5JDIA

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase
total genus 95
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiA00
1MXHA 4ND4A 1C14A 3G17A 1LI4A 1CQJA 5EINA 5DNAA 3U4HA 1LTHR 1HZZA 4IQGA 1YE3A 4RO0A 4EITA 4PFJA 4NFSA 2UAGA 1M75A 3INTA 2BGLA 4R3NA 3WMWA 4DLLA 5TIIA 3C1OA 3RI3A 4QTZA 3WBFA 3KRTA 1M66A 1YDWA 1FDVA 2CMDA 3JQ7B 3JSAA 3STHA 1AE1A 2DC1A 2ZTUA 4WE3A 3QVXA 2C29D 5B4VA 4BMNA 3H5RA 3IDSA 4HNGA 4I5EA 3W6ZA 3PHHA 2CVOA 1EK5A 4IS3A 1VL6A 1SB9A 1YQGA 2VWQA 4CQMD 2NTJA 1DDOA 1LRLA 3KM0A 5G0WA 4AJOA 3NTQA 3NDRA 4WGGA 1I2ZA 3F1KA 2ZJ1A 3B20A 1U3VA 4DLBA 5FFFA 1IPFA 1T2FA 3MJVA 5TT0A 1VPDA 4BVAA 4Z9YA 5HTOA 4OOEA 4PLGA 4JX8A 1D1SA 3U4DA 4D3DA 2AW5A 4XIYA 5F5NA 1KYQA 4XDZA 3RC7A 3X2EA 3JD1A 1FDTA 3TL3A 1F0YA 2ZK7A 3PLNA 3PJGA 4MIOA 1S7CA 1GYRA 3UCEA 1E7WA 3O8QB 4QUKA 1DLIA 1GUZA 3BMCB 4L4RA 5IXYA 1YB4A 1U8XX 4EJ6A 1D7OA 4CMGA 2IODA 3TNLA 1H9BA 1P1KA 3ROKA 2Q46A 3S2IA 1EE9A 2OP0A 4ESOA 4ALJA 2OL4A 2OXIA 3WFJA 3GDOA 4YEDA 4UEKA 4DBVO 4R69A 1ENOA 3JQ8B 2SCUA 3JQ9A 4NJOA 4ID9A 2Z1MA 4RORA 4UULA 4UUOA 2YFQA 5JCXA 2HRZA 4YDRA 4EYEA 5JLAA 3PRJA 4MVJD 5KCZA 2GN9A 4CLOB 2DTXA 3GEDA 3TFOA 5J23A 5JYDA 1H93A 1W8DA 3HDJA 2WWRA 2EIHA 5IG2A 3LT4A 4L75A 1T2DA 3ZGYA 3V1TC 1DO8A 4EUEA 1PJ2A 3E5RA 4CJXA 4DUPA 2WMDA 5C5IA 3WYBA 5BSFA 3ANLA 5MDHA 1PGJA 2EXXA 2P91A 2O3TA 4OQYA 1NQAO 4M89A 1GQQA 2QQ5A 3O9ZA 5KKCA 3DBRA 1PTJA 4M1QA 2GERA 4J16A 3UGKA 1X1EA 5TC4A 3HFGA 3OQ1A 4MIYA 2Q3EA 4JXKA 3WS7A 3B1KA 4O0LA 1ZCJA 3DB2A 3QJ5A 3WDSA 4CUJA 1Y8RB 4LISA 3NX4A 1ZMTA 4IGEA 3FD8A 1WMAA 3PHIA 3BMNA 4J4BA 3RUAA 4CODB 1U3UA 3C3XA 4NG5A 1LDBA 3KYBA 4IY1A 4N5LA 4YVFA 3D4NA 4FFMA 3ZU4A 4CQMA 4E2XA 1GFSA 4E6PA 3KBOA 1RM5A 3GR6A 1LA2A 5DBGA 1T26A 4DBZA 3DZHA 1E1NA 3GVIA 4O63O 2Q2VA 3TJRA 2O2SA 4LVUA 1QKIA 2FZEA 4LRSB 5JMPA 5T8KA 4B4WA 1CF2O 4FPXA 4Y9DA 5KWEA 1S6YA 2IZ0A 1I32A 4XRRA 1XSEA 3TSCA 2IEDA 3WWYA 3Q2IA 4ND5A 3A06A 4IDDA 4E5KA 3TZQA 1U5AA 3I9JA 1HYHA 3GRKA 3JD2A 1F14A 4GPD1 1N2SA 2VQ3A 1NYTA 1ISIA 1SPXA 4WNIA 4I8XA 4D3SA 3LC7O 4FQ8A 4WOKA 5C3MA 4IGFA 2O4CA 1JWAB 3BMOA 4EJMA 1CEQA 4KUHA 2H6EA 4DLAA 3QV1A 4HUJA 4YAJA 4GX2A 1PJCA 2BKAA 5FWNA 4ZJUA 4YWJA 3ZNNA 1H6BA 1AXEA 2AE1A 4RPJA 3OJ0A 1Q2XA 1HWYA 4FCCA 4WLVA 2Q1UA 5BR7A 2GYYA 5GZ6A 1P1FA 1LDGA 4RL6A 1N1GA 4CV0A 2Y68A 4DRYA 4H3VA 4JCOA 1EDZA 5GZ3A 4DTIA 1X7GA 5A9SA 5JDIA 4FFNA 1F8FA 2JD0A 3QVSA 2AEMA 3HDHA 1SBYA 1E92A 3LK7A 3LVFO 2NU7A 1C1XA 2NQ8A 1BHSA 4CPDA 1E77A 1VL0A 3QWHA 3GPIA 1HT0A 1GQYA 1XCBA 3RU7A 3TZKA 1I2BA 4AJNA 3HB4X 2IZZA 1IUKA 1RYDA 3AW9A 3R3SA 4IXTA 2WYVA 1P1JA 1V3UA 4F3YA 2W90A 4FFLA 4AJIA 4W7HA 1GR0A 3AM4A 4L4SA 2C5EA 4IPTA 1VJ1A 5BSGA 1CIVA 2BLLA 3NT5A 4BO0A 1RM3A 4BGVA 4DPMA 5IXSA 3GA0A 1PZGA 4NMHA 4E2YA 3UN1A 4QO8A 2C0CA 2R00A 1QORA 4LSWA 4UVDA 2WDZA 4LCEA 3KYCA 4P38A 1VJ0A 4N5MA 4NU5A 4RPGA 4K9DA 4J1TA 5H82A 4BNGA 1GZ3A 1HXHA 1I0ZA 2PD4A 3RVDA 1U3WA 3INRA 4BNYA 1UZMA 3PXXA 1CDOA 3HWRA 3V1YA 4IINA 3DTYA 4J3FA 1P33A 1QYCA 3PHGA 1IPEA 4BNXA 4I5FA 3K96A 4ZRMA 3VPXA 5CEJA 2IXAA 4J9UE 4JJFA 3HNPA 1K89A 1GU7A 4G5HA 3ABIA 3GMSA 2B35A 2OP1A 4DYVA 5KVVA 4UVEA 4EI2A 3WGGA 2EJWA 1PIWA 2X5OA 3AUUA 2IXBA 3BHIA 4E5YA 4MO2A 4GLOA 2YFHA 3KSUA 1O0SA 2W98A 1KVUA 3SXPA 3AI2A 3C7DB 5DCYA 1WZIA 3IAHA 2G1UA 2H63A 1ID1A 1PX0A 5L7YA 4CLRB 4EUFA 6ADHA 2X4GA 3M6IA 4YJFB 4LMPA 1TLTA 1K6IA 4B7CA 1E7SA 4MKXA 2NVUB 3HSKA 5KOIA 4OXNA 4QFCA 1ZW1A 3JYNA 4ROSA 3AWDA 4WLNA 2P4QA 1VSVA 2DBVO 3SBOA 3PYXA 2D5AA 2WTBA 1C0LA 4II2A 1Y5MA 3VZRA 3VH1A 5G4LA 1YJ8A 4XD2A 2P4HX 3WNQA 1UDAA 5LCXA 1YOVA 5EL0A 5HM8A 1J4AA 3CIFA 4QFDA 3F1LA 2VOJA 3BMNB 3ASUA 4Y6PA 1GCUA 4MP8A 2HMWA 3IQDB 4PG6A 5JBIA 1PJQA 4B7XA 1ZK3A 1NX6A 4XGIA 3QRWA 1U5CA 5IF3A 3GGOA 3PJFA 3EYWA 3AY7A 4TZKA 1GYQA 1SMKA 2I3GA 4IQ8A 2QZZA 1JN0A 2FR1A 1Z7EA 4P4GA 1U1IA 3ONEA 2NVWA 3G3EA 6LDHA 5I7FA 1VKOA 1H5QA 1Z82A 1JA9A 3V2GA 4RCVA 4TROA 3ONFA 2C2XA 1LLCA 1N1EA 4EEXA 3M2PA 4BKQA 3DBLA 5ILGA 2W2LD 4QXMA 4AJ2A 1DOHA 2TMDA 1EZ4A 3BMOB 2E48A 3AFMA 3Q3CA 3NYWA 2A35A 1N92A 3QE3A 3DMTC 3ZWMA 4MJLA 4BQRA 4XYMA 1SB8A 1ZK4A 3UVEA 4RQTA 4Q3BA 1ZJYA 3ADOA 4E3ZA 3AOEC 3H65A 2HJSA 1ZO8A 3PQFA 3O03A 3CZRA 3IP1A 5EMHA 1HZJA 5DP2A 2HRBA 4Q3NA 2ET6A 4BGUA 3K2BA 2CDCA 1MB4A 5GY7A 1Q1NA 3I5MA 1OOEA 5T8KC 3UCFA 1DIAA 3TOXA 5A9SB 3F5QA 2W2KB 5BSHA 5C37A 3I9LA 4Y6SA 5BQFA 3WGTA 2GLXA 1N8KA 3WR5A 2D8AA 2DAPA 5CDSA 3F5SA 4BO9A 1P45A 4U0KA 3P2YA 4PG8A 1Z75A 2X5JO 3KLMX 2EJVA 3TZ6A 2YDXA 1EQ2A 2YV2A 4GGPA 4HFMA 3ZNOA 7ADHA 4HP8A 4EUHA 3JQFA 1UP7A 2J3JA 4YXFA 3G1TA 4A10A 3UW3A 2UVDA 1NVMB 1HDOA 1TI7A 4XCVA 4EDFA 2PKQO 5JDIC 4W6ZA 2CF5A 3HN7A 3WLFA 1OZAA 4BQPA 3GHHA 2GCGA 3JTMA 1PZHA 2Y1FA 3EVTA 4OGWA 2VT2A 4W9NA 3VOSA 1LQTA 1UH5A 4NJMA 2O23A 3JQ9C 4BHTA 4YR9A 4K1LA 3OSUA 4A7PA 3OP4A 7MDHA 2P9EA 1WPQA 3VH2A 1LX6A 2VRBA 1ONOA 2JCXA 5F1KA 1VKNA 1ZKMA 2UV8A 4JN6B 4N7RA 1I3NA 4FFPA 1E6EA 1CYDA 1DFIA 4FJ1A 4L8VA 4CMKA 5I7VA 3DEYX 3PDJA 4CR7A 1CQIA 3GFBA 5JDCC 4DPLA 1WZEA 4I9NA 1YVEI 4OKIA 2ZB3A 4RVDA 4YT4A 3VDRA 3QHAA 4UUMA 2WYWA 3I6QA 