5JEAD

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
224
structure length
224
Chain Sequence
SMSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 68
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaD00
2PO0A 1UDOA 5C0XC 5JEAF 3CDIA 4OO1A 5C0XE 5K36D 1OYSA 2BA1D 5C0XB 2NN6F 2WP8B 2PO1A 2C39B 1OYPA 2BA0D 3GLLA 5K36A 2NN6C 3L7ZB 4NBQA 5C0XD 4BA1B 2NN6E 3M7ND 4IFDD 2C38A 2JE6B 5C0XA 4BA2A 2PNZB 5JEAC 2WP8A 2PO2B 4IFDA 5JEAE 3U1KA 1E3HA 3CDJA 4OO1F 4AIMA 2WNRB 5JEAB 1UDSA 4IFDF 3M85G 4OO1C 3GCMA 4OO1E 2BR2B 2PO0B 2JE6A 1UDQA 5JEAD 5K36F 2NN6B 3KRNA 1OYRA 3B4TA 2C39A 2JEBB 2JEAB 2NN6D 2C37B 2WNRA 3DD6A 3L7ZA 2PO1B 4BA1A 1UDNA 5C0XF 3GMEA 4AIDA 3HKMA 2NN6A 3M85D 1R6MA 3H1CA 2BA1G 4IFDC 2PNZA 4IFDE 2C38B 2JEBA 2PO2A 4OO1B 2JEAA 2C37A 1R6LA 4BA2B 2BA0G 5K36C 5K36E 4IFDB 5JEAA 4AM3A 3M7NG 4OO1D 1E3PA 5K36B 2BR2A
chains in the Genus database with same CATH superfamily
1RR9A 4DV1I 4YHHE 4JYAI 2CZ9A 4U3DA 4LFAE 5LMNI 5C0XE 4NXNI 1EA6A 4DUZI 2X36A 1RREA 1WUUA 2HHHE 4B3TI 4FW5A 4U3BA 4FW4A 2NN6F 1Z0BA 1XMQE 2C39B 1B62A 4X66I 2X7IA 2BA0D 4DR3I 2GO4A 5C0XD 4BA1B 2R3VA 1J5EI 2CVEA 3B8HA 4DV5E 3J7AG 1XNQE 3PS1A 4DXLA 5LMUE 2ZM6I 2C38A 2JE6B 1IBME 5L3JA 4LF6E 4LF4I 4ZVIA 1P42A 1MX0A 2PO2B 1VI7A 3CDJA 1Z0GA 1H72C 2V34A 3Q6NA 4NXMI 1PIEA 2Z5CB 4LPFA 4LF8E 1XNRI 4IZKB 4X64I 4IFDF 4QNJA 4LFBE 4DR7E 3GCMA 4OO1E 2PO0B 2Z5EA 4X65I 2O3ZA 4JI3E 5DRQA 2WW4A 3KRNA 1OYRA 1N36I 1Z0VA 4FW3A 1YH8A 4OZEA 3P3CA 4DV2E 2A2DA 2C39A 4AQYI 2NN6D 1N34E 4YY3E 2E5LI 4DV7E 1IBKE 5IWAE 4BA1A 4DR6E 2O1WA 1UDNA 1HR0I 2CGEA 1ZXMA 1HNZE 1Z0TA 4GKJI 4B3RI 1FI4A 3K85A 3V2UC 4IFDE 1H73A 4JV5I 2JEBA 2PO2A 4B3ME 2JEAA 5GMDA 5IT9Q 4BA2B 3ZKBA 3J81C 2BA0G 4DV0I 5K36C 4FW9A 4DPWA 5FWKA 2GS8A 4DR2E 4AM3A 1S4EA 3ZKDA 3UHMA 3HULA 2PO0A 4DUYI 4DPTA 3T1HI 4DR5E 4OX9I 4J3DA 3Q6MA 4JI5E 4OKGA 1FJGE 1N0UA 3K17A 4JI6E 4KHPI 4DR4E 1ZM9A 3WU4A 4DV3I 4DPYA 2Z5BA 2UXBI 1D6TA 3LNUA 4XTJA 1N33I 5BR8E 4DV4I 4DU8A 5LL6R 3GONA 3L7ZB 2UUCI 2E1RA 2O1VA 2VQFI 4P52A 3J7AM 1I94E 1Z0WA 1KKHA 5C0XA 3QT8A 4BA2A 1NZ0A 1FKAE 1HNWI 2PNZB 4GKKE 4JI7I 2LJPA 4KQVA 4DU7A 1BKNA 5EKWA 5FLXC 3K1JA 4OO1F 4AIMA 