5JDIA

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
molecule tags Oxidoreductase
source organism Trypanosoma brucei brucei
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
total genus 95
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiA00
1P1KA 1H94A 3ROMA 1PQWA 1ZSNA 4ND3A 1NVMB 5IZ4A 4YDRA 4I5GA 3GN2A 1GTMA 3IS3A 5IZCA 1EQ2A 4Z0PA 4CV0A 3JQGA 1HKUA 3E5RA 1L7DA 1NR1A 1C0LA 1T2CA 2B5WA 1KERA 4DYVA 5I8WA 3IQDB 4UVDA 4F45A 4YACA 1HDCA 1E7RA 3IP1A 4L76A 3BYZA 3PJEA 3P19A 3E6AA 1VL0A 2E4AA 2Y0DA 3GC6A 3DBVO 2J6IA 1YJ8A 5F21A 1CQIA 4DWVA 1B7GO 3I1JA 4BS9A 2PV7A 3DHNA 1ISMA 3QVTA 1Y5MA 2LDBA 1FDSA 4RVFA 1YL5A 2TMGA 1GUYA 2X0RA 2R6JA 4DBVO 1OC2A 1N1GA 4ZQEA 5KVCA 5DN9A 4NJMA 3I5MA 3Q1LA 1EUCA 4CM7A 3V1TC 4KUHA 5L4SA 4Y6PA 3ORFA 4YEDA 3CMMA 3PHJA 3TJRA 1P33A 1MLDA 1QXSA 3ZW8A 5ITWA 2CVQA 3HDJA 2CSUA 4MKZA 1KOLA 1VKNA 3KYBA 5FI3A 2VRCD 4CR6A 1HDGO 3C7CB 3LC7O 1HDYA 3BMOA 4RF2A 2DKNA 3B20A 1DRVA 3UXYA 1DXYA 3Q9NA 2J8ZA 1ARZA 3LQFA 2IE0A 5T6BA 1PJLA 3AFMA 3D4PA 2FSVA 2CDCA 4YAKA 3V2UA 3GEGA 1GQ2A 1KVSA 2Q1WA 1EDOA 2GSDA 4CMIA 1PL7A 2BI8A 4DLBA 4J9VA 4U6QA 3IDSA 2Q3EA 3BMCB 4LCJA 1NHGA 1EDZA 1JKFA 1ISIA 3V5NA 2ZATA 4Y98A 3GLQA 5KIAA 3W8EA 1U2DA 4BB6A 5KKCA 4E5MA 3TZHA 2VHZA 3FD8A 1Y81A 3VH2A 4NBUA 3ON5A 4O59O 3CH6A 2YDYA 1I3KA 3FSRA 5JCJA 3JYNA 5ENDA 1E1LA 2DLDA 1O89A 3ZWMA 4AJHA 4YJHA 4DGSA 4TMFA 5DDIP 2GUGA 4BQPA 1UXJA 4CV2A 4ZQBA 1P1RA 4GGPA 1ADCA 5K0ZA 4RLHA 1V6AA 5T67A 2CY0A 2Q1TA 1X1EA 4NFSA 5CDSA 7ADHA 3JYOA 1ZJZA 1IZ9A 2D59A 5AXDA 2AE1A 4KWIA 4JGBA 1DHTA 1E7QA 3GEDA 4DC0A 4CMIB 4DREA 1EEHA 2VWHA 4ND5A 5A3VA 4DL9A 4N5NA 3UVEA 3I52A 3WGZA 1QR6A 3KUXA 3SC6A 5JMWA 1U4OA 4WLFA 3WQQA 5CHEA 4R51A 2O4UX 3HDQA 3TF5A 4RDIA 2Q1UA 3GVXA 5FI5A 4GX5A 2VOEA 2VYVD 3QE3A 4FFPA 3A06A 4LRSB 5TJ9A 2ZCUA 3BTUA 3PDJA 4MVJD 3UAGA 3H5RA 4UUMA 2Z1MA 2IDZA 2B4RO 2GLXA 3BAZA 3ZU4A 4ZHSA 4PG4A 4D45A 1KETA 4QFCA 2HAEA 5H83A 2FP4A 4EZBA 5EPOA 4GSLA 4NHEA 4TWRA 3RKUA 4M86A 5DCUA 5CEEA 2PD3A 2AHRA 4RCVA 1ZZEA 1NQ5A 4BO2A 4RVUA 5KVSA 4P4GA 3O03A 3EHEA 5EL0A 4A5OA 2ZJ0A 4AJOA 4QO7A 4BNFA 4J1NA 1KVRA 1UZNA 2NACA 1SEVA 3DBLA 3NKLA 1VJ0A 4JJFA 3OEYA 3DFZA 4OKIA 1WDKA 2G76A 1WDLA 3VVBA 4RQTA 2BGLA 1UXGA 1E7WA 3ZWYA 4IS3A 1H9AA 3D3WB 3MEQA 4KTTE 2PKRA 1HE2A 2C20A 1IL0A 2PTGA 2ILTA 3W6ZA 4FSHA 2ZTLA 4HX5A 2OMEA 4HNGA 1M75A 4R1NA 5A05A 5THQA 4HBGA 3NT5A 5JCXA 1KYQA 3BIOA 2O3UA 3DZBA 3GH3A 1YVEI 4ND4A 3VHRA 3OQ1A 1RM3A 4EEXA 4G2NA 3SVTA 3AU8A 4CLOA 5C7IO 3TOZA 5TJHA 3SLGA 1BVRA 3RUHA 1JTVA 2PFGA 3O26A 3HUDA 4UAGA 1PL6A 1E7MA 4BNHA 1NQAO 5A4DA 2AXQA 1Z45A 2FHSA 4EJ6A 4L73A 4L4SA 4K1LA 3E1KA 4BNGA 4CMEC 1AXGA 2Y93A 2ZB7A 3HN2A 1QP8A 4Z9XA 1N8KA 1AGNA 1GFSA 4OL9A 1T1SA 2IXAA 1KC1A 5KOIA 3KETA 3ZGYA 2GRAA 1Y8RA 1ISFA 1HETA 5I7VA 3GT0A 3INGA 3OMLA 1ZBQA 1FDTA 1B14A 1CWUA 1C0PA 3SJUA 3VVCA 2PK3A 3BHIA 1FK8A 2PWZA 3ST7A 3H3JA 3WS7A 4MP3A 1XG5A 2VHWA 3LSYA 2JD1A 1L1FA 4XDYA 3WGGA 3WSVA 4I8XA 1XQ6A 1X1TA 3QQPA 1Y1PA 3PZBA 2RIRA 1DB3A 1PZHA 2GN6A 2I67A 4IINA 4BO4A 4KWHA 1E5QA 2GZ3A 1BGVA 2D0IA 2IZ0A 3IJRA 4HADA 4DUPA 3AUUA 1PJTA 4UEKA 3TN7A 4YR9A 1E6WA 1T4BA 1DAPA 3DZJA 3NTQA 1K6XA 4RF4A 5H81A 4FFMA 2QIOA 4JBGA 5JCJD 3PHLA 4R9SA 2FZEA 1KEWA 2IRWA 4TVOA 4NZ9A 4XGIA 4FCCA 5I7EA 3ZWPA 1H2BA 1EE9A 4II3A 4RF3A 4FDAA 2WMDA 1NP3A 2O3JA 4MIOA 2YJZA 4UEOA 2X0IA 3GZNB 2IODA 3C7AA 4KDEA 3PVZA 5I9MA 3A1NA 3IKTA 4FFOA 1GEGA 2HUNA 1A7KA 4Z3DA 3P5SA 3PGJA 3JQAD 4B4UA 4YA6A 2QQ5A 4FBGA 3S2GA 1PZFA 4MKRA 4IZHA 1V3TA 4W6ZA 2R00C 4II2A 1R16A 3FNEA 3GGGA 1YB4A 2BFMA 2PD4A 5DF1A 4XA8A 3DB2A 2EEZA 5G4LA 1X7HA 3F6YA 4PLFA 4PZDA 1B16A 1BDMA 3ADOA 2C54A 2WD7B 3AOEC 4U7WA 3A14A 3KYDA 4PGFA 4DPLA 3GNQA 2JFGA 2PLAA 1SB8A 2OO5A 1LU9A 2YHIA 2EKPA 1ONPA 1PJSA 4YAJA 4AJ1A 3DTYA 1KVUA 2X0NA 3AJRA 4FW8A 1H6BA 3QVWA 1SOWA 2PNFA 3VPSA 4F6LA 3PIDA 4A03A 1R4MB 4YAIA 1DIBA 3PLNA 4ZVVA 2AQIA 4ALMA 3EC7A 1NWCA 3OH8A 1HDRA 3NTRA 3WWYA 5L9AA 5EINA 3RVDA 2GN9A 1PGPA 2A4KA 3UOGA 2W2KB 4D79A 5IN4A 3ANMA 2GN4A 4B4OA 3DONA 3EY4A 3S2FA 4QQRA 1LRJA 4HWKA 1PJ4A 4J91A 4BO3A 3PYMA 5CEFA 3VOSA 1QORA 4I5DA 3I4FA 1X15A 1DJNA 5C3MA 3WJAA 1W73A 3ZCXA 5JNLA 2H9IA 4G5HA 4K28A 2NNLD 2NTVA 4CV3A 3M6IA 5F1KA 2O48X 2ET6A 1O95A 4KTVE 4K6FA 4YXFA 3RC9A 1HF3A 4J0FA 3G1UA 2VHYA 2AEJA 2JAHA 4CR7A 2B0JA 5COBA 5AYVA 1W0CA 3K92A 3F5QA 3L6DA 3PQDA 2ZQZA 4Q3EA 1Y6JA 3GQVA 2NADA 5I8ZA 4WLNA 3HB5X 3LT1A 1QG6A 4IJWA 4PLTA 3V1UA 2QHXA 4Y67A 1M6HA 1MG0A 4FC7A 3WQSB 4XRGA 1WMBA 4HFJA 1MB4A 4GVXA 1GYPA 1KEVA 1T2DA 5EESA 3SX2A 3B6ZA 5B4VA 3RC2A 1ZMOA 3IUSA 4RL6A 1Q7CA 1EMDA 4BNLA 4XYEA 2ZB3A 3N74A 1YKFA 2NU8A 5DZSA 3GDFA 1HYGA 3F1KA 2HK7A 1C0IA 5G2OA 2YZ7A 1OOEA 2E49A 4CUJA 3GR6A 3ZHZA 4IXTA 3RQSA 3NEPX 3PXXA 1DIRA 1H9BA 3KM0A 4C7KA 1TT7A 3A28A 3S8MA 3H9UA 4E5YA 4XYMA 1VLLA 4UREA 1C1DA 4QFDA 4DC1A 2J5QA 1ZFNA 3VPGA 1QKIA 1CYDA 1YOVB 3ZZNA 5COAA 3UKOA 2X4GA 5AQ1A 3CKYA 2EGGA 4EUEA 2BD0A 4LVUA 4PZCA 2FWMX 1NR7A 2Y66A 2X8LA 1Z82A 3GA0A 1GAEO 1LSJA 3AWDA 4PRLA 4XIJA 4Y6RA 3ZU2A 3FNHA 3HSKA 4XJTA 5JSFA 3H6KA 1R6DA 