2BI7A 3GNSA 1DAOA 3TDKA 4HNHA 1BVUA 1GCOA 3ETDA 1HYEA 3HJAA 3WB9A 4D46A 3MJCA 3H9GA 5T67A 2P5YA 3K31A 3RCBA 3ZNQA 5CEEA 4DPKA 3EZYA 1E5QA 4E32A 1ZUD1 5DN9A 2X58A 3TZCA 3VTZA 3D5QA 1GV0A 1LRKA 2PR2A 2ZTMA 4U0JA 3NV9A 3ZWAA 3BYZA 3ZNPA 4JROA 3QA9A 4CMAA 4HKTA 3WXBA 8ADHA 3WFIA 2AE2A 4O5OA 3KLPX 4C4OA 4XGNA 4M87A 2EV9A 4CL3A 2B5WA 2PFGA 3F6YA 3QP9A 4J6FA 2OORA 2VOEA 4HFJA 1T1RA 4NDNE 2IZ1A 5A02A 4ZQBA 1H9AA 3D5TA 2NQTA 1E3JA 3UOGA 1QYDA 1R4MA 2B69A 2EHDA 3BZUA 1Y8RA 3RROA 2G5CA 4B4OA 4YBZA 1HEUA 1R4MB 1C1DB 5JAQA 4CM7A 3SVTA 1QMGA 2A94A 3CH6A 4TQGA 3E8XA 3RWBA 1PGPA 3JD3A 4CLEA 5KIAA 2A92A 1OC2A 4TRRA 3WJAA 3MJ4A 9LDBA 3VC7A 4GMGA 4W9NC 5HS6A 5T64A 3NAQA 5THQA 2UDPA 2FZWA 1SEPA 2WYUA 4MKRA 3QY9A 4PLYA 2GSDA 1YRLA 2QW8A 1JAYA 4JBIA 1DC3A 4E2ZA 3HADA 3U5TA 1PQUA 4Z0TA 1X15A 2EW8A 3I9OA 5BNFA 4UEJA 5LDHA 5A05A 1E6WA 1QG6A 2PWZA 3OIDA 2WSBA 5JAIA 1YQDA 5DDIP 2W8ZA 5EERA 1K5HA 4B3JA 2EW2A 1H6CA 4ALMA 1UDBA 2FR8A 5L4NA 4A2CA 4DQXA 4UREA 1NPDA 2PNFA 4R4JA 2QHXA 1KEVA 5CDGA 1LXCA 4F45A 1XELA 2FPGA 3A14A 1I30A 3JCZA 4RPHA 4YQYA 4AJ4A 1ADCA 3GHYA 1E5LA 4OKNA 4ILKA 4TVOA 5KJ6A 2VTDA 3DWFA 3GK3A 3DOCA 3QIVA 3FR8A 3TQHA 1QRRA 4E5NA 3RJ9A 5A5EA 4FW8A 2X0JA 4RZIA 1PWZA 4DIOA 3BAZA 4E13A 3GFGA 2AG5A 1ZEJA 3WGOA 3OJLA 4TRMA 1YBAA 3HHPA 3A28A 3LT1A 4I5DA 3L6DA 4R9SA 4OYRA 4BKRA 1AXGA 3PDUA 3E82A 4INAA 3JYOA 3S2GA 4CMCA 2YW9A 2P9CA 2C7GA 3G1UA 1H2BA 1DJQA 2JFHA 1ULSA 2J3HA 1NWHA 3PEFA 2A9FA 1A7AA 1HE5A 4OOFA 4B3HA 2Y1GA 3L9XA 3E9MA 1XR3A 2DFVA 3ADPA 5TS3A 3RUHA 3W4JA 1UDCA 1Q0LA 1E3WB 2R2GA 3COSA 1WXDA 3HFSA 3DR3A 4FDAA 4RLHA 3VZSA 4DVJA 1I8TA 2V65A 5I8WA 3ITDA 2QIOA 5GZ1A 3DOJA 3ANNA 5COBA 5HBRA 1HTBA 4BNNA 4W99A 4AJHA 3ZHZA 3ZWOA 2X9NA 1ADFA 1VLLA 2FPPA 4CMIA 2PH5A 4KWIA 2I99A 4AICA 2POQX 1ORRA 4M54A 1OAAA 1D3AA 2GNAA 2HO5A 2J6IA 1ZXLA 2HQ1A 3WQQA 4CLOA 4ND3A 3I6IA 3IOYA 1O6ZA 5DT9A 1I01A 4BOYA 2ZCUA 3MOGA 1XDWA 2X9GA 1Y81A 5U1PA 3HE3A 2C59A 2WD7B 3H5AA 1Y8QA 4HFRA 4CLRA 4J1QA 3C1TA 4ALKA 3CE6A 1PGOA 1R6DA 3D7LA 5HS4A 1DSSG 2B4RO 4IZIA 2UYYA 4Z9XA 1VM6A 5ILOA 4CR6A 2DKNA 1N9GB 2DVMA 4GVLA 3O26A 1B0AA 1X1TA 2Q49A 4MINA 3L77A 3MWEB 4J1SA 3VHRA 1ZH8A 4XB1A 4NBUA 3ROQA 4EW6A 3PPIA 4WECA 2VYND 3UFXA 1YDEA 4PRLA 4DMLA 2C7VA 4ND1A 3F4BA 4J0EA 1VL8A 2HU2A 3T4XA 3ZWNA 4GX1A 1E1KA 4LCJA 5ADHA 4WCFA 4K28A 3U4IA 4D43A 1UZNA 4GMFA 3HG7A 4GGOA 1JKIA 3DZBA 4CMEA 2NUAA 3ULKA 3R1IA 4NK4A 1O94A 1RPNA 3DQPA 4O1MA 4MP3A 5AVOA 3U09A 3L6OO 5C7OO 3UHAA 3OH8A 2VWGA 3OEYA 2Z95A 3FF4A 1EVJA 4RVGA 4CM6A 4ZU3A 1GZ6A 3CINA 5COAA 5B4UA 3SLGA 2R6JA 2RAFA 3GG9A 1NBOA 2VNSA 2JHGA 2P68A 3WWZA 1NFFA 5CDUA 3M1LA 1P0CA 3LLVA 3CMCO 4UUNA 1GYPA 1I24A 3I83A 5CEFA 3S2EA 4YRBA 1DC6A 4J4HA 3PIIA 4NBVA 3VTFA 3U3XA 3GN2A 2ZKLA 2QX7A 1RKXA 3A9WA 3H8VA 2E49A 3WGQA 3SLKA 3VAZA 2Q99A 4JBHA 1N7HA 5G0SA 1MX3A 1Y9AA 2CDAA 1ZNQO 2XF8A 3FRJA 4QSMA 1KEPA 2PH3A 1W0CA 3E5MA 3O4RA 5KKAA 2NVUA 1NQOA 1QSGA 4UVIA 4Q3EA 2G82A 3PIDA 1MC5A 4IJWA 4MVJE 4XJSA 4J4TA 1MG5A 2X9VA 3T7EA 3ZWYA 4R3WA 3CPSA 1FDSA 3ICPA 3BHJA 5AXBA 2YUTA 2VHXA 1A4UA 4PVCA 3OA2A 4A0SA 3IJPA 4BKUA 3AY3A 3ENKA 5L51A 3DBHB 3L07A 4H15A 3ETGA 4N5NA 1J5PA 4ALNA 1H94A 1QLHA 5CHEA 4IS2A 3KYDB 1JW9B 2Z5LA 4Q39A 3BTOA 4LRTB 1HE3A 3ZV5A 3PGJA 1NWCA 3ZZNA 3FSRA 2O3UA 3PQEA 1C1XB 1KVRA 2B36A 3AU8A 1BXGB 4YT2A 1E3IA 4D3FA 4ZQEA 5CDTA 3OHSX 4WCFC 4K6CA 1NPYA 1G0NA 4URFA 5I9LA 1G6KA 3F4LA 1A27A 1NPTO 3H9JA 3INGA 1TT5B 4ONEA 4R1TA 3JQGA 4DIFA 1NQTA 1U7HA 5AOVA 1FDWA 3VPSA 3TOZA 4JLWA 1BVRA 1GZ4A 3QWFA 3JQAD 4GLLA 1O5IA 3WIEA 4FBGA 3GF4A 2CD9A 4KDEA 5JY1A 5DF1A 3ZHYA 5IAAA 4YJHB 3H2ZA 2X22A 3IIEA 3RASA 1R16A 1BTOA 2B4QA 4DREA 1T25A 3CKYA 3EK2A 4UVGA 3UF0A 1U4SA 5MGBA 2BRUA 3PZBA 3Q9UA 4BB6A 2VHWA 3AU9A 1ONPA 3BIOA 4NHEA 2AG8A 1EUCA 2BH9A 4K6FA 2GR9A 3K8ZA 4L4XA 4FGSA 3G49A 5A5FA 1EUDA 3KEOA 1O89A 1DBVO 3RUDA 3V2UA 3RUIA 4IDCA 1PL7A 4BO7A 4N54A 3M2TA 3EY4A 3PQDA 4DYDA 4DXHA 4Z0PA 3D3WA 4KMSA 3NDJA 4M86A 3E18A 2HK9A 2GGSA 2X6TA 2E37A 5IDYA 4CLDA 4RVSA 4A26A 4BO3A 3BXXA 1W73A 2VWHA 3NRCA 1TVEA 3CZMA 1HDXA 4RPKA 4XYEA 1Z7BA 5KJCA 1BDBA 1PR3A 3TF5A 3AI3A 4XJTA 1FDUA 2NM0A 3KZVA 1LNQA 4OH1A 4BO4A 1DPGA 1GEGA 4PVDA 3GVXA 2IDZA 3OQ6A 3WGIA 1HETA 1GUFA 1MFZA 3GC6A 1L1FA 1V8BA 4NBRA 4PCVA 3UUWA 1TEHA 1UP6A 4D7AA 3U62A 1JAXA 1EVIA 1HRDA 4KUGA 1DIHA 5TT1A 2Q2WA 1U9JA 3NJ8A 3CTMA 1VSUA 2AQ8A 5EJ2A 1IZ9A 4OQZA 1EQUA 3Q2KA 1HL3A 1QV7A 3H9QA 4XGKA 2VYVA 4XYGA 3SC6A 1J49A 2JAPA 3WIDA 4HXYA 3OJFA 1XWFA 1ARZA 4KQWA 4LMRA 1K2WA 4AG3A 5IZ4A 1FF9A 3JQAB 1DIRA 4GL4A 1I33A 2JHFA 2J3KA 3H7AA 3DZIA 1P3DA 3ROPA 4MVJF 2BFPA 3D3EA 3GEGA 2CY0A 3AOEA 3WG9A 3F9IA 3PLRA 1NHWA 3RKRA 1WW8A 3KOUA 4BB5A 3DHYA 2NV6A 1RM0A 1R0LA 5IDQA 5TJHA 4WEOA 1ENYA 2G17A 2GRAA 2WE8A 4NI5A 4NK5A 2CUKA 2EKLA 2QYSA 4JBGA 2BGKA 4LSMA 1ZBQA 5KJEA 3W8EA 1KVTA 1LDMA 5CFZA 1PJTA 3PZRA 1T2EA 4WLOA 2O3RA 3PYLA 4L9RA 5F21A 1U3TA 5L3ZA 5JE8A 3D0OA 1AHHA 5CPBA 3S2FA 1HLPA 1ZK1A 3H3JA 4U7WA 4ZGWA 3GH3A 1GTMA 2Y93A 2YV1A 3V5NA 1G0OA 1PQPA 1P44A 2Y05A 4BO6A 4O59O 2JCYA 