5JEAF

Structure of a cytoplasmic 11-subunit rna exosome complex including ski7, bound to rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
245
structure length
210
Chain Sequence
DRRRLLGPAAAKPMAFEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
pubmed doi rcsb
molecule keywords Exosome complex component RRP45
molecule tags Hydrolase/rna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 55
structure length 210
sequence length 245
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01138 RNase_PH 3' exoribonuclease family, domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.70 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 GHMP Kinase, N-terminal domain 5jeaF00
4IFDC 5K36F 2BA1D 3CDIA 1R6MA 2BA0G 2JEAB 3KRNA 5JEAF 3B4TA 2NN6B 4OO1E 2C38B 2PO1B 2PO2B 5C0XC 2JE6B 2JEBA 2PNZA 4BA1B 4IFDA 4OO1A 4BA2A 2NN6C 2C37A 3CDJA 2PO0B 4OO1F 2BR2B 1R6LA 1OYPA 2BA0D 5K36D 2JEAA 4IFDE 4AM3A 5JEAD 2C38A 2PO1A 3L7ZB 2WP8B 2JE6A 5K36B 1E3HA 4NBQA 4BA1A 5JEAB 2WNRA 5C0XE 1UDNA 5C0XA 4IFDF 3GMEA 5K36C 2BR2A 4AIDA 3GCMA 2NN6E 5JEAC 1OYRA 1OYSA 2C39B 2NN6A 5C0XF 2PO2A 3L7ZA 2WP8A 5K36A 2NN6F 3M7NG 4OO1C 2PO0A 1UDOA 3M85D 2BA1G 4IFDD 4OO1D 3M85G 3U1KA 1E3PA 3H1CA 2JEBB 2PNZB 3GLLA 5K36E 4AIMA 4IFDB 4OO1B 2C39A 5C0XD 3DD6A 5JEAE 2WNRB 3HKMA 4BA2B 1UDSA 2C37B 5JEAA 5C0XB 3M7ND 1UDQA 2NN6D
chains in the Genus database with same CATH superfamily
3ZKBA 5LMUE 4OX9I 2LJPA 2HK2A 4DR2E 2BA1D 1EA6A 3CDIA 1R6MA 2BA0G 1N32I 1HNWE 3KRNA 5DNLA 2NN6B 4OO1E 2C38B 2PO1B 4LCGA 2HHHI 2PNZA 1I94I 4OO1A 4LF9E 5DRQA 3PRYA 3HULA 4J3DA 2ZM6I 3LTOA 1PVGA 3K1JA 2E1RA 4OO1F 3Q1QA 4DV7E 4ZVIA 2O3ZA 4Z7CA 4LF4E 3WU5A 1R6LA 2CG9A 2BA0D 5L3JA 1ZXNA 3PYEA 4IFDE 1Z59A 2VQEI 2UXDI 4B3ME 3J7AM 4X65I 5K36B 3K17A 2AE8A 2IERA 4BA1A 3HJCA 4LOMA 2WW4A 4LF5I 4MDTA 3PS2A 1K47A 4JI4E 4DR3I 4WUBA 4LFAI 1OJ4A 4IFDF 2Z5BB 1FI4A 4YHHI 4AIDA 2R42A 4ISAA 