5JDIA

Trypanosoma brucei ptr1 in complex with cofactor and inhibitor nmt-h024 (compound 2)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
249
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Profiling of Flavonol Derivatives for the Development of Antitrypanosomatidic Drugs.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 95
structure length 249
sequence length 267
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2016-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jdiA00
1YGYA 4EUFA 4W6ZA 5F1KA 3VZRA 3GC6A 4PG5A 1BDMA 1BWSA 1SCUA 3LC1O 1ENOA 3RKUA 4BNYA 1EQ2A 2DBRA 4YTEA 3DBRA 3GNQA 3BYZA 2VRCD 5L95A 1ONNA 2GPTA 2EXXA 4E2WA 1Q0LA 2PV7A 3I52A 2Q1WA 1IULA 1IB6A 4B7XA 2G82A 2HMVA 2X9NA 3JQ8B 2ZYAA 1PGNA 2DU8A 4D7AA 3M2TA 1E7SA 1F17A 1JTVA 1YB1A 2IYPA 2RHRA 4CV2A 4JBHA 3JYOA 5ICSA 1UP4A 1BMDA 4GKBA 1D3AA 2Y1FA 4LVUA 3TZHA 3DZHA 2IEDA 4BVAA 4CL8A 5F1PA 4N54A 3CUKA 4YXFA 3DMYA 4QFDA 1OI7A 3EGOA 1ADFA 3OETA 3EY4A 1WDKA 3AOGA 4TKLA 2GGSA 1UXJA 1NQOA 4J90A 4YACA 4YYZA 3W6UA 4EW6A 3QVOA 3MJVA 3LVFO 2P4HX 2PK3A 2I5PO 4IDFA 1LTHR 3Q2IA 4O0LA 4U0KA 3QWHA 1V0JA 4ND3A 4TSKA 2A4KA 2UDPA 3LU1A 1B2LA 1E77A 1TT5A 3IUSA 4F46A 2IZ1A 2ZB4A 2ZJ1A 1GYQA 1ISFA 1Y9AA 3C3XA 3DWFA 2EHDA 3UCFA 1Y8RA 5JAQA 4U8GA 3JQGA 4MDHA 5JPIA 2YY7A 3ZWBA 2E48A 1DIRA 4BMSA 1NBOA 4EJ6A 2G0TA 1HYHA 1PQUA 3QIVA 5JY6A 3FR7A 5FEUA 3GEDA 1N9GB 5H83A 4GKVA 4BQRA 5F5NA 5JE8A 3RJ5A 4WCFB 4BO4A 4MO2A 5IZCA 3FWZA 3WICA 2I99A 1YONA 2V6MA 1IY8A 1NYTA 5DP2A 2P9CA 1WAMA 2YJZA 3G1TA 2VOEA 3H8VA 5K6AC 1PQWA 1EZ4A 2NU8A 4ALMA 5THQA 3OP4A 4UVGA 3K92A 2BFMA 1P1JA 4OHUA 5T5QA 3KVOA 4JK3A 3H9JA 4Z0PA 3O38A 5EN4A 1K89A 3AOEA 4BO9A 4QUKA 3OA0A 4MINA 5GZ3A 3AM3A 5JCXA 5KKCA 3C7CB 3ULKA 4PG6A 3I83A 3UF0A 1I30A 3Q1LA 2HMSA 3K5PA 5B4VA 3PQFA 3S8MA 3WLFA 1E3EA 2OXIA 4D42A 1E3WB 1Q2XA 1Q7GA 5CEFA 1FDTA 2X0NA 4AJKA 2ZQZA 1IUKA 5DBFA 1S7CA 3LF1A 4JP3A 5A04A 1B7GO 3P19A 1XEAA 4PLFA 2JKVA 4XDZA 3U4DA 4E5PA 1ADBA 5A06A 3H7AA 2AQKA 4QXMA 1WP4A 4GLOA 3PHLA 1PL7A 4PZDA 4RVUA 2I3GA 1YQXA 2Y1DA 3FI9A 5EMHA 3UAGA 3CE6A 3NJ4A 5G0WA 2CSUA 3AJRA 1Z73A 3INGA 2X86A 4BO7A 2R2GA 3MJ4A 4IDEA 4DREA 2DVMA 3ZH2A 3GOHA 1M76A 2PKQO 1LA2A 3OIFA 4CMKA 5EIOA 2AE2A 3F5QA 1C1XA 2WSBA 1CJCA 1HRDA 1Q0QA 1KIFA 2Y1GA 1IYZA 4HV4A 1T1SA 2O2SA 2YV1A 5MGBA 3H9GA 3NTQA 3MJEA 1VSVA 1HTBA 5EQFA 5CAEA 5CG2A 1JDJA 2Y1OA 4IJWA 1SZJG 4BNTA 3JV7A 4YAIA 2O4UX 1N7HA 1U3VA 1I0ZA 2FWMX 4GAEA 5TQVA 1M2WA 1NAIA 1PJ3A 1WPQA 1YOVA 2BH9A 4Q3EA 4GSLA 4YJGA 3MTGA 3Q9NA 3RU7A 3GN2A 3FNGA 1ZK4A 2X5KO 3E9QA 4J1QA 3QWAA 4A2CA 1DLJA 2YDYA 5G4KB 1UAGA 3BMOB 3C7DB 1VL8A 4KWHA 1KVRA 1B8UA 1EK6A 1NAHA 2BFPA 4FFNA 1DC4A 4ZQFA 2W4QA 1RM0A 4XA8A 3PLRA 2HU2A 4PLVA 4WECA 3Q3CA 8ADHA 3QVXA 3ZU4A 5JCJD 2JAPA 3L4BC 4D46A 3WB9A 2Y67A 2VZ8A 3V2HA 2QZ9A 4JP2A 4B7UA 3VPFA 2YHIA 1HSZA 2NNLD 2PWZA 3JQ7A 3P2YA 3TN7A 3A1NA 3WSVA 4YJFB 1R66A 1P1KA 1Q7CA 2Q1UA 3QP9A 2VOJA 3HZZA 4TQGA 4QTZA 2XXJA 4AJHA 3VVBA 3NDIA 4DC1A 2DPGA 1MXHA 4CLRB 1E5LA 4R1TA 3LT2A 3OIDA 1DBVO 2CVZA 2NVWA 3FTPA 3JQBC 4Y6SA 3NUGA 3VTFA 4EJ0A 1IPEA 5BNTA 1A27A 3GDFA 3PZRA 4BKOA 3OQBA 4R4JA 1Y1PA 2VUUA 3HNPA 1ORRA 4RDIA 3UCEA 1XLTA 4LCEA 2QYSA 3K9QO 3HDJA 4XGNA 1GTMA 2HKIA 3K31A 2PKRA 3UVEA 1OAAA 1PIWA 5DULA 3UH1A 4ZGWA 3GFBA 1K5HA 2C82A 1WMAA 4PCVA 3OJ0A 4L4RA 1FXSA 1GAEO 1ZK1A 2QX7A 3RFXA 2GZ2A 4NJMB 2WYUA 3DONA 3WMWA 4FFLA 2VCYA 4D45A 2EIHA 1KEPA 4AFNA 2Y68A 1WVGA 5C7IO 3I9LA 3ONEA 3WFJA 3RFTA 2V6FA 1WZIA 1QV7A 3JD4A 1PGOA 5CP8A 3WGQA 1KVSA 2X5OA 1T2FA 4NU6A 4BGIA 5L3ZA 4R68A 2EJVA 3ANLA 2YFHA 3DMTC 1YJQA 3C8MA 1ZK0A 2X0JA 2RCYA 1R15A 4DIFA 1O95A 4HNHA 4HWKA 1N7GA 3AM5A 4JGBA 1MUUA 1A7KA 2PZJA 3AY7A 3PVZA 5CEEA 2PGJA 1GCUA 3H9UA 3SEFA 3FNFA 4RORA 4ZJUA 3JD0A 3OFSA 2Q49A 4RCVA 4CMIB 4JJIA 4EUEA 2C2YA 1NWCA 4HY3A 4L4XA 1LSJA 4KTVE 1JQBA 3ZU3A 4A27A 1QMGA 1KC1A 4KDFA 5I8WA 2AEJA 4YT4A 4CMEC 4ND2A 4IDGA 3WXBA 3SLGA 1UZLA 3ZDFA 5KVQA 4YBZA 4ZQGA 3DBHA 5ITVA 2P9GA 1JWBB 4R9SA 3DZBA 1KY4A 2SCUA 4DUPA 3WIEA 4IXTA 1SMKA 4BNHA 5CPFA 1C0LA 2YW9A 3ETDA 1R4MB 4PLWA 2UUOA 1RJWA 4RZHA 4H3VA 2CF5A 2ZB3A 2DAPA 1D1TA 4OQYA 2Y05A 3V1YA 2GNAA 4XR9A 4BHTA 4ESOA 2BI7A 4XYLA 1LX6A 1UZNA 1V3UA 3OF2A 3PPIA 1EFLA 4L9RA 2YYYA 2UUPA 1X14A 3GNSA 3ZHBA 3ZU5A 1K0UA 1XYGA 3EC7A 4YCAA 4E6PA 5K9ZA 2B5VA 3ORFA 2OL4A 2DC1A 4FSHA 1EDOA 1OFGA 2NVUA 2B37A 3EZYA 4MPDA 3QVWA 2IXBA 4CM5A 4TRJA 1HDRA 3LC7O 3QRWA 4OMUA 3GGPA 1YKFA 1X1EA 1U3UA 3RC2A 3Q11A 3H4VA 3GNTA 2R6JA 3IUPA 5C7LO 5G4LA 2FPGA 1UDBA 5B4TA 3JCZA 2R00A 2JCVA 3PFFA 2OFPA 3RIHA 3O26A 4PLZA 4UUNA 4XCVA 1IPFA 1H93A 2O7QA 1VPDA 1Z74A 2PZKA 3BTSA 3M1LA 3VKUA 3WQRA 3A14A 1I8TA 2VHXA 4IS2A 4L8VA 4XRRA 4BV9A 4PFJA 3GH3A 1HETA 4IGEA 4R9RA 1E6UA 1R0LA 4YQYA 3GUCA 4A5OA 1N2SA 4ZHSA 4FOOA 4G65A 4CM7A 3ZU2A 1PZFA 3H5NA 2VUSA 1ZMTA 1HDXA 2HMWA 3GRPA 2J5KA 5L7TA 3R3SA 1JAYA 2X0RA 1DOHA 3L6EA 3DZGA 1UDCA 1C0KA 4M1QA 2ZCUA 1R6DA 3EVNA 4Q39A 4XQGA 4BL5A 3TDKA 3NGLA 3LZ6A 1DXYA 3GEMA 4NBRA 2H9IA 3SX2A 5MDHA 3H6KA 3SC6A 4OXYA 1AXEA 3PWKA 2AQIA 4YQZA 3DBVO 5AQ1A 1OC4A 1HLPA 