5JEAD

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
224
structure length
224
Chain Sequence
b'SMSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 68
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01138 RNase_PH 3' exoribonuclease family, domain 1
D PF03725 RNase_PH_C 3' exoribonuclease family, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaD00
3DD6A 3L7ZA 2PNZB 2JEBA 2C38B 4IFDB 3GLLA 4BA2A 1OYRA 2NN6D 5C0XD 1R6LA 1UDSA 2WNRA 2PO2A 2PO1B 4OO1B 2PNZA 2PO0B 5JEAC 5K36C 2C38A 4IFDA 2C39A 2C37A 2JE6A 4IFDE 2BR2A 2JEAB 3CDIA 2PO1A 5JEAB 4OO1C 2BA1G 5K36B 1UDNA 3M85G 2BA0D 1OYSA 4IFDD 1E3PA 2NN6B 3H1CA 5C0XB 4IFDF 2JEAA 3GMEA 5K36A 2WP8B 3M7ND 3GCMA 5JEAE 1OYPA 3U1KA 5K36E 3L7ZB 3KRNA 4BA1B 4OO1A 2JEBB 2NN6C 5C0XC 2PO0A 4BA2B 4OO1E 4AIDA 2NN6E 5C0XE 2WP8A 4NBQA 5K36D 5JEAF 4AIMA 5K36F 5JEAA 2BA0G 4BA1A 1UDOA 4OO1D 2C39B 4AM3A 2C37B 2JE6B 4OO1F 3HKMA 2BR2B 2NN6F 3B4TA 5C0XF 2NN6A 5C0XA 3M7NG 1UDQA 1E3HA 2BA1D 5JEAD 3M85D 1R6MA 4IFDC 2WNRB 2PO2B 3CDJA
chains in the Genus database with same CATH superfamily
3WU6A 1Y4UA 2F1DA 2VQFE 2IESA 1PKPA 4LF5E 4PRXA 4N3OA 2PNMA 2E5LI 2PNZB 4JI7I 3WU5A 4IZJB 3K1JA 2PNLA 1FWLA 2UUBE 4IFDB 4NXMI 4K0KE 5GMDA 1R6LA 4LCFA 1UDSA 5EL9A 4UTGA 4LF7E 4DR3E 2PO2A 3J80C 4KQVA 1KKHA 4OO1B 1KTVA 1PIEA 1NHJA 3ZKBA 4DV5I 4GQUA 5ELWA 2V34A 3ZZTA 2C38A 1D6TA 4MQYA 4MU3A 1B62A 4LF6E 4LFBE 3P3CA 1USVA 4DUYI 4DR1E 1Z0GA 1IBKE 2BA1G 1UDNA 3LTOA 5DRQA 4USMA 4DV6E 2GS8A 1HNWE 5DNXA 4X66E 3QT6A 1Z0CA 1Z0TA 4IFDD 4DPUA 2NN6B 4JI8I 2UUCI 2BM1A 3GMEA 4FW9A 4JI6I 2V8PA 1NZ0A 1ZM9A 2WP8B 3HJCA 4B3SI 4LF9E 3U1KA 1B63A 3PS3A 3KRNA 2AJ4A 5IWAI 1HR0I 4LFAI 2JEBB 3ZZ0A 3WU3A 2PO0A 4BA2B 5EKWA 1QZRA 5BR8I 1XNQE 1Z0EA 3B82A 5JEAF 5L3JA 5IT9C 4LF8I 3B78A 5K36F 1HNZI 1UEKA 1N32I 4B3RE 2BA0G 1WUUA 1NHIA 2CZ9A 4DR6I 1H73A 2C37B 1XHKA 4J3DA 4LCHA 4LFCI 4JI8E 4OO1F 1HK7A 4WUCA 3HKMA 2BR2B 4JI3I 5C0XF 4JI6E 3PYGA 4GKJI 3WU4A 1ZXNA 1FNMA 3J81Q 2EFGA 2BM0A 4DR4I 2OI2A 2Z5BB 5IWAE 3P76A 1HR0E 4IFDC 2WNRB 4LFAE 2V2ZA 3L7ZA 2ZBKB 4LF4E 4X62I 4JI0I 5BR8E 3GLLA 4R1FA 4XTJA 1Z5AA 1KVKA 2J7KA 4LF8E 2JT2A 1HNZE 4YHHE 1H7UA 5LMUI 2PO1B 3QT5A 1ELOA 2VESA 