5JFEA

Flavin-dependent thymidylate synthase with h2-dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluating H2-dUMP as an Intermediate in the oxidation of Flavin-dependent Thymidylate Synthase
rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 80
structure length 213
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jfeA00
4GTLA 1O25A 4FZBA 4GTBA 1O26A 4P5BA 4KASA 5IOTA 1O28A 1O27A 1O24A 4GTFA 5IORA 4P5AA 1O29A 4GTAA 5IOQA 3G4CA 5CHPA 4GT9A 4KARA 4GTDA 3N0CA 5JFEA 2CFAB 1O2AA 3AH5A 4GTEA 5IOSA 3G4AA 3N3YA 4KATA 2CFAA 1KQ4A 1O2BA 3N0BA 4GTCA
chains in the Genus database with same CATH superfamily
2XCQA 1XZQB 1SMYA 3RZOK 4YFKA 4A3DC 1BDFA 1TWAK 3V4GA 5C44C 5IP9C 1I3QK 1TWGK 1O28A 1O24A 3HOZK 2PA8D 2BE5A 1O29A 1Y1WC 3GTLA 3GTQA 4QJVA 4YFNA 3S1QC 5JVOA 1J6VA 4LQYA 3GTMA 1I6HC 3K7AK 4A3BK 4DDQA 5D4DA 1DCHA 4Y52C 1WOPA 4KN7A 3SZYA 3N0BA 4OINA 2A6EA 3HOUK 1INNA 4FZBA 5HL8A 3H0GC 3A8IA 3S1RC 1K83A 1IL2A 3GEIA 1YX2A 1TWHK 4G0UA 1BS2A 5IP7C 1TWFC 1TWGA 3G4CA 2NVYC 4WILA 3GEEA 1XXAA 2ZUEA 4A3CK 3HOVK 4A3CC 3LAPA 3T00A 3S17K 3GTPC 2JA8C 2O5JA 3S1NC 2GSNA 1I6HK 3AQOA 3A8KA 4C3JK 1WIHA 4A3IK 1USMA 4KMAA 4AYBL 1AB4A 4GTBA 4OIOA 3HOXK 3FKIA 3GTOC 4KASA 2R92K 4A3IC 3H0GA 4XLPA 2CFAB 1R9TA 1O2FB 3HOZC 3S14K 2NVYA 2W7VA 3GTGK 4A3LC 2CFAA 1EFWA 1DCPA 5M5YK 2XCOA 1WSRA 1WCMA 1ISEA 5L46A 4O2DA 2JA7K 1TWCC 2RH6A 3Q3QA 3T02A 3LAJA 1EH1A 3M3YK 3S15K 1IS1A 4WJ4A 5IOQA 3HOUC 5IYCK 3FKIC 4LJZA 2V6SA 3G4AA 2NVTC 3N3YA 2RGRA 4A3JC 4KATA 1TWAA 2WAQD 1KQ4A 4GTCA 4C3IK 4A3MK 2NVXC 1XZQA 1PJ5A 1F93A 4PABA 3FHZA 2A69A 3S16K 1O26A 4JK1A 2PA8L 1TWGC 4OIPA 1I50K 1J6XA 4GTFA 3HOYK 3GTKC 1WQHA 3GTJK 5C3EC 4G7HA 1SFOC 3AD9C 2GSUA 1TWHC 4GTEA 3CQZA 5TMFA 3HOYC 4A3KC 1XZPA 1EK8A 4GFQA 4XLNA 5IYBC 3ERED 1XPPA 5IYDK 3S1MK 3GEHA 2Y0SD 3ADAC 2PPBA 3PO2K 3AD7C 4LK1A 4Y52K 3GTGA 4KMHA 4Y7NC 2YU9A 4A3GK 2GAHC 3IPJA 3AD8C 1JOEA 2GAGC 3TTGA 1ZVUA 3AH5A 4NOIA 3DXJA 4A3JK 1Y1WA 2PHCB 5IYDC 3HOXC 1WCMK 5C44K 3QX3A 3M3YC 3S15C 1O2BA 1IW7A 2Y0SL 4C45A 3HOVC 5M5XK 1BGWA 4KC6A 3AQPA 2NVQK 2JA5K 2XCRB 3HKZD 3GTGC 4A3LK 2YU9C 4GT9A 2B63A 2KWAA 5FJ8K 1I50A 