4IZJB 2A2CA 4Z7CA 4LCHA 5JEAB 1FWKA 1UDSA 4LFCI 4LF9E 1IBLI 1HNXE 4FWGA 2BR2B 2O1TA 4JI0E 4HY1A 1XXEA 3JAMC 3D4JA 4JI2I 5K36F 2DEIA 2J65A 4YHHI 1EI1A 1ZM3A 4LFAI 3Q1QA 5EL9A 2JEBB 3PS2A 2JEAB 3T1YE 3OTOE 4MU1A 2UXCE 3DD6A 3L7ZA 2HHHI 1USVA 2V2ZA 2UU9E 2VQEE 1U2RA 4PRVA 4AIDA 1XMQI 3HKMA 5DNLA 4JI4E 3J80C 2NN6A 3P3EA 4MU3A 2IOPA 4LF7E 1PKPA 2AE8A 4PRXA 4RPFA 4HACB 2CG9A 2PNZA 1PVGA 5IT9C 1USUA 1N32E 4DV5I 1XNQI 2UUAE 4K0KE 1NHJA 2C37A 1XHKA 5LMUI 1KVKA 1MG7A 1XMOE 4DV6E 2Z5BB 4IZJA 5K36E 1IBMI 4HXZA 4LF6I 5JEAA 2V2VA 4OO1D 1E3PA 3PYEA 2BR2A 2GQ0A 1UDOA 4X62E 2R42A 4LF8I 4LFBI 1ZM4A 4DR7I 5K36D 2GO3A 2BA1D 2NPFA 5C0XB 4JI3I 2DEJA 1OJ4A 4DR1E 4MU0A 1Y6ZA 3ZZTA 1Z0CA 1HK7A 3PYFA 3F0NA 2F4VE 3CWVA 2NN6C 2UUBE 3M6AA 4NBQA 4MQYA 4LF5E 1S16A 4JI1E 1N34I 4YY3I 4DV7I 4JG4A 4B3SE 3M7ND 1IBKI 1ZXNA 4FW7A 4USMA 4IFDD 4DR6I 4HACA 4JI8E 4USKA 5DROA 4ISAA 2UXDE 1Y5YA 1HNZI 4WUDA 1FWLA 1QZRA 5JEAC 2WP8A 2BV3A 3U1KA 4DV1E 4B3MI 4JYAE 4FWDA 4EMDA 5LMNE 2HKEA 5DNXA 4DUZE 4NXNE 4DR2I 2PNMA 2EFGA 1B63A 1Z59A 4JI7E 4B3TE 2NN6B 2HFSA 1K47A 3WU6A 1YHCA 3B82A 3B4TA 5DRPA 2F1DA 4DR5I 4Z7YA 4X66E 4JI5I 4DR3E 1FJGI 4JI6I 3J81Q 4FW6A 3PS3A 2WNRA 2C37B 4DR4I 1J5EE 2V2QA 2PO1B 4JI2E 5BR8I 3GMEA 5ELWA 2ZM6E 2J7KA 3WU3A 1Z5CA 3ZZ0A 5A2QQ 4LF4E 3M85D 1R6MA 2BA1G 3V5RA 2HKJA 1NHHA 2ZITA 4URLA 2BM1A 4NXME 1I94I 1RHYA 2JT2A 1KTVA 1XNRE 4X64E 4IFDB 4LCGA 4GKKI 3PYGA 3M7NG 4X65E 4MYTA 4P7AA 1N0VC 3P3GA 1VISA 1Z5BA 1N36E 4MDTA 5C0XC 3HJCA 5JEAF 3CDIA 4PU9A 4LF9I 4OO1A 4AQYE 1HNXI 1OYSA 1ELOA 4JI0I 2E5LE 5GMEA 4WUCA 4MYUA 2HK3A 4N3OA 3QT7A 1HR0E 1Y4SA 2O1UA 2WP8B 2PO1A 1OYPA 5FLXQ 3GLLA 5K36A 3ZZUA 3PRYA 4GKJE 4B3RE 2NN6E 3T1YI 3OTOI 3WU5A 2UXCI 2UU9I 4JV5E 2VQEI 4GQUA 2BM0A 3JAMQ 4DV0E 2OI2A 4JI4I 1NHIA 4LF7I 4FWHA 4LOMA 4IFDA 5JEAE 2XEXA 1MU5A 1E3HA 1N32I 3PYDA 4DUYE 3T1HE 2Q2EB 2UUAI 4K0KI 2WNRB 5DRRA 3U1YA 4I3HA 4DV2I 4OX9E 1ZM2A 4UTGA 1XMOI 4DV6I 1KIJA 3QT6A 3M85G 1H7UA 4KHPE 4OO1C 3B78A 3J80Q 5IWAI 1Y60A 2JE6A 4IZJD 4DV3E 1H7SA 1UDQA 4FN5A 2UXBE 3LPSA 5JEAD 1DARA 1Y4UA 1N33E 4DV4E 4X62I 4R1FA 4QNKA 1Z5AA 2VF3A 2UUCE 2Z5CA 4ED4A 2VQFE 4IZKA 4HYMA 4MU4A 1Z0EA 2AJ4A 5C0XF 2PNLA 4DR1I 4DPUA 3P06A 5A2QC 2IOQA 2F4VI 1H74A 2IESA 2ZBKB 2UUBI 1HNWE 3NZKA 4LCFA 4LF5I 3H1CA 3H4LA 3QT5A 4JI1I 4IFDC 1A6FA 4B3SI 3LTOA 3P76A 2VESA 2C38B 4OO1B 1R6LA 4JI8I 2IERA 1FNMA 2UXDI 4LFCE 2HK2A 4IS9A 1IBLE 4UT4A 4WUBA 3ZM7A 2V8PA 1UEKA 2HFUA 5K36B 4M1KA 4DPXA
