5JEAF

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
245
structure length
210
Chain Sequence
b'DRRRLLGPAAAKPMAFEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exosome complex component RRP45
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Hydrolase/rna
total genus 55
structure length 210
sequence length 245
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaF00
4OO1B 2BA0G 5K36B 3L7ZA 4NBQA 2NN6E 1UDSA 4OO1D 1R6LA 1OYRA 4IFDC 3H1CA 2PO1A 4IFDA 2NN6B 4BA1A 5JEAE 3GCMA 4IFDE 2BR2B 2JEAA 4AIDA 2WNRB 5JEAF 4IFDF 1R6MA 3CDIA 3GLLA 2PO0B 1UDNA 5JEAB 2PNZA 3KRNA 1OYPA 5C0XC 2C39A 2C38B 4BA2A 5C0XA 2C37B 2JEBA 5K36D 1E3PA 3M85D 5C0XF 3U1KA 3L7ZB 2PNZB 3M7ND 3B4TA 3GMEA 3HKMA 2PO2A 4BA2B 2NN6D 2BA1G 2PO1B 4IFDB 3M85G 4OO1C 2WNRA 4BA1B 1UDQA 4OO1A 3M7NG 5K36C 2JEAB 2BA1D 5JEAD 4IFDD 5C0XE 4OO1F 3CDJA 1OYSA 2NN6C 2C39B 2NN6A 5C0XB 2JEBB 1UDOA 2BR2A 1E3HA 2JE6A 2NN6F 4AIMA 5C0XD 2WP8A 2PO2B 5JEAC 2BA0D 2PO0A 5JEAA 4OO1E 5K36A 4AM3A 3DD6A 5K36E 2C38A 2JE6B 2C37A 5K36F 2WP8B
chains in the Genus database with same CATH superfamily
4OO1B 1XMQI 4QNJA 2GO4A 2HHHE 2CGEA 5DNXA 4UTGA 1DARA 1R6LA 4DR6I 2UUBI 3Q6NA 1OYRA 4JG4A 5IWAI 3GONA 4LF7E 2O1WA 4UT4A 2NN6B 4YY3I 4OX9E 4FW5A 4I3HA 2UU9E 4P52A 2UXDI 4BA1A 5JEAE 4LF5E 1XNRE 4DUYE 1NHHA 4AIDA 1USVA 4JI8I 1ZXNA 5IT9C 2UXBE 4LF6E 3LPSA 4LFCE 2VESA 4GKJI 1FJGI 5IT9Q 4DR5I 4DPTA 1XHKA 3T1YI 1IBKI 1Y60A 4LF4I 5C0XA 5LMUI 1H74A 2V2QA 1VISA 1HR0E 3GMEA 2PO2A 4HY1A 2Z5CA 1RREA 4DV0E 2Q2EB 4WUBA 3Q1QA 3P76A 2BA1G 1IBME 1I94E 4LFAE 4JI6I 4OO1C 4DR7E 4BA1B 2HKEA 2IERA 5EL9A 1NHJA 1N34I 3P3GA 4OO1F 2V2ZA 4MU4A 1Z0VA 4JV5E 1YH8A 3HJCA 4JI0I 2V2VA 4URLA 1ZM4A 2NN6C 4LCHA 3J80C 3P3CA 1Z5BA 4FW7A 5C0XB 1D6TA 4HXZA 1E3HA 4K0KE 2NN6F 2O3ZA 4LOMA 3M6AA 4DR3E 4LF9I 4JI5E 3PYDA 1ZM2A 2WP8A 1Z0CA 2CVEA 2PO2B 2Z5CB 4QNKA 4B3TE 2GO3A 4OO1E 1XNQI 4JYAI 4X64E 3ZKDA 2GQ0A 4MDTA 2C37A 4DV6I 3OTOI 3B8HA 1ZM9A 1PIEA 4MU3A 4DV5I 4DV3E 1BKNA 1A6FA 4DV7E 1HNXE 4M1KA 2NN6E 1N32I 1PVGA 1KTVA 4RPFA 4IZJD 4USKA 1XMOE 3LNUA 4DV2E 4KQVA 3PYGA 5LMNE 1N0UA 3H1CA 4IFDA 1P42A 1N0VC 2UXCE 1RR9A 1N36I 1N33I 5L3JA 4IFDE 3T1HI 3JAMC 2VQFI 2WP8B 5JEAF 