3HG7A 4OYRA 4KZPA 4RVHA 3ASUA 3WOHA 3D64A 3PZRA 4IDDA 1MXHA 1GUFA 1HXHA 1ULSA 1PWXA 3U5TA 4IQGA 1H6DA 4KMSA 1NBOA 2OP0A 4XIYA 3KYDB 4GVLA 1VC2A 3DBHB 2VZ8A 2B83A 4M1QA 1EVYA 3KHUA 3M1AA 1QLJA 4O1MA 3JQEA 4ZQGA 2JFHA 3F4LA 3WTCA 5JAIA 1P44A 1D7OA 1UZLA 1Y9AA 5CPFA 2XOXA 2YY7A 4GKVA 2Y1DA 4OSPA 3LF1A 2EIHA 3H5AA 4IXWA 1I33A 2O3TA 3I83A 4J4BA 4IJUA 4PLPA 4NIMA 3IL2A 4UVGA 1UJMA 1ZKMA 3C1TA 5T8KC 4E21A 2HLPA 4JX8A 4WLOA 2PGLA 4OAQA 5TT0A 4K26A 1ENZA 1J0XO 3FCOA 4CV1A 2JL1A 3F3SA 4B7UA 1J4AA 3ZWXA 3U09A 1BXGA 2H63A 3GZNA 1KY5A 4INAA 4RV9A 2TMDA 4IM7A 3ZHBA 3PEFA 1HSOA 7MDHA 4FQ8A 1MG5A 1GQYA 4FFLA 1C1XA 4R1UA 3FWNA 2CF5A 5EQDA 4K6CA 2RCYA 4FGWA 4GWGA 1BWSA 4UULA 5IDQA 2Z1NA 3WYEA 2NV6A 2RBEA 3PHHA 4BNTA 1V8BA 1UP7A 4IDEA 1DLJA 3OQBA 4OOFA 2C59A 1BG6A 3ASVA 3LT2A 3QWHA 4TRMA 5K9ZA 1DJQA 3NT4A 5BNFA 3ANNA 1P9LA 3PYXA 2DTXA 4H15A 1V35A 3DXFA 5THKA 4FN4A 2DTDA 1ZK4A 3DAPA 1PR9A 3IAHA 3DHEA 2Y1CA 2VCYA 3AY3A 4TZTA 3M2TA 2C07A 3Q0EA 4BO0A 1QV7A 2GO1A 3PQFA 4DQXA 1FMCA 2FPPA 1JAXA 4CPDA 1DC4A 4HXYA 2HMTA 3UGKA 2EP5A 1B8UA 3K6JA 1VM6A 4HP8A 3JQBC 3U4IA 1T1RA 5HWSA 5IG2A 3G0OA 3VTZA 2BI7A 1UUFA 5I7FA 5U1PA 1P1HA 4XQGA 3JQDA 3ZW9A 5H82A 5CDYA 3C1OA 4W82A 1JWBB 2UVDA 1QMGA 3GN1A 5BSHA 4J7CA 4BO8A 4PIVA 1M67A 3RKRA 2GDZA 4WCFA 4CMKA 3PHIA 3PIIA 1DFGA 1N5DA 4GMGA 1J5PA 4BKRA 4IS2A 2OP1A 4WCDA 5IFLA 1I2ZA 1ZO8A 2BELA 2I9PA 2O7QA 4NG5A 5AXCA 4MVJI 3EYWA 4WJZA 1YJQA 1YS4A 2QW8A 1B26A 4JP2A 1R15A 1U7TA 2Q46A 2PH5A 3FPLA 5GMOA 1E1NA 3BHJA 1PR3A 4XX0A 2Q4EA 1VL6A 1LC0A 1HYEA 1RYDA 3E48A 3WX0A 3E8XA 3NV9A 1SCUA 3L4BA 4L9RA 3ITDA 2OXIA 1GYQA 1LRLA 3OFSA 4AJEA 5AVOA 3FN4A 1RM0A 2C5AA 3TFQA 3VDQA 3WNVA 2EJVA 3VAZA 1V3VA 3SJ7A 3GZ4A 4XR9A 3DC2A 4NQZA 1PQUA 1U9JA 3AM4A 3EAGA 3FBTA 5TRTA 1DRWA 4YYZA 2J5RA 3PJFA 4P8RA 4AJJA 2Y05A 1OBFO 3WTBA 2BLLA 4FC6A 1ZCJA 4WCFB 1JU9A 2HJRA 5COQA 5AXBA 4R16A 1U28A 4MP6A 3JQFC 4WCFC 5JAQA 1GZ4A 3WBBA 3FR7A 1IHYA 1UAGA 3O8QA 4BO7A 4ZU3A 2HU2A 5IF3A 4NI5A 3B1FA 3K73O 4CQMD 4R5MA 1ISHA 1HL3A 1K89A 2X9GA 3AW9A 4D3SA 1P74A 2DBRA 5BNTA 1WMAA 3AY6A 4D3DA 5CDGA 2G5CA 2ZB4A 2CZCA 4GLLA 4YQYA 1B3RA 3LLVA 1IB6A 3RFTA 4BUCA 2AQ8A 3TL3A 3PK0A 4F46A 1U5AA 2B4TO 3L6EA 1Q1NA 4R1TA 9LDTA 1F06A 4YRAA 5A9SB 4B8ZA 1PGJA 5A9SA 2AQHA 1QRRA 2BMAA 1LDEA 3OJLA 3A4VA 1Q0QA 4R5HA 3RU9A 1HYHA 1LDYA 4DLAA 2FZWA 3BXXA 1W6UA 2VYNA 1VKOA 2DFDA 3I9KA 1HE4A 3C24A 1AHIA 2OL4A 4NFYA 4WASA 3M2PA 3ZWOA 5CG1A 4KQWA 3WR5A 2DPGA 2AG5A 1DO8A 1B8VA 3ITKA 3JQFA 4ZICA 2C7GA 3O8QB 5LDHA 3G1TA 4MVJP 1MUUA 1GADO 4YJFA 4ID9A 4BNJA 3MTJA 1VPDA 2V6MA 4IGFA 4BNMA 2EW2A 1U4SA 3WLEA 3VDRA 4E2XA 1HE3A 2BRUA 2GZ2A 4OHUA 2AMFA 3DOOA 4J9UE 1R0KA 4LSWA 3MZ0A 3PI7A 1AE1A 3K30A 2O2YA 2X5KO 5G4KB 4BNVA 3O9ZA 2JHFA 4BL5A 5A9RA 4PLZA 1V3UA 4B79A 1DPGA 3PP8A 3BTOA 1PGQA 4RORA 3AI1A 1JLLA 4AL4A 1D8AA 3JD0A 3ZWWA 3HN7A 4EITA 1ZH8A 3AOEA 1BVUA 5DBIA 3ZI0A 5BSEA 1D1SA 5IAAA 5CDTA 4F6CA 2PR2A 3N58A 3WBFA 1PS9A 4IQ8A 3GHYA 3KV3O 1NFQA 3D4OA 1DIHA 4J43A 4R3WA 5TGDA 1XDWA 1T2FA 1WWKA 5EERA 3WIDA 1F8FA 4CM8A 4AJPA 1XCBA 4RPGA 4DIFA 3DMYA 3T4EA 3KBOA 3OJOA 4B7CA 3AY7A 4E2WA 3G17A 5I9NA 3AM5A 3OA0A 4P4LA 2VTEA 3SC4A 4ND1A 3DBHA 3DMTA 2CUKA 5A04A 1B2LA 5C37A 4EDFA 3H5NA 4D3FA 1GQQA 2HQ1A 3D3EA 3GHHA 3CTMA 3ONDA 1S7CA 2B36A 2VWGA 4CM9A 3Q9UA 3ETDA 3TZQA 5ADHA 1YQXA 4J16A 2W4QA 1WLYA 2E37A 3DEYX 1SAYA 5CP8A 3CZRA 5JPIA 5BSGA 4XB2A 3DMTC 4ALLA 1E3LA 1MV8A 1PGNA 2NU9A 3EVNA 2P9CA 4L4XA 1A4UA 1H6CA 1Z7EA 4E5NA 5CEJA 2DVMA 2Q99A 3JYLA 2OOSA 4KDFA 4CODB 1JDJA 2EERA 1XSEA 4HNHA 1E1KA 2BFAA 4L8VA 3H2ZA 1ZEMA 4FFNA 1VE9A 1M66A 3LC1O 3AFNA 3R6DA 4FOOA 1LRKA 1GV1A 1CRWG 3ICCA 1YBMA 3QY9A 3LYLA 4CMGA 1I30A 1GR0A 3TQHA 4LISA 5JW6A 3D1LA 4QECA 2QRKA 3H9QA 4EUHA 5U9CA 3EUWA 4GKBA 4K9DA 4MVJM 1SZJG 4BNKA 1J6UA 1ADGA 1EBFA 1M2WA 2NUAA 3WQRA 1PJQA 2YYYA 4BKOA 2GERA 1GEEA 2EG9A 4MJLA 3HFGA 4E5KA 2UDPA 1TT5A 2P4QA 2HJSA 3I6QA 4XR4A 3WB9A 2POQX 2AEMA 2IXBA 1NM5A 1XHLA 2Y0CA 3NJ4A 3RFVA 3ZU3A 3C7DB 3ZHXA 5FEUA 4MPDA 3W8FA 2IEDA 2YQ5A 1OC4A 4AJIA 2AQKA 2BF7A 5HA5A 1GUZA 3NT2A 4A73A 4I08A 1IPEA 1I24A 1NAIA 3OA2A 3VH1A 2ZJ1A 2GR9A 2VRCA 1GZ6A 4P22A 2E82A 4RVGA 1SNYA 2YHUA 2VNAA 3D7LA 4UEJA 4C4OA 2VOJA 4WEOA 4YJHB 2E48A 3M1LA 3W1VA 1ENYA 4JQCA 1ADBA 4NNJA 3JD2A 1JKIA 3RUAA 2HMWA 3NJ8A 6ADHA 1XU7A 1VL8A 3D5QA 1OMOA 1WZEA 4S1VA 4W7IA 3P2YA 3WGHA 4QO8A 1I3MA 1LNQA 3ZNNA 2GNAA 3NGXA 5HBRA 4BO9A 1KVQA 5JFOA 3BMCA 3PWSA 2DUUA 1FDVA 1XQ1A 3RROA 4E5PA 1CETA 1PL8A 2X5OA 3H9EO 2O3RA 4BMSA 1E7YA 4P4NA 1LJ8A 4B3IA 3QVOA 1C14A 4LVCA 1D4FA 4PZEA 4TRJA 5F1OA 1ONNA 4U6SA 5HM8A 1UP6A 4YTEA 3ENNA 3WFJA 3WWZA 2DT5A 4M87A 5A06A 2CF6A 4J49A 4FOSA 4GX0A 1SEPA 2FR0A 4OXKA 1DC3A 5DP1A 3ZWCA 1U3TA 3KSDO 3QV1A 2B4QA 4M49A 3ONFA 2CVOA 4IIUA 4ALNA 4CMCA 4D44A 1PSDA 4FPXA 2I99A 4DPKA 1E6UA 1P45A 3JQ6A 4TROA 2NSDA 4OOEA 4MIYA 5T5QA 3DHYA 3DZIA 1N9GB 4NFHA 2PZMA 1BRMA 3RBZA 4CM4B 4YJFB 1TXGA 5DCYA 3GAFA 2QX7A 4WK6A 1HE5A 2I65A 1DAOA 1NVGA 3ROQA 4ESOA 1YQDA 1C3VA 3L4BC 2Q45A 4CLRA 1VRWA 3RBVA 1QSGA 3VC7A 2WE7A 2X1HA 4ALIA 