1VRWA 5BSHA 3QSGA 4YRBA 1P1FA 3EYWA 4Z9FA 4IXWA 3ICCA 3MJTA 4N5MA 3I3OA 3TSCA 3AFNA 5G0TA 1DB3A 2QYTA 3RU9A 4XDYA 4F3YA 4PRLA 3ROQA 1VM6A 1PZGA 1PSDA 3A06A 3ON5A 4UVEA 4OKNA 5ER6A 3KETA 4C4OA 2BLLA 2PD6A 3KYDA 1VJ0A 4XX0A 4IZIA 4J2OA 4NFYA 4D44A 2F1KA 3NDRA 3DOCA 1J4AA 1J5PA 2HJSA 1KY5A 5F1OA 3QQPA 3DHEA 3BMCA 4MVJD 4BNMA 4BNWA 3B70A 1I2ZA 2IDZA 2ZYDA 1VE9A 1LRKA 4R16A 1I33A 4I9NA 4UUOA 4RVSA 3VZPA 4F45A 1WWKA 1ONOA 3PWSA 1DRUA 1PJ4A 2I76A 1FMCA 3VKVA 4BIIA 4D0RA 4XD2A 4XJSA 3H5RA 3OEWA 5DN9A 4QT0A 2D8AA 4DVJA 2FZWA 2O50A 2Y0DA 1UP6A 1GDHA 1K6XA 1NFFA 1YJ8A 4AVYA 4Z3DA 1NXQA 1DIGA 5EQDA 4PLYA 4J9VA 3INRA 1T2AA 1BDBA 3IKVA 3RCBA 3GUYA 4I5DA 3K2BA 3JQCA 4FQ8A 1HL3A 4W7IA 2HJRA 1E1NA 4FJ1A 4J1SA 2ZJ0A 3AK4A 3JYPA 1MA0A 1E6EA 1LBEA 1JN0A 1UXKA 2Z5LA 5DP1A 3S2FA 1JKFA 3WNQA 1YVEI 1CRWG 1IL0A 3K73O 2BGLA 3PZBA 1PZEA 3AUAA 2HMTA 1OOEA 2VYND 1G1AA 1MLDA 4CQMB 5B4UA 4B3IA 1NNUA 1V35A 1PS0A 5G0SA 5JC8A 3LLSA 2DTEA 4II2A 3KXDA 5KJCA 3GG2A 3JYQA 4YRAA 4X54A 4YJDA 2PGLA 5TJ9A 3BTOA 4PG4A 1LDGA 5ENDA 1M67A 1GV0A 1F12A 2JFFA 4BUCA 4QEDA 2EJWA 5KVSA 3TFQA 3FN4A 2V65A 4Y6PA 4EJMA 4XGKA 2EV9A 3MZ0A 4LMPA 4XEHA 3RD5A 5A5FA 3RSHA 1QYDA 3RAJA 5IAAA 1GQ2A 2EKQA 3AOEC 4Q3AA 2BRUA 3PLNA 4JN6B 4W9NA 2B35A 4MVJF 1GL3A 3P7MA 3WGZA 2FN7A 2O23A 1SO8A 1HDGO 4PIVA 4ALLA 4JCOA 1I5RA 3ZWXA 4E5KA 5A5EA 1DIHA 1NASA 4Q3CA 5ER9A 4E21A 1A4UA 4LISA 3CKYA 4N18A 4OQZA 3PJFA 2WWRA 4J1TA 2ZB7A 4C7JA 2O3JA 3AM4A 3S2GA 4NZ9A 1KC3A 2HMUA 2GLXA 2IE0A 2AQHA 2HRZA 4ND4A 2CDAA 3ROKA 3ZWVA 1AGNA 2NADA 2C7GA 2JCYA 3G49A 2CY0A 3U09A 4AL4A 1H9BA 1LSUA 2C20A 2NSDA 3W8DA 4HADA 4FCCA 5DCWA 4DLAA 2NTJA 3D4OA 4J3FA 3LYLA 1SEPA 4KOAA 3WG9A 4KTTE 3OA2A 4M8SA 4WE3A 2C0CA 3HFSA 2YQ5A 4EBFA 2NUAA 2ZK7A 4TZKA 2Q4EA 3TJRA 4B3HA 4E12A 2NWQA 4BNVA 3KYCA 1V3TA 4HNGA 1RWBA 1HSOA 3ASUA 1Y8RB 3NGXA 3ZHZA 3KSDO 4KQWA 1QYVA 4KWIA 1Z7EA 3JQGB 2VRCA 1ZEJA 1PJQA 1JAXA 5TNXA 1T25A 3F46A 1GZ3A 3QA9A 3U4IA 4OXKA 2DFDA 5L4NA 1EFKA 1V9LA 4TRMA 1B0AA 1BXKA 4Z6KA 2CD9A 2ZIZA 5DZSA 5JS6A 2IODA 2Z95A 4OSPA 1HF3A 3TWOA 4MVJP 3UN1A 1WDMA 3E5RA 3AU9A 1P45A 2UV8A 1WLYA 4RLSA 1T1RA 4ILKA 1YDEA 4DMMA 2NVBA 4EGFA 4XIJA 1I2CA 2X8LA 5I7EA 1C0IA 1R0KA 4OKIA 1QP8A 3PHJA 3VH3A 4DLLA 1TVEA 4WCFC 3PDUA 4BO6A 5IJZA 1E7YA 3GN1A 3DAPA 4CMJA 3KEQA 2Q2QA 4WJZA 4WEQA 4LVCA 1XHLA 1KS9A 4RLHA 4NNJA 5T57A 1M6HA 2C54A 5FF9A 2ZCVA 2PFGA 4E2ZA 1X7DA 2AW5A 3OECA 4CM4B 3ZWWA 3NJ8A 4MKZA 3HE3A 4P38A 1LSSA 4ONEA 2J3JA 3VTZA 3HSKA 3RKRA 2B4RO 1RYEA 4FC6A 3D7LA 5JNLA 1MG5A 3OM9A 4OM8A 3KRTA 3LT4A 3UGKA 1ADCA 2OORA 3F5SA 2PTGA 1CWUA 3DZKA 3RBXA 4AICA 2GRAA 3U49A 3D4NA 2JAHA 1V6AA 1FK8A 4IJUA 3U9LA 3PTZA 4J7UA 2CF6A 1ZXBA 3AUUA 4JROA 5HRUA 4XB1A 1X1TA 3ZNNA 1GEEA 1TT7A 4RPJA 1YL7A 1U4SA 1VKNA 2RHCA 3AFMA 1PJ2A 4CQMD 4ALNA 3RUAA 4U7WA 3RUHA 3HN2A 3N7UA 4LCJA 3FF4A 1PX0A 4KDEA 3R3JA 1C1XB 4RF5A 2DBVO 5HM8A 5CEJA 3DQPA 1UH5A 5IF3A 4NBVA 1ADGA 2XF8A 1LLQA 3ENKA 1P74A 3P5SA 1NPDA 4W7HA 5CFZA 2YHUA 3Q2KA 4CV0A 1EMDA 2Q99A 3OMLA 5IN4A 4XGIA 2OZPA 4K6CA 4FN4A 3RWBA 3BIOA 3P2OA 4IUYA 3WYEA 2RBEA 4QFCA 3DAFA 4BNJA 1GR0A 4EYEA 1BVUA 4CL3A 3OICA 5JMWA 5KVVA 3JD1A 1DPGA 4MVJH 4GVLA 1SOVA 2WDZA 4H16A 1E7RA 4BNGA 3ZV4A 1EUDA 2CZCA 1K6JA 2Q46A 2OBNA 1QYCA 4CMAA 4RF3A 4AJ4A 5IFLA 3KSZO 2ZATA 1QORA 1EUCA 2B4TO 4TVOA 1W73A 3VPHA 2VT2A 1E7MA 1NP3A 4DBVO 3BAZA 3C1OA 4TWRA 3JQFC 5KJFA 3HHPA 1QRRA 5GZ1A 3O8QA 2FOIA 3QWBA 3D1LA 1BSVA 2YHIB 2X5JO 4D0SA 1N1GA 1ISGA 3A28A 4ZVVA 4KUHA 2C5EA 1KETA 4PLTA 1AHIA 4NJOA 2UVDA 2DBZA 2P4QA 1PU2A 4GWKA 1SEVA 5KOIA 1HDOA 1W6UA 1YQDA 3G1UA 3PYLA 1YWGO 2ILTA 4PVDA 1N1EA 3BHMA 2A92A 3ZWMA 1CERA 3E8XA 1A71A 1HZZA 4BGVA 4FW8A 4EI2A 3WQQA 4GGOA 2Y93A 4I5FA 1IZ0A 3W8FA 1XWFA 4G2NA 1B14A 2FY8A 4DIBA 1PS8A 5AXAA 2WMDA 4RJTA 5LDGA 4EEZA 1EBFA 4YJHA 3WTCA 3DB2A 2E6UX 1F06A 1XQ1A 3QE3A 4NH4A 4URFA 2AHRA 2V6GA 4PLCA 5JXWA 2VTDA 4B8WA 2GSDA 1KVTA 2DFVA 4NBWA 4PLHA 3KBOA 3OHSX 1KOLA 4BKQA 1WDLA 2EGGA 3F6YA 1XR3A 5JCJA 3BA1A 4CJXA 3INTA 4CUJA 2NLOA 1LNQA 1XA0A 1H0KA 1LRJA 3E18A 3NT5A 3WGOA 4IZHA 1H9AA 2R00C 1X13A 1I2BA 2D2IA 4GWGA 5EPOA 4WOJA 2FMUA 2I67A 4XR4A 3JQEA 4N5NA 3PJEA 4O5OA 2CDCA 5TSDA 3IOYA 4YAKA 2X23A 4K1LA 1HDZA 2D1YA 4IJKA 2AXQA 1Q0HA 3ZW8A 3TPCA 1I3LA 4KUGA 4K28A 3W1VA 2EEZA 2VHVA 1MB4A 3NDJA 1YB5A 1K2WA 3DOOA 2NQTA 3AWDA 5A03A 3K8ZA 5KWEA 4NHEA 4OSOA 4IMRA 1JKJA 4YAJA 3VZQA 4E5YA 1VSUA 3K30A 1E6WA 4MOWA 3GQVA 4YT2A 5JMPA 3UW3A 1VLLA 1WMBA 1MX3A 4WLFA 5U4QA 1LQTA 3DBHB 4NQZA 1NQTA 3NT4A 4B4WA 5TJHA 3QWFA 3JQ9A 3WLEA 3SLKA 1LDEA 4QSMA 3WTBA 3D3WA 3GVPA 4KUEA 4FPXA 4RVHA 1PL6A 2BMAA 2BF7A 3Q6IA 3MWDB 4GX0A 2EW2A 4N5LA 4B4VA 4FIZA 4E30A 1W8DA 4ZRNA 4EUHA 5KTKA 1Z82A 2DTDA 3PEFA 2JFGA 4HFJA 2E4AA 2YV3A 3LK7A 3RUEA 4ZICA 3KHUA 4AJJA 5HBRA 4IM7A 3UUWA 5AXDA 3M6IA 1YL6A 2D5AA 3CXRA 1U9JA 7ADHA 5IDXA 5I9LA 3W8EA 2AG5A 3ZWOA 3KV3O 4RF4A 4HFNA 3KLMX 2PH3A 3RUFA 2V6BA 4CLOA 2NVUB 5FFFA 2POQX 3WGGA 1CYDA 1DSSG 3ST7A 1A9ZA 1CETA 3GY0A 4J0FA 1PR9A 2G5CA 2VRBA 1U3TA 4TRNA 3ETGA 5DCYA 5JYDA 5EESA 3OEYA 1PJBA 2OGUA 3T7CA 1VJ1A 3WMXA 1T2EA 5ADHA 4K26A 