chains in the Genus database with same CATH topology
2PO0A 1UDOA 5C0XC 5JEAF 3CDIA 4OO1A 5C0XE 5K36D 1OYSA 2BA1D 5C0XB 2NN6F 2WP8B 2PO1A 2C39B 1OYPA 2BA0D 3GLLA 5K36A 2NN6C 3L7ZB 4NBQA 5C0XD 4BA1B 2NN6E 3M7ND 4IFDD 2C38A 2JE6B 5C0XA 4BA2A 2PNZB 5JEAC 2WP8A 2PO2B 4IFDA 5JEAE 3U1KA 1E3HA 3CDJA 4OO1F 4AIMA 2WNRB 5JEAB 1UDSA 4IFDF 3M85G 4OO1C 3GCMA 4OO1E 2BR2B 2PO0B 2JE6A 1UDQA 5JEAD 5K36F 2NN6B 3KRNA 1OYRA 3B4TA 2C39A 2JEBB 2JEAB 2NN6D 2C37B 2WNRA 3DD6A 3L7ZA 2PO1B 4BA1A 1UDNA 5C0XF 3GMEA 4AIDA 3HKMA 2NN6A 3M85D 1R6MA 3H1CA 2BA1G 4IFDC 2PNZA 4IFDE 2C38B 2JEBA 2PO2A 4OO1B 2JEAA 2C37A 1R6LA 4BA2B 2BA0G 5K36C 5K36E 4IFDB 5JEAA 4AM3A 3M7NG 4OO1D 1E3PA 5K36B 2BR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PO0 A;  1UDO A;  5C0X C;  5JEA F;  3CDI A;  4OO1 A;  5C0X E;  5K36 D;  1OYS A;  2BA1 D;  5C0X B;  2NN6 F;  2WP8 B;  2PO1 A;  2C39 B;  1OYP A;  2BA0 D;  3GLL A;  5K36 A;  2NN6 C;  3L7Z B;  4NBQ A;  5C0X D;  4BA1 B;  2NN6 E;  3M7N D;  4IFD D;  2C38 A;  2JE6 B;  5C0X A;  4BA2 A;  2PNZ B;  5JEA C;  2WP8 A;  2PO2 B;  4IFD A;  5JEA E;  3U1K A;  1E3H A;  3CDJ A;  4OO1 F;  4AIM A;  2WNR B;  5JEA B;  1UDS A;  4IFD F;  3M85 G;  4OO1 C;  3GCM A;  4OO1 E;  2BR2 B;  2PO0 B;  2JE6 A;  1UDQ A;  5JEA D;  5K36 F;  2NN6 B;  3KRN A;  1OYR A;  3B4T A;  2C39 A;  2JEB B;  2JEA B;  2NN6 D;  2C37 B;  2WNR A;  3DD6 A;  3L7Z A;  2PO1 B;  4BA1 A;  1UDN A;  5C0X F;  3GME A;  4AID A;  3HKM A;  2NN6 A;  3M85 D;  1R6M A;  3H1C A;  2BA1 G;  4IFD C;  2PNZ A;  4IFD E;  2C38 B;  2JEB A;  2PO2 A;  4OO1 B;  2JEA A;  2C37 A;  1R6L A;  4BA2 B;  2BA0 G;  5K36 C;  5K36 E;  4IFD B;  5JEA A;  4AM3 A;  3M7N G;  4OO1 D;  1E3P A;  5K36 B;  2BR2 A; 
#chains in the Genus database with same CATH topology