4DR6E 2PNZA 3Q1QA 4JI5I 2HK3A 4JI3E 4IFDA 2HFUA 3T1HI 4GKJE 4DV7I 4P7AA 1N0UA 1I94I 4IFDE 2Q2EB 4DR4E 1K47A 2JEAB 2O1WA 5JEAB 4X64E 2UU9E 5K36B 5FLXC 3M85G 3JAMQ 5FWKA 5DROA 1IBLI 4ISAA 2AE8A 4NXNE 4X62E 4JI0E 4DV0E 4FW6A 4ZVIA 1Y5YA 4DV1I 4HYMA 5LMNE 3K85A 4DR2I 1ZM3A 2DEIA 1E3PA 5C0XB 4U3BA 4UT4A 4OX9I 3J80Q 3M7ND 3GCMA 5DRRA 2R3VA 2LJPA 1OYPA 1ZM2A 4JG4A 1MU5A 4MU0A 2V2QA 2GO4A 4DV7E 4HACA 1EA6A 2E5LE 3J7AG 4JI7E 3J7AM 4HY1A 4USKA 2HKEA 4IZJD 2NN6E 2WP8A 5K36D 4KHPI 1IBLE 4NXME 2UXDI 4AIMA 2A2CA 1P42A 3PS2A 4FW3A 2UXBI 4Z7YA 4MU1A 4PRVA 2HHHI 4JV5I 1UDOA 4OO1D 4DR2E 5GMEA 4IZKB 3T1YI 4FW4A 3CWVA 4DUZI 4DV5E 3PYEA 2J65A 2CVEA 4FWGA 1Z59A 4WUDA 1E3HA 4DV2I 4DUYE 1R6MA 3HULA 3CDJA 4LCGA 3DD6A 1XMOI 4B3TI 2CGEA 4DR5I 1N33I 2HK2A 3LPSA 2IOQA 3NZKA 1OYRA 4FW5A 4KHPE 1FJGI 2UXDE 2NN6D 4JI1I 5IT9Q 2Z5EA 1MX0A 1J5EI 1S4EA 2UUCE 2WNRA 2UXBE 5DRPA 4B3SE 2E1RA 2HHHE 3UHMA 1H7SA 4JV5E 4FN5A 3T1YE 1EI1A 4DUZE 1NHHA 2PO0B 2VQEI 5JEAC 5A2QC 5K36C 1OJ4A 2Z5CA 2C39A 1PVGA 2UUAI 2JE6A 1DARA 2HKJA 4X65I 2PO1A 4B3MI 5LL6R 4P52A 4Z7CA 4OO1C 4DPXA 4ED4A 1OYSA 4DV4I 4LF5I 1N32E 4B3TE 4OZEA 1N33E 4JI4I 1XMQI 2WW4A 3PYFA 4FWDA 4JI2I 2UUBI 1FJGE 1Y60A 1YHCA 4PU9A 4JI1E 3H1CA 1RR9A 4LFCE 4DU7A 4IZJA 2JEAA 1J5EE 3PS1A 1XXEA 5K36A 4DPTA 4DV3I 5JEAE 1XNRI 4MYTA 3P06A 5K36E 2XEXA 3L7ZB 1A6FA 4U3DA 4BA1B 2O1UA 4OO1A 2V2VA 2NN6C 1RREA 3V5RA 2UUAE 4X65E 4MDTA 4LFBI 4OO1E 4LOMA 4WUBA 2ZM6I 1Z5BA 5C0XE 4B3ME 2X7IA 4DR1I 4NBQA 1IBKI 2NPFA 4JYAI 5FLXQ 4DV6I 3PYDA 1HNWI 3QT8A 4DV4E 4X66I 1RHYA 5LMUE 1ZM4A 4JI4E 1Z0BA 4RPFA 1XMQE 4JI2E 4AQYI 1Y4SA 4JI5E 2A2DA 3V2UC 3T1HE 2VF3A 4DV3E 2NN6A 2HFSA 1XNRE 3ZM7A 1I94E 4LF9I 2GQ0A 3M7NG 4M1KA 4HXZA 2BA1D 2ZITA 5JEAD 4DR7I 2PO2B 4DXLA 4IZKA 3OTOI 1VI7A 2GO3A 4DV1E 2ZM6E 3QT7A 2JEBA 2F4VI 1N34I 1HNXI 2C38B 4QNKA 1XNQI 4BA2A 3M6AA 1KIJA 4JYAE 5C0XD 2O1TA 4B3RI 4OX9E 4IS9A 4QNJA 4AQYE 2UXCI 4YY3I 5DNLA 1U2RA 4HACB 3P3EA 4GKKI 4I3HA 2C37A 1Z5CA 2BR2A 1VISA 3CDIA 4DR7E 3D4JA 1H72C 3GONA 2DEJA 4OKGA 2BA0D 3ZZUA 4URLA 2Z5BA 3OTOE 3PRYA 4LF4I 2F4VE 1N34E 1HNXE 2IOPA 4LPFA 1BKNA 4FW7A 4IFDF 2O1VA 4MYUA 1Z0WA 4YHHI 4DPYA 2UXCE 3J81C 1MG7A 1FWKA 4YY3E 1N36I 4DV2E 