1DRWA 1EBUA 4R5HA 2V7PA 5TT1A 3R1IA 1IHXA 1B16A 2GF2A 3AUSA 5AOVA 5JAIA 4CM8A 2Q2WA 3I5MA 3ONDA 4ZN6A 1KEWA 2Q45A 2C7VA 3I4FA 3MOIA 3DDNA 1QYXA 4IBOA 4FFPA 1LQUA 2IYOA 3GGGA 1SBYA 4J7XA 1KERA 2I9PA 2D3TA 3MTJA 1P44A 1DC5A 1NFQA 4GI2A 5DF1A 4D3DA 3VH4A 4OXNA 3IL2A 2B36A 5TLSA 5ILOA 4J16A 5K0ZA 4ZD6A 3U5TA 2CUKA 4Y9DA 3G0OA 1WXDA 1KYQA 1M75A 2B83A 4JJFA 1VI2A 1E5QA 2BFAA 3ASVA 4BKPA 2FR1A 3SBOA 2Z1NA 3BMNB 1RM4A 1D1SA 3KEOA 3ADOA 4HP8A 5L51A 4IDAA 4EITA 5A9SA 4ROSA 4BMVA 3I9JA 4GMGA 1T4DA 2W8ZA 1U8FO 4AJOA 4F6CA 4OOEA 2PNFA 1AE1A 5U9CA 2ZB8A 3D4PA 2JFHA 2JJYA 3DAGA 4UVIA 4PG8A 4FB5A 2A94A 2B69A 2EG9A 4WKGA 2BKAA 2QIOA 3JQAB 3O03A 3CZMA 1C1DA 5G4KA 2ET6A 3BMOA 3CH6A 3DFUA 3WGYA 4BV8A 3ITKA 1QKIA 2X7HA 4DLBA 3B6ZA 3GRKA 3WSWA 2VWGA 1EVZA 4FOSA 5L45A 1U28A 1Y5MA 3IMFA 2E82A 3KB6A 3KYDB 4J49A 3C1TA 4B3JA 3ONFA 5TF4A 4M86A 4XJTA 1R37A 2EW8A 2VWQA 3F1KA 2YDXA 5L4LA 4ZQEA 1U7HA 6LDHA 1ZUD1 3ZW9A 1MG0A 1NR1A 3EHEA 4GX2A 1E1MA 1CEQA 2FR0A 1KEUA 3F4LA 2VHZA 1Y8QA 2HUNA 1NHWA 1ISHA 1RPNA 2JHFA 4ALKA 4TROA 1J0XO 5A02A 2IZZA 2X1HA 2GO1A 4CQLA 2IRWA 5KIAA 1W0CA 3PFWO 4XKJA 1GYPA 3OH8A 1NQAO 1QYWA 4XYMA 1L1FA 4FR5A 4DL9A 5EJ2A 1EQUA 4OO3A 1O8CA 4RPKA 4WPGA 3KYBA 3JTMA 2C5AA 3BMQB 4XQCA 2HO5A 3GAFA 3SJUA 4DQVA 1SC6A 4BNLA 4CPDA 2EERA 1HZJA 1NVGA 4JLWA 2BELA 4ND5A 3SC4A 1NX6A 4J9UE 4JXKA 4TZTA 3SVTA 4R69A 5B37A 2B4QA 1OMOA 1A4IA 4CLXA 4RO0A 2GN8A 2WEKA 2X6TA 2H1SA 2JCXA 3HUDA 2Y99A 5T64A 4UEOA 2NTNA 4J2HA 4YT8A 1ARZA 1ZIDA 2WD7A 3QVSA 2JL1A 2FPPA 5DOVA 3RJ9A 3S2EA 3BHJA 4MVJA 2YV2A 3ITDA 3GDGA 3RC7A 2W2LD 1UXGA 4Q3DA 4TMFA 4MKRA 1NM5A 1NVMB 5CG1A 3IS3A 1BGVA 2FP4A 3ZCXA 1O9BA 1U7TA 2JD2A 2DM6A 3H3JA 1EVJA 1YRLA 4WK6A 4DGSA 4HBGA 4J6FA 2AEMA 1WNTA 3Q0EA 4JQCA 5AXCA 4RGBA 1PTJA 4LSMA 4CM9D 3D64A 1CIVA 4Y67A 4GVXA 4BNFA 4CMIA 3PYMA 4HFMA 4DQUA 4UUMA 1FDWA 3L4BA 1LJ8A 5KVCA 1XELA 1QLJA 2I66A 1UXIA 1ENZA 3FRJA 3DL2A 3PWZA 4BNXA 3FCOA 4OOFA 1SB9A 4W82A 1H6BA 2AMFA 3GEGA 1DLIA 4FC7A 1GV1A 1GADO 3GF4A 3SJ7A 4QQRA 4PRKA 1R4NA 4WLOA 3NTRA 3ZGYA 2XAAA 1F8FA 4CMGA 5B1YA 1DC6A 1Q1NA 1QV6A 1GPJA 5L7WA 4AJEA 1V3VA 4IQ8A 5G0UA 4D41A 2VYNA 1A9YA 4MVJE 1FDSA 3AY3A 4WLVA 2ZKLA 3GK3A 1HE2A 5C3MA 3TL3A 4CV1A 3NTOA 5ENVA 4MJLA 2VNSA 2YQ4A 2GCGA 3HDHA 4U5QA 4U6QA 1PZHA 3EW7A 5COAA 1ZXLA 3RUCA 2PGDA 3FTNA 3WX0A 5EL0A 2P2SA 2EF1A 1YL5A 2I3AA 2VHYA 3JQAD 4NBTA 2P5YA 3DZIA 3NAQA 4MIOA 4A0SA 4CLHA 1P31A 3KYCB 3GZNA 3HDQA 1BW9A 4YDRA 4DBZA 2J3IA 3DO5A 4OH1A 1KEVA 3WGHA 4P22A 3ADPA 4R41A 2QQ5A 4RVFA 4IY1A 1DFGA 4K6FA 4NBUA 3DMTA 4WEOA 4E5NA 3I23A 4M55A 4GGPA 2B5WA 4NK4A 4BNZA 1ZCJA 4AJNA 1HDYA 1ZK3A 1MP0A 1FJHA 1Z45A 2OP1A 2YUTA 5JC1A 4NPCA 2D5CA 3GFGA 1E3JA 4NI5A 3WOHA 1HEUA 1ZW1A 3L9WA 4A03A 1ZSYA 3T4XA 2Y66A 2HRBA 2PH5A 4KMSA 3O9ZA 5IZCC 4YWJA 2X22A 5JLAA 3A4VA 4LRTB 3VAZA 2NACA 3WGTA 1E1LA 3R6DA 3DBRB 4Q3BA 1MFZA 2FZEA 3EMKA 3OBBA 2Q1SA 5DT9A 3U3XA 1UP7A 4DIOA 4UAGA 4E0BA 3E48A 4H7PA 4RPHA 3CZRA 1LLCA 3I9KA 3FSRA 1ENPA 2P5UA 1SNYA 1XIVA 4AG3A 4B79A 2O3TA 2GR9A 4BO1A 1PJTA 1H2BA 2H63A 4YB8A 4NFHA 2VUTA 4ZQBA 4BO8A 1ZSVA 4E2YA 2WYWA 1I3MA 3PP8A 2IZ0A 4GQAA 2I65A 2EP5A 1UZMA 3DHNA 3N58A 3F47A 5T6BA 3A9WA 3IP3A 4O59O 2GUGA 1TB4A 4IINA 4BQPA 3B20A 3V5NA 5T8KA 2NU7A 4UVDA 5I8ZA 5FI5A 2J5QA 5BSFA 3DFZA 2RH8A 1UDAA 2HK8A 5JAZA 1YS4A 4MVJM 2A35A 2IEBA 4RVDA 1P0CA 5HS6A 3PIIA 5EERA 3I9NA 1LI4A 3N74A 2FHSA 1RYDA 5IXSA 2DQ4A 3QW2A 2VYVA 4E32A 2ZTVA 4YT5A 1JVSA 3TZKA 3BZUA 1HDCA 3RBVA 1TT5B 1KVQA 1XU7A 4R54A 4BNUA 3VPXA 4GX5A 4HKTA 3KLPX 1IHYA 1IE3A 1C14A 4BO2A 4PG7A 3R0IA 2PKQP 3QHAA 4OYRA 4PZCA 3RI3A 5JDCA 2Q1TA 2FRDA 3ANMA 3EUWA 2F00A 1PS9A 3H65A 3LC2O 4N7RA 1TA4A 1Y6JA 3E9NA 3UICA 1Y81A 1YO6A 1LUAA 3E82A 2QW8A 5IZ4A 5DDIP 3BTUA 3CSDA 1TEHA 1LXCA 1T26A 3I1JA 3MCVA 4IDBA 2YFQA 3IIEA 1GZ4A 1XKQA 2LDBA 3PIDA 3W4IA 1HE3A 5BSGA 2D0IA 1KVUA 3X2FA 1G0NA 1GU7A 3PQEA 4UREA 3GHYA 3ZNPA 1FDVA 1Y7TA 3JYLA 1H94A 5CDGA 1DJQA 3LT0A 3CTMA 4IQ0A 5GZ6A 1J6UA 3O8QB 4MVJI 3FR8A 1L7EA 3E1KA 1JKIA 4MP6A 4FJ2A 4OIMA 3H2SA 1DIAA 3LSYA 4WLNA 5IDYA 2NU9A 1P1IA 3JD2A 1EEHA 4M89A 5TIIA 3C7AA 5IDQA 1N92A 4UUPA 3B1KA 3KTDA 1ZEMA 4PZEA 4RZIA 3UXYA 4CR6A 3JQ9C 3KZVA 4BNIA 1BHSA 1HKUA 4P4GA 3PJGA 1E3IA 3S1LA 2WYVA 1M6WA 1A72A 2AE1A 4I08A 4IDDA 1EE9A 1O94A 5I9NA 2CDBA 3IDSA 1LLUA 3I6IA 4CUZA 2O4CA 4YJHB 2QRLA 4ID9A 1KBZA 1X7HA 3ZWNA 4TRRA 5GY7A 4A10A 3PJDA 4G81A 1H6CA 1PJSA 5C5IA 5LCXA 3F4BA 3FPCA 3K96A 3ZWPA 1DC3A 3G79A 2VZ0A 2ZYGA 2OOSA 3T4EA 1EUZA 3V1UA 4II3A 4B8ZA 3QVTA 4BS9A 2GASA 2P91A 1H6AA 2AQ8A 2DKNA 2W2KA 4H15A 3ZNQA 4BOYA 3DEYX 1SOWA 4ALIA 5JDIA 3PI7A 1PGQA 4EDFA 1NPTO 4WNIA 1BXZA 1YH3A 2J3KA 1DIBA 3DZJA 3F1LA 5JAMA 3VPGA 5LDHA 1FDUA 3DBLA 4BNKA 1ZO8A 2CNBA 1YOVB 4Y6RA 4YJGB 3PK0A 3WDSA 8LDHA 3WFIA 4IGFA 4CUKA 2HK7A 1NHGA 3ZI0A 4J4BA 2E49A 4QECA 3UFXA 5BSEA 3OJOA 5CDSA 4A7PA 1PJLA 1XSEA 4WOKA 2DTXA 3TZQA 4I1IA 4CMHA 3VDRA 1Z7BA 5KCZA 3ETEA 3ZWCA 1P0FA 2D4AA 5BNFA 2DLDA 3I9MA 4GLLA 4CR8A 4L76A 3EK2A 4CLDA 2AEFA 5CHEA 1MC5A 3F3SA 5LC1A 5DBIA 4GH5A 2ZTMA 5THKA 1Q7BA 3VDQA 3MJSA 1HE4A 5I9MA 4CMCA 5KJ6A 