1WVGA 4HX5A 2VZ9A 1J6UA 3KSZO 1AGNA 4KTTE 4KWHA 4U8GA 2I9PA 2OBNA 4BGIA 2YJZA 3ETEA 2ZQZA 3H4VA 1YONA 3NKLA 3QWAA 3LT0A 4W7IA 4A5OA 2VHZA 1H0KA 1YWGO 4L74A 3RC1A 1IB6A 1GV1A 4KOAA 4OIMA 2QRLA 4CV1A 3WGZA 4MIEA 1PS0A 4OSPA 5THKA 4S3MA 1PU2A 3RQSA 3VH4A 2NTNA 5JAMA 3VH3A 3WSVA 1XKQA 4XB2A 1WWKA 2RCYA 4XEHA 1C1DA 4RDIA 2DQ4A 3E1KA 4XA8A 1EBFA 3WGYA 2BFMA 4DWVA 1PZFA 2IE0A 2Q45A 4GBJA 5A3VA 3EDMA 4CM5A 5I7SA 4YJDA 4OSOA 5IJZA 5JAZA 1IL0A 3GVCA 4RF5A 3K9QO 3EAGA 3QVOA 4IM7A 5CG2A 4CM1A 2Y0EA 3TRIA 1WDKA 1CERA 2EG9A 1VC2A 4DQUA 5DP1A 1BW9A 3WOHA 4HV4A 4XDYA 3DZJA 3WNVA 3KYCB 1EUZA 3DAPA 3FHLA 5EQDA 5EQFA 1UXIA 1EBUA 1E3WA 2XPCA 1WLYA 3RSHA 1JTVA 3BMCA 3D64A 3ASVA 1BSVA 3GLQA 1LDEA 3GVHA 3L4BA 3ZH2A 2Y1CA 3RBVA 1E3SA 3PK0A 2JAHA 4JP3A 3ZU5A 1WMBA 2P2SA 4FN4A 4M8SA 2X0IA 3FTPA 3CUKA 1PZEA 2Q1SA 3PI7A 1LEHA 3PFFA 1B3RA 1SNYA 5G2OA 3PJDA 1PR9A 2W2LA 4E31A 4MPDA 1GPDG 1XEAA 4AJPA 4CMJA 2H1SA 5TJ9A 5A03A 3OECA 1KETA 4CM4B 3CSDA 2X1HA 3FI9A 1DC4A 2QZ9A 3W6UA 2X86A 1NHGA 1R12A 3AY6A 1KEWA 5ENDA 2AHRA 3FCOA 1UAYA 3W1VA 5TLSA 5DCUA 5JY6A 4M49A 3GAZA 1A72A 4KUEA 1Y6JA 1PGNA 2FPIA 1R0SA 1N9GA 2Y1EA 4EZBA 1HSOA 4GI2A 1JDJA 4PLVA 3DC2A 3ICCA 4FJ2A 2GN4A 5JPIA 2RHCA 5F1PA 4F6CA 2NACA 1I10A 3LDHA 1B3BA 4K26A 2BGMA 4MVJM 3GNTA 1PEDA 4E12A 5L7WA 2B83A 3GDGA 2HAEA 1I3LA 1MC4A 3I9MA 2HUNA 1M76A 1YXMA 3GZ4A 1QV6A 3KB6A 3NTRA 4ZQHA 2OBYA 1YQXA 4WCDA 2BI8A 1YOVB 3G79A 1V35A 4LK3A 3ZWPA 5C7IO 4F46A 4D79A 3IUPA 3K92A 5L45A 3ZDFA 3IJRA 3E03A 5IFLA 3RUCA 1D4FA 2TMGA 1DIGA 3NT2A 4Y6RA 5ICSA 4L73A 2GN8A 3H6KA 3NGLA 1B7GO 2PLAA 2DPGA 2OO5A 4DMMA 4JQCA 2FSVA 3B1JA 1WDLA 5EIOA 2R00C 2OHXA 4CM9D 5TX7A 4DQVA 2FR0A 4NQZA 3G0OA 2W4QA 4PZDA 5KJ1A 1ISGA 3ZWBA 3LT2A 5HWSA 1NVTA 1R4NA 1A5ZA 2H5LA 3DBVO 1YB1A 1GAEO 3FBTA 4NBTA 4CQLB 1MV8A 3LLSA 3UCXA 2VT3A 3L4BC 4ZQFA 1KY5A 4EJ0A 4GH5A 3ONDA 1LC0A 5DCWA 3K73O 1O8CA 4X54A 4TWRA 3T7CA 1Z74A 3M1AA 1ONNA 1YBVA 4TKLA 5L4SA 5JS6A 2BFOA 5ER6A 4YPOA 4PLCA 3R3JA 1Q0HA 5KVSA 3EUWA 1NFQA 4KP7A 5A4DA 3DO5A 2AQHA 4OJNA 1X0VA 1LJ8A 2B5VA 4NFYA 1GY8A 1IHYA 3IMFA 1MXFA 4FOOA 3U49A 4G2NA 4B79A 5K9ZA 1E1MA 2CSUA 4OHUA 3FR7A 4ALIA 4BL5A 1XHLA 2DTEA 1PS9A 2GN6A 3PHLA 4J7CA 1UZLA 1YS4A 3R6DA 1YL7A 5LDGA 1JLLA 2AQKA 4YB8A 3TN7A 1O95A 3I9NA 3QVWA 1VRWA 4J7UA 2IYOA 1DJNA 4E0BA 2FMUA 5ITWA 3PYMA 4B7UA 3Q1LA 3AUTA 3KSDO 4E2WA 4J7XA 2XAAA 3ZU3A 4WUVA 3TZHA 1BRMA 4R54A 5A04A 4GSLA 2J5RA 3SJUA 1SO8A 2OGUA 3OBBA 4IDFA 4WLEA 4D45A 1E3EA 1LSJA 2V6GA 1M2WA 1WDMA 3P7MA 3UH1A 4PN3A 1C3VA 4FJ0A 5IN5A 4KZPA 2GPTA 2CVZA 3F47A 4R16A 1BW9B 5COQA 3I1JA 3OF2A 3BTUA 3NT4A 4LVCA 1SEVA 5BT9A 3PWKA 4NPCA 5TGDA 3IL2A 1Y9EA 1ZSNA 1WAMA 4J1NA 1LLDA 1MP0A 4P8RA 2EWMA 3MJTA 1C0KA 1DHRA 1BGVA 5G0VA 1WNTA 4E4YA 4ITUA 4AJEA 3IUSA 1DC5A 1SOVA 2PZMA 1ZJZA 1E7MA 1XIVA 2ZIZA 2E82A 3VVCA 4MOWA 2D4AA 2HK7A 3GT0A 3OIFA 4GX5A 1CRWG 1DEHA 2YDYA 4CMBA 1YBMA 3DAFA 1Q7CA 3GGGA 3PFWO 2JD2A 3UXYA 1P1RA 4TRJA 1LSOA 1AUPA 5F1OA 1W6UA 2NNLD 2UUPA 1T2AA 5HA5A 5CG1A 4CUKA 1NR7A 1B15A 2O3JA 3HQ4O 3LC2O 1YL6A 2HMTA 3HB5X 5U9CA 4CM4A 3LQFA 3DOOA 5JMWA 2CF6A 3BTSA 3ZHBA 3ANMA 2DUWA 2PZLA 1V6AA 3OM9A 3L0DA 4B8ZA 1ZEMA 2QYTA 3DONA 1FK8A 2O3QA 3EHEA 4E5MA 4YAIA 4ZD6A 3ZW8A 5LC1A 2PD6A 5DOVA 4LN1A 1XU7A 1NP3A 2VYNA 4BO8A 1VI2A 3FN4A 3PTZA 4ZQGA 5EN4A 3GQVA 2D3TA 2O2YA 2V6BA 4MVJG 3OFSA 4OMUA 2D59A 1KVQA 3A4VA 3Q0EA 3JQBA 1D8AA 5G4KA 2B0JA 3MOIA 1ZXBA 3QQPA 4E21A 1QXSA 4XWYA 2ZQYA 1BXZA 3F46A 2UUOA 3N74A 3EGOA 1UXKA 1KERA 2CVQA 1R0KA 5TF4A 4BNWA 5K6AA 4D44A 1FXSA 3U4CA 2CNBA 2HMSA 4TZTA 2X5KO 3RAJA 4O6VA 2AQIA 2RH4A 4U6QA 1YKFA 3JQAA 4L76A 2NU6A 2GUGA 3VZPA 2ZCVA 4JP2A 1V9LA 1I2CA 5KNLA 4RQUA 4YJGA 1BG6A 1MGOA 2GO1A 2RIRA 4XQ9A 5ES3A 1SAYA 3BHMA 2FRDA 5L95A 2C07A 4RVHA 3LU1A 4FOSA 2FN7A 2V6MA 2VWPA 4BNVA 4II3A 2C82A 2I65A 2VCYA 1U2DA 4NR0A 4BNIA 1B8VA 1P1HA 4HFNA 2YHIA 1OI7A 1PS8A 4BNJA 3KETA 3MEQA 3DDNA 1K6JA 1I3MA 1LC3A 3ZV6A 2VUTA 1B14A 1P9LA 2X7HA 3DHNA 2NSDA 2EERA 3P2OA 1H6DA 1U7TA 1Y1PA 2D1YA 2PKRA 4RPLA 2DLDA 1LSSA 2Q1WA 2EGHA 4KQXA 4IMPA 5TSDA 4BGEA 8LDHA 2Z1NA 3GGPA 3H3FA 1K0UA 3SEFA 1PGQA 3JQEA 3GZNA 3RU9A 1QLJA 4CR8A 4S1VA 3LSYA 3B6ZA 1XYGA 5ENVA 2PKQP 4RVUA 4NH4A 4Z9FA 2Q1TA 3JQBC 4BNZA 4XIJA 1A71A 1O9BA 2AXQA 1BMDA 4Y67A 3MWDB 4R9RA 4Q3DA 4RLSA 3UICA 4BMVA 1AN9A 3JYPA 2PGLA 5JCJD 2WD8A 3VPGA 3WBBA 4IIUA 4WNCA 4BO2A 2FWMX 3KXDA 3RKUA 2EGGA 1B8PA 1E3LA 2DM6A 5IDWA 3BMQA 3ZWXA 1R15A 4NNJA 5IN4A 3F3SA 4WEQA 4PG4A 4CMEC 2J3IA 2NVBA 3NGXA 2O7SA 2Q4EA 3I9KA 2DT5A 4JJIA 3PGXA 1NVGA 2DFDA 2WEKA 5FI5A 5BNTA 5GMOA 5FI3A 1UP4A 1P74A 2WJPA 1TT5A 1Y5RA 5U4QA 2ZTVA 2F00A 4CV3A 1Z6ZA 1IE3A 1DFGA 2CFCA 3FTNA 2JJYA 3FNGA 4HY3A 4AJLA 1Q7GA 3KUXA 2I5PO 4D0RA 4CUZA 2X0RA 1PJ4A 1X7DA 3VPFA 4NZ9A 2V7PA 1D1TA 3FPCA 4PG5A 3ZW9A 5BSEA 4F6LA 5JFOA 2H9IA 3C1AA 4CMIB 1HE4A 4BMSA 2OZPA 3RIHA 4I5GA 4XR9A 4B4VA 4DC0A 5T57A 4CM9A 3ZHXA 3BTVA 1LSUA 3WX0A 2Y0DA 1GL3A 2JFGA 5L7TA 1CWUA 1LUAA 1PL8A 1U8FO 2EP7A 3RD5A 3GAFA 2PGJA 4PG7A 4OO3A 4QQRA 2I66A 3OMLA 3PJEA 4ND2A 4YRAA 4IMRA 