUA 3RGLA 5FP3A 4MALA 4AISA 5C3JA 3ZSSA 5AQUB 4EEBA 1T7SA 3RIUC 3UU3A 2KWIB 4HWIB 5HXRA 4HKAA 2WY2A 3LK2B 4QKNA 1HF8A 3FZKB 2H89A 3BQKA 2QA7A 3H3MA 4CN1A 1IBMT 4BJNA 2XM1A 4X20E 2M6BA 1KNPA 4PK4A 4CXYA 3JC6C 3AE6A 2C5IT 3ZT5A 3AY5A 2IDOB 2C5KT 2BVLA 2XQ7A 5FY7A 4TNWA 3CQXC 4N78D 5FY1A 3RRWA 5EK2A 5L3DB 5LXTE 4HFCA 4YFSA 4PJMA 3LK42 3N2GE 5AQPB 5KXJA 4F7GB 3LBXA 4JI1T 1N33T 2ZMAA 3AT7A 2CRBA 3AAIA 3KV5A 2W00A 4UEMA 2NW8A 1US7B 3CVRA 2MTQA 4A56A 5HYAA 4HFDA 4LF8T 3PF0A 1FEWA 3RYCE 2RPAA 3JADA 1VOMA 4PFOA 2XTLA 4OYJA 3CPZA 4NXNT 3WAJA 1IBKT 3ANWA 4U3CA 3O1IA 5LGTB 1WR0A 4NUVA 3O1HA 4F6RC 2X9HA 3RHWA 3H3AA 5F5WA 1N36T 1V9DA 5ETWA 4DBQA 1U4QA 4EEDA 2JQ9A 4U33A 4DV5T 4QXBB 1HNXT 4H63H 4HFVA 5L47A 4NIQA 3LFMA 3RRCA 4HTEA 4C91A 1MIVA 3TLSA 4JI4T 2KT9A 3AVSA 3K3OA 4L9IA 2K5BB 1OEDB 2C5JA 4H9RC 3TLUA 5JREA 3A8YC 3AEEA 3K3QC 2L8KA 2UXBT 3P7IA 5HEHA 3ZMZB 2QRXA 3ESLA 3SRZA 2X68A 4EV6A 4AKHA 4EZ4A 4MFRA 2LT3A 3QC9A 1Z0PA 3WI3A 4DR5T 2HN1A 3RYHE 3AEBA 2BS4A 1MMDA 3FZLB 4P1NA 2X0LB 1D0YA 3ZT7A 4B6XA 4KBMB 4NPPA 2XZEA 3P4PA 1AJ3A 2XQYA 3ZMVB 3SFEA 3UQ7A 5LBQB 4JEHB 4DR2T 3VKGA 2IIUA 5JH7E 1D0XA 2V7JA 4PJNA 2JMKA 4U2ZA 3CMLA 2HN2A 4OFZA 2QYWA 5FVLA 4EYUA 1KEYA 4EAHA 5AQHB 5FL0A 1FJGT 2WMOA 3VU7H 1HR0T 3QNUA 4ADZA 4JI0T 3T8OA 2LKGA 3EVYA 3KFWX 2WDVA 2ODVA 4YTPA 5A1LA 3PV0F 4DV4T 1LKXA 4LMJA 2OLTA 3IBPA 2BDEA 2XY8B 2W63A
chains in the Genus database with same CATH topology
2LM9A 2V26A 4I4TE 2X51A 4O4JE 2CXDA 1MNEA 2OA5A 3TKLB 2GK9A 2CM0A 2ZLYA 2DWGA 5LOVE 3NRYA 5F8PA 3MK7C 3ZJ1A 4ZI7E 4GYSA 2IW5B 3DTOA 4ONRA 2VKHA 3KBTA 3OJAA 4IDZA 5LCYA 4G2AA 4PFPA 2E9XB 3H37A 3RYFE 2EHOA 2ZM8A 4DBRA 4P0AA 4ISTA 5KX5E 2Q9QA 3CX6B 4L0RA 3SOLA 3PHF1 1HG5A 2G0UA 2MOZA 3Q9DA 4QX8B 1VRBA 2W62A 2EHOC 4XAXB 5JRCA 4K0UA 3ZJ2A 4PNIA 2EHOD 3K3NA 1HX8A 2DCFA 3AA7B 2SPCA 2WAUA 4H9OC 3ZC1A 3N2KE 4EYYR 4TN7B 3VJZA 2C0SA 2LEHA 1H7CA 2W0GA 3ZYLA 4FJOA 4P0BA 1BR0A 1NAFA 3O4XE 1WYBA 5H6RB 3KVBA 1LRZA 3MKDA 3MZKB 1NWMX 2VK9A 2X67A 5IYZE 4HGAA 5EK4A 3SWHA 3KVAA 4PJJA 3FBZA 4ZI3C 2LJLA 3IHRA 5LP6E 5JRCB 3UT5E 3OYZA 5L3CB 2N1GA 5JDHA 1U5PA 5JR9A 4IGUA 2PG8A 4MLKA 3ZCJA 1KK7A 4ERRA 5HXHA 5JDQA 4U72A 4CXWA 2E9XA 2DNXA 2MTCA 4UELA 4ISSA 2V7LA 3PURA 4UVBB 4IE4A 1UX5A 3K8PC 4PAGA 4UV8B 5L3GB 2ODUA 4AXPA 2KXPB 3IEEA 3N9PA 3ZLIA 3C98B 2P9BA 3GN5B 4I43B 2LSKA 3E0ZA 5EK3A 2D0TA 3CQCB 5J1GA 2V7KA 2A3DA 2KNDA 2YK0A 3R6NA 4ASKA 3CKDA 3LBXB 3PUGA 1X79A 4DMVA 4HEAA 4UVCB 3PDYA 5LHIB 5FXVA 4OYKA 1FMWA 3HI2A 2NP9A 4EXTA 3C4WA 2PFVA 3AA1B 3AVRA 4XZCA 1IJ5A 2N9DA 3PU8A 5C8YE 2WWUA 5LA6E 3ZMTB 3WURA 2BZBA 3N9QA 2XASB 2WBLA 2B1EA 3GA8A 2NW7A 4H9SE 3KV6A 4PJLA 4E7SA 1KNZA 3ANWB 3KV9A 1MMNA 2YU1A 3RPUA 1UCUA 5FMNA 3F57A 4QXHB 3Q5XA 3UUNA 3ZMSB 2HPLA 4AQFA 2V7IA 4CI1B 4EIWA 4IHJE 4IE6A 4X1YE 1OWAA 2CWYA 2MYSA 2V1DB 3VKHA 4O4HE 5HWXA 2H7OA 3QK6A 4ZHQE 5LG4A 3U78A 4BA9A 5EZYE 2PJQA 3C51A 4BAYB 2NTYA 3N9MA 5LGNB 2IAKA 4ZI2D 4HE8A 4UIGA 5FNVE 4DNDA 1T98A 1G73A 3C50A 3HKDE 3RH3A 2LSYA 3WAJA 4O2AE 2JPFA 5LGUB 3EDUA 4JLEA 1IAPA 1HTJF 2H3RA 4PK6A 4TV9E 5LNKA 1MIYA 4UXNB 2CLYC 2CLYB 4H63V 2E9XC 4AQFC 5FXZA 2D0UA 4PW8A 3OBVE 4NUUA 4GK5E 3RC8A 3NRXA 4DMWA 4YHJA 3RKOA 5FXXA 2LSIA 4HN9A 3MJXA 3GWHA 3PTRB 4IE0A 2LOSA 5JVDE 3HA4A 3IF8B 2XAGB 1HS7A 4WBOA 1QSDA 2Q9QC 5FXWA 5JDMA 3KINB 1WYCA 4O4IE 2YINA 4MBQA 5JDGA 2IC9A 3UUXB 4TZ4C 5J2UE 3PU3A 3UTKA 1LVFA 2L3LA 