5TS3A 3T7EA 1PWZA 3CMCO 3TZCA 1L7DA 3KM0A 1QG6A 1PL8A 5CDTA 4DMLA 3EDMA 4MP8A 1DAOA 3JQ7B 1BXGA 1B15A 1Z75A 3MOGA 4L74A 3ZNOA 3D3WB 4AJPA 2BD0A 3CMMA 1T2DA 3L6OO 3KOUA 4R5MA 3V2UA 2EKLA 1DJNA 4FFRA 4C7KA 1E3LA 3H5AA 1YQGA 3O4RA 5L7YA 3VC7A 1U2DA 3DZFA 1U4OA 1HWYA 2X0IA 3M1AA 4W99A 4AJLA 4CV3A 3FWNA 2VN8A 1T24A 1ISMA 5TC4A 4GX1A 2Q2VA 1B8VA 1ULSA 4DXHA 1X0XA 3F9IA 2WTBA 4ZRMA 2D59A 1R12A 2VTEA 4YAGA 2FPIA 1BVRA 4J0EA 1UR5A 1NPYA 3GA0A 3I9OA 1ML3A 5C37A 4CLOB 2EGHA 3TF5A 3S55A 4CM4A 3U4HA 3KUXA 4YPOA 4B4UA 4WNCA 2TMGA 2O3QA 3GGOA 3JQ8A 4FBGA 4E5MA 1JW9B 1PQPA 2VWPA 5CPBA 1MFPA 2DUWA 4E31A 1DAPA 4DYVA 3WJ7A 4B7CA 5JO0A 1NFRA 1B8PA 1LDYA 4W4TA 1I3NA 3PGXA 4RQUA 3WIDA 4NDNE 3GDOA 2DPHA 4CM8B 5AVOA 2OUIA 3RASA 4R1NA 2OHXA 3GVIA 4FD3A 4G5HA 3ZN2A 2OBYA 4XQEA 3NX4A 2JD0A 4J4HA 2WM3A 4J1NA 4DWVA 3EZLA 3OJFA 1I10A 2HAEA 3IQDB 2BI8A 4R3WA 1ZBQA 4CM6A 5A4DA 4YAEA 1ISIA 4ALJA 4U6SA 5FWNA 1TLTA 2GN6A 4UEJA 4D3SA 1RM5A 1D4FA 3RC1A 2QG4A 3FBTA 3G3EA 5DCUA 1EDZA 2EWMA 3H9QA 3OIGA 1T4BA 4MIEA 5A9SB 2XPCA 3U62A 2AA3A 5TX7A 1M66A 1ZH8A 4UEKA 3V1TC 1UUFA 4RF2A 3Q9UA 4AJ1A 4OL9A 4GBJA 1C1DB 4XWYA 1YDWA 2Y0EA 2G1UA 1N9GA 1MC4A 5A1TA 2A9FA 2C2XA 4WCFA 4Z3KA 4RPGA 4BNNA 3W4KA 1DO8A 5A9RA 1ZZEA 3WWYA 2WJPA 3K2EA 4NG5A 2GZ3A 6ADHA 4J43A 1LU9A 4O6VA 4AJIA 2PR2A 1LRLA 3G17A 4I9HA 4WLEA 5HWSA 4BO3A 1O6ZA 1WZEA 4XYGA 5H81A 3VOSA 2ZTLA 4LSWA 3V8BA 4NMHA 4A26A 1OBFO 2J6IA 3TL2A 5G2OA 3JYNA 5TRTA 1QLHA 1HLDA 4BGUA 1QR6A 1XGKA 3L07A 1JLLA 1A7AA 4B4OA 2FSSA 3GPDG 1AUPA 1DFIA 4RDHA 2PZLA 1E3WA 1PEDA 3CINA 5COQA 5GMOA 1Y8QB 1ZJZA 1VL0A 2Y0CA 3WNVA 1X7GA 3NYWA 2I6TA 2JD1A 1AXGA 2C07A 1PGPA 2DBQA 3D5TA 3TOZA 5EINA 3PQDA 2ZTUA 2CMDA 4I5GA 1E7WA 4CQLB 4K9DA 1D8AA 1H2HA 4DPKA 1X0VA 3QWIA 5L4SA 4KP7A 3ROMA 5I7FA 4CODB 4LRSB 4YR9A 1P3DA 3GVHA 5TT0A 3DR3A 1DFHA 1EVIA 4OJNA 4PLPA 1E92A 1A5ZA 4L0QA 3U0BA 1LLDA 3ZHXA 1QSGA 1RM3A 4FGSA 1G0OA 1ID1A 3ICPA 1GPDG 1AN9A 2B0JA 3ROPA 4BKUA 2GERA 3D0OA 3PGJA 4IPTA 4ND1A 2Q50A 4UVHA 4RL6A 3NRCA 1W4ZA 1K3TA 1JWAB 2O7SA 4LW8A 1U5CA 2BGKA 4PVCA 3S2IA 2H6EA 3UCXA 1OZAA 2O3RA 3COSA 3NKLA 3OJEA 4D79A 4OAQA 2WE8A 5KKAA 5BNIA 3DTTA 1GQYA 2WD7B 5BQFA 3STHA 1F8GA 2W98A 5ES3A 3AUTA 4IQGA 1NR7A 4DRYA 1VC2A 3L0DA 1U3WA 4WLUA 4DA9A 4JNKA 3H3FA 3VVCA 2OP0A 2W90A 4E13A 5IDWA 3GT0A 7MDHA 3FNHA 4QO7A 3VH2A 2QRKA 3D5QA 3WS7A 1GYRA 2Z1MA 3GVXA 5T67A 5K6AA 1I3KA 2O48X 3RUIA 4IIUA 3LLVA 3RROA 4KZPA 5JO9A 1GUFA 2HDHA 3UKOA 4BO0A 4BMNA 3JQFA 3FBGA 3CIFA 4R51A 1V8BA 4LMRA 3RVDA 3W6ZA 4O1MA 4AJ2A 3LT1A 1PWXA 2HCTA 4I9UA 3GMSA 4CLEA 3GPIA 1H6DA 3SXPA 9LDBA 3LF2A 5COBA 4JIGA 1R4NB 3ZV6A 3RQSA 4J7CA 1HXHA 3BMCB 2X9GA 4YJFA 3W4JA 4W9NC 1ISJA 4FDAA 1O89A 4WGGA 1JA9A 3JD3A 1H5QA 3C85A 1GQQA 3FD8A 3NEPX 2HSDA 4HUJA 5JW6A 1NWHA 4BB5A 4IMPA 3L6DA 3WQSB 4CLRA 1JVBA 3WBFA 1P1HA 2X4GA 4DC0A 3HDYA 1LDBA 1CQJA 2PZMA 4RVGA 1NQ5A 2O2YA 5IN5A 1TXGA 2PY6A 1YXMA 2XXBA 3HWRA 2W2LA 1O5IA 1UAYA 3GHHA 3H9EO 2FSVA 4IJVA 1GZ6A 3PHHA 2LDXA 5T8KC 3QV1A 1GEGA 3L4SO 5U1PA 3C1AA 4HXYA 4PLGA 1LC0A 3IAHA 4EEXA 4E2XA 2O3UA 2DT5A 2J8ZA 3B1FA 3E03A 1DRVA 2G76A 2Y1EA 3VZSA 3RFVA 4CM9A 1NVTA 3GZNB 4Y98A 3MWEB 4NJMA 1BW9B 3AW9A 4JJGA 5CDUA 3H2ZA 4E33A 1I36A 3IKTA 3OSUA 1O0SA 3HG7A 3MJCA 3D3EA 1E1KA 3GAZA 1B3BA 2BFOA 3TNLA 5I7VA 1SAYA 1EK5A 1ZMOA 3PHIA 1MGOA 4DQXA 4L73A 3ZHYA 2ZQYA 4A73A 2TMDA 5JDCC 5IG2A 3I6QA 1ZKMA 3AY6A 2G17A 4S1VA 4Z0TA 4M54A 3E5MA 2C29D 1U5AA 3OJLA 1ZK2A 3GR6A 2PLAA 5AYVA 4ZU3A 4DPMA 3DHYA 5IXYA 3ZWYA 3UHAA 3NT2A 3HB5X 2GN4A 1PR3A 1YBMA 2P9EA 3BMNA 1IZ9A 3VH1A 4DYDA 3QY9A 4MVJG 3HADA 4CMBA 1AHHA 2C59A 1CDOA 3E9MA 2P68A 2CVOA 1LC3A 1LDNA 5A9TA 1E3SA 1XG5A 4R1UA 1EE2A 5DOZA 1Y5RA 1VJTA 3WGIA 5AXBA 5H82A 3TOXA 2WE7A 3E6AA 3JQAA 3X2EA 5HS4A 2GD1O 4Q3NA 5JYEA 4P4NA 1DHTA 1R4MA 2Y1CA 2FR8A 4U0JA 2EKPA 2QHXA 2HQ1A 3JQBA 3M2PA 3LQFA 4JX8A 1RKXA 5L53A 2J5RA 3I4CA 4TKMA 4D43A 1TI7A 3EAGA 1GFSA 3WR5A 5JSFA 4CR7A 1ZSNA 1IOLA 2YZ7A 4DTIA 1GUYA 1XU9A 5DNAA 2VHWA 4INAA 1DDOA 1P9LA 5A05A 1Y9EA 5L40A 1JU9A 1OC2A 2RAFA 2NQ8A 3RUDA 3DC2A 1R16A 3JQ6A 3RC9A 2IXAA 1F14A 1Z6ZA 3HFGA 1CQIA 4P8RA 4Z9YA 4XQ9A 4Z0HO 3PYXA 1BRMA 4EZBA 2NM0A 1G6KA 3WYBA 3OQ6A 3FNEA 3TZ6A 3FHLA 4KQXA 2EP7A 5CDYA 4WASA 1T2CA 5G0VA 3IJPA 4HFRA 3ABIA 3BXXA 3QJ5A 5BR7A 3ZV5A 4HX5A 1C0PA 4S3MA 4LK3A 2Q3EA 3GG9A 4LGVA 3PDJA 4ITUA 5JDIC 1ONPA 3ANNA 3PHGA 3WBBA 5J23A 2JHGA 2RH4A 5F5LA 4GPD1 4Y8VA 1PJCA 4FGWA 4IIVA 4R3NA 4YRDA 3IJRA 3LDHA 4TVBA 3AI1A 2OMEA 4CM3A 4FJ0A 2VZ9A 1PGJA 3BMQA 2UYYA 3GLQA 5JBIA 1XDWA 4Q9NA 4OGWA 2PD4A 1YE3A 2E37A 1E7QA 4J4TA 1YBAA 2BHLA 3VPSA 4MP3A 3PXXA 2NV6A 5ICMA 1X15A 1YBVA 3C24A 1BTOA 2PA3A 4XIYA 1LSOA 1FF9A 2RIRA 2O3SA 5L9AA 4FFMA 1HYGA 4CMEA 1GY8A 1XQ6A 3PRJA 4P4LA 5JFOA 4I5EA 3ZZNA 4QO8A 2PD3A 4YEDA 1J49A 1XCBA 2NTVA 1ENYA 4MKXA 1S6YA 1K6IA 1LDMA 2VQ3A 4RV9A 4NR0A 4I8XA 3RBZA 3GVCA 1I24A 3B1JA 2H5LA 3AU8A 5B12A 5F3RA 5KJEA 4RQTA 2VWHA 4QX6A 1DEHA 5A3JA 1P77A 3EVTA 1N5DA 2VT3A 5ILGA 1I01A 1ZVMA 4RPLA 4XYBA 4XRGA 3BTVA 1MXFA 1WW8A 4LN1A 1SB8A 4UULA 5ITWA 1LEHA 4ZQHA 1CF2O 1DHRA 2AG8A 4M49A 4XZ3A 