5JW6A 4EGFA 1HDYA 4AJKA 2CZCA 1EFKA 1HYGA 3WQSB 2OMEA 5JXWA 1MUUA 2IEBA 3QVTA 4AJ1A 2HMUA 3EZLA 4ZRNA 3JQDA 4DA9A 1KS9A 1EDOA 5AXDA 4OL9A 4XKJA 1IYZA 4IIVA 5BNIA 1L7EA 3U9LA 1B26A 5AYVA 4DL9A 1QYXA 3EVNA 3A1NA 4YJFA 4BO5A 4B3IA 2VRCA 3V2HA 4NIMA 3WSWA 3C85A 1BXGA 3MTGA 4JGBA 2ZYGA 3TFQA 3GN1A 3O38A 4WJZA 1SOWA 2VUUA 4B4UA 1OBFO 1OC4A 2DBZA 1LBEA 1QYVA 2DU8A 3OQBA 1PWXA 3NEPX 4IXWA 3WTCA 1XQ6A 1JWBB 2ZTLA 4G81A 2NLOA 3GUCA 2PK3A 1FMCA 3T4EA 1LLQA 2GD1O 3K5PA 4FFRA 2E6UX 3ZCXA 3OIGA 3DL2A 1TB4A 3L9WA 4AVYA 3HDYA 3CEAA 3FNEA 4L0QA 5HRUA 3ORFA 3ITKA 1B16A 4XQCA 4J91A 2FSSA 3KO8A 4UAGA 4ZN6A 2JCVA 3NDIA 4RZHA 3E9NA 4YCAA 2VYVD 3GMDA 3AOGA 2YZ7A 3RBZA 1J0XO 4BNKA 4MVJI 3ZV3A 1SCUA 4YRDA 4MVJA 2IRWA 3W8FA 3I4FA 5JO0A 1R4NB 1GUYA 5I7EA 2ZYAA 5IZCA 3K30A 4IZHA 3TL2A 4IUYA 2ZB7A 4PLTA 1I36A 2EF1A 1DHTA 5FYDA 1XQ1A 5TQVA 3D4PA 5K6AC 3EMKA 4FB5A 4ZICA 3RBXA 3DMTA 2JKVA 3GUYA 4I1IA 2NWQA 4BUCA 2O4UX 2Q2QA 2RH8A 4RVFA 4AJJA 5B4TA 1C0IA 3S55A 1T24A 2LDXA 2VZ0A 5KVCA 2X8LA 3WGHA 4BO1A 3DTTA 5CPFA 2OFPA 1T1SA 4QEDA 5G0UA 1M6WA 3AM3A 3C7CB 4YQZA 4H7PA 1K3TA 4YT8A 3MTJA 3QSGA 3AI1A 3ROMA 4PIVA 4JK3A 4FD3A 3LF2A 2PD3A 1E7QA 3L4SO 4ZVVA 3HN2A 3AM5A 1ADBA 4YT5A 2Q50A 3WICA 3AK4A 1X14A 2LDBA 3OICA 3D1LA 2I67A 4B8WA 4BIIA 5C7LO 1FJHA 2NTVA 1YO6A 3KYDA 4Q3CA 2W2KA 3IC5A 1LDNA 1R66A 1ULUA 2NADA 2VTEA 3ST7A 4MVJP 3GEMA 2PZKA 1HKUA 4UEOA 1PJSA 5JSFA 1NNUA 4I9HA 5G0TA 1NM5A 3VDQA 1TA4A 3K2EA 1QR6A 5ER9A 1MG0A 4GWGA 1LLUA 1NXQA 3AUAA 1MLDA 4QO7A 5H81A 4U6SA 3MJSA 1NAIA 3IKVA 1CJCA 4TSKA 4Y8VA 1A9ZA 3DAGA 5B1YA 1EVYA 3C7AA 3KV3O 3OJEA 2I76A 1XGKA 3W4IA 2PA3A 4P4LA 4CQLA 4J0FA 4CLHA 1Y7TA 4GWKA 3WQRA 5A06A 2BHLA 4J49A 1T4DA 4BS9A 1P1IA 3U0BA 3VVBA 2BMAA 1DLJA 4CL8A 1GDHA 3LYLA 3JD0A 1R37A 5F3RA 5EPOA 1CETA 4JIGA 2ZATA 1PJ3A 1P77A 1UXHA 2AMFA 4PLPA 4PZCA 3LZ6A 4DIBA 5JYEA 2FP4A 2ILTA 1RM4A 1N5DA 4N18A 1ZSVA 3PWZA 5I9NA 3GPDG 5EESA 2JL1A 3QWBA 2YY7A 1NTOA 4C7JA 4RF4A 3B70A 2A4KA 4MKZA 4AL4A 4E33A 3AFNA 3PHJA 4LGVA 2WD7A 4QT0A 1IHXA 4CMHA 3FNHA 2V6FA 5JC1A 2Y1DA 3C8MA 2P9GA 3ZU2A 3HDQA 1A9YA 2GZ2A 3QW2A 2JD1A 4DGSA 3E6AA 3DZFA 5JCJA 4XYLA 2B37A 3FPLA 3JD4A 4TMFA 3FWNA 3I4CA 1LQUA 3DMYA 2J8ZA 1RWBA 1EVZA 3WJ7A 4IDBA 2I6TA 5A9TA 5K0ZA 1V0JA 2DPHA 2YHUA 3HUDA 4XR4A 3GVPA 3FWZA 3LF1A 4CV2A 1F17A 1C0PA 2GZ1A 1PJBA 1NR1A 4ZHSA 4J9VA 1P31A 1UXJA 2BFAA 4GVXA 5CP8A 4OAQA 1ENZA 3RC2A 4WLUA 2XOXA 1BXKA 3RC9A 3SC4A 4WCFB 1PSDA 2YQ5A 4UUPA 1PL6A 1B2LA 4R68A 4AFNA 4R1SA 2HMVA 4XZ3A 3UKOA 4RF3A 4RJTA 1EMDA 4NJMB 3E9QA 1M6HA 5F5LA 5A9RA 5L53A 2Q4BA 1LU9A 5DOZA 3ZV4A 1NAHA 4FS3A 4EEZA 4U5QA 1K6XA 4CLXA 3PWSA 4YACA 3JQ8A 1ADGA 4Z3DA 2BF7A 5I8ZA 3NJ4A 1XG5A 2J5KA 2J5QA 1T4BA 1Y8QB 4YJGB 3RJ5A 4Z0HO 2QRJA 3JQ6A 4Z3KA 5T6BA 4YYZA 2QG4A 2OUIA 2D5CA 1JKJA 1SC6A 3N7UA 1ZFNA 4UVHA 2O3SA 5JNLA 2RBEA 1HDGO 5JC8A 1I5RA 1HSZA 3I23A 4FR5A 4PLZA 3OJOA 3V8BA 4FGWA 1U28A 2YHIB 1T2CA 3SX2A 1ZZEA 4CM8A 1BWSA 2GASA 5IZCC 2P5UA 3BA1A 1Z73A 3DFZA 5B12A 4CM8B 3Q9NA 2FHSA 3ZWVA 3GRPA 2Y66A 1KY4A 4J43A 3N58A 4NU6A 4YAGA 4KDFA 3Q11A 5ITVA 3X2FA 3NTOA 4R41A 4BKPA 4Q9NA 1ISFA 2VRCD 9LDTA 1PQWA 2X0NA 3V1UA 4LW8A 5H83A 2CDBA 1XA0A 2EP5A 3JQFC 4A73A 5T5QA 3R0IA 3W4KA 2Y1OA 4R5MA 1E1LA 1U4OA 3WYCA 3IKTA 4R1UA 1E0DA 4EBFA 2OOSA 2WM3A 4PGFA 1F8GA 3EW7A 4MVJH 3S8MA 1IY8A 4CM3A 4IBOA 1GADO 2C54A 4R51A 4DC1A 5KJFA 2G76A 1DRWA 3JYQA 4PZEA 3TPCA 3AJRA 3DZKA 2PZJA 4E30A 2O7QA 2C2YA 3ZN2A 4RDHA 3I52A 3RFTA 2YYYA 1JU9A 5JO9A 1KEUA 2Y99A 4PLHA 4HBGA 1E7RA 3WMXA 2ZJ0A 2XXBA 2D0IA 1XU9A 5AQ1A 1F06A 4PLFA 4D41A 4GKBA 1G1AA 2HK8A 4P22A 5DBIA 2BELA 4YAEA 3DBLB 4JNKA 4R01A 1JKFA 2WE7A 3NUGA 3PVZA 2BD0A 4G65A 3HZZA 3KHUA 4XQEA 3IP3A 1GQ2A 1JVSA 3ZI0A 3L6EA 2X23A 3FNFA 3Q6IA 4PLWA 2D2IA 5A3JA 3GOHA 4GSKA 4IDGA 1EK6A 1W4ZA 1LRJA 4IJKA 4I08A 2HSDA 3JQ7A 4OXYA 1ZK2A 5DBFA 3CXRA 3IS3A 1DXYA 4I9UA 1TT7A 2VHVA 4FC6A 4XQGA 1OFGA 4TVBA 4XYBA 2O50A 3DBHA 5L4LA 1ZK0A 5L40A 1DRVA 1YH3A 5ICMA 2HKIA 1GPJA 4M55A 1SZJG 1JVBA 1UXGA 4QECA 3P19A 1H6AA 1YJQA 4GAEA 4WKGA 2QRKA 4BNUA 4XX0A 4P4NA 1ZSYA 2ZYDA 3MJEA 4H16A 1DAPA 2FOIA 4GKVA 1NFRA 3B1FA 4BNMA 4IDAA 2NU9A 2EKQA 1H2HA 5TNXA 4TKMA 1KIFA 1Q0QA 1Z45A 2E4AA 1N7GA 3ENNA 3VKUA 4WOJA 2YQ4A 1A4IA 1GD1O 4RV9A 1E7YA 3WLEA 1XLTA 4YAKA 2PTGA 3EC7A 3KVOA 2RHRA 3QLJA 1DFHA 3O8QA 2GZ3A 3D4OA 3JQCA 4ZA2A 1KOLA 1UJMA 3ZWCA 2AA3A 1QP8A 4HWKA 3RFXA 1VJTA 3GY0A 3MZ0A 2ZB4A 1DB3A 1KC3A 2PGDA 3DHEA 3E48A 3PP8A 4D42A 5A1TA 3WYEA 3RUEA 3K6JA 4WK6A 1ISJA 3LC1O 1VE9A 2FY8A 2B4TO 2YV3A 4YJHA 1GEEA 3OA0A 4BV8A 1TXGA 1A7KA 5FF9A 4MDHA 4A27A 5DZSA 1IZ0A 4OXKA 4WPGA 2HDHA 2DUUA 2G0TA 2PY6A 2PV7A 3W8DA 2ZB8A 4YTEA 1LDYA 1OMOA 3AUSA 2VUSA 2AEJA 3RFVA 4BKOA 4NBWA 2EEZA 3D3WB 1YB5A 3H2SA 5IDXA 4BNFA 4RF2A 4A03A 2VN8A 5B37A 1YL5A 4YA6A 4FFOA 1HDZA 2Y0CA 3SJ7A 4MP6A 4JJGA 4Q3AA 1V3TA 2IYPA 1UUFA 2GF2A 1NASA 4FIZA 1RYEA 4PRKA 5DULA 4W4TA 1WP4A 1B8UA 2HLPA 1HE2A 1X13A 2C20A 2EKPA 4BV9A 4IJVA 5AXCA 3CMMA 4HADA 5FEUA 1EFLA 1HDCA 4E5PA 3DBRB 1ZMOA 3KEQA 4J2OA 5JDCA 2F1KA 4QX6A 