 1RR9 A;  4DV1 I;  4YHH E;  4JYA I;  2CZ9 A;  4U3D A;  4LFA E;  5LMN I;  5C0X E;  4NXN I;  1EA6 A;  4DUZ I;  2X36 A;  1RRE A;  1WUU A;  2HHH E;  4B3T I;  4FW5 A;  4U3B A;  4FW4 A;  2NN6 F;  1Z0B A;  1XMQ E;  2C39 B;  1B62 A;  4X66 I;  2X7I A;  2BA0 D;  4DR3 I;  2GO4 A;  5C0X D;  4BA1 B;  2R3V A;  1J5E I;  2CVE A;  3B8H A;  4DV5 E;  3J7A G;  1XNQ E;  3PS1 A;  4DXL A;  5LMU E;  2ZM6 I;  2C38 A;  2JE6 B;  1IBM E;  5L3J A;  4LF6 E;  4LF4 I;  4ZVI A;  1P42 A;  1MX0 A;  2PO2 B;  1VI7 A;  3CDJ A;  1Z0G A;  1H72 C;  2V34 A;  3Q6N A;  4NXM I;  1PIE A;  2Z5C B;  4LPF A;  4LF8 E;  1XNR I;  4IZK B;  4X64 I;  4IFD F;  4QNJ A;  4LFB E;  4DR7 E;  3GCM A;  4OO1 E;  2PO0 B;  2Z5E A;  4X65 I;  2O3Z A;  4JI3 E;  5DRQ A;  2WW4 A;  3KRN A;  1OYR A;  1N36 I;  1Z0V A;  4FW3 A;  1YH8 A;  4OZE A;  3P3C A;  4DV2 E;  2A2D A;  2C39 A;  4AQY I;  2NN6 D;  1N34 E;  4YY3 E;  2E5L I;  4DV7 E;  1IBK E;  5IWA E;  4BA1 A;  4DR6 E;  2O1W A;  1UDN A;  1HR0 I;  2CGE A;  1ZXM A;  1HNZ E;  1Z0T A;  4GKJ I;  4B3R I;  1FI4 A;  3K85 A;  3V2U C;  4IFD E;  1H73 A;  4JV5 I;  2JEB A;  2PO2 A;  4B3M E;  2JEA A;  5GMD A;  5IT9 Q;  4BA2 B;  3ZKB A;  3J81 C;  2BA0 G;  4DV0 I;  5K36 C;  4FW9 A;  4DPW A;  5FWK A;  2GS8 A;  4DR2 E;  4AM3 A;  1S4E A;  3ZKD A;  3UHM A;  3HUL A;  2PO0 A;  4DUY I;  4DPT A;  3T1H I;  4DR5 E;  4OX9 I;  4J3D A;  3Q6M A;  4JI5 E;  4OKG A;  1FJG E;  1N0U A;  3K17 A;  4JI6 E;  4KHP I;  4DR4 E;  1ZM9 A;  3WU4 A;  4DV3 I;  4DPY A;  2Z5B A;  2UXB I;  1D6T A;  3LNU A;  4XTJ A;  1N33 I;  5BR8 E;  4DV4 I;  4DU8 A;  5LL6 R;  3GON A;  3L7Z B;  2UUC I;  2E1R A;  2O1V A;  2VQF I;  4P52 A;  3J7A M;  1I94 E;  1Z0W A;  1KKH A;  5C0X A;  3QT8 A;  4BA2 A;  1NZ0 A;  1FKA E;  1HNW I;  2PNZ B;  4GKK E;  4JI7 I;  2LJP A;  4KQV A;  4DU7 A;  1BKN A;  5EKW A;  5FLX C;  3K1J A;  4OO1 F;  4AIM A;  4IZJ B;  2A2C A;  4Z7C A;  4LCH A;  5JEA B;  1FWK A;  1UDS A;  4LFC I;  4LF9 E;  1IBL I;  1HNX E;  4FWG A;  2BR2 B;  2O1T A;  4JI0 E;  4HY1 A;  1XXE A;  3JAM C;  3D4J A;  4JI2 I;  5K36 F;  2DEI A;  2J65 A;  4YHH I;  1EI1 A;  1ZM3 A;  4LFA I;  3Q1Q A;  5EL9 A;  2JEB B;  3PS2 A;  2JEA B;  3T1Y E;  3OTO E;  4MU1 A;  2UXC E;  3DD6 A;  3L7Z A;  2HHH I;  1USV A;  2V2Z A;  2UU9 E;  2VQE E;  1U2R A;  4PRV