1P1RA 1P33A 5KJ1A 4YVFA 1QXSA 4NU5A 5FI3A 4YA6A 3L77A 3NV9A 2Q4BA 5KNLA 3L9XA 1YB4A 3U4CA 3KSUA 3V2GA 5TGDA 1GUZA 1ZJYA 4F6LA 2BGMA 3GZ4A 3TRIA 2HLPA 3WJAA 3TQHA 2CFCA 2W2KB 5A3VA 4CM1A 4E4YA 4IDCA 4BO5A 1U1IA 1GCOA 4L4SA 4MIYA 4WCDA 3CPSA 1EVYA 3DOJA 3HQ4O 3CEAA 2GDZA 2GYYA 4FS3A 2UAGA 4NFSA 3ZV3A 1ZNQO 4NIMA 5I7SA 3HJAA 1HE5A 1R0SA 3AI2A 2GZ1A 3DBLB 3DXFA 4E3ZA 3KO8A 3GMDA 2HK9A 3VHRA 9LDTA 5BT9A 1C3VA 1VKOA 2DUUA 2VNAA 4BKRA 5HTOA 1BG6A 3QLJA 1NTOA 1UJMA 1ZFNA 4M87A 2J3HA 5F21A 5FYDA 4D3FA 1B3RA 5HA5A 4GL4A 4JBGA 2X9VA 3DTYA 4R1SA 3MEQA 1HYEA 2OO5A 3AI3A 3IC5A 4DPLA 4NK5A 1SPXA 3FPLA 4ZA2A 2NU6A 2QZZA 3BHIA 1U8XX 3WWZA 1HT0A 3ZWAA 2XOXA 5JY1A 3JQDA 2X58A 4JBIA 1D7OA 1GD1O 3UOGA 2WD8A 1U2GA 1N8KA 4Z9XA 2CVQA 4GMFA 4CQMA 1F0YA 3IP1A 3HN7A 2QRJA 1BXGB 4FFOA 5DBGA 4BGEA 4XYEA 1MV8A 4O63O 4WUVA 3WYCA 3K6JA 4PGFA 1E0DA 4XB2A 4R01A 4L75A 3ENNA 3TFOA 4BB6A 4GSKA 4IS3A 4PN3A 1UXHA 5C7OO 1I32A 2VYVD 3JSAA 1B26A 1VL6A 4J91A 3OQ1A 3HB4X 2GN9A 1ULUA
chains in the Genus database with same CATH superfamily
3A25A 1OLUB 1W4LA 4W6ZA 4YJ3F 5F1KA 3TLKA 3Q12A 1ZA2A 4UMEA 3GC6A 3ZJYA 4EVIA 1BDMA 3NHSA 4N9QA 2CJFA 3B53X 4V0KA 5DNDA 4CW7A 3RKUA 3NV7A 3P0IA 1EQ2A 4YIHA 4L4UA 3GNQA 3AVWA 3IT3A 3BYZA 3KQMA 1NJFA 2PWYA 3QUSA 5L95A 4PR0A 4B3XA 2GPTA 2EXXA 2P2LA 3IV6A 1ORTA 1Z0SA 4IDOA 3OIVA 4QJ4A 5ALGA 4E2WA 1N2BA 2WHPA 5BR4A 2Q1WA 1IULA 1VIVA 5I7HA 4FX5A 2G82A 4B7XA 4C03A 2AV6A 3STUA 4BLUA 1JHMA 5FOVA 3NVDA 1QOPB 1YFJA 4UD6A 2VZEA 3GA5A 4N82A 3M2TA 4QQ8A 3DA8A 3ZGNA 2IYPA 1KDOA 2QZPA 1KO5A 3DH0A 3JYOA 5AVJA 4ZI2A 1OT5A 6Q21A 3OQMA 1QCZA 2CFOA 4KXQA 3OC0A 1MA3A 2WIKA 1D3AA 2G0NA 3DZHA 3EY9A 1DEAA 4BVAA 3FMPB 3IHLA 2CXQA 4CL8A 4CG2A 5F1PA 3Q8KA 1GFZA 4N54A 4BVEA 2I2BA 2Y71A 4N9WA 1JDBC 1YZGA 1MPTA 4DUZB 1OI7A 3EGOA 4KV7A 2R4UA 1F38A 1CW2B 2WJZB 1KBQA 3OPYI 4LVOA 2GM5A 1NQOA 4YACA 4HQLA 4YYZA 4I8IA 1HNNA 2QVZX 2PA0A 3TUJC 5J1TB 1OYWA 1X8JA 2GJSA 5DH9A 2FE1A 1ECBA 1RC0A 5EZQA 5IC4A 2I5PO 4NDAA 4OG2A 4O0LA 1ZS9A 3OTHA 1ZI6A 1QZTA 1IY2A 4O1HA 4TSKA 4JI5B 2UDPA 5CB6A 2V54A 4QIHA 2OPHA 2YMMA 2EQBA 3WIVA 1VPLA 3FYUC 4MR8A 2OGZA 3ABSB 2ZJ1A 3C3XA 3DE2X 4TKUB 4Y2GA 3PNLA 4WN9B 4D9JA 4EHDA 3TLGA 5LP6B 3F6BX 4KXXA 1OILA 2IEGA 4V0SA 2VJMA 3KT0A 2MSCB 2G6BA 4MKFA 2WIGA 3C6MA 5JY6A 5CRIA 3I5AA 4RH3A 2LGJA 4A8PA 3WSTA 2W58A 3GEDA 5H83A 2XKBA 4GKVA 5DE3A 1K5GA 3TQCA 5JE8A 1K75A 5ED4A 3H3XA 4HRVA 3NCTA 3RJ5A 1RPAA 3AEUB 1ZN9A 3O1HB 3I0ZA 4WRRA 4AULA 2HF8A 3FWZA 4BO4A 3WICA 3IR6A 2I99A 2V6MA 1IY8A 2V74B 2P9CA 1CY8A 1WAMA 2FEKA 3ME5A 2XF2A 2A33A 2VOEA 2V6JA 3MTEA 2FRXA 2OKGA 2OXRA 2OYSA 2ZBFA 3KT8A 4J0KA 2IV7A 1YIOA 5CDFE 3O75A 1MV5A 3WYFA 2BFMA 4RA6A 1P39A 1YI0A 3R5JA 1PFWA 1YS2X 3HL0A 4JK3A 4Z0PA 5T5QA 3UMSA 5JHGB 2Q4RA 3CA8A 3ED1A 3OT5A 2AR0A 4F4UA 1F3LA 4QUKA 1T5OA 1ODTC 1ULAA 4MINA 1RQLA 2E1RA 2YY6A 2PMEA 4YONB 1X2EA 3ANSA 5GONF 4P0PB 5AW0A 1R0BA 1TYEB 1I30A 3BICA 3G8BA 221PA 1WQ3A 2BZGA 2HMSA 2V7WA 4GZ6A 2W22A 3DT6A 3I72A 2V5UA 3MS7A 1IWOA 2WFMA 3S68A 4JY7A 4D3ZA 1XHFA 2P5SA 3JVEA 4D42A 2QYHA 1E3WB 2UYCA 1LBTA 1Q7GA 3GJXC 4AZVA 1QIEA 2LNDA 4FI3F 1FDTA 5HIMA 3D8TA 4EY4A 5CEFA 2ZQZA 2WD9A 1ZVVA 4JP3A 5A04A 1VKRA 5FR1A 4ZZ3A 3FCXA 2H3EA 4XDZA 3U4DA 2FMTA 4E5PA 2GAJA 1XP5A 1Q22A 3A4MA 4AO7A 3WLRA 1EWVA 4ACBA 4BVHA 3H2GA 2F64A 1A9XA 4ZO9A 3OEEA 1XBTA 2QL5A 3CZ9A 3D81A 4PZDA 3WWEA 5JZBA 2I3GA 1EUQA 1JJ7A 1DKMA 1SVLA 2Y1DA 4FGLA 4JH0A 4RMHA 4Y2UA 3M82A 4RA9A 5IKEA 1FFEA 3TLXA 3ETJA 1FX1A 4FCWA 1LPNA 5C4GB 2FN4A 5H70A 3REQA 2DF8A 5AJZA 1IC6A 4M38A 1JA0A 4BO7A 5EPEA 2ZI9A 1X7YA 2DVMA 1XRNA 1YJXA 3GA7A 4E6EA 1M76A 3OIFA 3RU3A 1POWA 1C7EA 1CJCA 2GJ4A 3HU3A 1KIFA 1AKEA 1YULA 4M9RA 4CQNA 1V25A 3IODA 1J2RA 1T1SA 5IFKA 3P0RA 1W2WB 5FR2A 4DM4A 1K68A 1XZIA 4KMOA 2ZYWX 4DLTA 5BUCA 2B5OA 1PR4A 1ECCA 5E38A 2Y1OA 2WHEA 4LPSA 4HLUC 3G8DA 3V34A 1SZJG 3VRHA 3FYDA 4GOOD 4LZZA 1YVRA 4YAIA 1ZX1A 3AO0B 2C04A 4FYVA 4IMJB 5T3UA 1WM1A 4HLCA 2YVLA 4Y2XA 1PJ3A 1WPQA 1UBTS 2D1TA 1OGIA 4KGXA 1NC1A 1X3SA 1E79D 2IW3A 2ODBA 3SF8B 2WYIA 3GN2A 1Z4KA 3ET5A 1DCKA 1R4AA 4J1QA 2O7VA 4A2CA 5DM60 3GLIA 4PSUA 3IOMA 3BMOB 4RENA 2OC9A 2P3QA 3HUFA 3LSTA 1NAHA 5NULA 5JQGF 1COWD 1DC4A 4ZQFA 4QT4A 1RM0A 2PRJA 5HKAA 3H8WA 1CRQA 3K9HA 7ABPA 3Q3CA 4Q7KA 1DINA 1PTJC 3WGUA 3DDCA 1RBMA 3ZU4A 1QDLB 2NUPB 3F74A 2ECQA 4UHFA 1XZHA 4R8KA 3UJ8A 5JCJD 3IO5A 1E3MA 4UHBA 2ZBGA 4D9GA 4QXRA 4XXHA 3ACCA 1J0CA 3T15A 3V2HA 1K86A 1P61B 3L06A 4R40A 1PO7A 3CLUC 5DYWA 3ESAA 3JQ7A 3ORRA 2OGSA 2PX0A 1IY9A 1R66A 3KAJA 3KOMA 2Q1UA 2UZ0A 3CUWA 3OPNA 3OU7A 3ACBA 4L2IA 5ECWA 3HZZA 4QOGA 3X1JA 2CYAA 2ESRA 1VJ5A 4QTZA 2XVZA 3HRIA 3LY8A 4U3JB 3VVBA 4HXEB 1ZIYA 3L8CA 4DC1A 4F1WA 1M9NA 1FYXA 2IU0A 1US8A 3X1KA 3K9GA 1AQJA 4CI0B 2ZRPA 5TQ2A 1LZKA 4RMJA 2CVZA 2P8JA 3ECAA 4IHAA 3U17A 4FMDF 4E07A 5JZVA 3HKDA 4L5CA 1IPEA 1U8UA 1ZVKA 3GRAA 3IP6A 3GDFA 3PZRA 1PK7A 1FRFS 4BJHB 4C0QC 4OAPA 3BFVA 4D8VA 5C51B 1Y1PA 3DFKA 1V8PA 4UE3S 3IEMA 4MARA 3LHFA 5CXSA 1VRCA 1R9MA 3H0KA 3OKAA 4KR0A 3K9QO 5IHXA 5JEDA 3QH4A 2HKIA 1RXWA 5DK6A 4PIMA 3U60B 4MDFA 2QLMA 4NBSA 5DULA 