2D5UA 3D0TA 3HKCE 2VB6A 3HKBE 3W15B 5FY0A 4EOZB 2LSJA 4OHFA 3RC3A 3ZMUB 5KMGP 1HFAA 4OK0A 3AAEB 3PUSA 3U3IA 2I59A 1HG2A 3UFEA 3ZYKA 4CZZB 5DQVA 2A2FX 3LK3B 2ACXA 4M1PA 3ZEFB 5LYJE 3FB2A 4GOUA 3N2OA 2DLRA 2YU2A 3N9NA 1E1HB 2ZM2A 3I9YA 3NZPA 2CMRA 5KDMC 2PBIA 3F2EA 3LG7A 2KMFA 4O4LE 4KUMB 5JR9B 2Y8DA 5H6QB 3MXZA 1BR2A 4J2CA 3UULA 2LHNA 5JQGE 1SA0E 4QX7B 2NW9A 4AQGA 3E08A 2Y6XA 2D2SA 2X9XA 2DWKA 5BMVE 1D1BA 3ETUA 4I55E 1ZKEA 3PUQA 3ONXA 4GK0E 5ADXL 2CCQA 1ZV4X 2JJ9A 4MHCA 2XHEB 4AKLA 1HCIA 3BK9A 3GN5A 2LSGA 4P09A 3JC6D 2HPJA 4EZHA 3J9X1 1AJ3A 4V1Av 2K9AA 2VKOA 2VKDA 3A5XA 2H7VC 5L3FB 2JMHA 3KDSE 2WMNA 3WSCA 2VASA 3N9OA 4AKIA 1MMAA 2Z6EA 4AKRB 3NBXX 5CB4E 3AB3B 3CQGB 4PK5A 1D1CA 2WSSV 4WNKA 1ZHCA 5CA1E 1ZEEA 2ZM0A 3R84B 2Q9QB 2VL8A 4ZS3A 3V5UA 3C64A 3O1JA 5J2TE 5L2LA 2VKJA 4E7ZA 1O3XA 5CA0E 3PUAA 3B13A 5HXEA 1S94A 3N5LA 2E8IA 3V5SA 2CXFA 2DI4A 2UXNB 3EDVA 3ZC0A 4G63A 5HXCA 4X1IE 2A72A 3BQIA 3KV4A 4QWNB 4U74A 3WAKA 3I1AA 2LHRA 4UF0A 2E9XD 2VWAA 4O8SA 2JQQA 3RX6A 3ZPOA 1D0ZA 3OKQA 1FIOA 5GONE 1BR4A 1YD8G 2KINB 4CI3B 4ZI3D 1LVKA 5IHYA 4UVAB 3FXDB 4CXXA 3GMIA 3S4UA 4UF0B 2CEAA 5JR9C 4H9PC 3OYXA 1SHZC 4IE5A 4ANJA 3LJCA 5HAXA 4YLHA 4AKGA 2DHRA 4I50E 3FXEB 5LHHB 2XAHB 4CI2B 1OXZA 2XUEA 2Y48B 4UV9B 2CXLA 3AA6B 2RP4A 5DJQC 4C90A 3KBUA 1G8XA 1MMGA 4CQIA 2KWHA 4DO0A 5L3EB 2HH7A 1FMVA 2YEVC 2NOXA 3DP7A 5FYMA 3C4XA 3HKEE 3VHLA 2NWBA 4IE7A 1WRDA 4WBNE 4YJ2E 2L9QA 4ZOLE 4BGOA 3ZN1B 4L5GA 5F3JA 2MBGA 3CWZB 4TX5A 5T1DA 2CA5A 2RA1A 5DQWA 1BR1A 4DVDA 3DJBA 3B57A 5LHGB 3PE0A 4Z8XA 2NTXA 4GYRA 3Q2MA 1YKEB 4WW0A 3Q5WA 4O2BE 2QGSA 3EUHA 4KMCA 4TUYE 4ZS2A 3C4ZA 3ZCIA 4GIWA 4KP3C 3ZYMA 3L3PA 2X9WA 2XAFB 4TV8E 2XAQB 4IIJE 1CUNA 4ZI2C 1YW0A 3F31A 4H9NC 5HWYA 5JDLA 3NZQA 3UUMA 4EB6E 3ZN0B 1YKHB 1IZNB 1WLXA 3AAAB 2J1DG 2W61A 4XBFB 3M1CA 4QHOA 1UX4A 4FI5A 4BJMA 2KLQA 2CE7A 3P8CD 2UXXB 5LBMA 2ES0A 4H9QC 3E22E 4ILUA 3L09A 3FHNA 2EHOB 3I0QA 2Q9QD 2KZ7B 3QUJA 1MIWA 1QUUA 2K48A 2M67A 3RYIE 3M65A 3MA9A 2LE8A 3HR0A 1MNDA 3I9WA 1WR6A 2BVMA 4AI6A 4JEUB 2XAJB 3AA0B 2CWOA 5L3BB 1IJ6A 5JDFA 1Y64B 2N2NA 2X66A 5AFUL 3O9XA 3BQLA 3HL6A 3CX8B 3SS1A 4QXCB 5TAOA 5M4YA 2LOPA 1D1AA 2WM9A 3FBLA 5E0OA 3I0OA 1B7TA 5DABA 2X9YA 1S35A 3CX7B 4ECGA 3MACA 2IC6A 4X1KE 4YJ3E 3ETVA 5HXSA 3N9LA 2V7MA 1EZ3A 5LJNA 4JUYA 3J7Yq 2JRKA 5JDNA 2K24A 2LQUA 5FP3A 4MALA 2KWIB 5HXRA 4HKAA 3LK2B 4QKNA 1HF8A 3BQKA 2QA7A 4BJNA 4X20E 4PK4A 4CXYA 3JC6C 2C5IT 5LJMA 2C5KT 2BVLA 5EK2A 5FY7A 3RRWA 3CQXC 4N78D 5FY1A 5L3DB 5LXTE 4YFSA 4PJMA 3LK42 3N2GE 3LBXA 2ZMAA 3AT7A 3AAIA 3KV5A 2W00A 4UEMA 2NW8A 1US7B 3CVRA 2MTQA 4A56A 5HYAA 3PF0A 1FEWA 3RYCE 1VOMA 4PFOA 2XTLA 4OYJA 3CPZA 3ANWA 3O1IA 5LGTB 4NUVA 3O1HA 4F6RC 2X9HA 3H3AA 1V9DA 5ETWA 4DBQA 1U4QA 4QXBB 4H63H 4HFVA 3RRCA 3LFMA 4C91A 4HTEA 1MIVA 2KT9A 3AVSA 3K3OA 4L9IA 2K5BB 2C5JA 4H9RC 5JREA 3K3QC 2L8KA 3P7IA 3ZMZB 3ESLA 3SRZA 2X68A 4AKHA 4EZ4A 4MFRA 2LT3A 3QC9A 1Z0PA 3WI3A 3RYHE 1MMDA 2X0LB 1D0YA 4B6XA 4KBMB 2XQYA 3ZMVB 3VKGA 5LBQB 4JEHB 5JH7E 1D0XA 2V7JA 4PJNA 2JMKA 3CMLA 4OFZA 4EYUA 4EAHA 2WMOA 3VU7H 4ADZA 3T8OA 3KFWX 3EVYA 2ODVA 5A1LA 1LKXA 3IBPA 2BDEA 2W63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HXC A;  5HXR A;  5HXH A;  3V5S A;  5JDL A;  5JDM A;  5JDQ A;  5JDH A;  5JDN A;  5HYA A;  5HXE A;  5JDG A;  5JDF A;  5HXS A;  5HWY A;  5HWX A;  3V5U A; 
#chains in the Genus database with same CATH topology