3QT7A 3CDIA 4NXMI 4DR4E 3JAMQ 2HK2A 4DUZE 2V8PA 2O1TA 1J5EI 4DPUA 3QT6A 4P7AA 5DROA 4KHPE 3J7AM 1OYPA 3Q6MA 5C0XC 5FLXC 2XEXA 4IZJA 4DV4E 2C37B 1PKPA 5K36D 4B3RE 5FLXQ 1HNZE 1FNMA 1S4EA 1HNWE 5C0XF 4ZVIA 2CZ9A 4EMDA 1Z5AA 2HFUA 2WW4A 2PNZB 4JI4I 4YHHI 3HKMA 2UUCI 1VI7A 2J7KA 4DV1E 4DR2E 1FKAE 4ISAA 3B82A 1Z0TA 2E5LE 4PRXA 3J81Q 5GMDA 4IFDB 2HK3A 5EKWA 2X7IA 2OI2A 4JI7I 2ZM6E 4MU0A 2VQEI 1Z0EA 2JT2A 4DR1I 2R42A 3P06A 4JI3E 2BA1D 3PRYA 1Z5CA 5C0XE 3V5RA 2F4VI 5DRRA 1B63A 4AQYE 4FWDA 4DPYA 4IZJB 4JI2E 2UUAI 1IBLI 3ZM7A 1UDOA 3U1YA 2BR2A 1Z0WA 4MU1A 4WUCA 4AIMA 4GKKE 2PNMA 4X66I 5BR8I 2PO0A 2ZBKB 1FWKA 4NXNE 4X65I 3K1JA 4AM3A 4JI1I 4LFBI 1NHIA 4X62I 2C38A 4FW9A 2JE6B 4DPWA 4DPXA 2HHHI 3WU4A 4B3ME 4LF8E 4FWGA 1H7SA 4B3SE 1QZRA 5K36B 3L7ZA 2IOPA 2O1UA 4MYUA 4LF7I 4USMA 4OO1D 1XMQE 4OX9I 2UU9I 4IZKB 2Z5BA 3LTOA 4LF5I 1XNRI 2E1RA 4DUYI 4IFDC 1USUA 1XXEA 2IOQA 1Y4SA 4DR6E 2UUBE 3QT5A 5IWAE 2BR2B 4DXLA 2JEAA 2UXBI 4IFDF 3V2UC 4LFCI 1R6MA 3D4JA 4YY3E 4LF6I 3J7AG 2UXDE 1K47A 1KVKA 4IS9A 3PS3A 2AJ4A 2PO0B 4DU7A 1UDNA 4J3DA 5FWKA 3NZKA 4JI8E 2PNZA 3WU6A 2NPFA 3KRNA 3ZZUA 3P3EA 3PS2A 2C39A 2C38B 4R1FA 4GKJE 2JEBA 3PS1A 1FJGE 1HR0I 1EA6A 4WUDA 2GS8A 3T1YE 1NZ0A 1IBKE 4LF4E 2DEJA 4DV0I 1KKHA 3L7ZB 3B4TA 4PRVA 5LMUE 1IBMI 4LFAI 4U3BA 1I94I 4BA2B 2F1DA 5DRPA 4DR7I 2Z5BB 3CWVA 1H72C 2HFSA 3WU5A 5A2QC 1UDQA 1WUUA 5K36C 1HK7A 2JEAB 4JV5I 4Z7YA 5A2QQ 4JI6E 5JEAD 1H73A 1YHCA 3CDJA 1OYSA 1N34E 3B78A 2DEIA 3PYFA 2C39B 4K0KI 1H7UA 4JI0E 2JEBB 3J81C 4DR3I 4JI5I 2JE6A 1Y6ZA 4B3TI 5C0XD 3F0NA 1FI4A 4X64I 2BA0D 4MQYA 4FW3A 5JEAA 4LF9E 5K36A 3DD6A 5K36E 4N3OA 3WU3A 4IZKA 4DV7I 4DV3I 1XNQE 4JYAE 1HNXI 5GMEA 1MX0A 1ELOA 4GQUA 2BA0G 4Z7CA 4LCGA 3OTOE 4DV6E 1XMOI 4NBQA 1UDSA 4LFBE 4DV2I 2IESA 5LMNI 3HULA 4HACA 4DV5E 3K85A 2UXCI 2BM0A 5DRQA 1N32E 4U3DA 2EFGA 2PO1A 3ZZTA 4DR4I 3GCMA 4DUZI 2R3VA 1N36E 4FW4A 1N33E 4KHPI 2VF3A 3GLLA 3T1HE 2VQFE 2BM1A 4FW6A 5JEAB 4DV4I 2LJPA 4NXME 3PYEA 2CG9A 4B3RI 1J5EE 2BV3A 1HNZI 4BA2A 1MG7A 1HNWI 1B62A 1E3PA 3M85D 4DV1I 4LPFA 4DR2I 3U1KA 5ELWA 3M7ND 2E5LI 2A2CA 1MU5A 2X36A 4HACB 2NN6D 1S16A 4JI4E 4YHHE 3ZZ0A 2AE8A 4LCFA 3J80Q 2UUCE 4PU9A 2ZM6I 1Y4UA 2PO1B 4JI3I 4ED4A 