1ZXMA 4FWHA 1N0VC 5A2QQ 1IBMI 4MU4A 4EMDA 1XMOE 5C0XC 4GKKE 4DPWA 2VQFI 1H74A 3U1YA 4AIDA 3F0NA 4DR5E 1USUA 1FKAE 1S16A 4X64I 2UU9I 3ZKDA 2CG9A 2O3ZA 4K0KI 4NXNI 5JEAA 4LF7I 4DR3I 4DV0I 4BA1A 2X36A 5LMNI 1Z0VA 1FI4A 2R42A 1Y6ZA 2C39B 2Z5CB 4AM3A 3K17A 3Q6MA 2JE6B 3Q6NA 2VQEE 3LNUA 2NN6F 3B4TA 3H4LA 2IERA 5C0XA 4LF6I 1UDQA 1N36E 3B8HA 2BV3A 3M85D 1YH8A 1IBME 4DU8A 3P3GA 3JAMC
chains in the Genus database with same CATH topology
3DD6A 3L7ZA 2PNZB 2JEBA 2C38B 4IFDB 3GLLA 4BA2A 1OYRA 2NN6D 5C0XD 1R6LA 1UDSA 2WNRA 2PO2A 2PO1B 4OO1B 2PNZA 2PO0B 5JEAC 5K36C 2C38A 4IFDA 2C39A 2C37A 2JE6A 4IFDE 2BR2A 2JEAB 3CDIA 2PO1A 5JEAB 4OO1C 2BA1G 5K36B 1UDNA 3M85G 2BA0D 1OYSA 4IFDD 1E3PA 2NN6B 3H1CA 5C0XB 4IFDF 2JEAA 3GMEA 5K36A 2WP8B 3M7ND 3GCMA 5JEAE 1OYPA 3U1KA 5K36E 3L7ZB 3KRNA 4BA1B 4OO1A 2JEBB 2NN6C 5C0XC 2PO0A 4BA2B 4OO1E 4AIDA 2NN6E 5C0XE 2WP8A 4NBQA 5K36D 5JEAF 4AIMA 5K36F 5JEAA 2BA0G 4BA1A 1UDOA 4OO1D 2C39B 4AM3A 2C37B 2JE6B 4OO1F 3HKMA 2BR2B 2NN6F 3B4TA 5C0XF 2NN6A 5C0XA 3M7NG 1UDQA 1E3HA 2BA1D 5JEAD 3M85D 1R6MA 4IFDC 2WNRB 2PO2B 3CDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DD6 A;  3L7Z A;  2PNZ B;  2JEB A;  2C38 B;  4IFD B;  3GLL A;  4BA2 A;  1OYR A;  2NN6 D;  5C0X D;  1R6L A;  1UDS A;  2WNR A;  2PO2 A;  2PO1 B;  4OO1 B;  2PNZ A;  2PO0 B;  5JEA C;  5K36 C;  2C38 A;  4IFD A;  2C39 A;  2C37 A;  2JE6 A;  4IFD E;  2BR2 A;  2JEA B;  3CDI A;  2PO1 A;  5JEA B;  4OO1 C;  2BA1 G;  5K36 B;  1UDN A;  3M85 G;  2BA0 D;  1OYS A;  4IFD D;  1E3P A;  2NN6 B;  3H1C A;  5C0X B;  4IFD F;  2JEA A;  3GME A;  5K36 A;  2WP8 B;  3M7N D;  3GCM A;  5JEA E;  1OYP A;  3U1K A;  5K36 E;  3L7Z B;  3KRN A;  4BA1 B;  4OO1 A;  2JEB B;  2NN6 C;  5C0X C;  2PO0 A;  4BA2 B;  4OO1 E;  4AID A;  2NN6 E;  5C0X E;  2WP8 A;  4NBQ A;  5K36 D;  5JEA F;  4AIM A;  5K36 F;  5JEA A;  2BA0 G;  4BA1 A;  1UDO A;  4OO1 D;  2C39 B;  4AM3 A;  2C37 B;  2JE6 B;  4OO1 F;  3HKM A;  2BR2 B;  2NN6 F;  3B4T A;  5C0X F;  2NN6 A;  5C0X A;  3M7N G;  1UDQ A;  1E3H A;  2BA1 D;  5JEA D;  3M85 D;  1R6M A;  4IFD C;  2WNR B;  2PO2 B;  3CDJ A; 
#chains in the Genus database with same CATH topology