 2LM9 A;  2V26 A;  3B5M A;  3AED A;  3AXJ A;  2X51 A;  4I4T E;  2CXD A;  4O4J E;  3SFD A;  1MNE A;  2OA5 A;  3TKL B;  1ZOY A;  2GK9 A;  2CM0 A;  2ZLY A;  2DWG A;  5LOV E;  3NRY A;  5HCM A;  5F8P A;  2K3W A;  1E7P A;  4IDO A;  3MK7 C;  3ZJ1 A;  4ZI7 E;  4GYS A;  2IW5 B;  3DTO A;  4ONR A;  2VKH A;  3KBT A;  3OJA A;  5L3E B;  4IDZ A;  4C90 A;  5LCY A;  4EGW A;  4G2A A;  4PFP A;  2YOE A;  2E9X B;  3H37 A;  3RYF E;  2ACZ A;  2EHO A;  2ZM8 A;  3EAM A;  4DBR A;  3UFG A;  4P0A A;  4IST A;  5KX5 E;  2Q9Q A;  3Q5D A;  1M62 A;  3CX6 B;  4L0R A;  1KF6 A;  3SOL A;  4X62 T;  3PHF 1;  1HG5 A;  5AQJ B;  3AE7 A;  2G0U A;  2MOZ A;  3G06 A;  2WDR A;  3Q9D A;  4IT4 A;  4QX8 B;  1VRB A;  3L39 A;  2W62 A;  2EHO C;  4XAX B;  4DUZ T;  5JRC A;  4K0U A;  3ZJ2 A;  4PNI A;  2EHO D;  2VQF T;  3K3N A;  3AE9 A;  1HX8 A;  2DCF A;  3AA7 B;  2SPC A;  2M6I A;  3RIF A;  3P4W A;  2WAU A;  3AE4 A;  4KX6 A;  4H9O C;  3JAF A;  3N2K E;  3ZC1 A;  4EYY R;  2DL1 A;  4TN7 B;  1DU2 A;  3VJZ A;  2C0S A;  2LEH A;  1H7C A;  2W0G A;  3AEG A;  3ZYL A;  3JAE A;  4FJO A;  3JCF A;  4P0B A;  1QLB A;  4QH1 A;  1BR0 A;  1NAF A;  1YXR A;  2H88 A;  2CPT A;  1OED C;  3O4X E;  2WWV A;  1WYB A;  5H6R B;  4DUY T;  4JI8 T;  5FZT A;  1M7K A;  3KVB A;  4X5T A;  1LRZ A;  3X1D A;  3MKD A;  3MZK B;  1R8I A;  1NWM X;  2VK9 A;  2WDQ A;  2X0H A;  2X67 A;  4HFH A;  4HGA A;  5EK4 A;  5IYZ E;  3KVA A;  3P4R A;  3RLF F;  3SWH A;  4LF6 T;  4PJJ A;  3FBZ A;  4ZI3 C;  1YQ4 A;  2LJL A;  3QOF A;  1E2A A;  3FZM B;  2JQH A;  3IHR A;  4ZI3 D;  5ABF A;  5LP6 E;  3UT5 E;  3OYZ A;  5L3C B;  5JRC B;  2N1G A;  2JIW A;  5JDH A;  1U5P A;  5JR9 A;  4ILB A;  3K1S A;  4IGU A;  2UXC T;  2PG8 A;  4X64 T;  3TLW A;  4MLK A;  3ZCJ A;  1KK7 A;  3AE8 A;  3EHZ A;  4ERR A;  5HXH A;  5JDQ A;  4U72 A;  4CXW A;  2E9X A;  2J47 A;  5ABE A;  2DNX A;  3VR8 A;  4X65 T;  1UGO A;  2BKO A;  4UEL A;  4ISS A;  4B3S T;  4LF5 T;  2MTC A;  3PUY F;  2V7L A;  3PUR A;  4UVB B;  4YSX A;  1UUR A;  1UX5 A;  4IE4 A;  3K8P C;  1N32 T;  2XQ6 A;  4ZEY A;  4HWC A;  4PAG A;  4UV8 B;  2LLY A;  2XQ9 A;  2V5D A;  3AXJ B;  1J5E T;  5L3G B;  2ODU A;  4AXP A;  5J0Z A;  2KXP B;  5AQM B;  2V6X A;  3IEE A;  3N9P A;  4QH4 A;  2VL0 A;  3ZLI A;  2J4G A;  4DV3 T;  2YDR A;  3C98 B;  2P9B A;  3GN5 B;  3L8R A;  2LSK A;  3E0Z A;  4I43 B;  4ZZC A;  2QVA A;  1OED E;  2E5V A;  2D0T A;  3CQC B;  5EK3 A;  5AQK B;  5J1G A;  2V7K A;  2A3D A;  2KND A;  2YK0 A;  1W0B A;  3M3Z B;  3R6N A;  4ASK A;  3CKD A;  2CHN A;  4B3M T;  2VUR A;  3LBX B;  2E2A A;  3OPC A;  5HEJ A;  2XPK A;  3PUG A;  1X79 A;  4DMV A;  4HEA A;  3P4S A;  3PDY A;  4UVC B;  5LHI B;  5FXV A;  4HFE A;  4OYK A;  1FMW A;  4U7Y A;  3HI2 A;  2NP9 A;  4EXT A;  4F8H A;  4YTN A;  2F4V T;  1GQE A;  2CBJ A;  2VVS A;  4LF9 T;  3C4W A;  5FVK A;  3VRB A;  3RIU A;  2PFV A;  3AA1 B;  3AVR A;  4XZC A;  4LFA T;  3RQU A;  2BG9 C;  5FL1 A;  1IJ5 A;  5AQL B;  1I94 T;  1HNW T;  2N9D A;  3RQW A;  1OED A;  3PU8 A;  4KI0 F;  2XQ8 A;  4HWH A;  2XQ3 A;  5C8Y E;  2WWU A;  5LA6 E;  3ZMT B;  1W9R A;  2BZB A;  3N9Q A;  3WUR A;  4U31 A;  2BKP A;  3UU6 A;  2XAS B;  2WBL A;  2B1E A;  3GA8 A;  1SUM B;  2NW7 A;  4H9S E;  1I6Z A;  3KV6 A;  4PJL A;  4E7S A;  1KNZ A;  1W0A A;  3ANW B;  1J1J A;  3KV9 A;  3UU5 A;  1MMN A;  5IUX A;  2BS2 A;  2YU1 A;  4IDQ A;  4DV6 T;  2L7N A;  3RPU A;  1UCU A;  