3INRA 3WJ7A 3EZYA 1LSSA 3OP4A 1LA2A 4RO0A 2PGJA 3PWKA 5BQFA 4GH5A 4OXYA 2Y68A 4CLEA 4MVJA 4D43A 4PG5A 3S2IA 4GX2A 4IJKA 1EFKA 1BMDA 3ZWVA 5G0SA 5BNIA 2ZQYA 4JK3A 2A94A 5DOZA 5HS4A 4RJTA 2XAAA 1P77A 1HZJA 1UDBA 5DT9A 4IMPA 2O4CA 1HEUA 5ILOA 2Y99A 1G1AA 4BNXA 2BGKA 4CJXA 1WVGA 5CDUA 2NVUA 3PRJA 3W6UA 1BXKA 1WAMA 3WSWA 2HMUA 4OH1A 5J23A 3MJCA 3OIGA 5I9LA 1BW9B 3JQBA 2JFFA 4FIZA 3ZWNA 2RH4A 1ZXLA 2JKVA 1XELA 4DQVA 1KEPA 5KJEA 2GD1O 3C1AA 1TT5B 1KIFA 1KS9A 3GDOA 5CG2A 3DDNA 5EQFA 1IPFA 1U8XX 2NVWA 4BNYA 1QYCA 2AA3A 4CM6A 2WTBA 3GNTA 1UXKA 4H7PA 1GCUA 3VPXA 1PZGA 4HFNA 4OKNA 3DQPA 2EHDA 1GYRA 3FTNA 4YJDA 3B1KA 3E5MA 1C1DB 1MP0A 5C7LO 1A27A 2B5VA 1U1IA 2UAGA 3S1LA 2OUIA 4YB8A 4TZKA 2VNSA 4S3MA 4Z0HO 4E0BA 4Y8VA 1DC5A 1LLUA 4OMUA 2IYPA 2AE2A 2X86A 4BNNA 3NAQA 2F1KA 1U3VA 5KVVA 3KSUA 5G0WA 4L75A 3GOHA 3ZDFA 3U9LA 4CMEA 3GVIA 1LLDA 4YT8A 4PLVA 1ZK0A 1TB4A 5L7WA 4A26A 4N7RA 4G81A 1Y7TA 1WZIA 4CMAA 1XIVA 4MOWA 2P9GA 1I3NA 5F5NA 4P38A 3I9MA 4QX6A 3K96A 4A7PA 4FJ1A 3U4HA 3U4CA 3VKUA 2ZYAA 3AK4A 4I9NA 5DULA 1U7HA 2P9EA 2OBYA 1BW9A 1OAAA 1NQTA 4E2YA 4CM3A 2C29D 1X7GA 1EFLA 1I3LA 2IYOA 2VUUA 3CIFA 3QSGA 4NDNE 4HFRA 1A9YA 5B4UA 3OJ0A 4PCVA 3KVOA 2NVUB 1B3BA 3UF0A 1YB1A 2HDHA 3CPSA 2EV9A 2VTDA 2VHXA 3F4BA 4RVDA 2UUPA 4A0SA 1E0DA 3ZWBA 1LBEA 4M54A 3VZPA 3DZGA 1P0CA 2LDXA 5T8KA 3VH4A 4E32A 3IUPA 1YO6A 2GGSA 2R00A 3C3XA 1K3TA 1YDWA 3WYBA 2ZB8A 1LQTA 1PJ3A 3L0DA 5DP2A 4CMHA 2V6BA 4HV4A 4D0RA 1JVBA 3JCZA 4DMLA 4J7UA 3KO8A 4O0LA 3GFGA 1ORRA 3WYCA 1CEQA 1I8TA 3ONEA 2CDBA 5AOVA 2X5JO 3LVFO 1PX0A 5KTKA 5MDHA 1NAHA 1GZ3A 2J3KA 3AI2A 5T64A 4J7XA 3FR8A 5TC4A 3MOIA 3TZKA 3GUYA 1R37A 1TI7A 2HRZA 3U0BA 5A5FA 1EVJA 2VT2A 5L4LA 2NTNA 5HTOA 4XGKA 2DBQA 3DWFA 2J3JA 1UH5A 3DBRB 2Q4BA 3BMQA 3UHAA 2FN7A 4RZHA 4JNKA 3A9WA 5FYDA 1I5RA 4Z9FA 3X2FA 2FR1A 3CINA 3QA9A 1A5ZA 2I3AA 2CMDA 1Z6ZA 4DQUA 4XRRA 1XGKA 5CAEA 5L45A 3L77A 4ILKA 4IMRA 4WNCA 4B3JA 4Y6SA 2OFPA 5CPBA 4R3NA 4BKPA 4AJKA 4AICA 1C1XB 3QVSA 3HDHA 1F12A 2D3TA 1DIGA 1JN0A 3ZV3A 1A71A 3OETA 3QVXA 4PLYA 4WECA 4J6FA 1M6WA 2V6FA 3E9QA 4J1QA 1BHSA 1ZJYA 5EIOA 1JAYA 2NWQA 3RSHA 1PGOA 4ZD6A 1EVIA 3KEQA 2FMUA 5A3JA 4Q3BA 2I76A 1PS0A 3PQEA 4YPOA 4QTZA 1NHWA 2W2LD 4CL3A 5A03A 1FDUA 5L4NA 4PLCA 3R3SA 3UFXA 1Y8QA 3OQ6A 1FJHA 1ISJA 3V2HA 4IBOA 2QRLA 1SC6A 4FGSA 5G0VA 4NH4A 5ITVA 4DRYA 2VZ9A 3KYCA 4CM5A 1E5LA 3WICA 3NRCA 3Q6IA 3JYPA 3ETGA 2I5PO 3TL2A 1ZIDA 4IDCA 1HZZA 4R54A 4F3YA 1E3SA 2DPHA 2Y1EA 3WFIA 4CM1A 1NPDA 4AJ2A 1LTHR 2X9VA 3L6OO 3L4SO 2GCGA 2PH3A 3PFWO 2D4AA 1LSUA 4UUPA 1A9ZA 4MINA 1WPQA 1HLDA 3IC5A 4XQEA 3V1YA 1DC6A 1I36A 1H6AA 2Q49A 3MWDB 4U0JA 4IPTA 4NBTA 4NPCA 1ZSYA 4WE3A 1U5CA 4HKTA 3RASA 2ZIZA 3H4VA 4AVYA 1G6KA 4YBZA 3RJ9A 2C2XA 2EKQA 2Y67A 3SLKA 4JXKA 3EGOA 1H93A 4MO2A 4TSKA 3ZV5A 2YUTA 4CMBA 3RWBA 4RPKA 1MFZA 1M76A 4LK3A 2ZCVA 4U0KA 1DDOA 2QZZA 2PY6A 2BFOA 1O94A 1Q7GA 1GU7A 1ZK2A 4YRBA 3MOGA 1QYWA 2UUOA 3VZRA 5TIIA 4W4TA 4BQRA 3U4DA 4O63O 1FDWA 2Z95A 3ROKA 1E3IA 3IOYA 3U62A 2EKLA 1RYEA 4OJNA 1NX6A 8LDHA 4BGIA 4FB5A 1MXFA 4ONEA 2AG8A 4A10A 5KVQA 5ICMA 2WE8A 4UVEA 2WDZA 5JY6A 3MJVA 1QYXA 2W2LA 1DFHA 1DIAA 1CDOA 4CUZA 3JQGB 4DLLA 2WEKA 5BSFA 1OFGA 3TFOA 4DYDA 2VUTA 2V65A 4JBHA 3QLJA 1KVTA 3I23A 5DCWA 2JCYA 2DU8A 1JWAB 1JVSA 2PKQO 4Q3NA 5IZCC 4YQZA 3Q2IA 2ZTVA 2QRJA 4DTIA 4A2CA 2Y1FA 3KLMX 4FS3A 4LSMA 4N5MA 1DEHA 4ZQHA 4X54A 2P5UA 3KXDA 1EUZA 1BSVA 4DIBA 3I9LA 3FF4A 1EE2A 2D2IA 2R2GA 3I4CA 4LRTB 2Q2VA 5L7TA 4OSOA 1D1TA 1KY4A 2QG4A 3WG9A 4RF5A 3GGPA 3K31A 3OF2A 3TSCA 2GN8A 4CL8A 4IDBA 2P91A 2HO5A 4BNWA 4QSMA 2J5KA 2OHXA 5G4KA 3IP3A 3OEWA 5JLAA 1X7DA 1YGYA 1ZVMA 2HRBA 3GEMA 4JJGA 3BMQB 3W4KA 3H8VA 3SBOA 4CUKA 2Q2WA 4EJMA 1YL7A 1X0XA 3B70A 1R66A 4YWJA 2I66A 4OXNA 4R68A 4IDFA 5L95A 1SMKA 3VH3A 4RGBA 4MVJF 1TA4A 1JQBA 1JA9A 2D5AA 1W4ZA 3LU1A 5IDYA 1XYGA 2XXBA 1YBVA 2D1YA 3Q11A 3ICPA 1MGOA 4PLGA 1BXZA 2UYYA 4J2HA 4UUOA 5F1PA 1BXGB 2X7HA 4GPD1 5L7YA 4IIVA 1Q7BA 3B1JA 1VI2A 4BGVA 2UV8A 1D3AA 4BMVA 5JMPA 3QJ5A 1YDEA 2O3SA 4NJMB 3CSDA 1DFIA 4IDGA 5F5LA 3UICA 4LMRA 3HE3A 4Z0TA 3GG2A 5A1TA 4ALJA 3RD5A 4E13A 2Z5LA 1R12A 3VZSA 4WPGA 3LZ6A 4TVBA 3GNSA 3X2EA 3IMFA 4D0SA 1XLTA 2J3IA 4XQ9A 1Q2XA 1Q0LA 3HWRA 5CFZA 5L53A 3QP9A 1DHRA 2AW5A 5U4QA 3ZHYA 3NUGA 3QWBA 3HQ4O 3WLFA 4EBFA 3U3XA 4FD3A 5F3RA 3EZLA 5BT9A 3RUEA 5A9TA 4DXHA 1O0SA 1H2HA 1UR5A 3RUFA 1K6IA 1IY8A 4XEHA 1SPXA 4QEDA 1X13A 3EK2A 5JBIA 2B35A 1LI4A 4ZN6A 3RU7A 3OBBA 5JAZA 2XPCA 1R0LA 4J3FA 4UVHA 1GL3A 5TT1A 3WGYA 1I2CA 3VKVA 2G17A 1KC3A 1ZSVA 4EUFA 4IDAA 3E03A 3HZZA 3CUKA 3NGLA 5FF9A 2W2KA 3GRKA 2H6EA 1VJ1A 1NFFA 3OIDA 3GVHA 5JO0A 2FPIA 5JC8A 3JQAB 1EUDA 5B1YA 1KEUA 2WD8A 3RAJA 3VPHA 4RPHA 1ONOA 1YB5A 3L9WA 2VUSA 3JQAA 4J0EA 4NU6A 3RC7A 4B4WA 2VHVA 1KBZA 3WGIA 1E3JA 1WP4A 4RVSA 1FF9A 2EW8A 3FBGA 3T4XA 3TNLA 2JD2A 1P1JA 3ZWAA 5KJCA 4MIEA 1T2AA 1HRDA 8ADHA 3KRTA 2BFPA 4BNIA 1H5QA 4GLOA 5KJ6A 3JQCA 4NR0A 4LMPA 1IZ0A 3GY0A 2CVZA 1YH3A 3JQ7A 1EVZA 3F5SA 4IZIA 1UDCA 1YRLA 2W8ZA 4Q3AA 4BKQA 1EK6A 4UUNA 1PJ2A 2QYSA 3ABIA 5KJFA 1ZK1A 3GG9A 1NXQA 