1M5UA 3FNIA 5DHSA 3AF2A 4MR9A 1K5HA 3O84A 4PCVA 1Z2OX 3VUFA 1D6SA 4RWEA 4NJMB 3TG2A 3KKOA 4FFLA 2PUBA 3LV8A 4D45A 4N3AA 4RANA 1BXRA 2EIHA 3R23A 4HX2A 3FRHA 1IHUA 4YUWA 3L7JA 2V6FA 1AKYA 3UV7A 2ZUWA 1G7CA 1K1EA 2M6KA 3PEWA 4DNQA 1KVSA 1KOGA 1SBTA 4DGQA 2ORIA 4NU6A 1B43A 1AN0A 1N7IA 1H2YA 5HIKA 2EOAA 4LC9A 2CL0X 4D3YA 3FPSA 3GDHA 3NCHA 1RFLA 1VZ3A 1BFKA 3C8MA 4PNPA 4WQMA 3VPDA 3R4CA 4B75A 1MB0A 1UMCB 3KKMA 1CZLA 2HFJA 2HPVA 2P0EA 4QPJC 4QXPA 4UCQA 3DDSA 1NF2A 2BKUA 2JFUA 4O4LB 3YASA 1U81A 1ORDA 2QRHA 3UQZA 3DE5X 4I99A 4JGBA 3T3HA 1MUUA 2BP7B 2ZREA 4J0HA 1JE0A 1USVA 3P2MA 5AM0A 3E2IA 3QBEA 2QUBA 4OXQA 1GCUA 2CNKA 3ZHOA 4RORA 3PQ8A 4QUJA 3GP3A 4ML3A 3TJZA 4B84A 3L7OA 1WU8A 4H7FA 4CMIB 2JG3A 3BC1A 4S1OA 1ZOSA 1NWCA 3ZIAA 4N6GA 1NURA 1JRLA 3HEAA 4L4XA 5AMXA 1LSJA 2Q5FA 3VQTA 1SU6A 3V4SA 1YIAA 5I8WA 2AEJA 4ZDKA 2JIMA 4MUJA 3QEJA 2J6HA 5AP9A 2F4VB 1J5XA 4QC2A 5KVQA 4CG1A 4EHNA 3K05A 1JWBB 4FR2A 2OCXA 3DZBA 3PBKA 5ALHA 4W5QA 2AFIB 4B2LA 4BNHA 3P0FA 2EYQA 1CJBA 2YW9A 4Z7JA 5LWHA 3GIDA 4PZLA 2O0LA 2HCFA 5FTWA 1C2YA 3A9CA 5KBYA 3AB8A 2DAPA 5J4HA 4HN2A 1MIOA 2BHNA 1FZTA 3N6RA 3P9IA 4OQYA 4I50B 2Y05A 4WDQA 2CJYA 2R96A 2AXPA 2GNAA 3A31A 3V1YA 4DA6A 1E2NA 2VAVA 4ESOA 1N3YA 1UZNA 4XYLA 4V03A 2X3UA 3V4ZA 1XZ8A 2BZSA 3DKKA 5AKYA 1GSIA 1XT6A 4ANFA 3SQWA 1Z6TA 2PRZA 3AEKB 5HUJA 4GGMX 4LOKA 4G8CA 2HWKA 2QB5A 4WESB 3UJ3X 3ZU5A 5HOEA 3E22B 1SULA 6AT1A 1I7PA 4BP9A 2HOQA 2R1VA 4Z1MD 1XEXB 2B5VA 3ORFA 4Y9SA 4FSHA 4IHJA 4J3NA 3ROFA 4BWYA 5EXTA 2NVUA 3TR5A 2AIRA 1G16A 2HT6A 4BBZA 5FFNA 4PR3A 1HDRA 1NXXA 4YDSA 1UIMA 3HUTA 4OMUA 2J7PA 3GGPA 1NIJA 5HX7A 1XNHA 4GI3A 2QL7A 3HY3A 1G98A 3QBJA 4KMRA 3ZDQA 5EPUA 1SIUA 1I5OA 2B8EA 1KZYC 4X7PA 4DMRA 1VP9A 2FPGA 1UDBA 3UMYA 1OH7A 3FTQA 3BWXA 4H0FA 3TW8B 1ECFA 4PLZA 1WCIB 3ONVA 1QP7A 4XCVA 3U6KA 3WK5A 2DHQA 4Q1CA 1Z74A 1P0PA 2PZKA 1G41A 3M1LA 4MA5A 1ZYUA 3MT0A 3VKUA 4MUIA 3WQRA 4PNEA 3PTAA 1B8OA 1R6BX 2VHXA 1VJRA 4L8VA 4W5RA 3RG8A 4PYIA 5FHRA 4U9HS 5L6LB 4IGEA 3L0SA 4CKBB 3MVEA 2HT1A 3CZAA 2JH3A 5EHIA 1WBBA 4OUDA 5EJ8A 5SV2A 5BOVA 3VNUA 1N2SA 2DJ5A 2GCOA 4FOOA 3ZCUA 8ATCA 1HDXA 1ZJ6A 2C94A 2J5KA 1FU7A 2RGNC 2X6RA 1CUDA 3L6EA 3L8GA 5T7BA 2X2PA 1HQKA 3BSFA 2WY2D 5BRNA 2Z1DA 1J0AA 1T9KA 3IPLA 2P75A 4Q3LA 3I53A 1XTZA 4X1YB 4BL5A 5ICEA 3AVVA 4M7OA 1P2DA 4G9GA 1OBHA 3T1NA 1F0NA 4CYMA 2W2MA 3ENVA 1TK3A 5K0BA 5MDHA 1SQ6A 3SC6A 1J56A 2AN5A 3W6ZA 1J9ZA 5KQMA 5LQNA 4UTVA 4YQZA 3NHUA 1G20E 3LX5A 2Z2JA 4TKZA 2DHRA 1VRWA 2B30A 5BSHA 2C0PA 3H18A 3NIGB 2XV1A 1P1FA 1JL3A 2HZ7A 1KQGA 5EJ5A 4U9IS 2W6OA 3ICCA 3MJTA 3I3OA 4PYLA 2QPAA 1VCHA 2QYTA 3K5HA 3Q7EA 4G0MA 4HLQB 5EHNA 1DCMA 4ZXPA 4O4HF 3DNPA 4PRLA 4ER7A 2H8GA 5EC8A 1BCSA 2H2WA 1KU0A 3ZE7A 1PSWA 5FUVA 4V38A 4R05A 2G07A 3NHPA 3KETA 1G3RA 1XEFA 3BFKA 1BWPA 5ALQA 4C4OA 1YAJA 4UDNA 1V5IA 1EX6A 2EKBA 4IZIA 2VA8A 5EHGA 2EQAA 3DOCA 4YP0A 1J5PA 2Q62A 3IVXA 1M5TA 2HBZA 2HJSA 4E15A 4B35A 1I6KA 1QQ5A 4G5YA 5KKNB 1T6NA 3BMCA 2IYNA 2OQRA 4BNMA 1XP8A 1DT5A 3INNA 4EPWA 2W2VA 1RXUA 4HN4B 1B00A 2ZAIA 2ZYDA 3B6MA 3E7DA 1J23A 4RMNA 2QM7A 4B43A 4P86A 1IK6A 1A77A 1ZI8A 1QIMA 2XJ4A 4RVSA 1WWKA 2HSGA 1DWQA 2GK6A 1G2PA 3MHPA 1EG7A 4H1TA 2XMZA 4LY9A 3D8BA 2XE4A 3KX2A 1M8FA 2HK6A 1BMQA 2JIDA 1QMPA 1UMBA 4LWPA 2WPDD 2V45A 3QLVC 3CW9A 3KHKA 4QE3A 3SG0A 5JSYA 1OKKD 2HRRA 4UU8A 4WXRA 1LF0A 4EPVA 1ACJA 1OLXB 3R44A 3O1JC 2FZWA 5KI6A 3TTVA 2O50A 2QM3A 1NFFA 2G4LA 4AVYA 1NXQA 2P2GA 3AKEA 4G09A 2BEWB 1PDVA 1V16A 4BX0A 4HVLA 3WZ2A 2WZBA 3QOYA 4TWJA 3EDCA 4BV2A 4IJQA 1QJCA 1EWKA 3KOWA 3IKVA 1TC2A 3LGAA 3S7ZA 1CJVC 3UK0A 5ARBA 3EZ9A 2UZ1B 5IS2A 2WWXA 4FQ8A 2EBUA 3DCJA 3N2KB 4FYHA 5EEGA 1J42A 3MERA 2EWWA 4TXLA 1EE1A 2GZAA 4J1SA 4TTJA 2O14A 4B46A 3OO1A 3RB8A 1P9NA 1LBEA 2JLAA 3R3UA 4C0SA 1QRSA 5FYQA 4KH1A 2AN9A 1DRJA 1U6KA 3CVOA 3S2FA 3NPMA 4W8GA 2BKEA 2NXWA 3PZBA 3F49S 4HI0E 4JJ4A 4C0KA 1HORA 1V26A 4MW7A 5T4BA 3CKMA 2WV7A 1LJUA 1AVTA 2AH5A 1NNUA 4F8YA 2BR3A 5G0SA 2CVPA 1GGJA 4ZK2A 5CXUA 4HRAA 5JC8A 2HV9A 1M0TA 3RQIA 3UKJA 3LQ1A 3GG2A 2ZI4A 3JYQA 3M6VA 1ES9A 3VPAA 3JX9A 3M83A 3R5TA 4YJDA 3LKVA 4MUAA 2NUTB 4RPCA 3GELA 4Q01A 3V7FA 4KSCA 1E59A 1I2AA 2X2EA 3IIIA 3PC4A 1M67A 5IRCD 5LPNA 3TZEA 3RHFA 4ENSA 1QRUA 4IQFA 4MV7A 2FDRA 3OZXA 3U4QA 4M9ZA 4KAJA 1WG8A 1XOIA 1DUIA 4A9AA 3ZJ5A 2FK8A 4Y6PA 2WJ3A 3D8NA 2ZETA 3ORSA 5REQB 4EJMA 1SCUB 2EV9A 2X5NA 4PBSA 1P5HA 2FQXA 1I3OA 2ZDQA 4O4IB 5BV8A 4LMPA 5DLQC 1D6NA 1UM8A 1ZCFA 1X80B 5LL6P 1K8YB 5CK5A 4Q1EA 1GQ2A 1Q2UA 3HMQA 4DV3B 3LPNA 4Q3AA 5CIYA 3Q15C 4TL9A 4M0MA 4JN6B 1EB8A 3P7MA 2IYEA 2FN7A 5G1PA 1SO8A 2WFLA 1J90A 1HDGO 1KO4A 2WP8J 4HDRA 2MYPA 4E5KA 1I5RA 3ZWXA 4OEHA 1VHTA 4LISA 2R87A 1C8VB 3FVWA 5HYVA 3OCZA 4HATA 3FMFA 3UO8B 1A5SB 1UBNA 2D1QA 3HU2A 3ABOB 3GMTA 5EIWA 2XKAA 3A2MA 1AGNA 1N34B 1H2ZA 1HDEA 1TF2A 2JCYA 2NADA 2O0KA 3W2IA 3M6LA 1OGJA 1LJLA 1IH8A 1ULHA 3BORA 1TM2A 4HF7A 4DQDA 1VB3A 3W8DA 1ORWA 3OUTA 5DCWA 1PBNA 1J0EA 5FOUA 3PVCA 5CITA 3ZHUA 4IX1A 4KOAA 1EGMB 4KTTE 1FNMA 2V7BA 2XUKA 1M6YA 1GILA 1CUHA 4NLLA 4KFSA 2C0CA 2HA4A 4BQIA 2IV3A 2QD3A 4IIBA 3CJTA 4RTJA 1WDTA 2YQ5A 5SY9A 2NUAA 2ZK7A 2CLCX 4GPIB 2VAMA 1P91A 3ACDA 3L7CA 3GEPA 1SIBE 3K0CC 5F1YA 3W7BA 2DSNA 4NPAA 3IUQA 4L8LA 1C9KA 4KQWA 2WFZA 1QS0A 1Z7EA 3OC6A 4KWIA 3K70C 4RVOA 5FEMA 1JAXA 3H7IA 3IQEA 1GZ3A 1PJZA 4OXKA 3WJ1A 2DFDA 3M81A 1XZLA 2HJHA 2P9TA 1B0AA 4LWQA 4WERA 1OJ7A 4DILA 3L01A 3QMVA 5DZSA 3UK7A 1NNLA 5ERGB 4QULA 3DYIA 4DNPA 5LP6C 4MVJP 1XJ0A 4P53A 1GM5A 1WDMA 4KWEA 1MORA 1WLYA 4CKCB 1NKVA 1T1RA 4L8WB 1ZRSA 4AXBA 2QL6A 3GIWA 4DMMA 3ORYA 3S1SA 1MHTA 1E60A 1ZGJA 3IB6A 4ER5A 1TO1E 1JILA 5J2TB 4HC4A 1EP3B 1HGXA 1U90A 3AESA 4YPVA 4YRPA 4IH9A 3VH3A 1TVEA 3NIDB 1DC7A 3P9XA 3SQMA 2IH4A 1FFXA 2P3SA 1E7YA 2EC5A 5LSAA 1EHIA 4CMJA 3LDGA 1Y1QA 2EFEB 2Q2QA 3R0XA 4ENTA 3R6WA 4KQGA 2NT3A 3RARA 1AQYA 4RLHA 3MJFA 3AJEA 4K3UA 2C54A 4AF7A 1Y3DE 3NHLA 2BV3A 2YBEA 2ZCVA 3L0OA 4DE5A 1RXCA 3KJXA 4E2ZA 2FEAA 1CE8A 2GNOA 3NATA 4CM4B 3GGJA 4MQUA 4P38A 3HE3A 4KLZA 3VU0A 3Q72A 1EFAA 1WA5A 2B1GA 4UAUA 3QBTA 1W581 4TLMB 3RKRA 2PUTA 4AO8A 4FC6A 5EIEA 1L1RA 4DCGA 5ERXA 1KI9A 2CVHA 4ZO4A 2XQGA 3KRTA 1JNYA 3LT4A 4W1SA 2WICA 5JJBA 3FDXA 3F5SA 5AKHA 4MS1A 2ZXUA 2PR7A 1SVSA 1XTSA 3D4NA 5EFZA 4UPVA 5IUJC 3KKPA 4GC9A 3GEEA 1TEZA 1P80A 4B5KA 2CL5A 2XDWA 3LUHA 4M0LA 3TLJA 2L18A 5HUQA 1JR4A 2EX4A 3NBMA 4JROA 4LQ4A 4UQPA 4TTTS 1L3CA 4ZAGA 1GEEA 1J1IA 1TT7A 3LFUA 4RPJA 2GKOA 3UAVA 3ZNNA 1C50A 1L7BA 1IUNA 1OE0A 3RUAA 5JJKA 5K8CA 1T0PA 1XDDA 4YYEA 1L8LA 1YS7A 2O1SA 1B6GA 5JWHA 1T2NA 3HN2A 4LCJA 1KEKA 4KDEA 2CSXA 1DMSA 3R3JA 5KQSA 5T3YA 3E8SA 3FUUA 1YDMA 1C1XB 3DO8A 3G89A 3Q6MA 5HM8A 3T3NA 4GE0A 4DMFA 4KX5A 4L51A 3PFBA 1IZYA 2GBIA 3K72B 1N0WA 4B80A 5E0OA 1P74A 1NBME 1CP2A 2GTHA 2NXEA 1PHPA 2GXUA 3FIJA 3OOSA 1SRRA 2YCBA 4QELA 2XVYA 3SQNA 4C6TB 4F4CA 5LOVB 4QOFA 1EMDA 3ELWA 4EI7A 4PYJA 4KPUA 1OASA 2SKEA 2AYXA 1Y4ZA 1VP3A 2P2DA 2QU7A 2ZSHA 2OZPA 4DR3B 4MDEA 3TYXA 3NYQA 3RWBA 3P2OA 4IUYA 4GPBA 5C7YA 2BMVA 1JH8A 4GS5A 4H31A 4QFCA 4EYEA 3THXA 4CL3A 5JMWA 2B20A 1F5SA 1SBQA 2WVJA 4OHWA 4PU0A 1SOVA 2JDIA 2X4DA 4LMBA 2VAPA 4H16A 3Q5DA 4BNGA 3ZV4A 3CS3A 4DV4B 4MJ3A 1GT6A 3FWKA 4MJXA 3RLFA 4BTVA 4O8ZA 5ALMA 5HE9A 4YUXA 1Q91A 2WIDA 4IMIB 3KSZO 2N46A 3W9BA 3ZI4A 2WNIA 2B4TO 4S24A 2ZRCA 3ICEA 3R8CA 4TVOA 1W73A 5JS2A 3LI2A 3P9PA 4F04A 3PXEA 2AMYA 4S35A 2Y4OA 3O1LA 4JL8A 4F5EA 4DARA 2XLCA 5EKSA 2EU8A 3JAMA 1WBJB 1GU0A 3A9SA 2AG1A 1Q3KA 4IKEA 3JASB 3A4NA 3RV4A 2FDXA 2X5JO 4I4TB 2OQIA 4D0SA 1B41A 2D0DA 3ZHSA 1F60A 2NXJA 3AR6A 3MCTA 2XUAA 3LP8A 3UXHA 4HZIA 3SF0A 1NVKA 4UZFA 1SEVA 4LOHA 5AW2A 4B6FA 4PCLA 5KOHA 1V8OA 3COJA 5G1OA 2VKTA 4FX2A 2RCNA 4N49A 1O6BA 1T8WA 3E8XA 4EX7A 2HO4A 4FW8A 3VISA 3M33A 4LDZA 3QTTA 5LU8A 1KFEB 2Y93A 1KE2A 4KDCA 2O1WA 3C3MA 3FUVA 1XWFA 1KJZA 1X19A 2JJ1D 2PLRA 1GGEA 5TB5A 2FZ4A 4ABTA 2FLKA 3VPCA 2VS1A 1CTQA 2KLBA 2WMDA 1W1UA 3C4JA 1C7QA 4Q93A 4RTSA 5FLEX 4OTZA 1GPBA 3F71A 4DIDA 3BH7A 2E6UX 2RGCA 1A50B 1F06A 3ZD6A 1XQ1A 3HVJA 3M4NA 5DGTA 5B2ZA 5CJJA 3WOVA 2MJLA 1QQBA 2AUTA 2AL7A 4TV8B 3C15C 2PMCA 4CIXA 4HNUA 1CB7A 1XRMA 4WOPA 4U7DA 2Y27A 1LBQA 3D8SA 2K2WA 3DAYA 4BXOA 2G72A 2QD4A 1U2RA 3KBOA 2X1VA 4OMFG 4BKQA 4BP3A 2EBHX 4JNCA 3DEFA 5CT6A 4BZPA 4HGRA 1TMKA 3F6YA 3VR1A 4JLBA 2JZOA 5CT8A 1UZAA 3S70A 3A8TA 2VJYA 4BATA 2CDNA 2BEVB 1Y3HA 1X7WB 3QHQA 4B7AA 3MELA 5ICFA 3R7NA 1BYIA 2HRCA 3REFA 1F8UA 2O07A 3CG4A 3DT8A 4PTZA 5EPOA 4A0QA 4DABA 5IWAB 2JPDA 1XEWX 3NLLA 4GF5A 4N5NA 2CDCA 5F73A 3D8UA 4WCVA 5TSDA 1IOZA 2MSWA 1AA6A 1KIAA 4XCQA 3OIWA 4TL7A 3EDQA 3RVKA 2D1YA 3SDBA 2JVJA 3EXG2 2AXQA 1Q0HA 1YSCA 4G9BA 2A5YB 1I3LA 1Z2EA 3OQVA 3EBPA 4JEMA 4MWCA 3RM3A 4C1NA 3U1TA 5C53B 1E89A 4P36A 3LWZA 4ZQCB 1BE0A 2I2FA 5D87A 1XA3A 2G1KA 4N5DA 3ROZA 3DOOA 3WIOA 4LXUA 3LLMA 1G21A 4RHFA 5SICE 1H5UA 2HIGA 4HZUB 2YYAA 4FONA 2X8JA 5AWFC 2N9UA 3DBIA 1QHGA 1NNSA 1AY0A 5E9QA 1VSUA 2YVAA 3K30A 3OF5A 1T3SA 1J2JA 4MOWA 4RNCA 4JVNA 1RWWA 3DDOA 1MX3A 1M2OB 1KORA 1TIPA 4WLFA 5U4QA 1LQTA 3OIUA 3DBHB 1N3IA 3TOCA 4B4WA 1H8EA 3EE6A 4C89A 1RYYA 2OBLA 4D8XA 2IOYA 2VTBA 3QWFA 3JQ9A 3QI7A 1VOTA 3WLEA 3WLIA 4DB4A 1LDEA 3L7KA 1NN0A 4FM9A 3GVPA 4DRXB 4FPXA 1IN8A 1PL6A 2WA2A 2BF7A 3AEQB 4GX0A 1P9WA 2NNWB 2VF2A 4N5LA 4OHCA 2VUHB 1W8DA 5F33A 5BQXA 5C4IA 5KTKA 4FFVA 3ZBPA 2WF6A 5F52A 4JR2A 4MTCA 1VBMA 3G7UA 3RUEA 2PRIA 3W79A 5CA0F 1QR2A 3G2NA 3LG2A 4G5SA 2G25A 2IBTA 4L57A 5AXDA 4IIHA 4HNSA 5JYBA 5GJBA 2JAQA 2Q4OA 7ADHA 1K4MA 3N86A 4C4AA 4YAFA 4KE7A 2RAVA 3BCRA 3FCCA 3IQGX 1KFJB 2AG5A 4DWJA 3SI7A 2ODQA 1VI5A 3LK6A 4X94A 3PFIA 4PC2A 3I58A 3KLMX 4LOLA 2CE7A 2IU3A 2OFXA 1TPZA 2Q8QA 1U11A 2V6BA 1AQLA 3C5CA 3RUFA 5L3QB 3DEHA 1VYVA 4JUIA 2POQX 3HTXA 1AGYA 1CYDA 2XT0A 3C2QA 1Z38A 3IAFA 3OZCA 1FB5A 4J0FA 4KIFA 1NP7A 4YP5A 4EY3A 1YZUA 4BE7B 3NP9A 1AV7A 1BZYA 1T6ZA 4LHXA 2C1XA 2YZNA 4TRNA 4YLGA 1ISPA 2P11A 2OGUA 3BWEA 1ZMRA 1VJ1A 4RWZA 1DDIA 1P2BA 1YK0A 2VDUE 2XB8A 3URMA 3LUGA 3GGCA 4R5HA 5TT1A 4ZIRB 2GF2A 1B16A 3G23A 3DHVA 2EG5A 3NBUA 5LXTF 4CM8A 3PICA 2ZIUB 3ONDA 2P6OA 5JAIA 3N59A 2Q1YA 1QYXA 4MB0A 3BRWA 2Y2UA 3D6TB 3HP7A 4O3FA 4RFSB 4UJ3A 4L9SA 1KRHA 2X40A 4J7XA 1KERA 2I9PA 2D3TA 3K35A 3MTJA 3OZEA 4DUGA 1XVVA 4I3HA 4B0PA 1BD3A 