4IL9 A;  5FMN A;  3F57 A;  4YTM A;  4QXH B;  3Q5X A;  3UUN A;  2W67 A;  3UUB A;  2E5L T;  3ZMS B;  2HPL A;  4AQF A;  2V7I A;  4CI1 B;  4B3T T;  4EIW A;  4IHJ E;  4IE6 A;  4X1Y E;  4DV7 T;  1OWA A;  2CWY A;  2MYS A;  2V1D B;  5AQG B;  3VKH A;  3UU4 A;  4O4H E;  5HWX A;  2H7O A;  3QK6 A;  2YN6 A;  4ZHQ E;  3LSV A;  5LG4 A;  1VCT A;  3U78 A;  4HFB A;  5EZY E;  4BA9 A;  2PJQ A;  2XQ5 A;  5AQV B;  3C51 A;  5FKY A;  4JI5 T;  4WYV A;  4BAY B;  2NTY A;  3N9M A;  2YDQ A;  4JBW F;  2IAK A;  4ZI2 D;  5LGN B;  4HE8 A;  4UIG A;  1XDP A;  5FNV E;  4KHZ F;  4DND A;  2UUC T;  1T98 A;  1G73 A;  3C50 A;  3CK6 A;  2WCA A;  2LSY A;  3HKD E;  3P50 A;  4O2A E;  2JPF A;  3RH3 A;  5CGM A;  3EDU A;  4JLE A;  1IAP A;  5LGU B;  5AQR B;  1HTJ F;  2H3R A;  4PK6 A;  4TV9 E;  5LNK A;  1MIY A;  2R6G F;  4UXN B;  2CLY C;  3AE5 A;  2CLY B;  4H63 V;  2E9X C;  3PJA J;  4AQF C;  5FXZ A;  2D0U A;  4PW8 A;  3OBV E;  2XQ4 A;  4NUU A;  4GK5 E;  4Z90 A;  4CN4 A;  5IWA T;  3RC8 A;  2AE9 A;  3NRX A;  4DMW A;  4YHJ A;  3RKO A;  5FXX A;  2J62 A;  2LSI A;  4HN9 A;  2V6Y B;  1IBL T;  3MJX A;  3GWH A;  3PTR B;  4IE0 A;  2LOS A;  5JVD E;  2XSB A;  2AXD S;  3HA4 A;  1T8B A;  2XAG B;  3IF8 B;  1HS7 A;  4WBO A;  1QSD A;  2Q9Q C;  5FXW A;  4B3R T;  5JDM A;  2BG9 B;  3KIN B;  1WYC A;  1L0V A;  1ZP0 A;  4O4I E;  2YIN A;  4MBQ A;  5HEU A;  2WP9 A;  5CJ5 A;  5JDG A;  2IC9 A;  1NEN A;  3UUX B;  4LFB T;  1KNR A;  4TZ4 C;  3PU3 A;  5J2U E;  2KBB A;  2BG9 A;  3UTK A;  1LVF A;  2L3L A;  2D5U A;  3D0T A;  3HKC E;  2VB6 A;  3HKB E;  3W15 B;  3AEC A;  5FY0 A;  4EOZ B;  2LSJ A;  4OHF A;  1W09 A;  3RC3 A;  3ZMU B;  5KMG P;  4YY3 T;  2WU5 A;  4HWD A;  4COF A;  1HFA A;  4OK0 A;  3DYJ A;  3AAE B;  2KVP A;  3PUS A;  1VCS A;  3PJA A;  3U3I A;  2I59 A;  1CHU A;  1HG2 A;  3UFE A;  3ZYK A;  4CZZ B;  4DV0 T;  4NXM T;  5DQV A;  2A2F X;  3LK3 B;  2ACX A;  4M1P A;  3ZEF B;  2YKS A;  4YSZ A;  5LYJ E;  3FB2 A;  4X66 T;  4GOU A;  2IHR 1;  3N2O A;  2DLR A;  3ZST A;  2YU2 A;  2FBW A;  3N9N A;  1E1H B;  4LML A;  2ZM2 A;  3I9Y A;  3NZP A;  3NVO A;  2CMR A;  3ONL C;  5KDM C;  2PBI A;  3F2E A;  3LG7 A;  4LF4 T;  4YHH T;  2KMF A;  3FYQ A;  4O4L E;  4KUM B;  5JR9 B;  4GKK T;  2Y8D A;  5H6Q B;  3MXZ A;  1BR2 A;  2WQY A;  3PUZ F;  4J2C A;  3RI5 A;  1HX1 B;  2LHN A;  2PTF A;  3UUL A;  3AE3 A;  5JQG E;  1SA0 E;  4QX7 B;  2NW9 A;  4AQG A;  3E08 A;  2Y6X A;  2D2S A;  3UQ4 A;  2X9X A;  2DWK A;  3OVU A;  5BMV E;  1D1B A;  1Z8U A;  4ZXL A;  3ETU A;  4I55 E;  5AQQ B;  1ZKE A;  3PUQ A;  5L4H A;  5LMN T;  3ONX A;  4JI2 T;  4GK0 E;  5ADX L;  4KHP T;  2CCQ A;  1ZV4 X;  2JJ9 A;  4MHC A;  2XHE B;  4TWD A;  2FUP A;  2FJD A;  3A7M A;  4AKL A;  2FJB A;  1HCI A;  3BK9 A;  3GN5 A;  2LSG A;  4IL4 A;  3JC6 D;  2HPJ A;  4P09 A;  4Z91 A;  4I0U A;  3J9X 1;  4V1A v;  5AQN B;  4EZH A;  2K9A A;  2VKO A;  2VKD A;  3A5X A;  1JNR A;  4DV1 T;  2H7V C;  3VRA A;  5L3F B;  2JMH A;  3KDS E;  2B76 A;  2WMN A;  3IA3 A;  3WSC A;  2XSA A;  2VAS A;  3N9O A;  4AKI A;  1MMA A;  2Z6E A;  2WU2 A;  4AKR B;  3NBX X;  5CB4 E;  3AB3 B;  3CQG B;  1UK5 A;  4PK5 A;  1D1C A;  2WSS V;  4WNK A;  3QB5 K;  1ZHC A;  3AE2 A;  4IDP A;  5CA1 E;  1ZEE A;  2ZM0 A;  3R84 B;  2Q9Q B;  1WFD A;  2VL8 A;  4ZS3 A;  3C64 A;  4Q25 A;  3O1J A;  3V5U A;  5J2T E;  1T72 A;  5L2L A;  1KFY A;  2VKJ A;  1O3X A;  4E7Z A;  3PUA A;  3QB5 