 3WU6 A;  1Y4U A;  2F1D A;  2VQF E;  2IES A;  1PKP A;  4LF5 E;  4PRX A;  4N3O A;  2PNM A;  2E5L I;  2PNZ B;  4JI7 I;  3WU5 A;  4IZJ B;  3K1J A;  2PNL A;  1FWL A;  2UUB E;  4IFD B;  4NXM I;  4K0K E;  5GMD A;  1R6L A;  4LCF A;  1UDS A;  5EL9 A;  4UTG A;  4LF7 E;  4DR3 E;  2PO2 A;  3J80 C;  4KQV A;  1KKH A;  4OO1 B;  1KTV A;  1PIE A;  1NHJ A;  3ZKB A;  4DV5 I;  4GQU A;  5ELW A;  2V34 A;  3ZZT A;  2C38 A;  1D6T A;  4MQY A;  4MU3 A;  1B62 A;  4LF6 E;  4LFB E;  3P3C A;  1USV A;  4DUY I;  4DR1 E;  1Z0G A;  1IBK E;  2BA1 G;  1UDN A;  3LTO A;  5DRQ A;  4USM A;  4DV6 E;  2GS8 A;  1HNW E;  5DNX A;  4X66 E;  3QT6 A;  1Z0C A;  1Z0T A;  4IFD D;  4DPU A;  2NN6 B;  4JI8 I;  2UUC I;  2BM1 A;  3GME A;  4FW9 A;  4JI6 I;  2V8P A;  1NZ0 A;  1ZM9 A;  2WP8 B;  3HJC A;  4B3S I;  4LF9 E;  3U1K A;  1B63 A;  3PS3 A;  3KRN A;  2AJ4 A;  5IWA I;  1HR0 I;  4LFA I;  2JEB B;  3ZZ0 A;  3WU3 A;  2PO0 A;  4BA2 B;  5EKW A;  1QZR A;  5BR8 I;  1XNQ E;  1Z0E A;  3B82 A;  5JEA F;  5L3J A;  5IT9 C;  4LF8 I;  3B78 A;  5K36 F;  1HNZ I;  1UEK A;  1N32 I;  4B3R E;  2BA0 G;  1WUU A;  1NHI A;  2CZ9 A;  4DR6 I;  1H73 A;  2C37 B;  1XHK A;  4J3D A;  4LCH A;  4LFC I;  4JI8 E;  4OO1 F;  1HK7 A;  4WUC A;  3HKM A;  2BR2 B;  4JI3 I;  5C0X F;  4JI6 E;  3PYG A;  4GKJ I;  3WU4 A;  1ZXN A;  1FNM A;  3J81 Q;  2EFG A;  2BM0 A;  4DR4 I;  2OI2 A;  2Z5B B;  5IWA E;  3P76 A;  1HR0 E;  4IFD C;  2WNR B;  4LFA E;  2V2Z A;  3L7Z A;  2ZBK B;  4LF4 E;  4X62 I;  4JI0 I;  5BR8 E;  3GLL A;  4R1F A;  4XTJ A;  1Z5A A;  1KVK A;  2J7K A;  4LF8 E;  2JT2 A;  1HNZ E;  4YHH E;  1H7U A;  5LMU I;  2PO1 B;  3QT5 A;  1ELO A;  2VES A;  4DR6 E;  2PNZ A;  3Q1Q A;  4JI5 I;  2HK3 A;  4JI3 E;  4IFD A;  2HFU A;  3T1H I;  4GKJ E;  4DV7 I;  4P7A A;  1N0U A;  1I94 I;  4IFD E;  2Q2E B;  4DR4 E;  1K47 A;  2JEA B;  2O1W A;  5JEA B;  4X64 E;  2UU9 E;  5K36 B;  5FLX C;  3M85 G;  3JAM Q;  5FWK A;  5DRO A;  1IBL I;  4ISA A;  2AE8 A;  4NXN E;  4X62 E;  4JI0 E;  4DV0 E;  4FW6 A;  4ZVI A;  1Y5Y A;  4DV1 I;  4HYM A;  5LMN E;  3K85 A;  4DR2 I;  1ZM3 A;  2DEI A;  1E3P A;  5C0X B;  4U3B A;  4UT4 A;  4OX9 I;  3J80 Q;  3M7N D;  3GCM A;  5DRR A;  2R3V A;  2LJP A;  1OYP A;  1ZM2 A;  4JG4 A;  1MU5 