3M85G 2WNRA 4OO1A 1FWLA 3K17A 3M7NG 4IFDD 2HKJA 4DR5E 4FN5A 1Y5YA 5LL6R 3UHMA 4JI7E 2VQEE 4AQYI 4FWHA 4XTJA 4DR1E 4JI2I 4MYTA 1U2RA 2A2DA 4HYMA 2F4VE 1ZXMA 2NN6A 4GKKI 1OJ4A 2UUAE 4NXNI 2V34A 3QT8A 1KIJA 1Z0BA 4DU8A 2J65A 1IBLE 5DNLA 5JEAC 3ZKBA 3H4LA 2PNLA 4OZEA 1RHYA 1UEKA 1ZM3A 4B3MI 4OKGA 1EI1A 5BR8E 4X66E 2ZITA 1Z0GA 4LF8I 2Z5EA 1Z59A 5K36F 2O1VA 4B3SI 4X65E 4JI1E 2WNRB 4X62E
chains in the Genus database with same CATH topology
4OO1B 2BA0G 5K36B 3L7ZA 4NBQA 2NN6E 1UDSA 4OO1D 1R6LA 1OYRA 4IFDC 3H1CA 2PO1A 4IFDA 2NN6B 4BA1A 5JEAE 3GCMA 4IFDE 2BR2B 2JEAA 4AIDA 2WNRB 5JEAF 4IFDF 1R6MA 3CDIA 3GLLA 2PO0B 1UDNA 5JEAB 2PNZA 3KRNA 1OYPA 5C0XC 2C39A 2C38B 4BA2A 5C0XA 2C37B 2JEBA 5K36D 1E3PA 3M85D 5C0XF 3U1KA 3L7ZB 2PNZB 3M7ND 3B4TA 3GMEA 3HKMA 2PO2A 4BA2B 2NN6D 2BA1G 2PO1B 4IFDB 3M85G 4OO1C 2WNRA 4BA1B 1UDQA 4OO1A 3M7NG 5K36C 2JEAB 2BA1D 5JEAD 4IFDD 5C0XE 4OO1F 3CDJA 1OYSA 2NN6C 2C39B 2NN6A 5C0XB 2JEBB 1UDOA 2BR2A 1E3HA 2JE6A 2NN6F 4AIMA 5C0XD 2WP8A 2PO2B 5JEAC 2BA0D 2PO0A 5JEAA 4OO1E 5K36A 4AM3A 3DD6A 5K36E 2C38A 2JE6B 2C37A 5K36F 2WP8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 B;  2BA0 G;  5K36 B;  3L7Z A;  4NBQ A;  2NN6 E;  1UDS A;  4OO1 D;  1R6L A;  1OYR A;  4IFD C;  3H1C A;  2PO1 A;  4IFD A;  2NN6 B;  4BA1 A;  5JEA E;  3GCM A;  4IFD E;  2BR2 B;  2JEA A;  4AID A;  2WNR B;  5JEA F;  4IFD F;  1R6M A;  3CDI A;  3GLL A;  2PO0 B;  1UDN A;  5JEA B;  2PNZ A;  3KRN A;  1OYP A;  5C0X C;  2C39 A;  2C38 B;  4BA2 A;  5C0X A;  2C37 B;  2JEB A;  5K36 D;  1E3P A;  3M85 D;  5C0X F;  3U1K A;  3L7Z B;  2PNZ B;  3M7N D;  3B4T A;  3GME A;  3HKM A;  2PO2 A;  4BA2 B;  2NN6 D;  2BA1 G;  2PO1 B;  4IFD B;  3M85 G;  4OO1 C;  2WNR A;  4BA1 B;  1UDQ A;  4OO1 A;  3M7N G;  5K36 C;  2JEA B;  2BA1 D;  5JEA D;  4IFD D;  5C0X E;  4OO1 F;  3CDJ A;  1OYS A;  2NN6 C;  2C39 B;  2NN6 A;  5C0X B;  2JEB B;  1UDO A;  2BR2 A;  1E3H A;  2JE6 A;  2NN6 F;  4AIM A;  5C0X D;  2WP8 A;  2PO2 B;  5JEA C;  2BA0 D;  2PO0 A;  5JEA A;  4OO1 E;  5K36 A;  4AM3 A;  3DD6 A;  5K36 E;  2C38 A;  2JE6 B;  2C37 A;  5K36 F;  2WP8 B; 
#chains in the Genus database with same CATH topology
