5JELA

Phosphorylated trif in complex with irf-3
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
234
structure length
234
Chain Sequence
ENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for concerted recruitment and activation of IRF-3 by innate immune adaptor proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interferon regulatory factor 3
total genus 62
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10401 IRF-3 Interferon-regulatory factor 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.10 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 5jelA00
3GMJA 5JEMA 4R9PA 5JEJA 1YGSA 1KHUA 1U7VB 1G88A 1QWTA 1U7VA 5BVIA 5JEOA 1U7FB 5JELA 5C4VA 1MK2A 5JERA 5JEKA 3A77A 3DSHA 1MJSA 1KHXA 1DD1A 3DITA 1ZOQA 1DEVA 1J2FA 1MR1A 1U7FA
chains in the Genus database with same CATH superfamily
5JEMA 4D9VA 1YGSA 1GXCA 3UV0A 4JONA 1U7VB 2I1WA 2CSWA 1U0RA 2I2FA 1Y3IA 2I2BA 5JEOA 4L02A 3VZDA 2KKLA 3S40A 5DHPA 1Z0SA 1Z0ZA 1SUWA 2BONA 1MJSA 2Q5FA 1KHXA 2KB3A 5E50A 5EJIA 2BRFA 5DJOA 1ZOQA 1Y3HA 3UNMA 1J2FA 4H87A 2FEZA 3I6UA 4HAOA 2PIEA 1QU5A 1K2MA 1WV3A 3AFOA 2I2DA 3HUFA 4R9PA 1G3GA 4QCJA 5JEJA 3FM8A 1YJMA 3V8QA 5EJGA 1G88A 1U7VA 1YJ5C 3PFNA 2G1LA 2JQIA 5BVIA 3V8NA 1UHTA 2AFFA 3V8RA 3UN0A 5EJHA 2JKDA 3A77A 3DSHA 1J4KA 4WRRA 3MDBA 4V24A 5DHUA 1R21A 3UOTA 3I0MA 4DY6A 4WERA 3V7YA 1J4OA 1LGQA 4A4YA 3V8PA 3PO8A 5DHSA 1UJXA 2JPEA 3GMJA 2W3OA 2JQJA 1DMZA 1G6GA 1KHUA 1K2NA 1FHQA 2EH0A 3VA4A 5A8IA 3UNNA 4EGXA 1U7FB 2JQLA 3UMZA 5C4VA 5JERA 5JEKA 1J4QA 2FF4A 5EJFA 3GQSA 3V7WA 1FHRA 3DITA 3I0NA 2A0TA 1DEVA 3I6WA 3V7UA 3VA1A 3VZBA 3KT9A 1MR1A 4A0EA 2I29A 3OUNA 1U7FA 1WLNA 3POAA 2QV7A 4JIVD 4KU0D 3ELSA 2AN1A 5DHTA 1MZKA 2XT9B 1J4LA 1QWTA 1YT5A 3ELVA 2JGRA 4JIWD 1J4PA 3V8MA 3T5PA 3HX1A 4G2SA 1MK2A 3V80A 4EJQA 5DHQA 2XXSA 2KB4A 3VZCA 1DD1A 1Z0UA 1U0TA 5DHRA 1LGPA 1K3JA 2QVLA 2I2AA 1K3NA 3VPYA 2KFUA 2LC1A 2I2CA 3HUEA 2P1RA 1K3QA 5JELA
chains in the Genus database with same CATH topology
5JEMA 4D9VA 1YGSA 1GXCA 3UV0A 4JONA 1U7VB 2CSWA 5JEOA 4L02A 3VZDA 2KKLA 3S40A 2BONA 1MJSA 1KHXA 2KB3A 5E50A 2BRFA 5DJOA 1ZOQA 3UNMA 1J2FA 4H87A 2FEZA 3I6UA 2PIEA 1QU5A 1K2MA 1WV3A 3HUFA 4R9PA 1G3GA 4QCJA 5JEJA 3FM8A 1YJMA 1G88A 1U7VA 1YJ5C 2G1LA 2JQIA 5BVIA 1UHTA 2AFFA 3UN0A 2JKDA 3A77A 3DSHA 1J4KA 4WRRA 3MDBA 4V24A 1R21A 3UOTA 3I0MA 4WERA 1J4OA 1LGQA 4A4YA 3PO8A 1UJXA 2JPEA 3GMJA 2W3OA 2JQJA 1DMZA 1G6GA 1KHUA 1K2NA 1FHQA 2EH0A 3VA4A 5A8IA 3UNNA 4EGXA 1U7FB 2JQLA 3UMZA 5C4VA 5JERA 5JEKA 1J4QA 2FF4A 3GQSA 1FHRA 3DITA 3I0NA 2A0TA 1DEVA 3I6WA 3VA1A 3VZBA 3KT9A 1MR1A 4A0EA 3OUNA 1U7FA 1WLNA 3POAA 2QV7A 4JIVD 4KU0D 3ELSA 1MZKA 2XT9B 1J4LA 1QWTA 3ELVA 2JGRA 4JIWD 1J4PA 3T5PA 3HX1A 4G2SA 1MK2A 4EJQA 2XXSA 2KB4A 3VZCA 1DD1A 1LGPA 1K3JA 2QVLA 1K3NA 3VPYA 2KFUA 2LC1A 3HUEA 2P1RA 1K3QA 5JELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GMJ A;  5JEM A;  4R9P A;  5JEJ A;  1YGS A;  1KHU A;  1U7V B;  1G88 A;  1QWT A;  1U7V A;  5BVI A;  5JEO A;  1U7F B;  5JEL A;  5C4V A;  1MK2 A;  5JER A;  5JEK A;  3A77 A;  3DSH A;  1MJS A;  1KHX A;  1DD1 A;  3DIT A;  1ZOQ A;  1DEV A;  1J2F A;  1MR1 A;  1U7F A; 