1Z74A 3LLSA 1MX3A 4AFNA 1EQUA 1YL6A 1Z7BA 3DAGA 1DBVO 5FFFA 4U5QA 4EGFA 2EP7A 3GRPA 3KTDA 3OICA 1F0YA 2HMVA 9LDBA 2H1SA 5B12A 2JJYA 5C5IA 4ZRMA 1Y8QB 4G65A 3UH1A 3GVPA 5MGBA 1V9LA 4JJIA 3D4NA 3FPCA 3L07A 1ML3A 2Q1SA 2RAFA 3D3WA 4GI2A 3E82A 4XQCA 4QXMA 3MWEB 4J1TA 2HK8A 4TRNA 4PG8A 1S6YA 3P7MA 4BIIA 1MC4A 3FNGA 3K2EA 2BKAA 1IULA 3PWZA 1HT0A 3MJSA 1QYVA 1PTJA 3W4IA 1JW9B 4Z6KA 5DBFA 1E7SA 2IZ1A 2VQ3A 5IDWA 4H3VA 4CM4A 1UDAA 1HSZA 3ETEA 3U49A 1RWBA 2CNBA 2PZJA 5GZ6A 5JC1A 3GDGA 3JD4A 1OI7A 2P2SA 5JDIA 4OO3A 1CQJA 4NBVA 3LC2O 2C0CA 3DR3A 4GMFA 3LT4A 3NX4A 1K2WA 4YCAA 5A5EA 2WJPA 1CJCA 4EEZA 3I6IA 4XYLA 1EK5A 2RHCA 2JHGA 1B15A 1WXDA 4E2ZA 3BTVA 2FR8A 4WLEA 2A9FA 4BB5A 5K6AC 4E30A 3DBRA 2W90A 3K5PA 1K5HA 1EBUA 2CD9A 3VTFA 2NLOA 4E3ZA 3OJEA 1A7AA 1QV6A 1N7HA 1HLPA 1PIWA 3CMCO 3R1IA 4ZJUA 2B37A 3SXPA 4R4JA 4D7AA 1ADFA 2GYYA 1XKQA 3G49A 1LDBA 3NDIA 3COSA 4JROA 1ZMTA 2P5YA 1T2EA 5KNLA 1SB9A 2EWMA 2O3QA 2DQ4A 4H16A 4KUEA 1LSOA 2VWPA 1ZNQO 3BTSA 3ZH2A 4AJLA 6LDHA 1F17A 1G0NA 4IQ0A 4NJOA 2GASA 1ISGA 3WNQA 4E31A 4B3HA 3PYLA 2HMSA 4N18A 1LDNA 4Q3DA 4GQAA 4PLHA 1LDGA 4NK4A 3IJPA 4B7XA 4PFJA 3ANLA 1I2BA 2X6TA 2YDXA 2DM6A 1O9BA 1O6ZA 3QW2A 1PEDA 2JCXA 1RM4A 3FRJA 1GPDG 4JCOA 5JDCA 3OIFA 3NYWA 3MTGA 5EJ2A 5IN5A 1NFRA 2JAPA 2V7PA 3QIVA 1GCOA 4XZ3A 1NYTA 3GK3A 5EMHA 3RUDA 3OM9A 1NPTO 3PFFA 3E9MA 4NK5A 2E6UX 4RPJA 2QZ9A 4BO6A 4Q9NA 4YJGB 4GGOA 3IKVA 5B37A 4O5OA 3OJFA 4AG3A 4B8WA 4CQLB 1LLCA 1XR3A 2YQ4A 3FTPA 3GVCA 3O38A 3UCEA 1TEHA 5TS3A 1G0OA 2X23A 3HJAA 1RM5A 5JDIC 2WYUA 4HFMA 4MKXA 4J1SA 5JAMA 1O8CA 3DOCA 3JQ9A 1V0JA 2BHLA 2NQ8A 3RJ5A 1ENOA 3NDRA 4I1IA 3TPCA 3MJEA 1E3WB 4KQXA 4RPLA 4WLVA 5JXWA 4R1SA 2CDAA 1CF2O 4R69A 4ND2A 1LQUA 1FXSA 2YW9A 4OQZA 4L0QA 4LGVA 1LDMA 4TKMA 2G1UA 2WWRA 1F8GA 1Y5RA 2GPTA 3BMNB 4OIMA 4CQLA 5KCZA 1NVTA 2O23A 1E92A 1PS8A 4BHTA 5JY1A 3HB4X 2YFHA 5T57A 1XU9A 2BH9A 3UUWA 4CM9D 1U3UA 1I01A 1N1EA 4ALKA 4CLOB 5IJZA 3RUIA 1U2GA 2NQTA 4DA9A 4DIOA 4N5LA 2OORA 3WXBA 3GPDG 4XYGA 5JO9A 4OGWA 2OBNA 3KEOA 3DFUA 4DPMA 3UW3A 5LCXA 3AM3A 3R0IA 5ENVA 1NTOA 1YWGO 3PLRA 3RC1A 3S55A 2XXJA 4JP3A 4CMJA 1WNTA 3HFSA 1A4IA 1R4NB 4GX1A 4TKLA 4PVCA 4MP8A 3DAFA 2BGMA 1W8DA 2FSSA 4KUGA 3MJ4A 4XYBA 5EN4A 3JSAA 1VSUA 4BNUA 3BMNA 4RLSA 3RBXA 4YAGA 1YE3A 4BOYA 3SEFA 4WGGA 4CQMB 4JBIA 4Z9YA 2ZYDA 4GWKA 3EMKA 4CLXA 4GSKA 5GY7A 4PLWA 1RJWA 3QHAA 4R9RA 4BO5A 1P1IA 2C2YA 2NTJA 1LX6A 3MCVA 4Q3CA 1IOLA 1PJCA 1ZK3A 4ZGWA 3JQ9C 1NNUA 1U3WA 3F46A 4EYEA 3JV7A 2X9NA 1R4MA 1T25A 3BA1A 4PVDA 5KWEA 2G0TA 1N9GA 3Q2KA 4URFA 3T7EA 4U8GA 2O2SA 5LC1A 2EJWA 3WDSA 3GUCA 3JD1A 3QRWA 4AJNA 4EW6A 4NBWA 2DBZA 1GPJA 5TNXA 2YV1A 2YHIB 1YXMA 2EXXA 3DO5A 1N2SA 1N7GA 4W7HA 1GY8A 3V2GA 4FFRA 4I5FA 1P31A 3AU9A 3OECA 1AUPA 4YRDA 5BR7A 3KB6A 3L9XA 1UP4A 1AHHA 4HUJA 2Q50A 5TLSA 2PA3A 5JDCC 2P4HX 3FNFA 2DBVO 4NU5A 4BO1A 3F47A 2QYTA 1BTOA 2WD7A 3PGXA 1LXCA 5GZ3A 4I5EA 4YVFA 1X0VA 4M55A 4RQUA 4YT4A 3RI3A 4PN3A 1XEAA 2YV3A 3JTMA 3GMDA 4R01A 3AOGA 1CIVA 4BKUA 2WYWA 1L7EA 3WMWA 2D5CA 4MVJG 4JN6B 3PDUA 1DRUA 3LT0A 2FY8A 2RHRA 5DNAA 2HCTA 2J3HA 1MA0A 5TSDA 4DMMA 4J90A 1A72A 4TRRA 4DBZA 3K2BA 2A35A 4QUKA 4CQMA 5TF4A 1T4DA 3AUTA 4Y9DA 3UN1A 1AXEA 3CEAA 2OZPA 3D5TA 4ZQFA 1UXHA 4BGUA 5GZ1A 4MVJH 1AN9A 3CXRA 4FR5A 1IHXA 1LC3A 3WGQA 3C8MA 1Y9EA 1P0FA 1E1MA 3GF4A 1DSSG 4MDHA 3LF2A 1GV0A 1R4NA 4IJVA 4R41A 4OQYA 3ZNOA 3DZHA 3ZNPA 4LN1A 1WDMA 4CLHA 1IYZA 4DVJA 1SO8A 4W9NA 3AI3A 3N7UA 4IGEA 2ZK7A 5IDXA 1YQGA 1SBYA 1ZW1A 2CFCA 1EZ4A 2F00A 2X58A 4I9HA 3ULKA 5KJ1A 1ZUD1 4D46A 3TWOA 3ZU5A 3C85A 3GAZA 4C7JA 1MC5A 2WM3A 3JQ8A 1CERA 3EDMA 1QLHA 2WSBA 1HWYA 5ES3A 4O6VA 1NPYA 2P68A 1NASA 3JD3A 2VT3A 3VPFA 1U8FO 2ZTMA 4RDHA 1VJTA 2DC1A 4JLWA 4UVIA 5ICSA 3H9JA 2C82A 5G0UA 4L74A 1N92A 3VZQA 1DLIA 3TRIA 2NM0A 2FOIA 4EJ0A 5IXSA 1HDOA 3K9QO 5HRUA 3KOUA 3EW7A 2RH8A 5B4TA 3MJTA 2VWQA 3RCBA 5TQVA 1IUKA 1J49A 5JYDA 5L40A 2ZTUA 4BV9A 5ER9A 3JYQA 4BGEA 3G79A 3WGTA 4M8SA 3DZFA 4W9NC 3TOXA 2VRBA 3RIHA 3KYCB 2IZZA 4WLUA 2DTEA 4YJGA 3BHMA 3I9NA 2C7VA 4J2OA 1E3EA 3HHPA 3ENKA 1ZXBA 2ZKLA 2SCUA 3RUCA 3WIEA 1T24A 3KLPX 1IE3A 2EF1A 2PGDA 3E18A 3FWZA 4WEQA 3H7AA 5HS6A 1PQPA 3T7CA 2HKIA 4A27A 2VZ0A 3JQ7B 1JKJA 1Z73A 2X22A 4J4TA 3UCXA 3GGOA 3H65A 2YV2A 4ROSA 3IIEA 1NQOA 1HTBA 1I0ZA 1HDZA 2O50A 2YFQA 5JE8A 2O7SA 3P2OA 5DBGA 3UCFA 2OGUA 1QYDA 2X0JA 3GPIA 3DBLB 3R3JA 4CM8B 1PJBA 1RKXA 1VSVA 4D41A 5JYEA 1I32A 3WGOA 4LCEA 4FJ0A 5ILGA 1K6JA 3GMSA 4Z3KA 3DTTA 3KSZO 3PHGA 1LLQA 3GFBA 1LUAA 4JIGA 1F14A 2V6GA 4E12A 4WKGA 2I6TA 4D42A 5DOVA 1XWFA 2B69A 1E3WA 4CR8A 4AJ4A 1ID1A 5ER6A 3RFXA 4M89A 4FJ2A 4RZIA 1X14A 1TVEA 4GBJA 4BV8A 3I9JA 4IUYA 4MVJE 4Q39A 1B0AA 5LDGA 3G3EA 3ZN2A 3W4JA 3V8BA 5C7OO 4BVAA 4XDZA 1DOHA 2Q2QA 3W8DA 4XGNA 3TZCA 5K6AA 4W99A 3QWFA 4GAEA 1Z75A 2H5LA 2Y1OA 3K8ZA 1Q0HA 4ITUA 4WNIA 2JD0A 3JQ8B 2G82A 4YT2A 1HDXA 3AUSA 4CLDA 2FPGA 3ADPA 1PU2A 3OHSX 4E4YA 2C5EA 2DFVA 1K0UA 2HK9A 1PZEA 4J4HA 2VN8A 3H2SA 3D0OA 3DL2A 3H3FA 5KKAA 3F9IA 4LW8A 5L3ZA 3ROPA 1B8PA 2D8AA 3BZUA 4XWYA 1RPNA 2NU6A 4E33A 1NWHA 3I3OA 