A;  4IDN A;  5CA0 E;  3B13 A;  5HXE A;  5LMU T;  1XNR T;  4HWF A;  4JV5 T;  1XMO T;  3P4Q A;  1S94 A;  3N5L A;  2E8I A;  5ABG A;  3V5S A;  2CXF A;  2DI4 A;  2UXN B;  3EDV A;  4JI7 T;  1SJ7 A;  2VQE T;  3ZC0 A;  3ABV A;  3UU8 A;  3OTO T;  4GKJ T;  4G63 A;  5HXC A;  2W2U A;  2X0Y A;  4X1I E;  5LB7 B;  2MPK A;  4A5X A;  4ILA A;  4YSY A;  2JQK A;  5LG3 A;  1SE7 A;  2A72 A;  3BQI A;  3PUX F;  4IRE A;  5ABF B;  3KV4 A;  4QWN B;  4U74 A;  3WAK A;  3RF1 A;  3I1A A;  2LHR A;  4UF0 A;  4ZZB A;  2E9X D;  1N34 T;  2VWA A;  4O8S A;  4A97 A;  2JQQ A;  3RX6 A;  3ZPO A;  1D0Z A;  3FZF B;  3OKQ A;  4YXD A;  1FIO A;  5GON E;  5AQF B;  1BR4 A;  1HNZ T;  3RIA A;  4DR4 T;  1YD8 G;  2BBJ A;  2KIN B;  2LRL A;  1Y01 A;  1LVK A;  5IHY A;  4UVA B;  3FXD B;  4CI3 B;  3GMI A;  4CXX A;  3S4U A;  3EI0 A;  4UF0 B;  4AQY T;  2UUA T;  2CEA A;  2CHO A;  5JR9 C;  1XNQ T;  4H9P C;  3OYX A;  3Q5E A;  1SHZ C;  2IML A;  2WS3 A;  4IE5 A;  4ANJ A;  3LJC A;  1JNZ A;  2MAW A;  2W66 A;  5HAX A;  4YLH A;  2IUB A;  4AKG A;  2DHR A;  2VVN A;  4I50 E;  3FXE B;  5LHH B;  2LRK A;  2XAH B;  1XDO A;  4CI2 B;  2KGX A;  1OXZ A;  2XUE A;  2Y48 B;  4UV9 B;  2BG9 E;  2CXL A;  5HCJ A;  3ZT6 A;  3AA6 B;  2RP4 A;  5DJQ C;  4CN6 A;  2V8S V;  1G8X A;  1MMG A;  3KBU A;  2KWH A;  4CQI A;  3FZH B;  2V5C A;  2HH7 A;  4DO0 A;  1FMV A;  2YEV C;  5LJM A;  2NOX A;  3DP7 A;  5FYM A;  2UU9 T;  4JYA T;  3C4X A;  3HKE E;  3VHL A;  4DID B;  4TNV A;  2YDS A;  2NWB A;  4IE7 A;  1WRD A;  4TWF A;  4WBN E;  4YJ2 E;  4YT0 A;  4A98 A;  2L9Q A;  4ZOL E;  4BGO A;  3ZN1 B;  4L5G A;  2LKH A;  3NWI A;  5F3J A;  2MBG A;  3CWZ B;  3T1Y T;  4TX5 A;  5T1D A;  2CA5 A;  2RA1 A;  5DQW A;  1BR1 A;  4DVD A;  3DJB A;  3B57 A;  5LHG B;  3PE0 A;  4Z8X A;  2NTX A;  4GYR A;  3Q2M A;  1YKE B;  4WW0 A;  5C2T A;  1X9B A;  2BBH A;  3Q5W A;  4LFC T;  2W4X A;  4O2B E;  2QGS A;  4DR7 T;  3EUH A;  4KMC A;  4JI6 T;  2OV9 A;  2UXD T;  2WZH A;  4TUY E;  4ZS2 A;  3C4Z A;  2A9U A;  3ZCI A;  4GIW A;  4KP3 C;  4LMK A;  3ZYM A;  3L3P A;  2X9W A;  2KSR A;  2XAF B;  4TV8 E;  2XAQ B;  4IIJ E;  4OX9 T;  2D9D A;  1CUN A;  4ZI2 C;  1YW0 A;  3F31 A;  4H9N C;  5HWY A;  5JDL A;  3NZQ A;  3UUM A;  4EB6 E;  3ZN0 B;  1YKH B;  2FJE A;  1IZN B;  4QH5 A;  1WLX A;  2XJ7 A;  5HEG A;  4K0K T;  3AAA B;  2J1D G;  2W61 A;  3PUW F;  4ILC A;  4DR3 T;  4XBF B;  4QHO A;  3M1C A;  3AE1 A;  3NKZ A;  4DR1 T;  3EAB A;  1UX4 A;  4FI5 A;  1UUS A;  4BJM A;  2L10 A;  2KLQ A;  5ABH A;  2CE7 A;  2NR4 A;  2UXX B;  3P8C D;  5LBM A;  1SJ8 A;  4WZX A;  2ES0 A;  1XZY A;  4DV2 T;  4H9Q C;  3E22 E;  3ONJ A;  3VR9 A;  3T1H T;  4JI3 T;  4ILU A;  3L09 A;  3FHN A;  2FJA A;  2EHO B;  3I0Q A;  2Q9Q D;  4U7I A;  2KZ7 B;  3QUJ A;  1MIW A;  1QUU A;  5AQI B;  5AQT B;  2K48 A;  3ZKR A;  2M67 A;  3RYI E;  2WZI A;  3M65 A;  2LE8 A;  3HR0 A;  3MA9 A;  4UR9 A;  2WB5 A;  1MND A;  3I9W A;  2HHH T;  1WR6 A;  2BVM A;  4AI6 A;  4AIU A;  4JEU B;  2XAJ B;  3AA0 B;  4DR6 T;  2UUB T;  2CWO A;  2I0M A;  1IJ6 A;  5AQO B;  5L3B B;  5JDF A;  1Y64 B;  2N2N A;  2X66 A;  3PUV F;  2LM2 A;  5AFU L;  3O9X A;  4W8P A;  3BQL A;  2ZM6 T;  1J5W A;  3HL6 A;  3CX8 B;  3SS1 A;  5L4E A;  4QXC B;  4LF7 T;  5TAO A;  2BS3 A;  5M4Y A;  2BKN A;  2LOP A;  1D1A A;  3AEA A;  2WM9 A;  5AQS B;  3TLV A;  1XMQ T;  3FBL A;  5E0O A;  5CFB A;  5JTG A;  1WCR A;  3AEF A;  3I0O A;  