3H9UA 2O48X 3RUFA 1ISMA 1IOLA 2VNAA 1V3VA 2Y67A 1YGYA 2DBRA 2C5AA 5G4KB 3ZWWA 1MA0A 1Q7BA 4GQAA 4BNHA 1KBZA 3OETA 1ENPA 1NQ5A 2VZ8A 3GZNB 4FSHA 2AEFA 1UAGA 1HDRA 4IJUA 1MFPA 4WASA 4IQ0A 1RJWA 1U2GA 3ON5A 3FBGA 4BNTA 3I3OA 4TRNA 4XRGA 1DIBA 1E6UA 3VZQA 3WTBA 1P0FA 4Z6KA 3VPHA 4R1NA 5L9AA 1HLDA 3H5NA 3H9EO 2HJRA 3MCVA 4FC7A 1HF3A 2I3AA 3QWIA 4IDEA 1X7HA 1ZIDA 4KTVE 4NFHA 5I9MA 3VKVA 1PJLA 4RGBA 4WLFA 4CQMB 1QYWA 1EE2A 2XXJA 5KVQA 1EEHA 3P5SA 2NU8A 3S1LA 1UR5A 3TWOA 3GNQA 4Y98A 1ML3A 5KTKA 1JQBA 1L7DA 3JYLA 4J2HA 4W82A 1DRUA 4D0SA 3BMQB 1M67A 1X0XA 2DTDA 5AXAA 3DXFA 4GX0A 4C7KA 3JV7A 2HCTA 4J90A 5TRTA 4BNLA 3DZGA 4R5HA 3UAGA 3C24A 5CAEA 1AHIA 2JFFA 3GDFA 3GG2A 3JQGB 1ISHA 3DFUA 4OM8A 1ZVMA 2DBQA 1IULA 1BDMA 1KVSA 3KTDA 1I3KA 2VHYA 2GDZA 1KC1A 3OEWA 1F12A 5CDYA 4ALLA
chains in the Genus database with same CATH superfamily
4IXDA 1EVKA 4IDPA 3W5IA 1P2FA 3RAFC 4R98A 1XJCA 2P0EA 2DWUA 3T61A 2GEDA 1MV5A 1CQJA 5EINA 1YK0A 2P9HA 5BVGA 1YR6A 2LIPA 1LW6E 1EG7A 1X3SA 1XXHB 1XEWX 1RYZA 3TYXA 1KAOA 2DLCX 4NFSA 2H5IA 1DEKA 1NE7A 3IHWA 3K0AB 3WMWA 4DLLA 5A1JA 2GA8A 4QTZA 3CUYA 4Q4AA 3WBFA 2QTRA 4OI1A 1AE1A 2DC1A 2OZKA 1KHTA 2ADOA 2C29D 4QUAA 1ESEA 3B8EA 3D5EA 3IDSA 1S02A 4YGXB 3W6ZA 3R6WA 3DAYA 3NHSA 3PHHA 1GFZA 5JAPA 2EJUA 5IWCA 4B31A 2VWQA 1AY0A 4CQMD 4NCKA 5G0WA 5DTQA 5EZYA 5FOTA 4KACA 3MCWA 4Y30A 1I2ZA 1Y82A 1M1ZA 4D9NA 4G97A 3X44A 1L8LA 4F38A 2WAXA 2XRFA 2R1VB 4CGZA 2GZSA 2HXGA 1U3VA 4OQMA 1ZJ5A 3U7GA 1IATA 1T2FA 1UKCA 3MJVA 3QH4A 3HA3A 5TT0A 4BVAA 1L2TA 1B6TA 4JX8A 3UXEA 3U4DA 2JF0A 4NESA 1BA3A 3RC7A 3EZ6A 4AX4A 4FKZA 2CLMB 1FDTA 2OMKA 3TL3A 1F0YA 3EF0A 5M2QA 3SHQA 1J0BA 1FMTA 2G3YA 4OAPA 1FVFA 4RKEA 4C14A 2AJBA 2D1SA 4G5RA 3GP5A 1CFJA 3HPRA 4HQLA 4DAOA 4A0RA 3A4YA 3KE9A 2X2OA 1LPOA 5AR1A 1JIJA 4XUCA 3W8RA 2WHYA 1ZINA 1U8XX 5JH7A 1JHAA 1E63A 4FYWA 3MJDA 2NO1A 1RXIA 1KKUA 1WU7A 1LFAA 3EXG2 4NBNA 2M98A 3QU9A 5EGNA 1H9BA 2Q46A 4O4LA 4FYYA 2JA1A 4ESOA 1CLEA 1QE3A 4C4PA 5K3FA 2XBUA 3E3NA 3GDOA 1KS2A 3D9QX 3I2HA 4R69A 3E53A 2QMYA 4YEDA 4KQKA 2HF8A 1RZVA 3A2LA 1FTSA 3T54A 1OH5A 4LHEA 2QN7A 2DQZA 4A1FA 2Q8PA 2Z1MA 2UYQA 3B89A 3FGNA 4UULA 4JOBA 1U0OC 3EDCA 4YDRA 5AVRA 4EYEA 1D5WA 2ZUBA 4S1PA 3IQFA 3ZZ0A 1UT6A 1T9ZA 2HI0A 4NMMA 5IT4A 3S0JA 1FC0A 2ZFUA 1SXJC 1T6BY 4DVGA 3K72B 4F71A 3DDZX 4BZQA 2DTXA 4MUYA 2H51A 1UJCA 5ARCA 5J23A 1OXSC 3LHSA 4RD0A 2ZS8A 3GROA 4IIBA 5IAOA 2ADFA 2WWRA 3B9RA 4B3MB 1YFJA 2I29A 4L8FA 3LT4A 3AR2A 3ZGYA 4YCCA 1AB6A 2W2OA 2J3QA 4AS2A 2PUAA 2VYCA 3U7QA 4LY0A 1PJ2A 2XCLA 4GLBA 3O82A 1N8SA 4DUPA 2JDID 13PKA 3INYA 2V8BA 4NY1A 4RXUA 2RHJA 1CUJA 3I30X 4ZO7A 3WYNA 2D13A 4E4TA 1SFRA 4ECEA 2FCRA 4ZEWA 2C99A 2VLIA 4QGBA 4HUTA 1IOZA 1X3LA 4P08A 2QQ5A 4EPWA 5IAEA 4B6EA 3ER6A 1FUUA 1GSAA 1PTJA 1SC3A 3FYCA 3EGWA 4NCHA 3SYNA 2QPLA 4E08A 2GERA 1X9IA 4TXMA 1VECA 3VVMA 3WSTA 1W34A 1E4YA 5E1MA 3LCJA 4MIYA 4JXKA 5FR2A 1TE2A 4QTUB 1ZA1A 4UTPA 1AM4D 3DB2A 1E1QD 1JLLB 2O5EA 5H3HA 4O2RA 4ZVPA 5WRFA 4CUJA 1F2VA 2FEKA 3N0VA 2Q2NA 5P8WA 2JFUA 2VHJA 4AKTA 4D1YA 3OG9A 1V48A 3IDQA 2R8RA 5AOCA 2ZYVX 3RYCA 3VDMA 2A9KA 2JCBA 4JBNA 2HEGA 2Q6OA 2X4IA 1U8TA 5E4JA 3C3XA 1YIOA 4QLOA 4D99A 1CX9B 2HJVA 1FA9A 4IY1A 3D4NA 3D7NA 4MGIR 5FO0A 4H7DA 2NPFA 2NXCA 1NW7A 3TRDA 4E2XA 2O2HA 4E2FA 1SHZA 3ZHVA 3BXFA 4KQ9A 3FPAA 1WHSB 2QX6A 2BMDA 3HVKA 1D2RA 3AHDA 5E2BA 3GJ6A 2JEZA 2E55A 3K9LA 1WBDA 3BE6A 3TB4A 5K3CA 1E1NA 3GVIA 4R8VA 4LNAA 3WRYA 1NSFA 4DM4A 4ZYWA 2G09A 1Z25A 3WIVA 4B2LA 5I6DA 1R3UA 2HYIC 3Q5GA 1QFXA 2FZEA 3QY0A 5JMPA 3AG6A 2XW6A 2EZ9A 1CF2O 5HKAA 3K7EA 3ZDZB 2DXIA 1GTL1 1HRKA 1M6YA 1XSEA 3K05A 2OO3A 4LRUA 4XRRA 2DH6A 3FWHA 3Q2IA 3TSCA 1U0LA 4RD2A 1SH7A 4LXTA 8GPBA 3TLGB 2EQAA 1F14A 1Q0RA 1N2SA 3U3MA 2VQ3A 5FPSA 5A3SA 4EYOA 5IHPA 4WNIA 5LLDA 2Y76A 4GEGA 4K9KA 2RBGA 5C3MA 1V1RB 2RG7A 3QUBA 1EEXB 2DBYA 2TRSB 3MAAC 1CEQA 4YRFA 2WB2A 4HJRA 2H6EA 1EHYA 4HUJA 4DLAA 4GX2A 5K3DA 4ZJUA 2GXSA 5IKMA 5J4YA 1B76A 2IOQA 4RH0A 1AXEA 3LZDA 3K0FB 3HJRA 3AF5A 1N2ZA 3OMXA 2B8WA 2O2XA 2Q1UA 4WLVA 1UADA 5KAPA 3TB6A 3SBEA 2PRIA 5BR7A 1JQJC 4JOCA 2O8DB 1KYVA 3DGFC 3TNDA 4TMVA 1ODJA 1SQGA 2A5LA 5BQOA 4CV0A 4Z51A 4DRYA 4F4IA 1JAZA 2GAAA 2HK6A 4BYGA 5JDIA 1X7YA 4W6QA 5LB4A 3GDHA 8ATCA 3QVSA 2K2QB 4D9MA 3FFAA 2R7MA 1YRQA 1VHDA 1JDPA 1FMLA 1QF9A 1E92A 3SI7A 4BJ5A 4BPRA 1G7TA 4E3WA 1BHSA 3CV3A 4KV7A 5AK0A 4D4GA 3GPIA 2I2BA 1J24A 3NVMB 1GQYA 1QNLA 1UJBA 4H3HB 5F4BA 3RU7A 4XWWA 3TZKA 1RP7A 2F1OA 3AW9A 1RYDA 2V3VA 2AS0A 2VQFB 1O7JA 3W5VA 4B35A 4PICA 4PO3X 3NM6B 2JS7A 1Q0SA 1PKEA 1K7XB 2GFIA 1TVKA 4W7HA 4X71A 5JISA 4IPTA 3P0FA 1VJ1A 3I5YA 4UHBA 3IAFA 1CW2B 2OQIA 1P1BA 2FLKA 1GGKA 1RM3A 3H5WA 3LTEA 3RHZA 3KZ1E 1QHHB 2XCUA 4Q7EA 1JLMA 3FF1A 1LV7A 4ZCMA 5IKXA 3PSAA 4RM3A 1ID8A 1DQPA 1M1YE 2B7BA 3ISVA 2WDZA 4JBWA 2WB4A 4LCEA 4PC7A 1VJ0A 3GMTA 4RPGA 3ZI4A 3QU4A 3TMKA 4BQNA 1NUTA 2KI5A 4F11A 4QZVA 1GZ3A 1HXHA 3FETA 2YYSA 3INRA 3RVDA 5LMZA 1UZMA 1VMKA 4Q7QA 3HWRA 3FXAA 3V1YA 1CC1S 3A1WA 1P33A 4J3FA 4BNXA 4K46A 4TL9A 2GM9A 1FOEB 1OBHA 3K5HA 3WRYC 2M6RA 