1DD5A 4XSZA 4A3BC 4LR2A 3VA7A 1WQFA 3JSTA 3T01A 3S1QK 1ZXOA 2R92C 1VLOA 3CAGA 2O5IA 1SFOA 5IYBK 1L0WA 3PO3C 1XXBA 1HI9A 5IYCC 2A6HA 4X6AK 2R93A 4C2MK 3FOFA 4A3EK 1J98A 3S17C 5FLMC 5C4XC 4LLGA 2NVYK 2JA6K 1I50C 5TMCA 4KMDA 3L4KA 1K83C 2FQTA 5CJ9A 5EGHA 4MEXA 4KM9A 3S16C 2PMZL 2WB1D 4XCHA 4A93C 4PAAA 4P9SA 2R92A 3GTPA 1ZBSA 3I4MK 5IORA 4A3FK 4Q5SA 4AYBD 4QJVB 4BXXC 3N0CA 5JFEA 1WORA 5E68A 4GZYA 3K7AC 4LOWA 4LK0A 2CW0A 2JA6A 4Y7NK 1JQWA 2JA7C 3RZDK 4C3HK 2R7ZA 2V6UA 1O25A 1YCLA 5M3FK 1VGXA 2E2IK 2VUMK 3S2DC 2JA8K 4A3KK 1UV7A 3GTLK 3GTQK 3GTPK 3GTJA 3RZOC 4KAWX 1WSVA 4GTAA 1IQ0A 5IP7K 1G51A 3BP8C 4KARA 3SZZA 4C2MC 1VH2A 1O2AA 3S1RK 5IOSA 3GTKA 4A3MC 2NVXK 4G0WA 4KDDA 1WCMC 3A8JA 3CQZK 1B4AA 4YG2A 3GDZA 2NVTK 4GTLA 4G0VA 4A3FC 1YNJA 2B63K 4BBRC 3H3VD 4BBRK 3H3VL 3HXAA 3GSIA 1WOOA 4XSXA 3BP3A 1TWAC 4BLAA 4A3DK 3S1MC 4KB4A 1TWFA 4A93K 1DCOA 4RMFA 2E2HK 4BY1K 4ZH4A 2JH3A 1WOSA 5C4XK 5FLMK 4Q4ZA 1X31C 4X6AC 2R93K 1C0AA 3L4JA 3GTKK 3GTLC 3GTQC 3PO3K 2ZUFA 5M5WK 1TWHA 3GTOK 2JA5A 4KM8A 3GTOA 3M4OC 4GTDA 4MQ9A 1VJEA 4C3IC 1ZQ1C 4C3JC 2WAQL 3NUHA 3I4NC 3BUEA 4G7OA 2B63C 5C4JK 3OEPA 1IBAA 1VRQC 2EBBA 1USOA 4OIQA 1V5VA 1Y1VC 2ZFZA 4KN4A 3I4MC 3I4NK 1TWFK 2GSOA 3EQLA 2NVQC 2WB1L 3LPXA 4J3NA 1B4BA 1PJ7A 3H0GK 1K83K 2YU9K 4BBSC 1TWCA 1I3QA 2R7ZK 2JA5C 2R93C 4FM9A 2E2IC 1BJTA 2VUMC 3S2DK 1I6VA 4BBSK 3WODA 2E2JK 3TFIA 1EQRA 1F9NA 3GTMK 4C3HC 2E2HC 4BY7C 1Y1WK 2NVXA 1GE9A 3TFJA 1O27A 1IE0A 3OREA 1R9TC 1PJ6A 5IP9K 3PO2C 4QIWD 2FQOA 2Y3PA 3MMLB 1JVIA 4BLBA 4OIRA 3S1NK 1I3QC 2PMZD 3M4OK 4KMUA 3HOWK 3S2HK 4KB2A 3HOWC 3S2HC 5C3EK 1XXCA 3HKZL 4P5BA 2R7ZC 4ILDA 5IOTA 4YFXA 1HQMA 1EI6A 3S14C 4BY1C 4P5AA 1SFOK 4QIWL 3S0XA 1ZYRA 2V6TA 1Y1VA 4BKWA 4G7ZA 1Y1VK 3RZDC 4BXXK 1R9TK 5C4JC 1XZPB 2D6FC 1RU0A 1YNNA 4BY7K 5EGEA 2P8TA 2E2JC 4A3GC 1TWCK 4M1XA 4MEYA 3GTMC 4WJ3M 5CHPA 3FKIK 3CQZC 2VUMA 1J6WA 2E2IA 2JA6C 1F7VA 4AH6A 2JA7A 2P5MA 5M3MK 5TJ3A 3FOEA 3OPFA 2A68A 2E2HA 3TFHA 4A3EC 3GIRA 1F7UA 1WQGA 3GTJC
chains in the Genus database with same CATH topology