A;  4AID A;  1XMQ I;  3HKM A;  5DNL A;  4JI4 E;  3J80 C;  2NN6 A;  3P3E A;  4MU3 A;  2IOP A;  4LF7 E;  1PKP A;  2AE8 A;  4PRX A;  4RPF A;  4HAC B;  2CG9 A;  2PNZ A;  1PVG A;  5IT9 C;  1USU A;  1N32 E;  4DV5 I;  1XNQ I;  2UUA E;  4K0K E;  1NHJ A;  2C37 A;  1XHK A;  5LMU I;  1KVK A;  1MG7 A;  1XMO E;  4DV6 E;  2Z5B B;  4IZJ A;  5K36 E;  1IBM I;  4HXZ A;  4LF6 I;  5JEA A;  2V2V A;  4OO1 D;  1E3P A;  3PYE A;  2BR2 A;  2GQ0 A;  1UDO A;  4X62 E;  2R42 A;  4LF8 I;  4LFB I;  1ZM4 A;  4DR7 I;  5K36 D;  2GO3 A;  2BA1 D;  2NPF A;  5C0X B;  4JI3 I;  2DEJ A;  1OJ4 A;  4DR1 E;  4MU0 A;  1Y6Z A;  3ZZT A;  1Z0C A;  1HK7 A;  3PYF A;  3F0N A;  2F4V E;  3CWV A;  2NN6 C;  2UUB E;  3M6A A;  4NBQ A;  4MQY A;  4LF5 E;  1S16 A;  4JI1 E;  1N34 I;  4YY3 I;  4DV7 I;  4JG4 A;  4B3S E;  3M7N D;  1IBK I;  1ZXN A;  4FW7 A;  4USM A;  4IFD D;  4DR6 I;  4HAC A;  4JI8 E;  4USK A;  5DRO A;  4ISA A;  2UXD E;  1Y5Y A;  1HNZ I;  4WUD A;  1FWL A;  1QZR A;  5JEA C;  2WP8 A;  2BV3 A;  3U1K A;  4DV1 E;  4B3M I;  4JYA E;  4FWD A;  4EMD A;  5LMN E;  2HKE A;  5DNX A;  4DUZ E;  4NXN E;  4DR2 I;  2PNM A;  2EFG A;  1B63 A;  1Z59 A;  4JI7 E;  4B3T E;  2NN6 B;  2HFS A;  1K47 A;  3WU6 A;  1YHC A;  3B82 A;  3B4T A;  5DRP A;  2F1D A;  4DR5 I;  4Z7Y A;  4X66 E;  4JI5 I;  4DR3 E;  1FJG I;  4JI6 I;  3J81 Q;  4FW6 A;  3PS3 A;  2WNR A;  2C37 B;  4DR4 I;  1J5E E;  2V2Q A;  2PO1 B;  4JI2 E;  5BR8 I;  3GME A;  5ELW A;  2ZM6 E;  2J7K A;  3WU3 A;  1Z5C A;  3ZZ0 A;  5A2Q Q;  4LF4 E;  3M85 D;  1R6M A;  2BA1 G;  3V5R A;  2HKJ A;  1NHH A;  2ZIT A;  4URL A;  2BM1 A;  4NXM E;  1I94 I;  1RHY A;  2JT2 A;  1KTV A;  1XNR E;  4X64 E;  4IFD B;  4LCG A;  4GKK I;  3PYG A;  3M7N G;  4X65 E;  4MYT A;  4P7A A;  1N0V C;  3P3G A;  1VIS A;  1Z5B A;  1N36 E;  4MDT A;  5C0X C;  3HJC A;  5JEA F;  3CDI A;  4PU9 A;  4LF9 I;  4OO1 A;  4AQY E;  1HNX I;  1OYS A;  1ELO A;  4JI0 I;  2E5L E;  5GME A;  4WUC A;  4MYU A;  2HK3 A;  4N3O A;  3QT7 A;  1HR0 E;  1Y4S A;  2O1U A;  2WP8 B;  2PO1 A;  1OYP A;  5FLX Q;  3GLL A;  5K36 A;  3ZZU A;  3PRY A;  4GKJ E;  4B3R E;  2NN6 E;  3T1Y I;  3OTO I;  3WU5 A;  2UXC I;  2UU9 I;  4JV5 E;  