1Y6ZA 2O1WA 4JI8E 1KIJA 1OYSA 1NHIA 3U1YA 4JI0I 4DUZI 1D6TA 1H7SA 3L7ZA 4PU9A 2AJ4A 1DARA 1XNRI 2UUCE 5DROA 2E5LI 5DRRA 4QNKA 3P3EA 5LL6R 4DV4I 2IESA 4GKKI 4MQYA 5GMDA 1HNZI 3M7NG 1USUA 4R1FA 4OO1C 2VF3A 1RHYA 2PO0A 4B3TI 4USMA 4DR3E 4OO1D 2R3VA 1RR9A 4LFAE 1XHKA 4DV1E 2CGEA 4OKGA 4AQYE 3PS3A 4DR5I 4GKJE 1FNMA 4JI5I 4LPFA 5IWAI 1Z0BA 4M1KA 4AIMA 4FW5A 1FJGI 4IZKB 1Z5CA 2V2VA 2WNRB 2XEXA 2CVEA 4BA2B 4FWHA 2C37B 4UT4A 3P76A 4B3SI 1NHHA 1XNRE 2E5LE 5LMUI 5IT9C 3M7ND 4FN5A 1Z5BA 4DR2I 4IFDC 4GKKE 1HNWI 1HNZE 3ZZUA 4JV5I 1MU5A 3LPSA 1HR0E 1ZM4A 3B4TA 1VI7A 4DR6E 4X66E 2PO2B 1H73A 4DPWA 4LF9I 1XNQE 2VQFE 2F1DA 1HK7A 4JI5E 5IWAE 1S16A 5A2QQ 1FJGE 1N33I 5FWKA 1PKPA 4DV7I 1N34E 4LF4I 2BR2B 3J81C 4FW7A 1Z0EA 3Q6MA 2HKJA 1IBKE 4OZEA 4JV5E 4B3MI 5BR8E 4QNJA 2NPFA 5JEAD 2C38A 2PO1A 4DU7A 2WP8B 4USKA 4KHPI 1E3HA 2Z5CB 4LFCE 2A2DA 1IBLI 4MYUA 3T1YE 3QT6A 4JI4I 4MYTA 1WUUA 3WU6A 1N33E 2V8PA 4LF6E 2BV3A 2UUAE 2IOPA 3P3CA 4JI8I 4DR1I 1NHJA 1OYRA 2UU9E 2O1UA 5EKWA 1N0VC 2C39B 4UTGA 1MG7A 2UUCI 4IZJB 1Z0GA 5K36A 4Z7YA 2O1TA 2V2QA 5EL9A 2PNMA 5FLXQ 4KHPE 3LNUA 3J7AG 4DR4E 4LFBE 1IBLE 3M6AA 1ZM9A 4K0KE 4DV1I 2ZITA 4AQYI 4GKJI 3U1KA 3H1CA 2A2CA 2JEBB 4DR1E 4FW9A 3GONA 4IFDB 3ZM7A 1Y5YA 2EFGA 5C0XD 3DD6A 5JEAE 4DPUA 5GMEA 1RREA 1KVKA 4RPFA 5JEAA 3P3GA 1FWLA 1Y60A 2X36A 2NN6D 3K85A 4B3RI 4JI6E 2IOQA 1PIEA 1HR0I 4HACB 4FW6A 4DR6I 4X66I 2UXBE 2JEAB 3WU4A 1Z0WA 5JEAF 3T1HE 1XNQI 1EI1A 3ZZTA 2VQFI 1N36I 1H72C 2JE6B 3QT7A 1XMQE 3PS1A 1S4EA 3B8HA 4U3BA 4DR7E 4HYMA 4IZKA 2HKEA 2HFUA 3J80Q 2V2ZA 4BA2A 1N34I 2C37A 1B63A 1ELOA 2PO0B 4JYAE 1IBKI 2GO3A 1XMOE 1ZM2A 1J5EE 2F4VI 4I3HA 1OYPA 5BR8I 4B3RE 3ZZ0A 5K36D 2BM1A 1Z0VA 4AM3A 4EMDA 3CWVA 4MU1A 4JG4A 1MX0A 4LFCI 4DPTA 3H4LA 1N36E 3T1YI 1H7UA 4FWDA 5C0XE 4DV5E 5LMNI 2HFSA 4JI2E 4HXZA 4LF6I 2UUAI 5A2QC 4DUYI 4FW3A 5C0XA 3GMEA 2BR2A 4XTJA 3GCMA 3V2UC 2UXCE 2NN6E 2UUBE 2UU9I 5JEAC 4DV2E 4LCHA 4DV3E 