#chains in the Genus database with same CATH topology
 5JEM A;  4D9V A;  1YGS A;  1GXC A;  3UV0 A;  4JON A;  1U7V B;  2I1W A;  2CSW A;  1U0R A;  2I2F A;  1Y3I A;  2I2B A;  5JEO A;  4L02 A;  3VZD A;  2KKL A;  3S40 A;  5DHP A;  1Z0S A;  1Z0Z A;  1SUW A;  2BON A;  1MJS A;  2Q5F A;  1KHX A;  2KB3 A;  5E50 A;  5EJI A;  2BRF A;  5DJO A;  1ZOQ A;  1Y3H A;  3UNM A;  1J2F A;  4H87 A;  2FEZ A;  3I6U A;  4HAO A;  2PIE A;  1QU5 A;  1K2M A;  1WV3 A;  3AFO A;  2I2D A;  3HUF A;  4R9P A;  1G3G A;  4QCJ A;  5JEJ A;  3FM8 A;  1YJM A;  3V8Q A;  5EJG A;  1G88 A;  1U7V A;  1YJ5 C;  3PFN A;  2G1L A;  2JQI A;  5BVI A;  3V8N A;  1UHT A;  2AFF A;  3V8R A;  3UN0 A;  5EJH A;  2JKD A;  3A77 A;  3DSH A;  1J4K A;  4WRR A;  3MDB A;  4V24 A;  5DHU A;  1R21 A;  3UOT A;  3I0M A;  4DY6 A;  4WER A;  3V7Y A;  1J4O A;  1LGQ A;  4A4Y A;  3V8P A;  3PO8 A;  5DHS A;  1UJX A;  2JPE A;  3GMJ A;  2W3O A;  2JQJ A;  1DMZ A;  1G6G A;  1KHU A;  1K2N A;  1FHQ A;  2EH0 A;  3VA4 A;  5A8I A;  3UNN A;  4EGX A;  1U7F B;  2JQL A;  3UMZ A;  5C4V A;  5JER A;  5JEK A;  1J4Q A;  2FF4 A;  5EJF A;  3GQS A;  3V7W A;  1FHR A;  3DIT A;  3I0N A;  2A0T A;  1DEV A;  3I6W A;  3V7U A;  3VA1 A;  3VZB A;  3KT9 A;  1MR1 A;  4A0E A;  2I29 A;  3OUN A;  1U7F A;  1WLN A;  3POA A;  2QV7 A;  4JIV D;  4KU0 D;  3ELS A;  2AN1 A;  5DHT A;  1MZK A;  2XT9 B;  1J4L A;  1QWT A;  1YT5 A;  3ELV A;  2JGR A;  4JIW D;  1J4P A;  3V8M A;  3T5P A;  3HX1 A;  4G2S A;  1MK2 A;  3V80 A;  4EJQ A;  5DHQ A;  2XXS A;  2KB4 A;  3VZC A;  1DD1 A;  1Z0U A;  1U0T A;  5DHR A;  1LGP A;  1K3J A;  2QVL A;  2I2A A;  1K3N A;  3VPY A;  2KFU A;  2LC1 A;  2I2C A;  3HUE A;  2P1R A;  1K3Q A;  5JEL A; 
#chains in the Genus database with same CATH homology
 5JEM A;  4D9V A;  1YGS A;  1GXC A;  3UV0 A;  4JON A;  1U7V B;  2CSW A;  5JEO A;  4L02 A;  3VZD A;  2KKL A;  3S40 A;  2BON A;  1MJS A;  1KHX A;  2KB3 A;  5E50 A;  2BRF A;  5DJO A;  1ZOQ A;  3UNM A;  1J2F A;  4H87 A;  2FEZ A;  3I6U A;  2PIE A;  1QU5 A;  1K2M A;  1WV3 A;  3HUF A;  4R9P A;  1G3G A;  4QCJ A;  5JEJ A;  3FM8 A;  1YJM A;  1G88 A;  1U7V A;  1YJ5 C;  2G1L A;  2JQI A;  5BVI A;  1UHT A;  2AFF A;  3UN0 A;  2JKD A;  3A77 A;  3DSH A;  1J4K A;  4WRR A;  3MDB A;  4V24 A;  1R21 A;  3UOT A;  3I0M A;  4WER A;  1J4O A;  1LGQ A;  4A4Y A;  3PO8 A;  1UJX A;  2JPE A;  3GMJ A;  2W3O A;  2JQJ A;  1DMZ A;  1G6G A;  1KHU A;  1K2N A;  1FHQ A;  2EH0 A;  3VA4 A;  5A8I A;  3UNN A;  4EGX A;  1U7F B;  2JQL A;  3UMZ A;  5C4V A;  5JER A;  5JEK A;  1J4Q A;  2FF4 A;  3GQS A;  1FHR A;  3DIT A;  3I0N A;  2A0T A;  1DEV A;  3I6W A;  3VA1 A;  3VZB A;  3KT9 A;  1MR1 A;  4A0E A;  3OUN A;  1U7F A;  1WLN A;  3POA A;  2QV7 A;  4JIV D;  4KU0 D;  3ELS A;  1MZK A;  2XT9 B;  1J4L A;  1QWT A;  3ELV A;  2JGR A;  4JIW D;  1J4P A;  3T5P A;  3HX1 A;  4G2S A;  1MK2 A;  4EJQ A;  2XXS A;  2KB4 A;  3VZC A;  1DD1 A;  1LGP A;  1K3J A;  2QVL A;  1K3N A;  3VPY A;  2KFU A;  2LC1 A;  3HUE A;  2P1R A;  1K3Q A;  5JEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...