 4OO1 B;  1XMQ I;  4QNJ A;  2GO4 A;  2HHH E;  2CGE A;  5DNX A;  4UTG A;  1DAR A;  1R6L A;  4DR6 I;  2UUB I;  3Q6N A;  1OYR A;  4JG4 A;  5IWA I;  3GON A;  4LF7 E;  2O1W A;  4UT4 A;  2NN6 B;  4YY3 I;  4OX9 E;  4FW5 A;  4I3H A;  2UU9 E;  4P52 A;  2UXD I;  4BA1 A;  5JEA E;  4LF5 E;  1XNR E;  4DUY E;  1NHH A;  4AID A;  1USV A;  4JI8 I;  1ZXN A;  5IT9 C;  2UXB E;  4LF6 E;  3LPS A;  4LFC E;  2VES A;  4GKJ I;  1FJG I;  5IT9 Q;  4DR5 I;  4DPT A;  1XHK A;  3T1Y I;  1IBK I;  1Y60 A;  4LF4 I;  5C0X A;  5LMU I;  1H74 A;  2V2Q A;  1VIS A;  1HR0 E;  3GME A;  2PO2 A;  4HY1 A;  2Z5C A;  1RRE A;  4DV0 E;  2Q2E B;  4WUB A;  3Q1Q A;  3P76 A;  2BA1 G;  1IBM E;  1I94 E;  4LFA E;  4JI6 I;  4OO1 C;  4DR7 E;  4BA1 B;  2HKE A;  2IER A;  5EL9 A;  1NHJ A;  1N34 I;  3P3G A;  4OO1 F;  2V2Z A;  4MU4 A;  1Z0V A;  4JV5 E;  1YH8 A;  3HJC A;  4JI0 I;  2V2V A;  4URL A;  1ZM4 A;  2NN6 C;  4LCH A;  3J80 C;  3P3C A;  1Z5B A;  4FW7 A;  5C0X B;  1D6T A;  4HXZ A;  1E3H A;  4K0K E;  2NN6 F;  2O3Z A;  4LOM A;  3M6A A;  4DR3 E;  4LF9 I;  4JI5 E;  3PYD A;  1ZM2 A;  2WP8 A;  1Z0C A;  2CVE A;  2PO2 B;  2Z5C B;  4QNK A;  4B3T E;  2GO3 A;  4OO1 E;  1XNQ I;  4JYA I;  4X64 E;  3ZKD A;  2GQ0 A;  4MDT A;  2C37 A;  4DV6 I;  3OTO I;  3B8H A;  1ZM9 A;  1PIE A;  4MU3 A;  4DV5 I;  4DV3 E;  1BKN A;  1A6F A;  4DV7 E;  1HNX E;  4M1K A;  2NN6 E;  1N32 I;  1PVG A;  1KTV A;  4RPF A;  4IZJ D;  4USK A;  1XMO E;  3LNU A;  4DV2 E;  4KQV A;  3PYG A;  5LMN E;  1N0U A;  3H1C A;  4IFD A;  1P42 A;  1N0V C;  2UXC E;  1RR9 A;  1N36 I;  1N33 I;  5L3J A;  4IFD E;  3T1H I;  3JAM C;  2VQF I;  2WP8 B;  5JEA F;  3QT7 A;  3CDI A;  4NXM I;  4DR4 E;  3JAM Q;  2HK2 A;  4DUZ E;  2V8P A;  2O1T A;  1J5E I;  4DPU A;  3QT6 A;  4P7A A;  5DRO A;  4KHP E;  3J7A M;  1OYP A;  3Q6M A;  5C0X C;  5FLX C;  2XEX A;  4IZJ A;  4DV4 E;  2C37 B;  1PKP A;  5K36 D;  4B3R E;  5FLX Q;  1HNZ E;  1FNM A;  1S4E A;  1HNW E;  5C0X F;  4ZVI A;  2CZ9 A;  4EMD A;  1Z5A A;  2HFU A;  2WW4 A;  2PNZ B;  4JI4 I;  4YHH I;  3HKM A;  2UUC I;  1VI7 A;  2J7K A;  4DV1 E;  4DR2 E;  1FKA E;  4ISA A;  3B82 A;  1Z0T A;  2E5L E;  4PRX A;  3J81 Q;  5GMD A;  4IFD B;  2HK3 A;  5EKW A;  2X7I A;  2OI2 A;  4JI7 I;  2ZM6 