2F4VE 3D4JA 4PRXA 2NN6A 5C0XF 1A6FA 2WP8A 4DV0E 2BM0A 1QZRA 4DR4I 4LFBI 5DRPA 4IS9A 3PYGA 1YHCA 2NN6F 5ELWA 4YY3I 4K0KI 2ZBKB 3WU3A 5LMNE 4ED4A 4JI3E 4JI1I 2J65A 1UDOA 3M85D 4JI7E 3JAMQ 4DUYE 4PRVA 2GO4A 4DV6I 1XXEA 1Z5AA 3JAMC 3P06A 2PNZB 4DPYA 3GLLA 5K36E 3PYFA 4OO1B 2C39A 4IZJA 4MU4A 4X64E 3NZKA 3V5RA 2OI2A 4JI6I 2Q2EB 5FLXC 2DEIA 1Z0CA 3F0NA 4LF8I 2UXBI 4YY3E 1IBMI 2Z5EA 3OTOI 5K36F 4P7AA 3T1HI 2Z5BA 4OX9E 4LCFA 1UEKA 4JI1E 3QT5A 1N32E 2O1VA 1XMQI 4DV6E 5C0XC 1KTVA 4WUCA 4DR7I 2JEBA 2CZ9A 3ZKDA 4BA1B 2HHHE 4IFDA 2GQ0A 1I94E 4N3OA 1Y4SA 3UHMA 1YH8A 2NN6C 4JYAI 3CDJA 4MU0A 1XMOI 1U2RA 1J5EI 4HY1A 2ZM6E 2X7IA 3PYDA 4URLA 1BKNA 4HACA 4LF8E 2PNLA 1FKAE 1IBME 4X62I 4NXNI 3OTOE 2JEAA 1P42A 1ZM3A 3B78A 3L7ZB 2JE6A 2VQEE 1USVA 5DNXA 4NBQA 4DV5I 2UXDE 4X65E 4JI2I 5JEAB 3B82A 4FWGA 2WNRA 1B62A 1UDNA 3J80C 4DU8A 4LF5E 2UXCI 2UUBI 5K36C 4DV2I 1ZXMA 4LF7I 1Z0TA 4DV3I 2HK3A 4IZJD 4YHHE 1Y4UA 4MU3A 4DV0I 4X62E 2PO2A 2JT2A 1HNXI 2VESA 4NXNE 4WUDA 4JI0E 4DUZE 4NXMI 5IT9Q 1H74A 4JI3I 4DV4E 4JI7I 1FWKA 2J7KA 4P52A 1NZ0A 2BA1G 4FW4A 4IFDD 3M85G 1KKHA 1E3PA 4DPXA 4B3TE 4LF7E 4KQVA 4DR5E 2DEJA 3Q6NA 4X64I 4U3DA 2V34A 4GQUA 3HKMA 1VISA 1UDSA 3QT8A 1HNXE 2Z5CA 1N0UA 2GS8A 3J81Q 4DXLA 5C0XB 4NXME 1UDQA 4B3SE
chains in the Genus database with same CATH topology
4IFDC 5K36F 2BA1D 3CDIA 1R6MA 2BA0G 2JEAB 3KRNA 5JEAF 3B4TA 2NN6B 4OO1E 2C38B 2PO1B 2PO2B 5C0XC 2JE6B 2JEBA 2PNZA 4BA1B 4IFDA 4OO1A 4BA2A 2NN6C 2C37A 3CDJA 2PO0B 4OO1F 2BR2B 1R6LA 1OYPA 2BA0D 5K36D 2JEAA 4IFDE 4AM3A 5JEAD 2C38A 2PO1A 3L7ZB 2WP8B 2JE6A 5K36B 1E3HA 4NBQA 4BA1A 5JEAB 2WNRA 5C0XE 1UDNA 5C0XA 4IFDF 3GMEA 5K36C 2BR2A 4AIDA 3GCMA 2NN6E 5JEAC 1OYRA 1OYSA 2C39B 2NN6A 5C0XF 2PO2A 3L7ZA 2WP8A 5K36A 2NN6F 3M7NG 4OO1C 2PO0A 1UDOA 3M85D 2BA1G 4IFDD 4OO1D 3M85G 3U1KA 1E3PA 3H1CA 2JEBB 2PNZB 3GLLA 5K36E 4AIMA 4IFDB 4OO1B 2C39A 5C0XD 3DD6A 5JEAE 2WNRB 3HKMA 4BA2B 1UDSA 2C37B 