3VNSA 1PQYA 5F35A 1LK5A 2C3MA 1MBZA 2C5FA 4P3PA 2XB2A 1CQXA 2OR3A 3AJDA 4JJFA 1QQAA 1N5LA 1Y6RA 5CXQA 3HNPA 1BO6A 1CDZA 1K89A 1YJAA 1YMVA 5MF6A 2JAWA 3ABIA 2EL9A 2FNAA 3C6YA 4MARA 4C6HA 4DLTA 1VGQA 4WSOA 3R5KA 4KEAA 1AUVA 5EI5A 2B35A 2OP1A 1Z5OA 1WIWA 4UVEA 3HYRA 2R48A 1KK3A 4EI2A 5FBZA 1PIWA 4HAVA 4NSNA 2IXBA 4OV6B 5KC8A 3BE5A 3MQ4A 2XGGA 3PDIB 1O0SA 2VJDA 2H59A 1KVUA 3SXPA 1M54A 4P35A 3BG5A 1WZIA 2YZGA 3O0DA 3OPYI 4MHTA 2N1MA 2G1UA 3OEHA 3WLQA 3RJMA 3CLHA 4NPAA 3FMPB 3PF9A 3EXFA 4CLRB 4EUFA 6ADHA 2X4GA 2W6ZA 4YJFB 2Z6AA 2W9XA 1NLUA 3E15A 4O8CA 1P4JA 3EZFA 4MW5A 3UZUA 4MB0A 4EQZA 2KLHA 5EJ9A 1ZW1A 3JYNA 4ROSA 3RHTA 4NCJA 4ID3A 4WLNA 3WK4A 1GPUA 4Y9TA 3RLIA 1T3SA 3UXMA 3SBOA 2GWRA 3JWIA 2WTBA 1L4GA 2AVDA 4LGMA 5CU7A 4JUBA 1PQ4A 3B9QA 3WNQA 4TYYA 4GNKA 2QU7A 5HM8A 3TLJA 3AF0A 4M0MA 3AWIA 1NJ8A 5DHSA 3F1LA 2G9QA 2OXCA 2ATXA 3BMNB 3ASUA 4YI5A 4ZCTA 3W90A 5EP3A 1WBJB 2RGUA 2JIQA 2OD9A 3DEJA 3SMVA 2H7XA 4PG6A 1E58A 1ZK3A 3P0JA 1U11A 1SCAA 2H3HA 5CNIA 3RDPA 2KMLA 4QXPA 4XGIA 3SICE 3QRWA 3VPCA 1MA3A 5ADUS 3DPSA 2WU8A 1BMFA 4Y1GA 3I39X 3GGOA 1QKJA 1YJ5A 1XF9A 5AK5A 4AKSA 4P3XA 5CVCA 1E2GA 5BW6B 2XUDA 1FLAA 4RVNA 3VAYA 1P5JA 1NG9A 3CWZA 1X38A 4QU0A 4CL2A 2QZZA 4FQ5A 3H2JA 1IHOA 3IDAA 2JA2A 3QVGB 5BUZA 1U1IA 2ISQA 3ONEA 2B99A 4N6OA 4P3NA 1T9GS 2OB2A 3E9YA 4DLUA 1N2CA 1Z82A 2JAUA 1SXJE 3K3PA 4FCWA 1N8NA 3V2GA 1VCOA 5KYVA 2QRQA 4KIJA 1LLCA 1Y8AA 4V1CA 1DT3A 1N2CB 1QTIA 3TXAA 1GSHA 1SPBS 3O9MA 4EEXA 2VSQA 3ITNA 4QXMA 4MI3A 4LV6A 3CO0S 1DOHA 1V2GA 2C9MA 2HH9A 1UJ5A 1UODA 5JAOA 2E48A 3WLMA 1SN7A 4DXAA 3Q3CA 4NONA 1ZJJA 2A35A 4UCXA 4DNQA 3BOSA 4AY4A 2BDTA 3N9IA 3P9NA 5EE9A 1EFPA 1NI4B 1YIAA 5DMXA 1T0UA 3UVEA 3ZWMA 4FT2A 3BWYA 5FUXA 4N3BA 4YRNA 3FCXA 4E3ZA 3QF4B 5EXSA 1MB2A 3DOIA 4NCAA 1KO7A 821PA 2WYHA 3HY3A 3LBAA 5EPEA 4B44A 1LS6A 4DWJA 4KVFA 3CZRA 3IP1A 5EMHA 4PEVA 1HX7A 4DCPA 4Q7KA 1LPMA 2HRBA 4Q3NA 4INJA 2ET6A 4BGUA 3AVXA 1Z35A 1U7DA 1SKYB 2G04A 3K2BA 3TQCA 2CDCA 3V3TA 3F6CA 5JI2E 1Q1NA 3I5MA 4S24A 5T8KC 3RODA 1QHGA 2VT7A 3F5QA 3N2ZB 1OKKA 4OMDA 5BSHA 5C37A 1T0PA 3I9LA 2V9CA 4UASA 4JBLA 2BSAA 2DR2A 4QOJA 3LDUA 2NO4A 3C3WA 3ORSA 3H8SA 5ICFA 4BO9A 3EY9A 3SZ3A 1ODSA 3RSLA 3KKEA 1Z75A 1IXRC 2ZS9A 3KLMX 2OY0A 1ZP6A 3Q3VA 2OQVA 3RRMA 1T8SA 2YV2A 4GGPA 2IOFK 4B09A 3RK0A 4J0IA 3JQFA 1QIMA 1UP7A 2UZ3A 4TLAA 4EUHA 4KYTA 3G1TA 5DE3A 3QKSA 5B53A 3H04A 2PKEA 2VF5X 1RHQA 3R24A 4QJ5A 4XCVA 5FYQA 2PKQO 2QZJA 4LBVA 2IIQA 3HN7A 5E1DA 1X9HA 2IQIA 4JUCA 1NUHA 2ZUSA 3GHHA 1N6HA 3L02A 5TPZD 2GCGA 2HDNB 2JJQA 3CLTD 1TZBA 1YZ3A 1T4CB 3EVTA 3NB0A 4W9NA 5HZMA 3JR3A 3WIBA 1N5IA 4YR9A 1NLFA 3IJEB 4P32A 1CB7A 2YJNA 2OA0A 4HF7A 1ZWKA 1FQWA 3VH2A 2FMHA 2VNHA 3FYHA 4G1BA 4X1KA 2JCXA 4WXYB 5F1KA 1VKNA 2BR5A 1T5BA 1ZKMA 1NNLA 2VQ6A 2ZWAA 3FZNA 2FE1A 4Z7NB 6PFKA 3T5PA 2ORYA 5ESRA 3DDUA 1CJVC 1XRSB 2VZEA 1WG8A 3WRVA 7REQB 4FFPA 5FEMA 1E6EA 3OD1A 1E9SA 1PT8A 4L8VA 2GEKA 1X92A 4BLPA 3Q3EA 4HDSB 2HCRA 3GFBA 3CE9A 3R0JA 4ZMRA 2D00A 1QU3A 1CZRA 2A1TS 2ZB3A 3I62A 3C48A 4CTNA 5HUJA 4OHYA 1QTQA 3EARA 1I5OA 3IODA 4AZ0B 1DAOA 1XZDA 1Z5PA 3KPJA 4HNHA 5HCIA 1PW5A 2RSLA 1BVUA 2DUJA 3QLUA 4KQMA 4CKEA 5DM60 2XMQA 1BDHA 3LH5A 1EINA 2L17A 3DEZA 5T67A 3NO4A 2ZRJA 3RCBA 4QPJC 3BJRA 1JEQB 3N2GA 3HJTA 4RHUA 3CEHA 1C80A 3A70A 1BWQA 4DPKA 5BMVF 1ZUD1 2I33A 4Q01A 2XADA 2WKRA 4H6PA 5DN9A 1LRKA 2LR0A 2HSZA 4OD0A 3BC1A 2LXNA 2PX4A 2MINB 1VYTA 2I7TA 4NYJR 4Q4LA 1L4EA 4YHBA 3K1TA 3ZGLA 2D1RA 2CBXA 5ULLA 1BE1A 1JXAA 2VH2A 8ADHA 3WFIA 2JFOA 1DG9A 3HY6A 4O5OA 3KLPX 5IABA 4MR8A 4RVCA 2Z2ZA 3MD0A 1MJ5A 2BDUA 2B5WA 3F6YA 4BV3A 1E20A 3TD2A 3EFHA 4DJJA 3VR5H 1GNTA 4HFJA 4U2BA 1T1RA 4NDNE 1WVIA 4X65B 1GOTA 2GSWA 5A4AA 4DV3B 1H9AA 1P9RA 3MWFA 2BSQA 3D5TA 4JOSA 1XMJA 3TNYA 4KR2A 1ND6A 4L08A 3UOGA 1HORA 1GRRA 1IRIA 4G0NA 1L6IA 5K0EA 2UU9B 4G5XA 4F1KA 3VTAA 1HEUA 3M7IA 5CCBA 3LLMA 4XASA 1OXBB 3DWGA 3LIIA 1TD9A 1JR3D 3CH6A 1MU0A 2CFOA 2IV7A 2OCGA 4TQGA 1XOIA 4BWVA 3RWBA 3WGUA 3TUZC 4CLEA 1Z16A 3TQFA 1PJZA 1N75A 1QOZA 1OC2A 4JVSB 3UAXA 2D2EA 1T3LA 4FHDA 3WJAA 1W35A 2XZTA 3WC4A 5JASA 1NJ5A 4C3OB 4Z7JA 9LDBA 4LF6B 4W9NC 5HS6A 1YQUA 3NAQA 3NNNA 4DJEC 2Z56A 5THQA 2BN4A 1T6NA 1SXPA 1SEPA 2P9ZA 1DI0A 1SXJD 2GSDA 2VP2A 4EVSA 1Y3BE 3D7MA 5LJIA 4E2ZA 3MMXA 4KR3A 1L3BA 2BM1A 5H16A 4QUGA 5JZBA 1X15A 1H3FA 1MOZA 2FI1A 1KI7A 2G4VA 2IVFA 4L57A 5BNFA 3VO2A 3ZLUA 2FH5B 5GM1A 4DW8A 5KTPA 1DX9A 4KJXA 2CEAA 1F9EA 5CM9C 3OIDA 4PGAA 3I61A 2MJLA 3MWYW 5DDIP 5EERA 4N40A 4DQ0A 3S8YA 3R40A 4M8NE 2FSVC 3OQHA 2BJVA 1H6CA 4ALMA 2FSFA 1AGRA 3SQWA 4G4JA 2FR8A 4DADA 4A2CA 2ONYA 4EMSA 3NWEA 2PNFA 3U1VA 2CJWA 5CDGA 3U9SA 2OCBA 1TU3A 1BA2A 5DCLA 2LUOA 5BVGB 5C81A 4LNHA 1I30A 1ZU4A 4M1WA 3VVLA 1T3ZA 2OOKA 4OKNA 3GZJA 3RARA 2JLYA 4IG9A 4TVOA 3GRRA 4FNAA 2O2IA 4TWIA 4X8LA 2XUHA 3DWFA 3GK3A 4RV4A 1U8AA 3S68A 2QF7A 3HRHA 5DN6A 4LDAA 3T3MB 3IB6A 5EJ7A 4KYIB 4UW9A 1CZOA 1QRRA 4ZCLA 4KR6A 5DYTA 2QX4A 5FORA 4BFYA 2HIGA 3H2BA 4YCNA 2Y0PA 5FNZA 2X0JA 4PONA 4RZIA 4YV2A 3WWYA 4B17A 4AQ7A 1MIHA 3BSSA 4LZNA 1KMCA 4E13A 