A;  4MU0 A;  2V2Q A;  2GO4 A;  4DV7 E;  4HAC A;  1EA6 A;  2E5L E;  3J7A G;  4JI7 E;  3J7A M;  4HY1 A;  4USK A;  2HKE A;  4IZJ D;  2NN6 E;  2WP8 A;  5K36 D;  4KHP I;  1IBL E;  4NXM E;  2UXD I;  4AIM A;  2A2C A;  1P42 A;  3PS2 A;  4FW3 A;  2UXB I;  4Z7Y A;  4MU1 A;  4PRV A;  2HHH I;  4JV5 I;  1UDO A;  4OO1 D;  4DR2 E;  5GME A;  4IZK B;  3T1Y I;  4FW4 A;  3CWV A;  4DUZ I;  4DV5 E;  3PYE A;  2J65 A;  2CVE A;  4FWG A;  1Z59 A;  4WUD A;  1E3H A;  4DV2 I;  4DUY E;  1R6M A;  3HUL A;  3CDJ A;  4LCG A;  3DD6 A;  1XMO I;  4B3T I;  2CGE A;  4DR5 I;  1N33 I;  2HK2 A;  3LPS A;  2IOQ A;  3NZK A;  1OYR A;  4FW5 A;  4KHP E;  1FJG I;  2UXD E;  2NN6 D;  4JI1 I;  5IT9 Q;  2Z5E A;  1MX0 A;  1J5E I;  1S4E A;  2UUC E;  2WNR A;  2UXB E;  5DRP A;  4B3S E;  2E1R A;  2HHH E;  3UHM A;  1H7S A;  4JV5 E;  4FN5 A;  3T1Y E;  1EI1 A;  4DUZ E;  1NHH A;  2PO0 B;  2VQE I;  5JEA C;  5A2Q C;  5K36 C;  1OJ4 A;  2Z5C A;  2C39 A;  1PVG A;  2UUA I;  2JE6 A;  1DAR A;  2HKJ A;  4X65 I;  2PO1 A;  4B3M I;  5LL6 R;  4P52 A;  4Z7C A;  4OO1 C;  4DPX A;  4ED4 A;  1OYS A;  4DV4 I;  4LF5 I;  1N32 E;  4B3T E;  4OZE A;  1N33 E;  4JI4 I;  1XMQ I;  2WW4 A;  3PYF A;  4FWD A;  4JI2 I;  2UUB I;  1FJG E;  1Y60 A;  1YHC A;  4PU9 A;  4JI1 E;  3H1C A;  1RR9 A;  4LFC E;  4DU7 A;  4IZJ A;  2JEA A;  1J5E E;  3PS1 A;  1XXE A;  5K36 A;  4DPT A;  4DV3 I;  5JEA E;  1XNR I;  4MYT A;  3P06 A;  5K36 E;  2XEX A;  3L7Z B;  1A6F A;  4U3D A;  4BA1 B;  2O1U A;  4OO1 A;  2V2V A;  2NN6 C;  1RRE A;  3V5R A;  2UUA E;  4X65 E;  4MDT A;  4LFB I;  4OO1 E;  4LOM A;  4WUB A;  2ZM6 I;  1Z5B A;  5C0X E;  4B3M E;  2X7I A;  4DR1 I;  4NBQ A;  1IBK I;  2NPF A;  4JYA I;  5FLX Q;  4DV6 I;  3PYD A;  1HNW I;  3QT8 A;  4DV4 E;  4X66 I;  1RHY A;  5LMU E;  1ZM4 A;  4JI4 E;  1Z0B A;  4RPF A;  1XMQ E;  4JI2 E;  4AQY I;  1Y4S A;  4JI5 E;  2A2D A;  3V2U C;  3T1H E;  2VF3 A;  4DV3 E;  2NN6 A;  2HFS A;  1XNR E;  3ZM7 A;  1I94 E;  4LF9 I;  2GQ0 A;  3M7N G;  4M1K A;  4HXZ A;  2BA1 D;  2ZIT A;  5JEA D;  4DR7 I;  2PO2 B;  4DXL A;  4IZK A;  3OTO I;  1VI7 A;  2GO3 A;  4DV1 E;  2ZM6 E;  3QT7 A;  2JEB A;  2F4V I;  1N34 I;  1HNX I;  2C38 B;  4QNK A;  1XNQ I;  4BA2 A;  