5JEAA 5C0XB 3M7ND 1UDQA 2NN6D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD C;  5K36 F;  2BA1 D;  3CDI A;  1R6M A;  2BA0 G;  2JEA B;  3KRN A;  5JEA F;  3B4T A;  2NN6 B;  4OO1 E;  2C38 B;  2PO1 B;  2PO2 B;  5C0X C;  2JE6 B;  2JEB A;  2PNZ A;  4BA1 B;  4IFD A;  4OO1 A;  4BA2 A;  2NN6 C;  2C37 A;  3CDJ A;  2PO0 B;  4OO1 F;  2BR2 B;  1R6L A;  1OYP A;  2BA0 D;  5K36 D;  2JEA A;  4IFD E;  4AM3 A;  5JEA D;  2C38 A;  2PO1 A;  3L7Z B;  2WP8 B;  2JE6 A;  5K36 B;  1E3H A;  4NBQ A;  4BA1 A;  5JEA B;  2WNR A;  5C0X E;  1UDN A;  5C0X A;  4IFD F;  3GME A;  5K36 C;  2BR2 A;  4AID A;  3GCM A;  2NN6 E;  5JEA C;  1OYR A;  1OYS A;  2C39 B;  2NN6 A;  5C0X F;  2PO2 A;  3L7Z A;  2WP8 A;  5K36 A;  2NN6 F;  3M7N G;  4OO1 C;  2PO0 A;  1UDO A;  3M85 D;  2BA1 G;  4IFD D;  4OO1 D;  3M85 G;  3U1K A;  1E3P A;  3H1C A;  2JEB B;  2PNZ B;  3GLL A;  5K36 E;  4AIM A;  4IFD B;  4OO1 B;  2C39 A;  5C0X D;  3DD6 A;  5JEA E;  2WNR B;  3HKM A;  4BA2 B;  1UDS A;  2C37 B;  5JEA A;  5C0X B;  3M7N D;  1UDQ A;  2NN6 D; 
#chains in the Genus database with same CATH topology
 3ZKB A;  5LMU E;  4OX9 I;  2LJP A;  2HK2 A;  4DR2 E;  2BA1 D;  1EA6 A;  3CDI A;  1R6M A;  2BA0 G;  1N32 I;  1HNW E;  3KRN A;  5DNL A;  2NN6 B;  4OO1 E;  2C38 B;  2PO1 B;  4LCG A;  2HHH I;  2PNZ A;  1I94 I;  4OO1 A;  4LF9 E;  5DRQ A;  3PRY A;  3HUL A;  4J3D A;  2ZM6 I;  3LTO A;  1PVG A;  3K1J A;  2E1R A;  4OO1 F;  3Q1Q A;  4DV7 E;  4ZVI A;  2O3Z A;  4Z7C A;  4LF4 E;  3WU5 A;  1R6L A;  2CG9 A;  2BA0 D;  5L3J A;  1ZXN A;  3PYE A;  4IFD E;  1Z59 A;  2VQE I;  2UXD I;  4B3M E;  3J7A M;  4X65 I;  5K36 B;  3K17 A;  2AE8 A;  2IER A;  4BA1 A;  3HJC A;  4LOM A;  2WW4 A;  4LF5 I;  4MDT A;  3PS2 A;  1K47 A;  4JI4 E;  4DR3 I;  4WUB A;  4LFA I;  1OJ4 A;  4IFD F;  2Z5B B;  1FI4 A;  4YHH I;  4AID A;  2R42 A;  4ISA A;  1Y6Z A;  2O1W A;  4JI8 E;  1KIJ A;  1OYS A;  1NHI A;  3U1Y A;  4JI0 I;  4DUZ I;  1D6T A;  1H7S A;  3L7Z A;  4PU9 A;  2AJ4 A;  1DAR A;  1XNR I;  2UUC E;  5DRO A;  2E5L I;  5DRR A;  4QNK A;  3P3E A;  5LL6 R;  4DV4 I;  2IES A;  4GKK I;  4MQY A;  5GMD A;  1HNZ I;  3M7N G;  1USU A;  4R1F A;  4OO1 C;  2VF3 A;  1RHY A;  2PO0 A;  4B3T I;  4USM A;  4DR3 E;  4OO1 D;  2R3V A;  1RR9 A;  4LFA E;  1XHK A;  4DV1 E;  2CGE A;  4OKG A;  4AQY E;  3PS3 A;  4DR5 I;  4GKJ E;  1FNM A;  4JI5 I;  4LPF A;  5IWA I;  1Z0B A;  4M1K A;  4AIM A;  4FW5 A;  1FJG I;  4IZK B;  1Z5C A;  2V2V A;  2WNR B;  2XEX A;  2CVE A;  4BA2 B;  4FWH A;  2C37 B;  4UT4 A;  3P76 A;  4B3S I;  1NHH A;  1XNR E;  2E5L E;  5LMU I;  5IT9 C;  3M7N D;  4FN5 A;  1Z5B A;  4DR2 I;  4IFD C;  4GKK E;  1HNW I;  1HNZ E;  3ZZU A;  4JV5 I;  1MU5 A;  3LPS A;  1HR0 E;  1ZM4 A;  3B4T A;  1VI7 A;  4DR6 E;  4X66 E;  2PO2 B;  1H73 A;  4DPW A;  4LF9 I;  1XNQ E;  2VQF E;  2F1D A;  1HK7 A;  4JI5 E;  5IWA E;  1S16 A;  5A2Q Q;  1FJG E;  1N33 I;  5FWK A;  1PKP A;  4DV7 I;  1N34 E;  4LF4 I;  2BR2 B;  3J81 C;  4FW7 A;  1Z0E A;  3Q6M A;  2HKJ A;  1IBK E;  4OZE A;  4JV5 E;  4B3M I;  5BR8 E;  4QNJ A;  2NPF A;  5JEA D;  2C38 A;  2PO1 A;  4DU7 A;  2WP8 B;  4USK A;  4KHP I;  1E3H A;  2Z5C B;  4LFC E;  2A2D A;  1IBL I;  4MYU A;  3T1Y E;  3QT6 A;  4JI4 I;  4MYT A;  1WUU A;  3WU6 A;  1N33 E;  2V8P A;  4LF6 E;  2BV3 A;  2UUA E;  2IOP A;  3P3C A;  4JI8 I;  4DR1 I;  1NHJ A;  1OYR A;  2UU9 E;  2O1U A;  5EKW A;  1N0V C;  2C39 B;  4UTG A;  1MG7 A;  2UUC I;  4IZJ B;  1Z0G A;  5K36 A;  4Z7Y A;  2O1T A;  2V2Q A;  5EL9 A;  2PNM A;  5FLX Q;  4KHP E;  3LNU A;  3J7A G;  4DR4 E;  4LFB E;  1IBL E;  3M6A A;  1ZM9 A;  4K0K E;  4DV1 I;  2ZIT A;  4AQY I;  4GKJ I;  3U1K A;  3H1C A;  2A2C A;  2JEB B;  4DR1 E;  4FW9 A;  3GON A;  4IFD B;  3ZM7 A;  1Y5Y A;  2EFG A;  5C0X D;  3DD6 A;  5JEA E;  4DPU A;  5GME A;  1RRE A;  1KVK A;  4RPF A;  5JEA A;  3P3G A;  1FWL A;  1Y60 A;  2X36 A;  2NN6 D;  3K85 A;  