2XCQA 2ZFZA 5EGHA 5CJ9A 3FHZA 3V4GA 1O26A 4KM9A 1O28A 2GSOA 1O24A 3LPXA 4J3NA 2R92A 4GTFA 1ZBSA 3GTPA 1B4BA 5IORA 1O29A 1WQHA 3GTLA 3GTQA 2GSUA 1TWCA 3N0CA 5JFEA 5JVOA 1I3QA 4GTEA 4LQYA 3GTMA 4DDQA 3CQZA 4FM9A 1BJTA 2JA6A 1EK8A 4GFQA 3ERED 3N0BA 1F9NA 2R7ZA 4C3HC 1O25A 4FZBA 3GTGA 4KMHA 2YU9A 2NVXA 1K83A 3GTJA 1GE9A 1O27A 4KAWX 3OREA 4G0UA 4GTAA 1TWGA 3G4CA 1XXAA 4KARA 4C2MC 3LAPA 1ZVUA 1O2AA 2Y3PA 3AH5A 5IOSA 3GTKA 4G0WA 3MMLB 1Y1WA 2PHCB 4KDDA 4BLBA 3QX3A 2GSNA 1B4AA 1O2BA 3AQOA 1BGWA 1WIHA 4GTLA 4KC6A 4KMAA 4G0VA 4KB2A 1AB4A 4GTBA 1XXCA 3AQPA 3L4KA 3FKIA 4P5BA 4KASA 4ILDA 5IOTA 2XCRB 4P5AA 3H0GA 4BLAA 4GT9A 2B63A 2KWAA 2CFAB 1R9TA 4KB4A 1I50A 3S0XA 1DD5A 1TWFA 2NVYA 4LR2A 1Y1VA 2CFAA 1WQFA 4BKWA 3VA7A 2JH3A 2XCOA 1WCMA 1ZXOA 3CAGA 1ISEA 3L4JA 1SFOA 5EGEA 4M1XA 2RH6A 3Q3QA 1TWHA 3LAJA 1EH1A 1XXBA 1IS1A 5IOQA 2JA5A 4KM8A 3GTOA 5CHPA 2R93A 3FOFA 2VUMA 4GTDA 2E2IA 4C3IC 3G4AA 4C3JC 2JA7A 2P5MA 3N3YA 3NUHA 2RGRA 4KATA 1TWAA 3BUEA 5TJ3A 3FOEA 1KQ4A 3OPFA 3OEPA 2E2HA 4GTCA 4KMDA 1WQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTL A;  1O25 A;  4FZB A;  4GTB A;  1O26 A;  4P5B A;  4KAS A;  5IOT A;  1O28 A;  1O27 A;  1O24 A;  4GTF A;  5IOR A;  4P5A A;  1O29 A;  4GTA A;  5IOQ A;  3G4C A;  5CHP A;  4GT9 A;  4KAR A;  4GTD A;  3N0C A;  5JFE A;  2CFA B;  1O2A A;  3AH5 A;  4GTE A;  5IOS A;  3G4A A;  3N3Y A;  4KAT A;  2CFA A;  1KQ4 A;  1O2B A;  3N0B A;  4GTC A; 
#chains in the Genus database with same CATH topology
 2XCQ A;  1XZQ B;  1SMY A;  3RZO K;  4YFK A;  4A3D C;  1BDF A;  1TWA K;  3V4G A;  5C44 C;  5IP9 C;  1I3Q K;  1TWG K;  1O28 A;  1O24 A;  3HOZ K;  2PA8 D;  2BE5 A;  1O29 A;  1Y1W C;  3GTL A;  3GTQ A;  4QJV A;  4YFN A;  3S1Q C;  5JVO A;  1J6V A;  4LQY A;  3GTM A;  1I6H C;  3K7A K;  4A3B K;  4DDQ A;  5D4D A;  1DCH A;  4Y52 C;  1WOP A;  4KN7 A;  3SZY A;  3N0B A;  4OIN A;  2A6E A;  3HOU K;  1INN A;  4FZB A;  5HL8 A;  3H0G C;  3A8I A;  3S1R C;  1K83 A;  1IL2 A;  3GEI A;  1YX2 A;  1TWH K;  4G0U A;  1BS2 A;  5IP7 C;  1TWF C;  1TWG A;  3G4C A;  2NVY C;  4WIL A;  3GEE A;  1XXA A;  2ZUE A;  4A3C K;  3HOV K;  4A3C C;  3LAP A;  3T00 A;  3S17 K;  3GTP C;  2JA8 C;  2O5J A;  3S1N C;  2GSN A;  1I6H K;  3AQO A;  3A8K