1B7T A;  3CIR A;  2XQA A;  2CBI A;  5DAB A;  2XM2 A;  2X9Y A;  1S35 A;  3CX7 B;  1YQ3 A;  3LDQ B;  1NEK A;  4ECG A;  3MAC A;  2IC6 A;  4X1K E;  2V6Y A;  4YJ3 E;  5HEO A;  3ETV A;  4TWH A;  3N9L A;  2V7M A;  4U2Y A;  5HXS A;  1EZ3 A;  4HFI A;  1XWM A;  3RKG A;  5LJN A;  2I6H A;  4JUY A;  3TLT A;  2JRK A;  5BR8 T;  5JDN A;  3J7Y q;  2K24 A;  2X0C A;  2LQU A;  3RGL A;  5FP3 A;  4MAL A;  4AIS A;  5C3J A;  3ZSS A;  5AQU B;  4EEB A;  1T7S A;  3RIU C;  3UU3 A;  2KWI B;  4HWI B;  5HXR A;  4HKA A;  2WY2 A;  3LK2 B;  4QKN A;  1HF8 A;  3FZK B;  2H89 A;  3BQK A;  2QA7 A;  3H3M A;  4CN1 A;  1IBM T;  4BJN A;  2XM1 A;  4X20 E;  2M6B A;  1KNP A;  4PK4 A;  4CXY A;  3JC6 C;  3AE6 A;  2C5I T;  3ZT5 A;  3AY5 A;  2IDO B;  2C5K T;  2BVL A;  2XQ7 A;  5FY7 A;  4TNW A;  3CQX C;  4N78 D;  5FY1 A;  3RRW A;  5EK2 A;  5L3D B;  5LXT E;  4HFC A;  4YFS A;  4PJM A;  3LK4 2;  3N2G E;  5AQP B;  5KXJ A;  4F7G B;  3LBX A;  4JI1 T;  1N33 T;  2ZMA A;  3AT7 A;  2CRB A;  3AAI A;  3KV5 A;  2W00 A;  4UEM A;  2NW8 A;  1US7 B;  3CVR A;  2MTQ A;  4A56 A;  5HYA A;  4HFD A;  4LF8 T;  3PF0 A;  1FEW A;  3RYC E;  2RPA A;  3JAD A;  1VOM A;  4PFO A;  2XTL A;  4OYJ A;  3CPZ A;  4NXN T;  3WAJ A;  1IBK T;  3ANW A;  4U3C A;  3O1I A;  5LGT B;  1WR0 A;  4NUV A;  3O1H A;  4F6R C;  2X9H A;  3RHW A;  3H3A A;  5F5W A;  1N36 T;  1V9D A;  5ETW A;  4DBQ A;  1U4Q A;  4EED A;  2JQ9 A;  4U33 A;  4DV5 T;  4QXB B;  1HNX T;  4H63 H;  4HFV A;  5L47 A;  4NIQ A;  3LFM A;  3RRC A;  4HTE A;  4C91 A;  1MIV A;  3TLS A;  4JI4 T;  2KT9 A;  3AVS A;  3K3O A;  4L9I A;  2K5B B;  1OED B;  2C5J A;  4H9R C;  3TLU A;  5JRE A;  3A8Y C;  3AEE A;  3K3Q C;  2L8K A;  2UXB T;  3P7I A;  5HEH A;  3ZMZ B;  2QRX A;  3ESL A;  3SRZ A;  2X68 A;  4EV6 A;  4AKH A;  4EZ4 A;  4MFR A;  2LT3 A;  3QC9 A;  1Z0P A;  3WI3 A;  4DR5 T;  2HN1 A;  3RYH E;  3AEB A;  2BS4 A;  1MMD A;  3FZL B;  4P1N A;  2X0L B;  1D0Y A;  3ZT7 A;  4B6X A;  4KBM B;  4NPP A;  2XZE A;  3P4P A;  1AJ3 A;  2XQY A;  3ZMV B;  3SFE A;  3UQ7 A;  5LBQ B;  4JEH B;  4DR2 T;  3VKG A;  2IIU A;  5JH7 E;  1D0X A;  2V7J A;  4PJN A;  2JMK A;  4U2Z A;  3CML A;  2HN2 A;  4OFZ A;  2QYW A;  5FVL A;  4EYU A;  1KEY A;  4EAH A;  5AQH B;  5FL0 A;  1FJG T;  2WMO A;  3VU7 H;  1HR0 T;  3QNU A;  4ADZ A;  4JI0 T;  3T8O A;  2LKG A;  3EVY A;  3KFW X;  2WDV A;  2ODV A;  4YTP A;  5A1L A;  3PV0 F;  4DV4 T;  1LKX A;  4LMJ A;  2OLT A;  3IBP A;  2BDE A;  2XY8 B;  2W63 A; 
#chains in the Genus database with same CATH homology
 2LM9 A;  2V26 A;  4I4T E;  2X51 A;  4O4J E;  2CXD A;  1MNE A;  2OA5 A;  3TKL B;  2GK9 A;  2CM0 A;  2ZLY A;  2DWG A;  5LOV E;  3NRY A;  5F8P A;  3MK7 C;  3ZJ1 A;  4ZI7 E;  4GYS A;  2IW5 B;  3DTO A;  4ONR A;  2VKH A;  3KBT A;  3OJA A;  4IDZ A;  5LCY A;  4G2A A;  4PFP A;  2E9X B;  3H37 A;  3RYF E;  2EHO A;  2ZM8 A;  4DBR A;  4P0A A;  4IST A;  5KX5 E;  2Q9Q A;  3CX6 B;  4L0R A;  3SOL A;  3PHF 1;  1HG5 A;  2G0U A;  2MOZ A;  3Q9D A;  4QX8 B;  1VRB A;  2W62 A;  2EHO C;  4XAX B;  5JRC A;  4K0U A;  3ZJ2 A;  4PNI A;  2EHO D;  3K3N A;  1HX8 A;  2DCF A;  3AA7 B;  2SPC A;  2WAU A;  4H9O C;  3ZC1 A;  3N2K E;  4EYY R;  4TN7 B;  3VJZ A;  2C0S A;  2LEH A;  1H7C A;  2W0G A;  3ZYL A;  4FJO A;  4P0B A;  1BR0 A;  1NAF A;  3O4X E;  1WYB A;  5H6R B;  3KVB A;  1LRZ A;  3MKD A;  3MZK B;  1NWM X;  2VK9 A;  2X67 A;  5IYZ E;  4HGA A;  5EK4 A;  3SWH