E;  4MU0 A;  2VQE I;  1Z0E A;  2JT2 A;  4DR1 I;  2R42 A;  3P06 A;  4JI3 E;  2BA1 D;  3PRY A;  1Z5C A;  5C0X E;  3V5R A;  2F4V I;  5DRR A;  1B63 A;  4AQY E;  4FWD A;  4DPY A;  4IZJ B;  4JI2 E;  2UUA I;  1IBL I;  3ZM7 A;  1UDO A;  3U1Y A;  2BR2 A;  1Z0W A;  4MU1 A;  4WUC A;  4AIM A;  4GKK E;  2PNM A;  4X66 I;  5BR8 I;  2PO0 A;  2ZBK B;  1FWK A;  4NXN E;  4X65 I;  3K1J A;  4AM3 A;  4JI1 I;  4LFB I;  1NHI A;  4X62 I;  2C38 A;  4FW9 A;  2JE6 B;  4DPW A;  4DPX A;  2HHH I;  3WU4 A;  4B3M E;  4LF8 E;  4FWG A;  1H7S A;  4B3S E;  1QZR A;  5K36 B;  3L7Z A;  2IOP A;  2O1U A;  4MYU A;  4LF7 I;  4USM A;  4OO1 D;  1XMQ E;  4OX9 I;  2UU9 I;  4IZK B;  2Z5B A;  3LTO A;  4LF5 I;  1XNR I;  2E1R A;  4DUY I;  4IFD C;  1USU A;  1XXE A;  2IOQ A;  1Y4S A;  4DR6 E;  2UUB E;  3QT5 A;  5IWA E;  2BR2 B;  4DXL A;  2JEA A;  2UXB I;  4IFD F;  3V2U C;  4LFC I;  1R6M A;  3D4J A;  4YY3 E;  4LF6 I;  3J7A G;  2UXD E;  1K47 A;  1KVK A;  4IS9 A;  3PS3 A;  2AJ4 A;  2PO0 B;  4DU7 A;  1UDN A;  4J3D A;  5FWK A;  3NZK A;  4JI8 E;  2PNZ A;  3WU6 A;  2NPF A;  3KRN A;  3ZZU A;  3P3E A;  3PS2 A;  2C39 A;  2C38 B;  4R1F A;  4GKJ E;  2JEB A;  3PS1 A;  1FJG E;  1HR0 I;  1EA6 A;  4WUD A;  2GS8 A;  3T1Y E;  1NZ0 A;  1IBK E;  4LF4 E;  2DEJ A;  4DV0 I;  1KKH A;  3L7Z B;  3B4T A;  4PRV A;  5LMU E;  1IBM I;  4LFA I;  4U3B A;  1I94 I;  4BA2 B;  2F1D A;  5DRP A;  4DR7 I;  2Z5B B;  3CWV A;  1H72 C;  2HFS A;  3WU5 A;  5A2Q C;  1UDQ A;  1WUU A;  5K36 C;  1HK7 A;  2JEA B;  4JV5 I;  4Z7Y A;  5A2Q Q;  4JI6 E;  5JEA D;  1H73 A;  1YHC A;  3CDJ A;  1OYS A;  1N34 E;  3B78 A;  2DEI A;  3PYF A;  2C39 B;  4K0K I;  1H7U A;  4JI0 E;  2JEB B;  3J81 C;  4DR3 I;  4JI5 I;  2JE6 A;  1Y6Z A;  4B3T I;  5C0X D;  3F0N A;  1FI4 A;  4X64 I;  2BA0 D;  4MQY A;  4FW3 A;  5JEA A;  4LF9 E;  5K36 A;  3DD6 A;  5K36 E;  4N3O A;  3WU3 A;  4IZK A;  4DV7 I;  4DV3 I;  1XNQ E;  4JYA E;  1HNX I;  5GME A;  1MX0 A;  1ELO A;  4GQU A;  2BA0 G;  4Z7C A;  4LCG A;  3OTO E;  4DV6 E;  1XMO I;  4NBQ A;  1UDS A;  4LFB E;  4DV2 I;  2IES A;  5LMN I;  3HUL A;  4HAC A;  4DV5 E;  3K85 A;  2UXC I;  2BM0 A;  5DRQ A;  1N32 E;  4U3D A;  2EFG A;  2PO1 A;  3ZZT A;  4DR4 I;  