4B3R I;  4JI6 E;  2IOQ A;  1PIE A;  1HR0 I;  4HAC B;  4FW6 A;  4DR6 I;  4X66 I;  2UXB E;  2JEA B;  3WU4 A;  1Z0W A;  5JEA F;  3T1H E;  1XNQ I;  1EI1 A;  3ZZT A;  2VQF I;  1N36 I;  1H72 C;  2JE6 B;  3QT7 A;  1XMQ E;  3PS1 A;  1S4E A;  3B8H A;  4U3B A;  4DR7 E;  4HYM A;  4IZK A;  2HKE A;  2HFU A;  3J80 Q;  2V2Z A;  4BA2 A;  1N34 I;  2C37 A;  1B63 A;  1ELO A;  2PO0 B;  4JYA E;  1IBK I;  2GO3 A;  1XMO E;  1ZM2 A;  1J5E E;  2F4V I;  4I3H A;  1OYP A;  5BR8 I;  4B3R E;  3ZZ0 A;  5K36 D;  2BM1 A;  1Z0V A;  4AM3 A;  4EMD A;  3CWV A;  4MU1 A;  4JG4 A;  1MX0 A;  4LFC I;  4DPT A;  3H4L A;  1N36 E;  3T1Y I;  1H7U A;  4FWD A;  5C0X E;  4DV5 E;  5LMN I;  2HFS A;  4JI2 E;  4HXZ A;  4LF6 I;  2UUA I;  5A2Q C;  4DUY I;  4FW3 A;  5C0X A;  3GME A;  2BR2 A;  4XTJ A;  3GCM A;  3V2U C;  2UXC E;  2NN6 E;  2UUB E;  2UU9 I;  5JEA C;  4DV2 E;  4LCH A;  4DV3 E;  2F4V E;  3D4J A;  4PRX A;  2NN6 A;  5C0X F;  1A6F A;  2WP8 A;  4DV0 E;  2BM0 A;  1QZR A;  4DR4 I;  4LFB I;  5DRP A;  4IS9 A;  3PYG A;  1YHC A;  2NN6 F;  5ELW A;  4YY3 I;  4K0K I;  2ZBK B;  3WU3 A;  5LMN E;  4ED4 A;  4JI3 E;  4JI1 I;  2J65 A;  1UDO A;  3M85 D;  4JI7 E;  3JAM Q;  4DUY E;  4PRV A;  2GO4 A;  4DV6 I;  1XXE A;  1Z5A A;  3JAM C;  3P06 A;  2PNZ B;  4DPY A;  3GLL A;  5K36 E;  3PYF A;  4OO1 B;  2C39 A;  4IZJ A;  4MU4 A;  4X64 E;  3NZK A;  3V5R A;  2OI2 A;  4JI6 I;  2Q2E B;  5FLX C;  2DEI A;  1Z0C A;  3F0N A;  4LF8 I;  2UXB I;  4YY3 E;  1IBM I;  2Z5E A;  3OTO I;  5K36 F;  4P7A A;  3T1H I;  2Z5B A;  4OX9 E;  4LCF A;  1UEK A;  4JI1 E;  3QT5 A;  1N32 E;  2O1V A;  1XMQ I;  4DV6 E;  5C0X C;  1KTV A;  4WUC A;  4DR7 I;  2JEB A;  2CZ9 A;  3ZKD A;  4BA1 B;  2HHH E;  4IFD A;  2GQ0 A;  1I94 E;  4N3O A;  1Y4S A;  3UHM A;  1YH8 A;  2NN6 C;  4JYA I;  3CDJ A;  4MU0 A;  1XMO I;  1U2R A;  1J5E I;  4HY1 A;  2ZM6 E;  2X7I A;  3PYD A;  4URL A;  1BKN A;  4HAC A;  4LF8 E;  2PNL A;  1FKA E;  1IBM