A;  3KVA A;  4PJJ A;  3FBZ A;  4ZI3 C;  2LJL A;  3IHR A;  5LP6 E;  5JRC B;  3UT5 E;  3OYZ A;  5L3C B;  2N1G A;  5JDH A;  1U5P A;  5JR9 A;  4IGU A;  2PG8 A;  4MLK A;  3ZCJ A;  1KK7 A;  4ERR A;  5HXH A;  5JDQ A;  4U72 A;  4CXW A;  2E9X A;  2DNX A;  2MTC A;  4UEL A;  4ISS A;  2V7L A;  3PUR A;  4UVB B;  4IE4 A;  1UX5 A;  3K8P C;  4PAG A;  4UV8 B;  5L3G B;  2ODU A;  4AXP A;  2KXP B;  3IEE A;  3N9P A;  3ZLI A;  3C98 B;  2P9B A;  3GN5 B;  4I43 B;  2LSK A;  3E0Z A;  5EK3 A;  2D0T A;  3CQC B;  5J1G A;  2V7K A;  2A3D A;  2KND A;  2YK0 A;  3R6N A;  4ASK A;  3CKD A;  3LBX B;  3PUG A;  1X79 A;  4DMV A;  4HEA A;  4UVC B;  3PDY A;  5LHI B;  5FXV A;  4OYK A;  1FMW A;  3HI2 A;  2NP9 A;  4EXT A;  3C4W A;  2PFV A;  3AA1 B;  3AVR A;  4XZC A;  1IJ5 A;  2N9D A;  3PU8 A;  5C8Y E;  2WWU A;  5LA6 E;  3ZMT B;  3WUR A;  2BZB A;  3N9Q A;  2XAS B;  2WBL A;  2B1E A;  3GA8 A;  2NW7 A;  4H9S E;  3KV6 A;  4PJL A;  4E7S A;  1KNZ A;  3ANW B;  3KV9 A;  1MMN A;  2YU1 A;  3RPU A;  1UCU A;  5FMN A;  3F57 A;  4QXH B;  3Q5X A;  3UUN A;  3ZMS B;  2HPL A;  4AQF A;  2V7I A;  4CI1 B;  4EIW A;  4IHJ E;  4IE6 A;  4X1Y E;  1OWA A;  2CWY A;  2MYS A;  2V1D B;  3VKH A;  4O4H E;  5HWX A;  2H7O A;  3QK6 A;  4ZHQ E;  5LG4 A;  3U78 A;  4BA9 A;  5EZY E;  2PJQ A;  3C51 A;  4BAY B;  2NTY A;  3N9M A;  5LGN B;  2IAK A;  4ZI2 D;  4HE8 A;  4UIG A;  5FNV E;  4DND A;  1T98 A;  1G73 A;  3C50 A;  3HKD E;  3RH3 A;  2LSY A;  3WAJ A;  4O2A E;  2JPF A;  5LGU B;  3EDU A;  4JLE A;  1IAP A;  1HTJ F;  2H3R A;  4PK6 A;  4TV9 E;  5LNK A;  1MIY A;  4UXN B;  2CLY C;  2CLY B;  4H63 V;  2E9X C;  4AQF C;  5FXZ A;  2D0U A;  4PW8 A;  3OBV E;  4NUU A;  4GK5 E;  3RC8 A;  3NRX A;  4DMW A;  4YHJ A;  3RKO A;  5FXX A;  2LSI A;  4HN9 A;  3MJX A;  3GWH A;  3PTR B;  4IE0 A;  2LOS A;  5JVD E;  3HA4 A;  3IF8 B;  2XAG B;  1HS7 A;  4WBO A;  1QSD A;  2Q9Q C;  5FXW A;  5JDM A;  3KIN B;  1WYC A;  4O4I E;  2YIN A;  4MBQ A;  5JDG A;  2IC9 A;  3UUX B;  4TZ4 C;  5J2U E;  3PU3 A;  3UTK A;  1LVF A;  2L3L A;  2D5U A;  3D0T A;  3HKC E;  2VB6 A;  3HKB E;  3W15 B;  5FY0 A;  4EOZ B;  2LSJ A;  4OHF A;  3RC3 A;  3ZMU B;  5KMG P;  1HFA A;  4OK0 A;  3AAE B;  3PUS A;  3U3I A;  2I59 A;  1HG2 A;  3UFE A;  3ZYK A;  4CZZ B;  5DQV A;  2A2F X;  3LK3 B;  2ACX A;  4M1P A;  3ZEF B;  5LYJ E;  3FB2 A;  4GOU A;  3N2O A;  2DLR A;  2YU2 A;  3N9N A;  1E1H B;  2ZM2 A;  3I9Y A;  3NZP A;  2CMR A;  5KDM C;  2PBI A;  3F2E A;  3LG7 A;  2KMF A;  4O4L E;  4KUM B;  5JR9 B;  2Y8D A;  5H6Q B;  3MXZ A;  1BR2 A;  4J2C A;  3UUL A;  2LHN A;  5JQG E;  1SA0 E;  4QX7 B;  2NW9 A;  4AQG A;  3E08 A;  2Y6X A;  2D2S A;  2X9X A;  2DWK A;  5BMV E;  1D1B A;  3ETU A;  4I55 E;  1ZKE A;  3PUQ A;  3ONX A;  4GK0 E;  5ADX L;  2CCQ A;  1ZV4 X;  2JJ9 A;  4MHC A;  2XHE B;  4AKL A;  1HCI A;  3BK9 A;  3GN5 A;  2LSG A;  4P09 A;  3JC6 D;  2HPJ A;  4EZH A;  3J9X 1;  1AJ3 A;  4V1A v;  2K9A A;  2VKO A;  2VKD A;  3A5X A;  2H7V C;  5L3F B;  2JMH A;  3KDS E;  2WMN A;  3WSC A;  2VAS A;  3N9O A;  4AKI A;  1MMA A;  2Z6E A;  4AKR B;  3NBX X;  5CB4 E;  3AB3 B;  3CQG B;  4PK5 A;  1D1C A;  2WSS V;  4WNK A;  1ZHC A;  5CA1 E;  1ZEE A;  2ZM0 A;  3R84 B;  2Q9Q B;  2VL8 A;  4ZS3 A;  3V5U A;  3C64 A;  3O1J A;  5J2T E;  5L2L A;  2VKJ A;  4E7Z A;  1O3X A;  5CA0 E;  3PUA A;  3B13 A;  5HXE A;  1S94 A;  3N5L A;  2E8I A;  3V5S A;  2CXF A;  2DI4 A;  2UXN B;  