4GL4A 5L51A 3F1LA 3ZV6A 2VYVA 1R0SA 3KZVA 3O4RA 4PG7A 3H9GA 3I9OA 2IEBA 1YONA 1P1FA 3NTOA 4XJSA 1I10A 3EVTA 1E77A 1O5IA 3E9NA 2EGHA 2WYVA 1E6EA 2PZLA 3FHLA 4KP7A 4L4RA 4NMHA 2VYND 4WOJA 1GDHA 4PRKA 4TQGA 4ZRNA 3DOJA 3WMXA 4XKJA 3TDKA 2Y1GA 3ZNQA 3LK7A 4I9UA 4KOAA 4XB1A 4BNZA 3NDJA 5IXYA 1XA0A 1YBAA 2A92A 3CE6A 4WUVA 3DZKA 4PG6A 5TX7A 5JS6A 3PTZA 3PPIA 3TZ6A 4XD2A 3S2EA 1UXIA 3HNPA 4BMNA 1OZAA 1ULUA 1PWZA 1UAYA 1BDBA 2NU7A 2PD6A 2DUWA 2I3GA 3PJGA 4CLRB 3LDHA 2DAPA 3Q3CA 3FI9A 1GD1O 4QT0A 3QWAA 4ZA2A 5AXAA 3HADA 4E6PA 2W98A 1YOVA 4IY1A 2PKQP 1UZMA 4OM8A 2ZYGA 4B4VA 3BMOB 1T26A 2AEFA 3STHA 5FWNA 1H0KA 2FRDA 3QWIA 3ZV4A 2NVBA 4HY3A 3INTA 2Y0EA 1ZEJA 1SOVA 1WW8A 5G0TA 1P3DA 4N54A 2GZ1A 1TLTA 4NBRA 1ENPA 2JCVA 4XCVA 2PZKA 4EI2A 3OSUA 4YT5A 1C0KA 3PJDA 1LEHA 5A02A 1MFPA 3HDYA 3CZMA 2GF2A 2HSDA 3AUAA 4YAEA 2XF8A 1Y8RB 4WOKA 5I7SA
chains in the Genus database with same CATH superfamily
2V9ZA 3LQYA 3IHWA 4ND3A 2BE7A 3EXIA 1DT5A 1FS6A 3AL3A 1MB2A 4KGXA 4UFNA 1UEIA 2R48A 2ZE6A 4UBNA 4LDAA 2C92A 1TK2A 1K5DA 5IZCA 2PMCA 3UHJA 4DT1A 1J9EA 1P2UA 1M6VA 3E7XA 1N2OA 4CV0A 4AK9A 2JARA 2XSZD 3IEMA 1HKUA 3E5RA 3FNIA 1L7DA 4TLCA 4YRTA 1C0LA 3A1UA 2I80A 4ZAWA 5IAOA 2VDMB 5KB3A 3WSTA 1OXSC 4AYTA 4BAUA 1QFMA 1DEOA 1LTKA 1ZMBA 1JQLB 3G2IA 2YVLA 1UM9A 3P0HA 1Z5WA 2VT6A 2LKDA 5JI2E 4QM6A 4YACA 3HM9A 4E1AA 3OCZA 4V3CA 3IP1A 1YAJA 3C6ZA 1RWWA 3AVQA 4IG4A 3E6AA 2O2JA 1VL0A 3BSFA 4CTKA 2HNKA 4XX1A 3WI7A 4LV5B 4CG3A 1NLMA 3CZ9A 4JUFA 1X8JA 3PVCA 1YJ8A 3SS9X 1CQIA 3BSWA 3Q5EA 3S1SA 3SC2A 2NIPA 4BS9A 2PV7A 5C1OA 2HU5A 2F17A 1DXOA 1ISMA 2PLWA 4HVCA 4GC5A 5LA6A 1FRQA 4C22A 1PYOA 2DG2A 2OFXA 4J07A 4LOJA 4TN1A 1YL5A 2I4MA 1Q12A 2TMGA 2FUNB 2O05A 2YZGA 1YZFA 2H0RA 3N76A 1AQNA 1XK6A 2V7QA 1GRQA 3NIDB 1OLXA 3PXBA 3KQVA 4P9NA 3QMVA 3ORFA 1L5KA 5FTNA 2FP4B 4WXRA 1SG9A 1F5NA 3CMMA 1E5VA 1XEFA 1YR3A 3FNBA 5CA0F 1QHNA 1WM1A 3PHJA 3TJRA 2QTMA 3ANYB 2HNAA 3DVSX 4LZPA 4PTYA 4UHHA 1CUJA 5HF8A 2RD2A 1PHPA 5FIUA 5CDHA 1VJRA 2BZ0A 1XQ9A 3JATA 3EZXA 1UKEA 2V74B 2FQYA 1Z22A 4MKZA 5E9QA 1W7AA 3ZCQA 2G8LA 4D57A 1HDGO 3LC7O 3QXJA 4X60A 1IEVA 3UV7A 2HJWA 4RF2A 5MF6A 2GA8A 2DKNA 4HAIA 2Z56A 2PKXA 3Q9NA 4FKMA 4DV7B 3LBIA 1ZVJA 3ESCA 3ZGLA 2FSVA 2CDCA 2RAPA 3FGPA 1CJKC 5DNWA 4L8GA 3V2UA 2VJPA 3WLSA 1CF9A 3DKRA 4Y2RA 4JV5B 4CMIA 3PRYA 4FGZA 3C6XA 2F9FA 3DHWC 1Q2UA 2Q3EA 3BMCB 3UFXB 4UTNA 2O0JA 4LCJA 1ISIA 1BMFA 1RJDA 5I4IA 5KIAA 1U2DA 1A82A 1RTKA 1Y7PA 2XCIA 5JPCA 3SM3A 1PQ4A 5KKCA 4DUZB 2YCBA 1Z2AA 1I3OA 4TTJA 1KSGA 4YQFA 2JG3A 5A4MS 1HOXA 1SCKA 4NBUA 3LBHA 5D1HA 1VG8A 2C9DA 2IHYA 3CH6A 1XB2A 2FPXA 2OBLA 3EC2A 3V42A 5H4HA 1WZUA 3JYNA 4Q4DA 2XT6A 3DNFA 5ENDA 2CLOB 1FSGA 2EKBA 3FIUA 4YJHA 5DN6A 3R74A 3ZWMA 4DE5A 3SKXA 4NYJQ 2QX8A 1IK6A 2XWSA 3VISA 4HQ0A 2FLKA 1YIAA 2PPVA 4O8ZA 5GP1A 1F2UA 5T67A 1V6AA 1K97A 2B5OA 2CY0A 5IVIA 1X1EA 5CT5A 4EB6B 3CVYA 3KXIA 3R5FA 3AUJB 7ADHA 1IZ9A 4NYMQ 3SAJA 4EK9A 2CDNA 2D59A 3EQZA 1N5KA 3FDIA 1HEIA 2C1EA 4H2DA 3SICE 3LHKA 2ISSD 3GEDA 1JL3A 1EEHA 1GU1A 4L5IA 4ND5A 4ZHQA 1TEZA 3VV2A 1FNSA 1PJRA 2JGEA 1EHIA 5K05A 1U4OA 4CIVA 5IM4F 4Z53A 3WQQA 3WLIA 4UTVA 1PJZA 2GRUA 4COOA 2BBTA 5AJHA 1NT2A 3HDQA 2X41A 1WF6A 3TF5A 10MHA 4M9QA 5LLTA 3DUWA 1X7WB 3WIBA 2JGDA 4PCAA 1JDZA 1MX9A 3PDJA 1MO4A 3BCSA 3AJAA 4KN6A 1IN6A 2MWMA 3N2GA 7ABPA 2J9YB 1LJUA 4UUMA 3V4RA 2GLXA 3ZU4A 4YJKA 4DR5B 3NV7A 4D6XA 3EDQA 4PG4A 1EVLA 1WUHS 1SIWA 4QFCA 2NX2A 3KBBA 2GWHA 1UF9A 3T9FA 1U9IC 4KGVA 1R0BA 3C41J 4R71A 3AF0A 1JP7A 2O2HA 1A9PA 4X95A 1L5SA 1USUA 1T2NA 2FN8A 1Z15A 4LMAA 2AHRA 3ZD8A 4Z5XA 1D2CA 3VAAA 4DNFA 5TPWA 1WXIA 3BWBA 5KVSA 1GPBA 4P4GA 1IN1A 3EHEA 4XTCS 4A5OA 1GA6A 1CZRA 4HH4A 1UADA 4QO7A 3TTUA 4BNFA 2QRQA 4HDKA 1KVRA 5SY9A 2P2ZA 5AK6A 1SEVA 3K8QA 1Z6XA 5ITSA 4YYEA 4TVSA 3RS3A 1WDLA 2VJYA 1HL7A 1IM8A 1EDEA 2D74A 3B9BA 4LNUB 3BRSA 1E7WA 3UT5B 4E22A 4C07A 4MWBA 1N6PA 2PKRA 3O4VA 3PG5A 4MAFA 1VJDA 2A84A 1DEAA 3CLTD 4Y2HA 5JCPA 4LE1A 3L8ZA 4I3HA 2VPXA 1TQDA 4HBGA 3I6ZA 5JCXA 3BIOA 4I50B 2O3UA 3GEIA 3FH0A 1YVEI 3GH3A 3OQ1A 4HVLA 3T99A 3SVTA 5FOVA 4QTUB 3RSCA 1RZUA 1KGSA 1UWKA 2DR0A 3QJGA 3SLGA 2HI0A 1JTVA 5IARA 1INLA 3HUDA 1R8SA 1RVDA 1V95A 3HRKA 3NHSA 4AWXA 2FCRA 2FF5A 2FHSA 2ASVA 2OAEA 3L0ZA 3LUCA 4L4SA 4K1LA 2AW3A 4F86A 4YJ3F 3IBFA 3GYGA 2Y93A 2ZKIA 3KJZA 4UE3S 3UT0A 3VYSB 3UMVA 3GPBA 4Z9XA 1AGNA 1GFSA 3O4IA 4JKOA 4OL9A 4ZAYA 4BEWA 1VDZA 5KOIA 4FR2A 3KETA 4UE2A 3ZGYA 1Z56C 5CA1F 3DMNA 2XCTB 3OHMA 5IYZA 1ZD9A 4JZYA 2X8JB 1M72A 2X1LA 3TW0A 3W90A 4CT0A 1G291 3OTHA 5AVTA 2L42A 4HGYA 4B44A 2JBAA 2PK3A 3MHPA 5LLDA 1FK8A 3U37A 5BWCA 1PFVA 1UDRA 3DE5X 3DB1A 3BSSA 1C5KA 4G6ZA 2QAGC 3LX5A 2E0IA 3OE5A 3WS7A 1XG5A 2VHWA 4LGYA 5C2JB 3W9UA 1L1FA 4XDYA 3WGGA 4EYKA 3WSVA 1Z34A 2YZMA 2WTNA 4F21A 3WK4A 4CKZA 3K0FB 1CHNA 3QQPA 1U8EA 1Y1PA 3E0XA 3LAWA 5K8CA 2PMFA 4WERA 1J33A 5CT9A 3T5MA 2R4QA 4ML3A 1GGKA 5A3QA 4DQLA 1C9YA 4F6CA 3IURA 3K70C 1Z0AA 2FI1A 3HYRA 4DS3A 4Z7JA 2A1UB 1E2JA 4MTCA 2GZ3A 1BGVA 1NF3A 2IZ0A 2VFAA 1ZUHA 3GAMA 4J29A 2C98A 2OR3A 3AUUA 4TL8A 1QHSA 5FORA 3ZZMA 