4X9XA 2C2MA 2VK2A 1IIRA 2C0QA 2AG5A 3WGOA 5ECGC 3I5AA 3HCDA 2ANCA 3R9KA 3A3PA 1T5LA 2Z8YM 4C29A 4WIAA 4R9SA 4D8WA 1KU0A 1AXGA 4MV4A 2C42A 3LW8A 3TLAA 1AKYA 1M2OA 3JYOA 4CKWB 5A6SA 4UNPA 4MTCA 3WLSA 3EXAA 4FNMA 4DCOA 4IYJA 5BW4A 3K70D 2J3HA 1DJQA 1NVBA 2JFHA 3R7LA 3JASB 3PEFA 1U9ZA 4M0KA 3C3AA 1ADYA 1VJCA 1A7AA 1U2ZA 4OOFA 2XITA 3C7TA 3FUXA 4UU0A 4Q1DA 4B3HA 1EFUA 2DY0A 1M0EA 3F5MA 4IHAA 4NFLA 2DFVA 2JFZA 2EOAA 3BORA 3RUHA 1OKKD 4M98A 2EJBA 3WLKX 2FJUA 5JNTA 1UDCA 1Q0LA 2CVPA 4HBZA 2IYNA 3EWNA 4G9BA 2HCJB 4V0MA 4ZREA 3BDVA 5JH7F 4GL2A 5LA6B 2ZBDA 1XX6A 5DM4A 1NW4A 3RSGA 4JLNA 5COBA 4HNQA 5HBRA 5KOHB 3D1JA 4PSUA 5D00A 1TTQB 2Y77A 1DCKA 1ZNWA 2HA5A 2F4NA 1UANA 3GPBA 5KOHA 2X9NA 3UJCA 2BEVB 2WY2D 1ADFA 1G9SA 1QDUA 2WMNB 2PH5A 4EG0A 3TLCA 4QDJA 4JL8A 4KWIA 4WNAB 1XTRA 1TYEB 2POQX 2E2WA 1OAAA 1G4UR 1QQ7A 2HO5A 1ZXLA 3NMUF 2JGDB 3EMVA 1I01A 2C3PA 4FYMA 4P34A 4UE2A 4EENA 3RVLA 1KPGA 4QELA 2QA5A 1Y81A 4L15A 2VHEA 2X15A 4QEKA 4EW2A 5F73A 2ZT8A 5FNVF 5CA0F 3A6DA 4R9VA 3NDPA 3T7RA 3C1TA 3TRHA 1R6DA 3D7LA 5IT5A 5JXIA 1MCZA 4LJYA 2XUFA 2B4RO 4IZIA 4Z9XA 2IYYA 5FA8A 4B5LA 4CR6A 1I3OA 1R4AA 3O26A 3PC8C 4GVLA 3KKLA 4H7KA 4K9RA 5AM0A 1A2QA 2DECA 4LOHA 3VU9B 1CUBA 4BBJA 1KZ6A 2VI5A 4YMVA 1I7PA 1X2BA 1ZH8A 2SBTA 4EW6A 3E4CA 2VYND 3UFXA 3DJYA 3ESBA 1USIA 1MQAA 4W63A 4W1PA 1IJFA 3F4BA 3PFHA 4XM1A 1VL8A 1YU9A 1ZNXA 1E1KA 3ROFA 5KOYA 3KAKA 2CZQA 2IKQA 4K28A 4EFMA 3VKWA 4GMFA 3MD9A 2PUGA 3PQ7A 1QBGA 2W93A 3RIYA 4CT5A 2BHRA 1OPRA 2ZSJA 3DJFA 3EA4A 3LBNA 4D2IA 1R0BA 1O96B 4CMEA 1NSTA 2GYWA 4AUEA 2QM3A 1MT0A 4LOAA 3UMSA 2VSFA 3DQPA 3ELUA 5C7OO 3QUTA 3AG5A 3AUFA 4I1UA 2QTCA 3DHWC 1K3UB 2ZM5A 4ZU3A 1GZ6A 1CIJA 2XUQA 4OF4A 4J3NA 5B4UA 2VJQA 3RS0A 2J87A 5TEWA 2XI4A 3GT3A 2JZOA 4B4DA 4JLVA 2FZVA 1E2NA 1MNAA 1RW4A 3CMCO 3SVZA 5B7PA 5L3VA 5CEFA 4GW3A 3S2EA 2XSZD 1U98A 3AF3A 1X1BA 2PUFA 3QLEA 4OXXA 3PEUA 4YPVA 3VTFA 3EBLA 3PIIA 2W0SA 4FZVA 4NBVA 1FFGA 2RGYA 2WWIA 1F4PA 4QNRA 3BGVA 1M2VB 2ZKLA 4IJ6A 2QG9A 1EK1A 1TYBE 2CHFA 3LGAA 3A9WA 1TUIA 4H3KB 2E49A 1MAVA 2CSXA 2RJOA 3KZOA 4G09A 3TL6A 4NRDA 4ZQIA 3ESCA 4ZDJA 4KGZA 3FTEA 2GKGA 1N7HA 3OX2A 5G0SA 3ONVA 2F8MA 2BIFA 3FWPA 4RD3A 4BB0A 2WIJA 5C9ZA 3BGDA 2PX6A 4Y2JA 1QIEA 2PH3A 3BHNA 1J90A 3UYLA 3O4RA 1APBA 3WO0A 1S5PA 1D2MA 1YCFA 5KKAA 1AXRA 1FZTA 1DX6A 1P75A 3EB9A 3EIOA 2WILA 3GFTA 1NUSA 1RABA 3MCAA 3OZTA 3B3QA 1KL7A 3QPBA 3M4ZA 4NULA 3SXUB 3WB0A 4U02A 1E2QA 3FNRA 2G82A 2GI4A 2WAMA 3I4LA 3PIDA 3SXUA 1R18A 4MVJE 2XTJA 4XJSA 4MB6A 1BCRA 1MG5A 5CH8A 5JCOA 4CF6A 3F6EX 3ZWYA 2QMUA 1FDSA 1XTKA 3IO3A 2YUTA 4PZ9A 2PZBA 3CNOA 3DFMA 3IIMA 4BKUA 4CEJA 1XNJA 2HO4A 3D2CA 3ENKA 1BMTA 1KF0A 2EG5A 3DBHB 3T1NA 2BBSA 4OJYA 3ETGA 1FU4A 1J5PA 3WLRA 4TOIA 1F60A 3IT3A 3CYFA 4Z4QA 1Q16A 2Z5LA 4NQRA 2EU8A 4EJSA 4LRXA 4MYHA 4PFQA 2P4SA 2WFLA 2D7JA 2PUCA 1ATIA 2FDXA 3T06B 2AWOA 3QQ5A 1PR2A 3CCFA 4LF4B 1BXGB 1Y4AE 1RDFA 3VGJA 3BIFA 4MVCA 3GA7A 2KYRA 5ISMA 4D3FA 5KSPA 1C9NA 4LV5B 2HSEA 3ZK7A 4F93B 5ERYA 1PTJC 4K6CA 1JV2B 3WLNA 5AIBA 2WKWA 1NPYA 1G0NA 1Z0ZA 3CUTA 3QBDA 5LBTA 5I9LA 3PICA 1TT5B 1Y9DA 2FG7C 4X6UA 3KWJA 3I3SR 2XKBA 3THXA 1U63A 1XN4A 2B9EA 1KMHB 3Q41A 2B78A 4EZEA 1MZPA 3DW1X 3GPCA 5IM4F 2H54A 3OF3A 1XCPA 2IEIA 5JXJA 1GR1A 1W88B 4GPBA 4UBMA 3QX3A 3QWFA 1T36A 3AMVA 3L8EA 5AUQA 1XEFA 5LOVF 2JVKA 3F4KA 4QA9A 1O5IA 2IIVA 4MI9A 4A5SA 1PG5A 1YDFA 3IQXA 1W4LA 2JFYA 4KDEA 5GONF 1PL0A 2GBLC 5JY1A 4DCSA 5TR9A 4HTFA 3A6ZA 5LUBA 4YJHB 2ZI5A 2X22A 2WIDA 5AW8A 4N48A 3IIEA 2DG2A 3RASA 5LOVB 4H1VA 1IJEA 4PPGA 3FHOA 4TTVA 4UAUA 3HABA 4C1NA 2PWYA 5B7GA 4FYXA 5J1TB 1Z39A 1CY0A 1N0VC 4UVGA 3UF0A 2AZDA 5IP5A 1U4SA 2BRUA 2PQ0A 1A2KC 3D8UA 4R7GA 4CHGA 4FI3F 2QYOA 3PZBA 3Q4GA 1OT3A 1ONPA 3D43A 4MS4A 2DYKA 4H6WA 4MB2A 4I36A 4K6FA 3IHKA 1GKLA 4FGSA 1A50B 3AT1A 3B1YA 4LJAA 4MS4B 3GL9A 4BWYA 2R2AA 4YDSA 3V2UA 3U13A 1RBYA 3RUIA 1UT8A 3OJCA 1H5NA 1PL7A 4N54A 4NHOA 4LY3A 4ERXA 1I2DA 1FFWA 2JGJA 1SHJA 2WZBA 1FVOA 3LQ4A 4WY5A 5CXXA 2ZGVA 1E9RA 5IK2D 2WA2A 2D4HA 5EE3A 3E18A 3KQVA 4JQSA 2HK9A 5CA0B 4Q0MA 2E37A 5IDYA 2G6BA 3ZWKA 1TKAA 5HJEA 2YRFA 3O8OB 5CA0A 1K5PA 1W73A 5AVYA 1TVEA 1DAMA 2QVXX 2X42A 1Z7BA 5KJCA 1BDBA 3MGBA 2P6NA 4J0CA 4BUZA 1P4AA 1FYXA 1E66A 3AI3A 3LRXA 4D8UA 4EKNB 1UKVY 1X42A 2IEAA 1VE1A 1GEGA 2EFGA 2GJSA 2HTFA 2IDZA 4FN5A 3MMPA 1TVKB 2AD1A 3GC6A 4HAZA 2UXCB 2Z43A 1L1FA 1V8BA 4PNZA 4NBRA 5FADA 3X1DA 3F8TA 3NCTA 4L27A 2AXNA 3E5NA 3L1KA 2DKOA 2HJGA 2GK4A 3N8GA 1ZQ9A 2WA1A 1CIPA 1PUIA 1EVIA 2WC1A 4FMPA 3I0MA 4MS3B 4X20B 3RF7A 1DIHA 2GOYA 3WXMA 1XVLA 5J58A 1AMUA 2J0QA 3CC8A 3VKFA 1W1WA 1TYCA 5K0LA 2VCHA 2WKQA 2Q2WA 1KJIA 3MF4A 4DS3A 2QDKA 4OQZA 1FL9A 1EQUA 3Q2KA 3B3FA 4UTOA 1QV7A 4AY5A 4CU5A 1RWWA 4F4JA 3UPTA 2DE0X 4II7A 2VYVA 4MQ6A 4XYGA 3S70A 1R8XA 3SC6A 4L0MA 4U7PB 2P77A 1W76A 4PAGA 2M32A 2BKXA 1G2QA 3I0ZA 4MYUA 1OZHA 3G2JA 1VKJA 3M1YA 3JQAB 5KYNA 1I33A 4FOPA 3TAUA 2BGGA 2Y1KA 3AZPA 3EDYA 3EG9A 4GRIA 4N7JA 2X76A 3QVGA 2A1IA 4CETA 3GEGA 2CY0A 2M9MA 4D9FA 4KFTA 2PS1A 1WW8A 3KOUA 4GEKA 3V4PB 1IWPB 4HATA 