3GCM A;  4DUZ I;  2R3V A;  1N36 E;  4FW4 A;  1N33 E;  4KHP I;  2VF3 A;  3GLL A;  3T1H E;  2VQF E;  2BM1 A;  4FW6 A;  5JEA B;  4DV4 I;  2LJP A;  4NXM E;  3PYE A;  2CG9 A;  4B3R I;  1J5E E;  2BV3 A;  1HNZ I;  4BA2 A;  1MG7 A;  1HNW I;  1B62 A;  1E3P A;  3M85 D;  4DV1 I;  4LPF A;  4DR2 I;  3U1K A;  5ELW A;  3M7N D;  2E5L I;  2A2C A;  1MU5 A;  2X36 A;  4HAC B;  2NN6 D;  1S16 A;  4JI4 E;  4YHH E;  3ZZ0 A;  2AE8 A;  4LCF A;  3J80 Q;  2UUC E;  4PU9 A;  2ZM6 I;  1Y4U A;  2PO1 B;  4JI3 I;  4ED4 A;  3M85 G;  2WNR A;  4OO1 A;  1FWL A;  3K17 A;  3M7N G;  4IFD D;  2HKJ A;  4DR5 E;  4FN5 A;  1Y5Y A;  5LL6 R;  3UHM A;  4JI7 E;  2VQE E;  4AQY I;  4FWH A;  4XTJ A;  4DR1 E;  4JI2 I;  4MYT A;  1U2R A;  2A2D A;  4HYM A;  2F4V E;  1ZXM A;  2NN6 A;  4GKK I;  1OJ4 A;  2UUA E;  4NXN I;  2V34 A;  3QT8 A;  1KIJ A;  1Z0B A;  4DU8 A;  2J65 A;  1IBL E;  5DNL A;  5JEA C;  3ZKB A;  3H4L A;  2PNL A;  4OZE A;  1RHY A;  1UEK A;  1ZM3 A;  4B3M I;  4OKG A;  1EI1 A;  5BR8 E;  4X66 E;  2ZIT A;  1Z0G A;  4LF8 I;  2Z5E A;  1Z59 A;  5K36 F;  2O1V A;  4B3S I;  4X65 E;  4JI1 E;  2WNR B;  4X62 E; 
#chains in the Genus database with same CATH homology
 4OO1 B;  2BA0 G;  5K36 B;  3L7Z A;  4NBQ A;  2NN6 E;  1UDS A;  4OO1 D;  1R6L A;  1OYR A;  4IFD C;  3H1C A;  2PO1 A;  4IFD A;  2NN6 B;  4BA1 A;  5JEA E;  3GCM A;  4IFD E;  2BR2 B;  2JEA A;  4AID A;  2WNR B;  5JEA F;  4IFD F;  1R6M A;  3CDI A;  3GLL A;  2PO0 B;  1UDN A;  5JEA B;  2PNZ A;  3KRN A;  1OYP A;  5C0X C;  2C39 A;  2C38 B;  4BA2 A;  5C0X A;  2C37 B;  2JEB A;  5K36 D;  1E3P A;  3M85 D;  5C0X F;  3U1K A;  3L7Z B;  2PNZ B;  3M7N D;  3B4T A;  3GME A;  3HKM A;  2PO2 A;  4BA2 B;  2NN6 D;  2BA1 G;  2PO1 B;  4IFD B;  3M85 G;  4OO1 C;  2WNR A;  4BA1 B;  1UDQ A;  4OO1 A;  3M7N G;  5K36 C;  2JEA B;  2BA1 D;  5JEA D;  4IFD D;  5C0X E;  4OO1 F;  3CDJ A;  1OYS A;  2NN6 C;  2C39 B;  2NN6 A;  5C0X B;  2JEB B;  1UDO A;  2BR2 A;  1E3H A;  2JE6 A;  2NN6 F;  4AIM A;  5C0X D;  2WP8 A;  2PO2 B;  5JEA C;  2BA0 D;  2PO0 A;  5JEA A;  4OO1 E;  5K36 A;  4AM3 A;  3DD6 A;  5K36 E;  2C38 A;  2JE6 B;  2C37 A;  5K36 F;  2WP8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...