4K1XA 1R74A 2GD6A 3QITA 2DQZA 4OHBA 1YQUA 3IL2A 4Z2AA 5BYJA 2IZ5A 4COOA 1O4VA 4J16A 1G60A 3M1IA 2CLLB 2OYCA 5K0ZA 4LF5B 3CUSA 4Y9DA 1BFUA 2V1UA 4ZDIA 1M75A 2B83A 3ASVA 2BFAA 4WXPA 4UZEA 1RD4A 1NLMA 3NETA 4QHYA 4A8JB 4UUAA 2Z1NA 2GPJA 3G2KA 5BV0A 5EMKA 1TL7C 4LJ8A 4AY2A 4HP8A 5LMCA 1L7PA 4IDAA 1ZICA 4EITA 2QK4A 4DDUA 5BN1A 4ROSA 4TZ6A 5IMSA 3QPUA 4IUDS 1XPOA 3UWDA 4GMGA 1P0IA 1T4DA 2W8ZA 4QNNA 4BZXA 1IAVA 1Y7IA 3SPXA 1AE1A 3MMZA 2ZB8A 2JJYA 3P4YA 4BMDA 3F3MA 2A94A 1JZSA 1MT0A 1X1CA 2BKAA 2J09A 2QIOA 4XUEA 2NAFA 5E95A 4BVBA 5H9WA 4UD2A 4ZVKA 4WXEA 5G4KA 2Q5CA 3QFCA 4BJ1A 4L8FA 2CNLA 1W5EA 4ZZ2A 1KI2A 1LVUA 4R0NA 1IWBB 1RJFA 1F2DA 2HSJA 2P7HA 4DLBA 4OYHA 5H9VA 2F9FA 4LDNA 1FLAA 3JRWA 3ADKA 5L45A 4KH0A 2P79A 1KAMA 2DFPA 4AX8A 2WQ7A 4AY4A 4WK2B 1PR2A 1O96B 1WXFA 4DDVA 3ONFA 4INJA 3AETA 3IRUA 1R37A 2EW8A 4AZTA 2YDXA 5A5DA 4J0DA 1VMKA 1PF7E 4KE8A 1GPNA 4R7ZA 3LT5A 4MQ4A 1U7HA 4M1SA 3CUUA 2JFYA 1WMEA 1TYDE 3E2PA 5EGNA 2LXNA 2BRUC 1KDVA 2Q27A 4GX2A 2N47A 2JLVA 1E1MA 1CEQA 4JVSB 3MSCA 4B9AA 3B1YA 3ZBTA 1IMOA 4HBZA 3OM1A 1KAHA 2HUNA 1FVFA 4JGGA 1J8DA 1G20A 1NVVQ 1R2QA 1RPNA 2GCNA 4L16A 3WXMA 4PS0A 3ZG6A 3UAXA 3ZD7A 1QHSA 3P0HA 4TROA 5AKKA 1CZHA 4NF2A 5EJGA 5F2KA 5A02A 1CSEE 2IPXA 3E05A 1TLFA 3L02A 2IRWA 5CGZA 3TINA 1ZU5A 3PFWO 4XKJA 4C7OA 2LV8A 4FMCB 3VDMA 1VLQA 3PSHA 4WZAA 3EPRA 1BIFA 3AEXA 4HNQA 2OBXA 2G04A 4AO6A 1CIJA 3N07A 4NG4A 2XECA 1GP2A 2VHCA 2ZVPX 1BA2A 3FHJA 3R4VA 4WJKB 2DWCA 2WJ4A 4M0DA 4DMGA 1O03A 2OXFA 4F2DA 3IBGA 1NVGA 2YWJA 3EPPA 3NWEA 1PZXA 5IU6A 1BDIA 3A1SA 4MRMA 1NQUA 1L4GA 2VJQA 2GM9A 5JU6A 2B4QA 4LXIA 2BUAA 1FVXA 1OMOA 1PYGA 1QKKA 1A4IA 3H1EA 1FMJA 1UPTA 4MITA 2XT9A 4RO0A 2GN8A 4MQEB 1X1AA 3PT5A 4KXMA 4MUGA 2JCXA 1KDZA 2JAWA 2Y99A 1YZHA 4MHOA 5E6UB 4PTYA 4UEOA 5BSMA 5C8YF 1A04A 2Q3FA 4KAFA 2FPPA 2YWEA 1PLKA 3R0VA 4MVJA 4K2AA 1OI2A 3ITDA 2W2LD 1XQWA 4Q3DA 3ESCA 3DDWA 1QGED 2IITA 2XGMA 4QBHA 2DPLA 4NBLA 3BQMB 4EO7A 1J8QA 1O9BA 2I71A 5DVZA 4FEGA 3ZCXA 4ZFNA 4WK6A 4PO1A 2C2HA 2Q5QA 4N1AA 3WK7A 4UFOA 2AEMA 3WBKA 5M04A 2YNMC 2W8BA 3BRCA 3CCCA 5ALRA 3W5AA 4FFSA 1PTJA 3ND6A 1QO0D 2X77A 2KSQA 4LSMA 5AJUA 5IAJA 3D64A 4CM9D 3FKSD 2X8WA 3NO4A 3VYTB 4BNFA 3M9XA 4UUMA 1FDWA 3HCDA 4BQNA 4RADA 1TMGE 4C4RA 1LJ8A 2Y0PA 1XELA 1VLZA 2I66A 4MMYB 1QVWA 3VXKA 4KGZA 4UHKA 1X8KA 5JZMA 2W5UA 3DL2A 3PWZA 5T4FA 1ZUWA 3BX1A 3TXXA 5JALA 2ALJA 1WPGA 2H5JA 3UENA 2H1LA 3R24A 3GEGA 2Y9PB 3H17A 3SJBA 4FC7A 1HNXB 3IVRA 2XRZA 4QTYA 5C8VA 1O6CA 2D1FA 4RCZA 2EATA 2OG2A 3GF4A 4B6GA 1EB9A 2BY4A 2FVXA 2WA1A 4G6ZA 4ROTA 4TUYA 3S3TA 4CIDA 5JXIA 3THWB 2J9YB 4I8DA 3MWJA 4WK0B 5K3EA 1KTIA 1F8FA 1DJPA 3WK4A 4ERNA 1DC6A 1Q1NA 1ONBA 2NTYC 3CU5A 3CF2A 4EPTA 1ZUNB 2HU7A 3UMVA 1BX0A 4ETIA 3IAAA 2VDOB 3PGA1 2M98A 1EK1A 3PUJA 3F4KA 2N1BA 2QSZA 2R6GA 1T34A 5HCNA 5CXXA 1DEXA 2O0HA 2Z9BA 1ECGA 4QOIA 4DS3A 3U7GA 2YXBA 4WLVA 3RRZA 1KI4A 1YACA 1REQA 4LY3A 3HFJA 2F9MA 2I29A 2IHBA 2V4ZA 3CB4A 4Q7LA 5DU2A 2XW6A 2B99A 5HJEA 2PUDA 4H7DA 4U5QA 1WCYA 3EW7A 1WF6A 1TVKA 3NQ41 1XTTA 1ZXLA 4TX1A 1THMA 4R8LA 2IH2A 1YMVA 2OESA 4H6WA 1UF9A 3LDFA 3QK7A 1XD8A 2ONYA 5F4ZA 5CFMA 2CFRA 5K7SA 4FWBA 3FOEC 2P5YA 1V6CA 3TD6A 2B1QA 5IWCA 4ZAXA 4CLHA 4P4SA 3L8EA 2VK1A 1Q83A 1QH1B 1T13A 2WKWA 1HURA 4WBSA 3S44A 2ZVQX 1XJCA 1C81A 3V3TA 3DFFA 1IUPA 1RPTA 2QTLA 2ZUCA 3M8KA 4FOTA 4J94A 2BPOA 3T7KA 1RI3A 2ZS8A 3UPUA 1KEVA 1ZOPA 5BUQA 2H5IA 4Z86A 2OLKA 2ZIXA 3GJ7A 3QKWA 3QEKA 4IY1A 1TO2E 1ZP6A 2PJDA 4R41A 5GGXA 3UV3A 2G08A 2PIDA 3FPFA 2AJDA 4E5NA 2JIRA 1P3Y1 2Z6QA 3ZOZA 1WSWA 3UMBA 1K92A 3KQUA 2XIJA 2H18A 4C0AC 2CLKB 3KR2A 2OBBA 4BNZA 4K6OA 1HDYA 2UVPA 1NNEA 1ZK3A 2BGUA 1Z5UA 4AAYA 2YUTA 4KJZA 2V3CC 5JXHA 2DP4E 3OZDA 1DWUA 2D5CA 2EBFX 4MS3B 4DCSA 3FLEA 5MN4A 4ZI3A 1IHDA 3SFVA 3LW8A 1E6MA 5F2EA 2AI3A 3HJHA 5AM1A 3MT7A 2HRDA 2PDAA 2PH5A 4P3NA 3PNKA 1E5DA 5IZCC 4YWJA 5LYJA 4EGAA 2ZSJA 5EXSA 3V8PA 5K0LA 4OA8A 4LUCA 2PO7A 4NJEA 5AOCA 3STXA 3M9LA 4Y0VA 3R6DA 3DBRB 3MINB 5J2UF 3D0RA 3OBBA 2V58A 3AR8A 1C9NA 4LKOA 3CLRD 4GQBA 4E0BA 2Q2OA 3E48A 4H7PA 3EIUA 4L3OA 3ZLTA 1LLCA 3H5VA 4I7EA 2GBCA 4DLUA 2H0RA 5J4YA 2AX3A 5HRAA 2O3TA 2XZTA 1TAGA 1L4MA 3BMXA 3KKZA 4M9XA 4O4JF 2EZTA 4WVFA 3IRVA 1Q7TA 3D6VA 3DTNA 621PA 3ED5A 5KYKA 3QPDA 2I65A 2XB2A 2BEJA 2EP5A 4LTMA 4BEWA 3KWLA 4YRLA 1KEEA 2XDQA 3F47A 5T6BA 3HUEA 2WWVD 4O59O 2H5EA 4GUAA 5B3AA 4FCVA 4NRDA 3ZUPA 1R8SA 1UJ6A 1C3EA 2WAXA 5T8KA 4Y1EA 5HMMA 2YWHA 4YRSA 3DFZA 1G63A 3IIJA 4N7BA 3IALA 2E7ZA 1KDYA 3VX3A 1P0CA 4UM5A 4HH0A 3NAGA 2OTCA 3PIIA 5F64A 2QPTA 3TSWA 4CEIB 1A4RA 2W70A 1JFTA 3GB9A 2H48A 2FHSA 3SYNA 4B6SA 2DQ4A 5IXSA 3KDPA 1JJAA 1FLNA 4J0CA 4PRZA 1D4OA 3W05A 1KJQA 3LRPA 3GGDA 4GOLD 1JHXA 1YV9A 1JVSA 4UBMA 5AJWA 1A88A 2WTAA 5I5GA 3TZKA 5B7QA 2C31A 4ND8A 1QF9A 1GN9A 1NT2A 4LDJA 4M2LA 1Z13A 5FTLA 3O3OB 3KLPX 2R2AA 3FIUA 5EA2A 5JD5A 1JAIA 1FLVA 1G9TA 3DVAA 1DAMA 2GD0A 1SIOA 3QHAA 4IG9A 4PZCA 5G41A 3RI3A 1RVDA 1GZVA 5BYBA 4RVCA 1GSOA 2JH9A 2Q9UA 3HEMA 2PS3A 3B5EA 4N7RA 1I1OA 5IYZB 2R65A 1YO6A 2QW8A 1CS4C 1UK8A 2P35A 5HIAA 4KR2A 4GM4A 1T26A 3QLEA 3P0JA 4YAUA 3NORA 5LJIA