3M6A A;  1KIJ A;  4JYA E;  5C0X D;  2O1T A;  4B3R I;  4OX9 E;  4IS9 A;  4QNJ A;  4AQY E;  2UXC I;  4YY3 I;  5DNL A;  1U2R A;  4HAC B;  3P3E A;  4GKK I;  4I3H A;  2C37 A;  1Z5C A;  2BR2 A;  1VIS A;  3CDI A;  4DR7 E;  3D4J A;  1H72 C;  3GON A;  2DEJ A;  4OKG A;  2BA0 D;  3ZZU A;  4URL A;  2Z5B A;  3OTO E;  3PRY A;  4LF4 I;  2F4V E;  1N34 E;  1HNX E;  2IOP A;  4LPF A;  1BKN A;  4FW7 A;  4IFD F;  2O1V A;  4MYU A;  1Z0W A;  4YHH I;  4DPY A;  2UXC E;  3J81 C;  1MG7 A;  1FWK A;  4YY3 E;  1N36 I;  4DV2 E;  1ZXM A;  4FWH A;  1N0V C;  5A2Q Q;  1IBM I;  4MU4 A;  4EMD A;  1XMO E;  5C0X C;  4GKK E;  4DPW A;  2VQF I;  1H74 A;  3U1Y A;  4AID A;  3F0N A;  4DR5 E;  1USU A;  1FKA E;  1S16 A;  4X64 I;  2UU9 I;  3ZKD A;  2CG9 A;  2O3Z A;  4K0K I;  4NXN I;  5JEA A;  4LF7 I;  4DR3 I;  4DV0 I;  4BA1 A;  2X36 A;  5LMN I;  1Z0V A;  1FI4 A;  2R42 A;  1Y6Z A;  2C39 B;  2Z5C B;  4AM3 A;  3K17 A;  3Q6M A;  2JE6 B;  3Q6N A;  2VQE E;  3LNU A;  2NN6 F;  3B4T A;  3H4L A;  2IER A;  5C0X A;  4LF6 I;  1UDQ A;  1N36 E;  3B8H A;  2BV3 A;  3M85 D;  1YH8 A;  1IBM E;  4DU8 A;  3P3G A;  3JAM C; 
#chains in the Genus database with same CATH homology
 3DD6 A;  3L7Z A;  2PNZ B;  2JEB A;  2C38 B;  4IFD B;  3GLL A;  4BA2 A;  1OYR A;  2NN6 D;  5C0X D;  1R6L A;  1UDS A;  2WNR A;  2PO2 A;  2PO1 B;  4OO1 B;  2PNZ A;  2PO0 B;  5JEA C;  5K36 C;  2C38 A;  4IFD A;  2C39 A;  2C37 A;  2JE6 A;  4IFD E;  2BR2 A;  2JEA B;  3CDI A;  2PO1 A;  5JEA B;  4OO1 C;  2BA1 G;  5K36 B;  1UDN A;  3M85 G;  2BA0 D;  1OYS A;  4IFD D;  1E3P A;  2NN6 B;  3H1C A;  5C0X B;  4IFD F;  2JEA A;  3GME A;  5K36 A;  2WP8 B;  3M7N D;  3GCM A;  5JEA E;  1OYP A;  3U1K A;  5K36 E;  3L7Z B;  3KRN A;  4BA1 B;  4OO1 A;  2JEB B;  2NN6 C;  5C0X C;  2PO0 A;  4BA2 B;  4OO1 E;  4AID A;  2NN6 E;  5C0X E;  2WP8 A;  4NBQ A;  5K36 D;  5JEA F;  4AIM A;  5K36 F;  5JEA A;  2BA0 G;  4BA1 A;  1UDO A;  4OO1 D;  2C39 B;  4AM3 A;  2C37 B;  2JE6 B;  4OO1 F;  3HKM A;  2BR2 B;  2NN6 F;  3B4T A;  5C0X F;  2NN6 A;  5C0X A;  3M7N G;  1UDQ A;  1E3H A;  2BA1 D;  5JEA D;  3M85 D;  1R6M A;  4IFD C;  2WNR B;  2PO2 B;  3CDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...