E;  4X62 I;  4NXN I;  3OTO E;  2JEA A;  1P42 A;  1ZM3 A;  3B78 A;  3L7Z B;  2JE6 A;  2VQE E;  1USV A;  5DNX A;  4NBQ A;  4DV5 I;  2UXD E;  4X65 E;  4JI2 I;  5JEA B;  3B82 A;  4FWG A;  2WNR A;  1B62 A;  1UDN A;  3J80 C;  4DU8 A;  4LF5 E;  2UXC I;  2UUB I;  5K36 C;  4DV2 I;  1ZXM A;  4LF7 I;  1Z0T A;  4DV3 I;  2HK3 A;  4IZJ D;  4YHH E;  1Y4U A;  4MU3 A;  4DV0 I;  4X62 E;  2PO2 A;  2JT2 A;  1HNX I;  2VES A;  4NXN E;  4WUD A;  4JI0 E;  4DUZ E;  4NXM I;  5IT9 Q;  1H74 A;  4JI3 I;  4DV4 E;  4JI7 I;  1FWK A;  2J7K A;  4P52 A;  1NZ0 A;  2BA1 G;  4FW4 A;  4IFD D;  3M85 G;  1KKH A;  1E3P A;  4DPX A;  4B3T E;  4LF7 E;  4KQV A;  4DR5 E;  2DEJ A;  3Q6N A;  4X64 I;  4U3D A;  2V34 A;  4GQU A;  3HKM A;  1VIS A;  1UDS A;  3QT8 A;  1HNX E;  2Z5C A;  1N0U A;  2GS8 A;  3J81 Q;  4DXL A;  5C0X B;  4NXM E;  1UDQ A;  4B3S E; 
#chains in the Genus database with same CATH homology
 4IFD C;  5K36 F;  2BA1 D;  3CDI A;  1R6M A;  2BA0 G;  2JEA B;  3KRN A;  5JEA F;  3B4T A;  2NN6 B;  4OO1 E;  2C38 B;  2PO1 B;  2PO2 B;  5C0X C;  2JE6 B;  2JEB A;  2PNZ A;  4BA1 B;  4IFD A;  4OO1 A;  4BA2 A;  2NN6 C;  2C37 A;  3CDJ A;  2PO0 B;  4OO1 F;  2BR2 B;  1R6L A;  1OYP A;  2BA0 D;  5K36 D;  2JEA A;  4IFD E;  4AM3 A;  5JEA D;  2C38 A;  2PO1 A;  3L7Z B;  2WP8 B;  2JE6 A;  5K36 B;  1E3H A;  4NBQ A;  4BA1 A;  5JEA B;  2WNR A;  5C0X E;  1UDN A;  5C0X A;  4IFD F;  3GME A;  5K36 C;  2BR2 A;  4AID A;  3GCM A;  2NN6 E;  5JEA C;  1OYR A;  1OYS A;  2C39 B;  2NN6 A;  5C0X F;  2PO2 A;  3L7Z A;  2WP8 A;  5K36 A;  2NN6 F;  3M7N G;  4OO1 C;  2PO0 A;  1UDO A;  3M85 D;  2BA1 G;  4IFD D;  4OO1 D;  3M85 G;  3U1K A;  1E3P A;  3H1C A;  2JEB B;  2PNZ B;  3GLL A;  5K36 E;  4AIM A;  4IFD B;  4OO1 B;  2C39 A;  5C0X D;  3DD6 A;  5JEA E;  2WNR B;  3HKM A;  4BA2 B;  1UDS A;  2C37 B;  5JEA A;  5C0X B;  3M7N D;  1UDQ A;  2NN6 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...