1PJTA 4B3MB 3AQ4A 3TN7A 3VRHA 1E6WA 1EG7A 4GMKA 4M6WB 4YCLA 3UBTA 1SUDA 3DZJA 4HC4A 3T3IA 4UHEA 4RF4A 1YBHA 3PCRB 3FAKA 2M6LA 4JBGA 4U00A 3THXB 4QBTA 3WRYA 2R1VB 1V2GA 4TVOA 3S4YA 1AO0A 4BTLA 1TUGA 3ER9A 4LCBA 3IT1A 4NZMA 5EUQB 4AY5A 3ZWPA 1EE9A 4TVKA 4FDAA 2WMDA 2O3JA 2JA2A 4HWGA 4XM1A 1W76A 2X0IA 4QUIA 2P2GA 4M37A 2QYOA 3OX1A 1GEGA 4GZLA 1JGTA 4ER5A 3CBQA 2CCKA 1L3IA 4Z3DA 3PJRA 3V8NA 4DDWA 3FKQA 4D8UA 5HP4A 3JU3A 2QQ5A 5DLDA 2Y1KA 3S2GA 1FYWA 2P5SA 4MKRA 4WY8A 5DO9A 1XC7A 4IZHA 3B1XA 2Z6AA 4R9VA 2BKVA 2Z3VA 4W6ZA 4ZYVA 2JLBA 2ZCJA 3MRXA 2ISCA 4NE9A 1MC1A 5K0EA 2OECA 2PD4A 4XA8A 3AEKB 3OIWA 4A8PA 5IS2A 2OWDA 3EFHA 2AUTA 1K8QA 2D4HA 3UMGA 1L4EA 3GDHA 4LFAB 1G7TA 2ZBUA 4RJ2A 4N3NA 1RKBA 4LNAA 1RCUA 2C54A 3Q40A 1OX5A 2WD7B 4OGFA 5IJ9A 3ACCA 1EB8A 2LIVA 3P45A 3AVXA 2R1VA 1KXJA 2Z9BA 3ICWA 3MCTA 5BVHA 1UOEA 1ZM7A 2L69A 3MFQA 2FMTA 4NEHB 3MGKA 2PLAA 1LCIA 2NU6B 3OIVA 4JC5A 3UG6A 1QO9A 4UEWA 3RU2A 2PRYA 2YHIA 4FSDA 1G9XA 3I2YX 1ONPA 4JD5A 1LVUA 1PJSA 3U3JA 4YAJA 4AJ1A 3UPTA 2BSXA 3SJBA 3W2EA 1KVUA 2X0NA 1DKLA 3AJRA 4FW8A 4NXNB 1FSFA 3C6YA 2PNFA 4OJYA 3RNOA 2ISQA 3T5DA 1VIDA 4GXRA 4Q01A 1T1IA 4C06A 2WKQA 4L28A 2EZTA 4L02A 4C30A 4OVKA 3BFPA 2AQIA 3PFBA 4HAXA 1Z6PA 4INOA 4ALMA 2CV0A 1NWCA 3IO5A 4I5IA 1C3XA 4ZPJA 2PR7A 5L8VA 3HVHA 1XVAA 2GN9A 2F2TA 4ZZ1A 1SVIA 4C3ZA 2ATXA 3WMGA 4O2AA 4D79A 1W96A 3ANMA 2DECA 3I8OA 3TD9A 2VAXA 3DONA 4QQRA 1LRJA 4HWKA 2FG5A 2VLBA 4LUCA 3DBOB 3T9CA 1ZIPA 4F2WA 4QELA 2R86A 4I5DA 3U3RA 2GN0A 3DKPA 1NZFA 1X15A 2Z98A 1PFGA 1V7ZA 1CY7A 1DJNA 1MJGA 1U0SY 3B3GA 3VJKA 2GB4A 3S27A 3T8YA 1U2QA 4A82A 1MA3A 4FI3C 2PANA 4OHVA 4EG0A 1VCMA 2YWBA 2ZWAA 1UWLA 4KGDA 4YV1A 5KNBD 5G41A 1CTQA 1PL0A 2NNLD 4MGZR 3SNHA 4YCNA 3CSSA 4RD3A 1E2BA 3ZDDA 3I2JA 3SX0A 3EZGA 2O48X 3QBDA 4K6FA 4YXFA 4BFTA 3G1UA 2W70A 3Q6NA 1BE8A 3PR1A 2WILA 4FI3F 2R6GA 1W0CA 3ED1A 5AYVA 4YHHB 2FWJA 3FUUA 1RAGA 3KKOA 3L6DA 4Q3EA 4HLUC 1GPLA 3GQVA 1FTNA 2NADA 3SJZA 4JI8B 2YMMA 4Z4CA 3WE7A 3LT1A 2FW1A 3HJGA 2A1IA 4JEHA 2CNWD 3USES 1MNAA 4XI9A 5DGHA 4TLEA 1OWNA 6CHYA 4LECA 5A2QA 4GPTA 4NPAA 3QYAA 1EA5A 2EW1A 4GVXA 4EHJA 1X9IA 1Z07A 1NGSA 3P71T 2OCAA 1ODTC 4D98A 1CE8B 5B4VA 4B4DA 2QM8A 3INYA 2ZS7A 3IUSA 4RL6A 4RABA 4U2CA 1V8OA 5DYTA 1Y9JA 2FSUA 1EFVB 1SUIA 3SDZA 2H29A 1U1CA 3RTEA 1YKFA 2C77A 5ARBA 5C3MA 1JEOA 2XD9A 5DZSA 5HKKA 5SZIA 1HYGA 1C0IA 1AN0A 1P7VA 2HK7A 3CG0A 3HCRA 3Q8WA 4R1LA 5H70A 5F1YA 5CIYA 2JAQA 3QFSA 3CEJA 4OYLA 3RQSA 4Z54A 1SBZA 2O5VA 3EVBA 4ZAFA 4C7KA 3M8KA 1WKCA 1TT7A 2V59A 3CUVA 3L7LA 4K9NA 3H9UA 4WKBA 1BN6A 3BRCA 4E5YA 1IZ8A 4TV9F 4P1ZA 4BFZA 4QFDA 4BX0A 2W37A 5E0OA 5C46F 2MINB 3CNOA 3OE7D 4F93B 4HAZA 3LNTA 4FNOA 1ZH0A 3VM6A 2CYCA 3ZZNA 2H54A 3HABA 1ESNA 3G5UA 4C7OA 3GD5A 3A4LA 5ALXA 3MIIA 1P0MA 4LDRA 1CUGA 1U1GA 2Q8QA 1Z4OA 2JZNA 3TDMA 2FWMX 3QK7A 1NR7A 1Z82A 4XIJA 1GAEO 3AWDA 4M1TA 4PRLA 3USCS 4Y6RA 4NCXA 2NTEA 1BZYA 3FJOA 1R6DA 5ALPA 4HCJA 3WMEA 1XN4A 4FK8A 4L15A 4NBKA 4HJXA 5HQTA 1CQPA 2BMDA 2C96A 3D64A 1G8FA 4IDDA 2CBGA 2VQ6A 3OEED 3GRVA 1D0VA 3ND7A 1RQXA 4XIYA 1EHYA 3KYDB 5BQ3A 1S2MA 1VC2A 2JHCA 2WIDA 2QT0A 3FMVA 4P92A 3KHUA 3M1AA 4ZQGA 1DQRA 1MOPA 1G6OA 2JFHA 1P2BA 1QDUA 1CHDA 3C2QA 3ESZA 1UZLA 3RWMB 5CPFA 2VTKA 3SYNA 4EKDA 2YJ4A 4QLOA 3DEHA 3OCVA 1VHLA 2Y1DA 1SPBS 2J9FB 3NHBA 2WPDA 2EIHA 4IXWA 4RU1A 4ZK6A 2BDTA 5A5GA 5LMUB 4IJUA 4NIMA 5HKKD 4OHFA 2QRMA 3WKDA 3OY2A 2X7JA 1H8HA 3C1TA 1ZKMA 1HX7A 4BQSA 1IXRC 1EGHA 5ECGC 2F1JA 2HLPA 4WLOA 4OAQA 5JYBA 2XKKA 1Z5PA 4RTRA 1J0XO 4P2GA 2CJWA 2DFPA 4M4SA 1VIVA 3F3SA 4JJ4A 4D9NA 2WVHA 5ESWA 4HAOA 2YZ2A 1EAYA 1GGEA 4CTNA 2XRZA 1NW7A 4IM7A 2I34A 1Y89A 3PEFA 4IQ4A 4UPDA 3UK1A 3VYUB 4A0HA 7MDHA 2GUWA 4L27A 3PNBA 5K0TA 1YTLA 5DGTA 1BMTA 4NLLA 3D6TB 3I62A 1SULA 3RIMA 1C3OA 5H02A 3AERA 3LWNA 4GWGA 2LCQA 3VFDA 2H1OA 2Z8ZA 4NVRA 1BRTA 5ITVA 3JY6A 4B5LA 4HTFB 3X1ZA 5GOTA 1V8DA 3S0JA 3DL0A 3TEFA 1I80A 4KQ6A 3RWOA 1UP7A 1T2UA 1DLJA 1SXJB 3NWJA 1EFRD 2I6FA 4IDEA 4V03A 4MR7A 3ZHUA 3LT2A 1N3LA 1N7JA 3HJFA 1GGFA 4EJSA 4HUQB 1CUCA 3KWLA 4OIFA 5C0OE 3JARA 5THKA 4S0ZA 2ORED 1RLMA 1IWPB 2DTDA 1QOPB 5LLSA 1ZK4A 1U7WA 4CGYA 4YRNA 1GJRA 2VCYA 3QHQA 5CBKA 5I3ZA 3TGLA 3HCBA 3VKWA 1YK0A 3CF4G 1G3UA 1R6AA 3RSZA 5AJTA 1FJGB 3TEMA 2YNMA 4FOTA 4DQXA 5FA8A 3P96A 4G97A 1Z36A 1DAEA 2FPPA 3B52X 5EXSA 4XWKA 5DNYB 1FFBA 2OB1A 2OY0A 3QKUA 4HXYA 2HMTA 1I6KA 3UGKA 4BLPA 1B8UA 1FXWF 3KZKA 4BQQA 1CB7A 1JR3E 1ATZA 1KAHA 1U2RA 2QRNA 3H83A 3LMKA 3OEHA 3O94A 3JQBC 4L9WA 2Q7DA 2E55A 3U4IA 5IG2A 2UUCB 4KXFB 3G0OA 3VTZA 1EFCA 2BI7A 2QWXA 3ZZ0A 4JLJA 1EUYA 2E18A 3MT9A 4YRJA 1YCGA 2EZ9A 1ZIYA 3C1OA 3K53A 4BXOA 4DCJA 4X1OA 3GN1A 5BSHA 4J7CA 4BO8A 4C0XA 5DNCA 3WMRA 1JG6A 5BOSB 3WKAA 2YVAA 4QOEA 4AY3A 2DKFA 3IXMA 4FFSA 2VTBB 2G5PA 4OFWA 4WCFA 1WKBA 3PHIA 5FL3A 2Z9CA 4ZV4A 4GMGA 4XSHA 3FWPA 1QAOA 1WCXA 1M6VB 1NC1A 1QH0A 1SELA 1SUSA 2B92A 2I9PA 3PEEA 5TVGA 3RVJA 4I46A 1K06A 4Q4JA 3R3VA 4TQ9A 5LOVA 4WJZA 5EIXA 1AF7A 3KXLA 1PJAA 4OMCA 4DSUA 4KQFA 2QW8A 3I6MA 1UPTA 4JP2A 3CX4A 2YASA 1YMVA 4AF6A 4G1BA 4F3RA 2PH5A 4L16A 