A;  4C3J K;  1WIH A;  4A3I K;  1USM A;  4KMA A;  4AYB L;  1AB4 A;  4GTB A;  4OIO A;  3HOX K;  3FKI A;  3GTO C;  4KAS A;  2R92 K;  4A3I C;  3H0G A;  4XLP A;  2CFA B;  1R9T A;  1O2F B;  3HOZ C;  3S14 K;  2NVY A;  2W7V A;  3GTG K;  4A3L C;  2CFA A;  1EFW A;  1DCP A;  5M5Y K;  2XCO A;  1WSR A;  1WCM A;  1ISE A;  5L46 A;  4O2D A;  2JA7 K;  1TWC C;  2RH6 A;  3Q3Q A;  3T02 A;  3LAJ A;  1EH1 A;  3M3Y K;  3S15 K;  1IS1 A;  4WJ4 A;  5IOQ A;  3HOU C;  5IYC K;  3FKI C;  4LJZ A;  2V6S A;  3G4A A;  2NVT C;  3N3Y A;  2RGR A;  4A3J C;  4KAT A;  1TWA A;  2WAQ D;  1KQ4 A;  4GTC A;  4C3I K;  4A3M K;  2NVX C;  1XZQ A;  1PJ5 A;  1F93 A;  4PAB A;  3FHZ A;  2A69 A;  3S16 K;  1O26 A;  4JK1 A;  2PA8 L;  1TWG C;  4OIP A;  1I50 K;  1J6X A;  4GTF A;  3HOY K;  3GTK C;  1WQH A;  3GTJ K;  5C3E C;  4G7H A;  1SFO C;  3AD9 C;  2GSU A;  1TWH C;  4GTE A;  3CQZ A;  5TMF A;  3HOY C;  4A3K C;  1XZP A;  1EK8 A;  4GFQ A;  4XLN A;  5IYB C;  3ERE D;  1XPP A;  5IYD K;  3S1M K;  3GEH A;  2Y0S D;  3ADA C;  2PPB A;  3PO2 K;  3AD7 C;  4LK1 A;  4Y52 K;  3GTG A;  4KMH A;  4Y7N C;  2YU9 A;  4A3G K;  2GAH C;  3IPJ A;  3AD8 C;  1JOE A;  2GAG C;  3TTG A;  1ZVU A;  3AH5 A;  4NOI A;  3DXJ A;  4A3J K;  1Y1W A;  2PHC B;  5IYD C;  3HOX C;  1WCM K;  5C44 K;  3QX3 A;  3M3Y C;  3S15 C;  1O2B A;  1IW7 A;  2Y0S L;  4C45 A;  3HOV C;  5M5X K;  1BGW A;  4KC6 A;  3AQP A;  2NVQ K;  2JA5 K;  2XCR B;  3HKZ D;  3GTG C;  4A3L K;  2YU9 C;  4GT9 A;  2B63 A;  2KWA A;  5FJ8 K;  1I50 A;  1DD5 A;  4XSZ A;  4A3B C;  4LR2 A;  3VA7 A;  1WQF A;  3JST A;  3T01 A;  3S1Q K;  1ZXO A;  2R92 C;  1VLO A;  3CAG A;  2O5I A;  1SFO A;  5IYB K;  1L0W A;  3PO3 C;  1XXB A;  1HI9 A;  5IYC C;  2A6H A;  4X6A K;  2R93 A;  4C2M K;  3FOF A;  4A3E K;  1J98 A;  3S17 C;  5FLM C;  5C4X C;  4LLG A;  2NVY K;  2JA6 K;  1I50 C;  5TMC A;  4KMD A;  3L4K A;  1K83 C;  2FQT A;  5CJ9 A;  5EGH A;  4MEX A;  4KM9 A;  3S16 C;  2PMZ L;  2WB1 D;  4XCH A;  4A93 C;  4PAA A;  4P9S A;  2R92 A;  3GTP A;  1ZBS A;  3I4M K;  5IOR A;  4A3F K;  4Q5S A;  4AYB D;  4QJV B;  4BXX C;  3N0C A;  5JFE A;  1WOR A;  5E68 A;  4GZY A;  3K7A C;  4LOW