2VQE I;  4GQU A;  2BM0 A;  3JAM Q;  4DV0 E;  2OI2 A;  4JI4 I;  1NHI A;  4LF7 I;  4FWH A;  4LOM A;  4IFD A;  5JEA E;  2XEX A;  1MU5 A;  1E3H A;  1N32 I;  3PYD A;  4DUY E;  3T1H E;  2Q2E B;  2UUA I;  4K0K I;  2WNR B;  5DRR A;  3U1Y A;  4I3H A;  4DV2 I;  4OX9 E;  1ZM2 A;  4UTG A;  1XMO I;  4DV6 I;  1KIJ A;  3QT6 A;  3M85 G;  1H7U A;  4KHP E;  4OO1 C;  3B78 A;  3J80 Q;  5IWA I;  1Y60 A;  2JE6 A;  4IZJ D;  4DV3 E;  1H7S A;  1UDQ A;  4FN5 A;  2UXB E;  3LPS A;  5JEA D;  1DAR A;  1Y4U A;  1N33 E;  4DV4 E;  4X62 I;  4R1F A;  4QNK A;  1Z5A A;  2VF3 A;  2UUC E;  2Z5C A;  4ED4 A;  2VQF E;  4IZK A;  4HYM A;  4MU4 A;  1Z0E A;  2AJ4 A;  5C0X F;  2PNL A;  4DR1 I;  4DPU A;  3P06 A;  5A2Q C;  2IOQ A;  2F4V I;  1H74 A;  2IES A;  2ZBK B;  2UUB I;  1HNW E;  3NZK A;  4LCF A;  4LF5 I;  3H1C A;  3H4L A;  3QT5 A;  4JI1 I;  4IFD C;  1A6F A;  4B3S I;  3LTO A;  3P76 A;  2VES A;  2C38 B;  4OO1 B;  1R6L A;  4JI8 I;  2IER A;  1FNM A;  2UXD I;  4LFC E;  2HK2 A;  4IS9 A;  1IBL E;  4UT4 A;  4WUB A;  3ZM7 A;  2V8P A;  1UEK A;  2HFU A;  5K36 B;  4M1K A;  4DPX A; 
#chains in the Genus database with same CATH homology
 2PO0 A;  1UDO A;  5C0X C;  5JEA F;  3CDI A;  4OO1 A;  5C0X E;  5K36 D;  1OYS A;  2BA1 D;  5C0X B;  2NN6 F;  2WP8 B;  2PO1 A;  2C39 B;  1OYP A;  2BA0 D;  3GLL A;  5K36 A;  2NN6 C;  3L7Z B;  4NBQ A;  5C0X D;  4BA1 B;  2NN6 E;  3M7N D;  4IFD D;  2C38 A;  2JE6 B;  5C0X A;  4BA2 A;  2PNZ B;  5JEA C;  2WP8 A;  2PO2 B;  4IFD A;  5JEA E;  3U1K A;  1E3H A;  3CDJ A;  4OO1 F;  4AIM A;  2WNR B;  5JEA B;  1UDS A;  4IFD F;  3M85 G;  4OO1 C;  3GCM A;  4OO1 E;  2BR2 B;  2PO0 B;  2JE6 A;  1UDQ A;  5JEA D;  5K36 F;  2NN6 B;  3KRN A;  1OYR A;  3B4T A;  2C39 A;  2JEB B;  2JEA B;  2NN6 D;  2C37 B;  2WNR A;  3DD6 A;  3L7Z A;  2PO1 B;  4BA1 A;  1UDN A;  5C0X F;  3GME A;  4AID A;  3HKM A;  2NN6 A;  3M85 D;  1R6M A;  3H1C A;  2BA1 G;  4IFD C;  2PNZ A;  4IFD E;  2C38 B;  2JEB A;  2PO2 A;  4OO1 B;  2JEA A;  2C37 A;  1R6L A;  4BA2 B;  2BA0 G;  5K36 C;  5K36 E;  4IFD B;  5JEA A;  4AM3 A;  3M7N G;  4OO1 D;  1E3P A;  5K36 B;  2BR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...