1ABFA 5GMOA 4ZDKA 1E1NA 1H9CA 3QUCA 3C4VA 2NUBA 3SE0A 1ACMA 3NXKA 1S8NA 1SN7A 2Q4EA 3PUHA 4H6PA 4CKBA 3HJCA 2QR5A 2Z9DA 3E48A 1RYDA 1YR9A 1YZUA 2XBLA 4U7PB 4YDSA 3NV9A 2IY7A 3ZR4B 4YCSA 1H4QA 1KFBB 3OFSA 1G8YA 2WINI 3WMFA 2V03A 5FPQA 1EESA 5KKNB 1QVRA 1K75A 4HMQA 1WNFA 1W52X 1YNOA 2HSWA 3IT2A 3L4EA 4HR7A 2IU0A 4TZ0A 2Q5IA 1PNQA 4FEEA 1GR1A 2CB0A 4OGGA 5TQ2A 3TQTA 4Q7JB 5BUCA 5JJLA 1V3VA 1XTVA 3JALA 5EWMB 3SJ7A 3A32A 4X3PA 4XR9A 2WSIA 5CT8A 1V16A 4WBNB 4IW3B 3EAGA 2CVPA 3H1TA 2BMFA 3X1KA 2J5RA 4AZ3B 2ECKA 3ZBTA 1E99A 3TRKA 2GXQA 2BLLA 4WXPA 5COQA 2B3DA 1M1NA 4U3JB 3REGA 3VJRA 4RSGA 3AO0B 1OT3A 4WCFC 1GZ4A 1QTNA 3LDFA 4BLWA 4BO7A 4F9EA 1K7CA 4CIAA 3K73O 2ZRJA 1A7JA 1L6RA 1AT1A 2CVHA 1ISHA 2YIDA 3QYJA 4R5MA 1K89A 1QC5B 1W0JA 1W30A 2GO7A 3TOSA 5BNTA 1WMAA 1TIKA 4M36A 4D3DA 4UOZA 5CDGA 4PSAA 2ZB4A 3QU9A 2CZCA 4GLLA 4II7A 4AO6A 1N6HA 4KI7A 1MIOB 1U65A 1D2AA 1WX1A 3PK0A 4RXTA 2B4TO 2FSGA 4F46A 2VJMB 3D43A 3G85A 3CW2A 3N8HA 3WWDA 5CDFE 2C5SA 2ZRIA 2DWPA 1J24A 1MT3A 1QM5A 5KCMA 5BW8A 4YRAA 5HIJA 2RE8A 2C7PA 4TZ6A 1JKXA 1QGDA 2GVZC 4GPZA 5KDOA 1PGJA 4KQ1A 2PKWA 2AQHA 3W2FA 3G0HA 1DBIA 2XNCA 3GLHA 3RODA 5AD1A 2G72A 1XLUA 2YNMC 4H6WA 5CNIA 2R68A 2V9PA 2AFHB 2QJOA 1LDYA 3RU3A 2H7XA 4AYWA 1ZGGA 2FZWA 1W6UA 3WP0A 2AMLA 4PZPA 2DFDA 3RYHA 4OHRA 3OX2A 2I4NA 3CRQA 1STOA 4DYHA 5B7QA 3ZHOA 2OL4A 4PFKA 2PCLA 4NFYA 3ZWOA 4PF1A 2JIQA 5AHWA 4EJSC 3KT6A 4KKXB 5LBIA 2FEXA 4W63A 4BB0A 3DDUA 2GXAA 2XOKD 3D7KA 4Q12A 4S1OA 5HKBA 3ZJTA 1WXEA 2C7GA 2AMYA 2JH8A 2IYYA 3AEUA 2YN0A 5DMXA 1NM5C 3NOXA 4K03A 4BUZA 4CIWA 1EWQA 3UWSA 4KNYA 4BNJA 1Y5IA 3LPLA 4ER0A 3OI7A 2CFTA 3NM5A 4JCCA 4UXIA 1ODFA 5HIAA 1U4SA 4WJLA 3M6XA 2BGJA 1DJPA 3NPAA 2OZKA 1HE3A 2XEXA 3BIWA 4OKSA 4TLLB 3MPUA 4D9FA 5EJ9A 3R3YA 3VR2A 2XYQA 1K9SA 1YZLA 2AG6A 1Z7YA 2BMJA 5E2AA 3JAMA 1N5RA 1AA6A 2BIFA 5EE9A 2IT1A 2ZIWB 4MS3A 4L72A 2LVBA 4RBNA 4WZAE 1PGQA 2RGRA 2C2OA 2N9UA 1JLLA 4AL4A 3JD0A 4BC0A 5LXTB 4HX9A 1SBIA 1SXPA 2J9GA 1XZCA 4I99A 3M1YA 2XVXA 3ZUPA 4ARUA 3H5OA 1T4GA 4K05A 3MD9A 1D1SA 3K9NA 1FP4A 5IAAA 3IVMA 3FCYA 5CDTA 2ACWA 1PS9A 4R3WA 3KV3O 1DIHA 1LWNA 2XMQA 4CETA 5AVXA 1T2FA 1PG5A 2HTEA 3O75A 2ZBRA 1F8FA 5ALSA 1FFWA 1N2CE 1N8TA 1HBJA 1UZUA 3D0KA 4KNVA 3OURA 4RPGA 2HJHA 3LO8A 4PN7A 3WAGA 5BN4A 1TZ2A 4ARZB 4KPGA 3AY7A 2VJCA 3UAVA 4ATNA 1Z4LA 2VTEA 4OHPA 2OAP1 3DMTA 4Q4AB 3KLOA 3TLCA 5A04A 4A0QA 5EY5B 4WFIA 3H5NA 1RXVA 2HQ1A 3VJLA 1G42A 1EWYA 3B78A 1G21E 2FLVA 1GLVA 3LO5A 4U1RA 4MI9A 5KHLB 2VWGA 5ECDA 3KNZA 3TXAA 1XTBA 1CUFA 4WK0B 4WBNF 2WTXA 3SY8A 5ADHA 1C9NA 3CU5A 2ODPA 2CV1A 1Z0IA 4HRYA 5CP8A 2WT8A 1SAYA 3HWX1 3WHPA 1Z62A 4LIPD 3PF9A 3W7AA 2BKUA 1MV8A 1PGNA 4FFVA 2P9CA 1IWBB 4EO9A 3N3AC 4L4XA 1A4UA 1DCMA 4NFLA 1Z7EA 3W77A 5F7JA 3D81A 1KDYA 3JYLA 3GLHE 3NAMA 4HDRB 4EGQA 3N8DA 5HE9A 5CYOA 5H3CA 1TAUA 3JWPA 3M7IA 4QU0A 3ENZA 4BGDA 5KSYA 1WBBA 1NF2A 3KZOA 1G19A 3U40A 3H2ZA 4FFNA 4JOQA 5AVUA 3QE4A 1VFPA 1GV1A 1MEOA 2XNDD 1KO7A 4YV2A 4FGUA 5IUJC 2Y0BA 3FFXA 1Z26A 3PD1A 1K4KA 4LQDA 1MDBA 1YJAA 3D1LA 3JWGA 4MKFA 3T1HB 4PY2A 2ZJ7A 2YKGA 3ZK7A 1J6UA 2OTCA 3I2IA 3IPRA 4KLCA 1EBFA 4CEHB 5B1DA 2EG9A 3W79A 3HFGA 2HXYA 1JJ7A 1WSBA 3P27A 4Y9SA 3BD7A 3L02A 1A2OA 2HGZA 4ARCA 3WB9A 1SQ6A 3DW3X 1FYXA 2WY2D 4CTJA 2HWKA 4Q18A 2PX6A 2DJIA 3NJ4A 3C7DB 4M1OA 1KAQA 5BORA 3COZA 3C8ZA 4IWXA 4AX4A 1JUDA 2R1TA 2YQ5A 4AJIA 3LBYA 2AQKA 2BF7A 5G3YA 4CWAA 1AS0A 1OJ7A 4KMRA 4Q3LA 2HF8A 2QAJA 4HLUA 2ZT5A 1KXZA 1R50A 2ZJ1A 1LVGA 3ILSA 3EGCA 1GZ6A 2BHTA 3KT8A 4NMMA 1JBEA 4P54A 4ESHA 1BNCA 1FTGA 3E1SA 4RVGA 5LUBA 4EPTA 1EM8A 3ET4A 2XLCA 4A1FA 3HNOA 2CDRA 4QODA 1ENYA 4CI0B 3OWXA 2FEWB 3THWB 1G7CA 3MGCA 4PSDA 3CLSC 3N39C 2ZANA 4HHEA 3RUAA 2GJ8A 4O4IA 4UNIA 1IQPA 1U99A 2GZHA 2V7QD 1OMOA 4W7IA 4CBVA 3P2YA 3TE6A 2NO0A 3FKSD 4XTRA 5DKFA 3X1WA 1I3MA 1N2JA 3DT6A 4JITA 1H66A 4DCOA 4NPHA 1QDEA 2V9CA 3HL0A 4OL0A 3ZNNA 1SKQA 3NGXA 2ATEA 3GJ5A 3OLXA 4F7DA 4YUAA 3QKSA 3UZUA 4H4CA 5HBRA 1CVLA 2C2HA 2IUSA 3BMCA 4H3KB 4UUBA 1FDVA 4O1IA 4E5PA 5JFOA 3TFOA 1SM4A 1AU9A 1VCOA 1NJ8A 1P18A 2X5OA 3H9EO 4ZAGA 1L1QA 5T3UA 3AF5A 4HNRA 4MJXA 4G8DA 2FH5B 3FLBA 4B3IA 4TRJA 4PZEA 4HS9A 1UANA 2XODA 1IAVA 4DLKA 1JA1A 3B38A 2B78A 3WFJA 3PFGA 3ZTYA 4UTXA 5A06A 3UNXA 4J6EA 3RRJA 1E9RA 1R5NA 4QPJC 3W5DA 1M1XB 1DC3A 5DP1A 3SEZA 1GQRA 1U3TA 5LZ2A 4M0DA 3KSDO 3QVVA 4P5EA 2H2HA 5KSWB 1E5DA 2PX3A 1I7LA 1G3MA 2HHAA 4I50F 4DLTA 4IIUA 4ALNA 2AS0A 4FPXA 2O8VA 3LQ1A 3ZUGA 4DPKA 4NZYA 1JSLA 2K5UA 3O8CA 1FPMA 4OOEA 4FXOA 3IAEA 3AL2A 5CCXA 3H1AA 2JI8A 5ALRA 5T5QA 3N07A 5L3SB 5FUXA 1FS4A 4H1TA 4HMOA 2B2NA 3MYYA 3MF4A 4LC9A 2PZMA 4REOA 4LX8A 5B3JC 4CM4B 3PUZA 4BNDA 4L5AA 4BXOB 1CRZA 4ZJYA 4RHXA 2I65A 3RC3A 3D3KA 5KWSA 4B47A 2Q45A 1TTQB 3RBVA 1TM4E 3LDUA 1QSGA 1M1YA 4TKUA 1RKUA 3EGIA 4HGRA 5C5CA 1QFYA 1RC1A 3ITNA 3NG1A 3KUCA 3R5XA 2GLUA 1XDUA 4LC1A 4YS6A 1IU9A 4RD1A 2IUEA 1F4LA 4R8MA 2OBXA 4I4TB 3NKVA 1LA2A 3TLBA 4RMHA 3UC5A 3PE3A 5BQFA 4HLDA 1DBSA 4IICA 3KOOA 4MZDA 4CFSA 4KR2A 3E61A 2C3OA 4CLEA 5BUQA 3HXTA 1SFRA 4PG5A 3ER6A 4Q9LA 1EFKA 1BMDA 1YU6A 