2YWCA 2MYUA 1L5RA 1TO2E 3IDFA 4MUAA 1ENYA 2G17A 4WEOA 3OU7A 4NI5A 4NK5A 1U4NA 1SVMA 3ICQB 3Q7RA 3B6MA 4IKEA 5TMEA 2P75A 1KR2A 4JBGA 5KJEA 5BYAA 1GNLA 3U5ZB 1XD2B 3PZRA 1SC1A 4RGVA 3DE7X 2O3RA 3MINB 4UU8A 1L7XA 2QTVB 3KC2A 4ZI7A 1PWEA 2Q8QA 2O8EB 4D9KA 3CBGA 1RWKA 1VJRA 1ZRNA 3FZQA 3GCGA 1AUOA 4MUFA 3TH5A 1U0SY 4Q48A 3FZYA 1U3TA 3NBKA 1TLLA 1AHHA 1Q7RA 4Q4HA 1O08A 1U2GC 2QNBA 4G9GA 3B2EA 1EM8A 5KOJA 3H9BA 3HDVA 5LZ4A 4ZI3A 2ZB2A 3CH5A 3IKJA 3MT0A 1L4BA 1Z2CA 3GH3A 5H80A 2BBTA 4BP8A 1N5RA 4EELA 1PT9A 3T4UA 4DDWA 1C1HA 4HD8A 1G66A 1NGSA 3BWXA 1P44A 1UPFA 4O4IF 4ABTA 3V8QA 1TUEA 3MAGA 2MWMA 4ZT3A 3L8HA 3DCJA 2JCYA 4HX5A 4KTTE 4KWHA 4Q9AA 1NNSA 2OBNA 4WN9A 2ZQZA 1GAQA 3ECCA 4M6WB 2QRMA 2ZSFA 3D4LA 3LT0A 3GLTA 4XSGA 3TGLA 1QONA 3IR7A 2KE5A 2M6LA 4ZMSA 2XCIA 1DUSA 1K92A 1RMTA 3MELA 4L74A 1IB6A 2DCMA 3EVGA 3BDAA 1ZJ6A 3CX3A 4OIMA 1U6KA 1UKYA 3T3GA 1PS0A 3K2QA 4EL0A 2OGTA 2ACVA 5A3RA 4H7IA 1JB9A 2XUPA 3DTVA 3IPCA 3Q12A 3HO8A 5IC5A 3RQSA 2JH8A 3VH3A 5JQGA 4D92A 1R9MA 2RCYA 5K8LA 1R0CA 4I81A 4PPYA 4XEHA 5KWSA 3ESDA 4KAJA 3VC3A 1DADA 3SHFA 3E1KA 4HDQB 1ZN8A 1EBFA 4GP9A 5K2MA 3WGYA 4DWVA 1ZR2A 2ZUTA 2Q45A 1GWNA 3MUNA 1Y8CA 4GUDA 4ACBA 2EP8A 1UJ6A 4LYEA 5KMGA 3EDMA 4TS9A 3P9CA 1RT9A 5JWRA 1P1CA 1TX4B 3VISA 4G3XA 1U0JA 3JTEA 4M38A 1ZH2A 2WF7A 4OSOA 2ZUEA 1N25A 3DYBA 3WL7A 1IL0A 4RF5A 5JVDA 3K9QO 3BGSA 4IM7A 4XDHA 1DZIA 1KEEA 3OJWA 2OCYC 5LQJA 2VJBA 5HTKA 2Z8ZA 1VC2A 5GAJA 2CMGA 1GUAA 2F9LA 3FVWA 3OQVA 4TWJA 4WZAB 3CH4B 3A6PC 1PEAA 2W00A 3L7LA 4MO9A 4RS3A 1QE0A 3KZMA 2VP0A 2PAAA 3KYCB 2B3DA 3HBJA 1EK2A 4X1KB 3EXHC 1EBUA 4XWKA 4AQDA 4MQ5A 5LP1A 1JTVA 2MMGA 3SFTA 2IUTA 3MIIA 1BSVA 1J99A 2PVSA 3CX4A 4F5WA 1KJJA 2PJZA 3ZDBA 4HS4A 4IFBA 4UHDA 4PAMA 2JAHA 3ROEA 3GLHE 4WCVA 3ROZA 2ZUFA 4E88A 4BRZA 1EFPB 1NI4A 2X7XA 4M8SA 3OUUA 4C2AA 2BFCB 4E46A 2CD7A 2X0IA 4QSHA 1YVPA 5IF9A 3CLSD 3G9QA 4M0UA 3PXDA 2M6SA 3A9SA 1PZEA 1JPNA 5TMPA 3PFIA 3SR4A 1QQBA 3PFFA 5MFPA 1O97C 3PJDA 4BMOB 2XEXA 4FILA 3VR5A 4HDSA 2W2LA 4YWHA 2YTZA 3TKAA 2P4EA 4C0KA 1OWLA 4Z9AA 4RE5A 4D25A 1OI4A 3C70A 4TTIA 2H4WA 2ZI4A 1GPDG 4MPDA 3RE1A 1YS7A 2H1SA 2QRHA 1EUDB 3B7GA 3OECA 3PCTA 4IKPA 3OCJA 4ZOLA 4DCMA 1DC4A 2QZ9A 2A78A 3D54D 2QW1A 3VJLA 4EYQA 3FKSA 4IFTA 1Z5UA 4BC1A 1KEWA 1E94E 3LVRE 3FCOA 2VP6A 4N5IX 3W1VA 5EJIA 2WWYA 2ORIA 5TLSA 4REOA 2AN1A 3S5UA 4EB0A 1NJSA 3KQMA 4M49A 3L6BA 5KSOA 2OG2A 2IHZA 5TIIA 2W2TA 2VQEB 2PYDA 4X3PA 2W70A 2ENWA 5BMVA 1C4KA 1JDJA 1I9CA 2GN0A 3DC2A 3ICCA 4L2IA 4LC9A 2WFMA 2NO9A 3LE8A 3VGPA 4EG7A 2NACA 2X6RA 1LBQA 1V11B 3FVVA 2BGMA 4MVJM 2NU9B 1ISSA 2XIQA 3GNTA 5EJ4A 3H11B 2D5IA 4E12A 2VTBA 2CXTA 5F23A 2PBRA 1I3LA 1P18A 2IUSA 3K0KA 5BPHA 1EPUA 3JRNA 3QHQA 3H11A 1YXMA 3H5LA 2GEVA 3NTRA 4WDQA 2RJ3A 4WK2B 4C3ZA 1ML4A 4IIHA 1YOVB 2VH1A 3UK2A 1BDIA 1AZTA 2DFKB 3SOPA 2WD9A 3ZWPA 1K7YA 4A8JB 5E3HA 3IUPA 3ZDAA 3ZDFA 1YACA 2Q5QA 2QT9A 3KXIA 4YUYA 3TPZA 1N78A 1E4EB 2YFKA 1ZN7A 1D4FA 4LWQA 2YOHA 2CDNA 3L0BA 5CH5A 5CNKA 4IVRA 3F9CA 1B7GO 2OKCA 1TJNA 1H2FA 2PLAA 3NALA 2DPGA 3SIRA 5HFJA 1W87A 4DMMA 2LD4A 2UZ0A 1YR7A 2C84A 2FSVA 2XKJE 4JQCA 5AJUA 2PGOA 2G0NA 1O3YA 4FD2A 1WDLA 4KRFA 1U0HC 2FEMA 4X8MA 1DUIA 2OAP1 2WIKA 3F6BX 2W4QA 2LBPA 3BRSA 3HKDB 3IHTA 5KJ1A 2FW0A 1RQRA 5EOVA 3M33A 5C0OE 5I01A 2L2QA 5HWSA 1ILEA 2ZRAA 1NVTA 4JQZA 2XMCA 1R4NA 1A5ZA 1D6SA 3DW3X 5T41A 1QGUB 1TFRA 5L51A 1M2HA 5KPDA 3KB1A 3H1PA 4GPEA 3UAVA 2PKXA 2HSGA 4KAAA 4M0DA 4NBTA 4CQLB 5C8DA 2F9MA 3M34A 5GOTA 4QG3A 4TX1A 3E1GA 2DMRA 1XZFA 2XYRA 2ZIFA 1LC0A 2WSMA 2C1EA 4ZRDA 3SYKA 3K73O 1XVAA 4DQKA 2G77B 3RK1A 3U40A 4X54A 5A4JA 2R1ZA 4BMXA 2V6IA 3B6IA 5CB8A 4LE2A 1M7HA 4I1VA 2ZIGA 3D7RA 1V1MA 3A1DA 4PLCA 5YASA 3LWZA 4ZZIA 1KOJA 4JMPA 4BBPA 2PJRA 2WF5A 1Q20A 1UPUA 3DO5A 4F7WA 2AQHA 1X0VA 3O75A 5I9IA 3F8WA 2B5VA 1RAIA 1GY8A 3P27A 1IHYA 2CHUA 2PH1A 1MXFA 2WIGA 2GXUA 1V1JA 2PKYX 3AB7A 3AINA 4G2NA 2CSUA 4ZTBA 3G2IA 3TMYA 1GPYA 4C88A 5IBRA 3V4OA 3VZDA 2CLOB 1XXHA 1I4LD 4F92B 1UZLA 2ODPA 5A4KA 4YRZA 3KFXA 1E6LA 5C3UA 3SYMA 2EWWA 4K40A 3I9NA 4O4IA 2C2WA 4JI6B 4UTXA 4LRQA 3EBOA 4M1OA 4CTMA 3MMSA 3R77A 1UC8A 1CDEA 2QT1A 2XECA 2VAXA 4OI4A 3KT0A 4E0BA 3ELBA 5AVTA 4EKIA 3Q1LA 1DWOA 1W6RA 4OUKX 1UK6A 2XAAA 3G5MA 4PQFA 3QELB 3DPIA 3IXQA 4R54A 3GLGA 2C83A 5BRNA 4YK7A 1JHZA 3AM1A 3RW9A 4O29A 4GSLA 4ZOEA 1EFRA 1MDFA 2I9KA 3MRVA 5A6SB 1NKTA 1KRXA 4IDFA 4DG8A 2RGXA 3U6KA 2EQ5A 1RJ9B 3SSOA 1HOXA 1LSJA 5IARA 4KO8A 1M2WA 2NZ2A 4BNDB 1IVNA 4F1WA 3QX9A 4MUXA 5IN5A 4PQEA 4KZPA 3QVLA 3R7WB 3FLAA 1M2OB 2A88A 2YMLA 4I99A 6NULA 2W5UA 2ZI7A 4RD6A 4KR9A 3FWKA 5AI0A 2AGVA 5HIMA 3KZCA 4CKBB 5JD4A 3I1JA 1M34E 2XJ4A 1CLUA 1F2DA 3BTUA 5AI6A 1XVVA 2Z3VA 4YAFA 3TZLA 1Z38A 2G28A 1Y4ZA 5CDFE 1NMZA 3QXHA 4TYNA 2J1LA 3ADKA 1E6CA 2W83A 1BX1A 4AO8A 3IL2A 3U60B 3L84A 3W0LB 3I34X 1Q6ZA 1WAMA 3PNYA 5TVGA 5DIZA 1GL6A 1MP0A 2R62A 2LNDA 3V7YA 3DYVA 3MJTA 2R86A 3G88A 5G0VA 1Z4JA 1FRFS 3ZI7A 2QV7A 4FX5A 4AWBA 4FNOA 4QHTA 5H59A 4EFNA 4KPEC 2PGNA 3L0CA 2YHAA 1DC8A 3AHEA 1SOVA 2PZMA 2W48A 1ZJZA 3H16A 2QTNA 2V7BA 3O3CA