3EDV A;  3ZC0 A;  4G63 A;  5HXC A;  4X1I E;  2A72 A;  3BQI A;  3KV4 A;  4QWN B;  4U74 A;  3WAK A;  3I1A A;  2LHR A;  4UF0 A;  2E9X D;  2VWA A;  4O8S A;  2JQQ A;  3RX6 A;  3ZPO A;  1D0Z A;  3OKQ A;  1FIO A;  5GON E;  1BR4 A;  1YD8 G;  2KIN B;  4CI3 B;  4ZI3 D;  1LVK A;  5IHY A;  4UVA B;  3FXD B;  4CXX A;  3GMI A;  3S4U A;  4UF0 B;  2CEA A;  5JR9 C;  4H9P C;  3OYX A;  1SHZ C;  4IE5 A;  4ANJ A;  3LJC A;  5HAX A;  4YLH A;  4AKG A;  2DHR A;  4I50 E;  3FXE B;  5LHH B;  2XAH B;  4CI2 B;  1OXZ A;  2XUE A;  2Y48 B;  4UV9 B;  2CXL A;  3AA6 B;  2RP4 A;  5DJQ C;  4C90 A;  3KBU A;  1G8X A;  1MMG A;  4CQI A;  2KWH A;  4DO0 A;  5L3E B;  2HH7 A;  1FMV A;  2YEV C;  2NOX A;  3DP7 A;  5FYM A;  3C4X A;  3HKE E;  3VHL A;  2NWB A;  4IE7 A;  1WRD A;  4WBN E;  4YJ2 E;  2L9Q A;  4ZOL E;  4BGO A;  3ZN1 B;  4L5G A;  5F3J A;  2MBG A;  3CWZ B;  4TX5 A;  5T1D A;  2CA5 A;  2RA1 A;  5DQW A;  1BR1 A;  4DVD A;  3DJB A;  3B57 A;  5LHG B;  3PE0 A;  4Z8X A;  2NTX A;  4GYR A;  3Q2M A;  1YKE B;  4WW0 A;  3Q5W A;  4O2B E;  2QGS A;  3EUH A;  4KMC A;  4TUY E;  4ZS2 A;  3C4Z A;  3ZCI A;  4GIW A;  4KP3 C;  3ZYM A;  3L3P A;  2X9W A;  2XAF B;  4TV8 E;  2XAQ B;  4IIJ E;  1CUN A;  4ZI2 C;  1YW0 A;  3F31 A;  4H9N C;  5HWY A;  5JDL A;  3NZQ A;  3UUM A;  4EB6 E;  3ZN0 B;  1YKH B;  1IZN B;  1WLX A;  3AAA B;  2J1D G;  2W61 A;  4XBF B;  3M1C A;  4QHO A;  1UX4 A;  4FI5 A;  4BJM A;  2KLQ A;  2CE7 A;  3P8C D;  2UXX B;  5LBM A;  2ES0 A;  4H9Q C;  3E22 E;  4ILU A;  3L09 A;  3FHN A;  2EHO B;  3I0Q A;  2Q9Q D;  2KZ7 B;  3QUJ A;  1MIW A;  1QUU A;  2K48 A;  2M67 A;  3RYI E;  3M65 A;  3MA9 A;  2LE8 A;  3HR0 A;  1MND A;  3I9W A;  1WR6 A;  2BVM A;  4AI6 A;  4JEU B;  2XAJ B;  3AA0 B;  2CWO A;  5L3B B;  1IJ6 A;  5JDF A;  1Y64 B;  2N2N A;  2X66 A;  5AFU L;  3O9X A;  3BQL A;  3HL6 A;  3CX8 B;  3SS1 A;  4QXC B;  5TAO A;  5M4Y A;  2LOP A;  1D1A A;  2WM9 A;  3FBL A;  5E0O A;  3I0O A;  1B7T A;  5DAB A;  2X9Y A;  1S35 A;  3CX7 B;  4ECG A;  3MAC A;  2IC6 A;  4X1K E;  4YJ3 E;  3ETV A;  5HXS A;  3N9L A;  2V7M A;  1EZ3 A;  5LJN A;  4JUY A;  3J7Y q;  2JRK A;  5JDN A;  2K24 A;  2LQU A;  5FP3 A;  4MAL A;  2KWI B;  5HXR A;  4HKA A;  3LK2 B;  4QKN A;  1HF8 A;  3BQK A;  2QA7 A;  4BJN A;  4X20 E;  4PK4 A;  4CXY A;  3JC6 C;  2C5I T;  5LJM A;  2C5K T;  2BVL A;  5EK2 A;  5FY7 A;  3RRW A;  3CQX C;  4N78 D;  5FY1 A;  5L3D B;  5LXT E;  4YFS A;  4PJM A;  3LK4 2;  3N2G E;  3LBX A;  2ZMA A;  3AT7 A;  3AAI A;  3KV5 A;  2W00 A;  4UEM A;  2NW8 A;  1US7 B;  3CVR A;  2MTQ A;  4A56 A;  5HYA A;  3PF0 A;  1FEW A;  3RYC E;  1VOM A;  4PFO A;  2XTL A;  4OYJ A;  3CPZ A;  3ANW A;  3O1I A;  5LGT B;  4NUV A;  3O1H A;  4F6R C;  2X9H A;  3H3A A;  1V9D A;  5ETW A;  4DBQ A;  1U4Q A;  4QXB B;  4H63 H;  4HFV A;  3RRC A;  3LFM A;  4C91 A;  4HTE A;  1MIV A;  2KT9 A;  3AVS A;  3K3O A;  4L9I A;  2K5B B;  2C5J A;  4H9R C;  5JRE A;  3K3Q C;  2L8K A;  3P7I A;  3ZMZ B;  3ESL A;  3SRZ A;  2X68 A;  4AKH A;  4EZ4 A;  4MFR A;  2LT3 A;  3QC9 A;  1Z0P A;  3WI3 A;  3RYH E;  1MMD A;  2X0L B;  1D0Y A;  4B6X A;  4KBM B;  2XQY A;  3ZMV B;  3VKG A;  5LBQ B;  4JEH B;  5JH7 E;  1D0X A;  2V7J A;  4PJN A;  2JMK A;  3CML A;  4OFZ A;  4EYU A;  4EAH A;  2WMO A;  3VU7 H;  4ADZ A;  3T8O A;  3KFW X;  3EVY A;  2ODV A;  5A1L A;  1LKX A;  3IBP A;  2BDE A;  2W63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...