1ZD4A 1QGOA 2ZQYA 3KR0A 3QVGB 2UVPA 4LA4A 4RM2A 5G1PA 4YCCA 1V5GA 4U7GA 4F4JA 4YXWD 2J59A 3EZ7A 4TL6A 5LQDA 4RJTA 4JGIA 1HZJA 1H0SA 1KZ9A 3EMBA 3F71A 1VL1A 1K3UB 3MYRA 2O4CA 4G4JA 1GPKA 1AURA 1CZNA 1QPGA 1WXHA 1KMNA 1XTUA 2GTIA 2Y99A 3QUTA 4LTNA 4MLZA 2CLLB 3WQHA 2WLSA 2FX5A 5AHOA 3RSGA 3VTKA 2IYEA 2XI4A 2NVUA 3ORRA 3QBEA 5AM0A 3WKCA 2ZSUA 3W6UA 3MMXA 2Y0PA 1BXKA 1DQPA 4ZVLA 2VS1A 3OIGA 5EGNA 1BW9B 1C7IA 3R0VA 3U7FB 3DFIA 5JHHB 3TBHA 1ZXLA 3LT5A 3NO4A 2JKVA 3GBVA 4DQVA 2O8DA 4NC9A 3E8SA 3EA0A 3FMOB 2GHIA 1L8AA 2GBLC 3C1AA 4PHTA 1TT5B 1FY2A 3A25A 3BRWA 3DDNA 2B1GA 3HZOA 4IZOA 4JDUA 4MCAA 4CNQA 1IPFA 4HRVA 4BV3A 3DYVA 1CSEE 4Q6BA 2IX9A 3F6BX 5T3YA 5AW3A 4F92B 3VPXA 1PZGA 1X7XB 4HFNA 2WWFA 3D6VA 4KYUA 2W2PA 1GYRA 1P4AA 2DFKB 2NNWB 3R20A 4WRRA 5JSQA 3ZCUA 1MP0A 5C7LO 1N3BA 1QX4A 1A27A 1U1IA 1KK3A 2UAGA 1C4OA 4QBFA 2XQKA 3G2LA 3T5BA 4EY6A 4LBVA 4P5PA 1M0TA 2VNSA 4PCLA 1NA5A 3S7TA 3SK0A 3WZLA 2OAQ1 3I0MA 3T3NA 1BWPA 3IR5A 3EHDA 2IBSA 2M1ZA 2R4TA 3GI1A 5DNEA 3KVRA 1U3VA 4MRRA 2B3TA 4AKSA 3KSUA 5ALOA 3GOHA 2C04A 2X0KA 2NOAA 3ZDFA 2WVGA 2MR6A 2G9ZA 3AR8A 3GVIA 4PLVA 3RG2A 1TB4A 5AKYA 5EE3A 1OV4A 3K1YA 1IQRA 1OVMA 3DD1A 1Y7TA 1WZIA 2FPWA 4CMAA 2PZBA 4MOWA 2XUFA 2P9GA 3PB3A 4QX6A 3B7GA 3I1FA 3TLEA 4FJ1A 1OX6A 1USGA 3OUZA 3TLAA 4ZC8A 1THZA 3B9RA 2ZYAA 3G5MA 3AK4A 3OTGA 6NULA 5LUAA 3Q12A 3BXZA 4US0R 5HUHA 1OAAA 4HQLA 3KR1A 1NQTA 3V8VA 4OI0A 4CM3A 1X7GA 1JE1A 4P86A 4ZKEA 4NDNE 5FPKA 1A88A 3BJIC 4HFRA 4IEEA 1A9YA 3K94A 5B4UA 4HXGA 1QB7A 4YUXA 3H1FA 1BVHA 2J7PD 3WRVA 1BQEA 1ZRHA 2XVZA 4QOSA 2QIPA 2QGZA 3H0CA 3NASA 2G1KA 2VHXA 3PVSA 3ZWBA 3FVWA 3O4JA 5AVJA 1RSZA 3DZGA 4PANA 2LDXA 3WLOA 5T8KA 1P5RA 1OW3B 1T2VA 4MYRA 4EENA 1P7PA 4QARA 5LM3A 4A8JC 1YDWA 5F78A 3RVBA 5LQKA 1JHMA 3IDZA 4HEJA 2ZB8A 2ZIGA 5BOVA 3WB1A 4EA8A 1JDNA 1KJYA 2C3MA 3EFBA 2ONKA 3HU5A 4WESA 2A5JA 4HV4A 2JS7A 5DT2A 3Q41A 2XCQA 4JI0B 4EG5A 1KMMA 3BS4A 2PE5A 4J7UA 3ZW7A 3KO8A 1OZFA 4OREX 5B6PA 1DX4A 2B2CA 3TLMA 3WYCA 4JENA 4PC2A 5AOVA 1VKRA 1U9IA 2XX3A 3ILXA 3S7ZA 1RXWA 2OO3A 3KZCA 3TECE 4Z1OA 4A0FA 2J3KA 2BDUA 2C9MA 2QGFA 2WIJA 1BQ4A 3GFSA 3H11B 2GD2A 4J0GA 2ZUTA 3RR2A 4RTNA 4RELA 2BEVA 1JIXA 5F76A 4ZV7A 1T9GR 1VOTA 1XL0A 2R3SA 4OLJA 5TC4A 3RFCA 5EJ4A 5LR6A 3IEKA 3OQNA 1TI7A 2H5EA 2VJNA 3R9XB 1I7DA 1OV6A 3U0BA 2VT2A 3MVEA 2ZZMA 2YRWA 2WWVD 2DBQA 3DBRB 4WA7A 2YJ6A 4IWNA 4L0DA 1ESMA 2PMBA 3KE8A 4A2WA 2QD1A 4DANA 4EGCB 4BZWA 5BN5A 1E2PA 2KHZA 1N9KA 3BWVA 3BN3A 1K92A 3SNKA 3C8DA 4LZZA 1UBCA 4MKHA 4KSCA 2BBSA 3J81k 3D0QA 3DWIA 1Z6ZA 1RLOA 2PGOA 4QDJA 1TUIA 4DQUA 4DEYA 4P80A 1PO7A 1QFXA 1O0BA 1S1CA 3NB0A 4MV6A 2WOJA 4Y6SA 5IAJA 2J6CA 1EK2A 1B6TA 2HADA 4BKPA 4AICA 2Q9AA 4XW2A 3TD2A 2C84A 4OP2A 1NXTA 3H0EA 1A96A 1VE7A 1A76A 3WBJA 5ALHA 5SYMA 4J0QA 4WDQA 2OPHA 2B4AA 3QVXA 5FJJA 4PLYA 2FRXA 1BKDR 2BFFB 2FEOA 5JATA 4RMJA 1HURA 2ATIA 4N6OA 1BN7A 1XMIA 4J1QA 5CX1B 5EIOA 3Q7EA 5LNK6 1VGRA 1J0CA 2AOVA 3L7BA 1YUMA 1ILWA 5EZSA 1EVIA 4MA0A 2GPJA 3E35A 1XEXB 1HE8B 5G40A 5A3JA 3T12A 1O97D 4F84A 4YPOA 3A1EA 3K9WA 1PAUA 2G4VA 1DUSA 3WHIA 4CG0A 3C97A 4KAJA 3R24A 3NBMA 4XJVA 4PV7A 3ZQ6A 1OFVA 3HZRA 2IU3A 3S5JA 3IBYA 1KKMA 2QRLA 4IBOA 4IHKA 3ICEA 5DW0A 4AN0A 1A69A 3TG8A 4LE2A 3PCXA 1JDBB 2VZ9A 1FRZA 4W8OA 1JIJA 3E8MA 1JS1X 2CUNA 3VGJA 7REQB 3T5PA 2FSVC 5IULC 2P90A 3G2PA 1CULC 4NH0A 1VJ5A 4F9GA 2YYSA 2Y9MB 3Q6IA 1UMBA 2I5PO 2YQZA 2IP4A 3TPFA 1L5MA 1E3SA 2GTHA 1W87A 3JQPA 3HXOA 4CM1A 2NZUG 5AIAA 2PKYX 3FZQA 3TTWA 1C4WA 1LTHR 2X9VA 1K8XB 2G6TA 3L4SO 4XUDA 2VSNA 3WIOA 4K9KA 3B7PA 2VSFA 1SCNE 1A9ZA 1KZ1A 3IR7A 2ZYWX 4MINA 5DNVA 3CE9A 1JFVA 1FYFA 4RLFA 3IMCA 3LGAA 3NHLA 1UBEA 3GGSA 3MWDB 4LYGA 4NPCA 4U0JA 4YMSA 4E03A 1ECBA 3IILA 2A9RA 2Q28A 3H13A 3KPJA 2HJGA 3UPUA 1TRHA 1G6KA 1T8WA 2LP4Y 4QU5A 4FYYA 1JU4A 4AVYA 4JLAA 1U0EA 1VB5A 2CLHB 2EKQA 3KHTA 4PC1A 4UBOA 2GEVA 3VNQA 4BBJA 4KAAA 4DA6A 3AP2A 2AZTA 4M0CA 4LOHA 1J42A 4E08A 2ZUFA 1P1BA 1U3CA 1COWA 1P3JA 2KLBA 4LK3A 1L5NA 2P2CA 2ZCVA 1T9AA 3RS4A 5LDDC 3C14C 4QDTA 5EC8A 3QOFA 3ZOKA 2WG1A 5CB4B 4C7MA 1GTJ1 1GU7A 1ZK2A 2IDJA 3MOGA 3SHWA 3PUWA 4X9XA 2O5EA 2L18A 3VZRA 3OO1A 3I72A 4W4TA 4EMBA 1S9DA 2C5BA 5AOCA 1KDRA 1PEKE 4JFRA 3IYLW 4Z1MD 3M5DA 3W5HA 1IZZA 5DBHX 3HXQA 2RMKA 4JR2A 3PPXA 3THRA 1RXYA 1MCZA 4TKVA 2O8DB 5JY6A 4QXQA 2W2LA 1DFHA 3AXTA 1G60A 2OYRA 1DIAA 1CDOA 1MEEA 3GRRA 5C3UA 4PRZA 4EL0A 1LBSA 1UFQA 1POXA 4DLLA 5LYJF 4QEKA 1CNFA 1EVKA 2RGUA 4NBNA 3MWJA 1GPNA 5F2OA 3DO8A 3NIWA 5DCWA 4MRMA 2JCYA 2DU8A 4URHA 3DVAA 3W3ZB 1V8PA 1JVSA 2PKCA 3DLHA 2H11A 8ATCA 1QFZA 5IZCC 3FFTA 1Z88A 1DUVG 1MABB 3KX2A 3P26A 2ZTVA 1ZOOA 1J9ZA 3V3KA 4A2CA 1KAGA 4R9UC 5EJFA 1L7XA 1Z4KA 3KLMX 2CMFA 5KU7A 4ZCLA 3NCTA 1Z0DA 4X54A 1NVXQ 5FHRA 2P5UA 2QDXA 1SC4A 1N2BA 1T6NA 1I6LA 2GYWA 3ND9A 2CMGA 4UD2A 2DCMA 3WL7A 1EE2A 1T4CB 4YMUA 4O4JB 3TFWA 4L1KA 2Q2VA 2BP7A 2H06A 2BN4A 3TTXA 3WWCA 1YZQA 4CIYA 4MV0A 5L7TA 3ZVMA 1D1TA 1T9GS 1S9HA 1F51E 1ZU4A 2O14A 1VRVA 2QJWA 3E2MA 4P3PA 4V0MA 2HFJA 3K31A 3OLZA 4Q02A 4F71A 4IDBA 3LW8A 4RK5A 3NKFA 3E7FA 3Q8KA 1ZG3A 1MVN