A;  4LK0 A;  2CW0 A;  2JA6 A;  4Y7N K;  1JQW A;  2JA7 C;  3RZD K;  4C3H K;  2R7Z A;  2V6U A;  1O25 A;  1YCL A;  5M3F K;  1VGX A;  2E2I K;  2VUM K;  3S2D C;  2JA8 K;  4A3K K;  1UV7 A;  3GTL K;  3GTQ K;  3GTP K;  3GTJ A;  3RZO C;  4KAW X;  1WSV A;  4GTA A;  1IQ0 A;  5IP7 K;  1G51 A;  3BP8 C;  4KAR A;  3SZZ A;  4C2M C;  1VH2 A;  1O2A A;  3S1R K;  5IOS A;  3GTK A;  4A3M C;  2NVX K;  4G0W A;  4KDD A;  1WCM C;  3A8J A;  3CQZ K;  1B4A A;  4YG2 A;  3GDZ A;  2NVT K;  4GTL A;  4G0V A;  4A3F C;  1YNJ A;  2B63 K;  4BBR C;  3H3V D;  4BBR K;  3H3V L;  3HXA A;  3GSI A;  1WOO A;  4XSX A;  3BP3 A;  1TWA C;  4BLA A;  4A3D K;  3S1M C;  4KB4 A;  1TWF A;  4A93 K;  1DCO A;  4RMF A;  2E2H K;  4BY1 K;  4ZH4 A;  2JH3 A;  1WOS A;  5C4X K;  5FLM K;  4Q4Z A;  1X31 C;  4X6A C;  2R93 K;  1C0A A;  3L4J A;  3GTK K;  3GTL C;  3GTQ C;  3PO3 K;  2ZUF A;  5M5W K;  1TWH A;  3GTO K;  2JA5 A;  4KM8 A;  3GTO A;  3M4O C;  4GTD A;  4MQ9 A;  1VJE A;  4C3I C;  1ZQ1 C;  4C3J C;  2WAQ L;  3NUH A;  3I4N C;  3BUE A;  4G7O A;  2B63 C;  5C4J K;  3OEP A;  1IBA A;  1VRQ C;  2EBB A;  1USO A;  4OIQ A;  1V5V A;  1Y1V C;  2ZFZ A;  4KN4 A;  3I4M C;  3I4N K;  1TWF K;  2GSO A;  3EQL A;  2NVQ C;  2WB1 L;  3LPX A;  4J3N A;  1B4B A;  1PJ7 A;  3H0G K;  1K83 K;  2YU9 K;  4BBS C;  1TWC A;  1I3Q A;  2R7Z K;  2JA5 C;  2R93 C;  4FM9 A;  2E2I C;  1BJT A;  2VUM C;  3S2D K;  1I6V A;  4BBS K;  3WOD A;  2E2J K;  3TFI A;  1EQR A;  1F9N A;  3GTM K;  4C3H C;  2E2H C;  4BY7 C;  1Y1W K;  2NVX A;  1GE9 A;  3TFJ A;  1O27 A;  1IE0 A;  3ORE A;  1R9T C;  1PJ6 A;  5IP9 K;  3PO2 C;  4QIW D;  2FQO A;  2Y3P A;  3MML B;  1JVI A;  4BLB A;  4OIR A;  3S1N K;  1I3Q C;  2PMZ D;  3M4O K;  4KMU A;  3HOW K;  3S2H K;  4KB2 A;  3HOW C;  3S2H C;  5C3E K;  1XXC A;  3HKZ L;  4P5B A;  2R7Z C;  4ILD A;  5IOT A;  4YFX A;  1HQM A;  1EI6 A;  3S14 C;  4BY1 C;  4P5A A;  1SFO K;  4QIW L;  3S0X A;  1ZYR A;  2V6T A;  1Y1V A;  4BKW A;  4G7Z A;  1Y1V K;  3RZD C;  4BXX K;  1R9T K;  5C4J C;  1XZP B;  2D6F C;  1RU0 A;  1YNN A;  4BY7 K;  5EGE A;  2P8T A;  2E2J C;  4A3G C;  1TWC K;  4M1X A;  4MEY A;  3GTM C;  4WJ3 M;  5CHP A;  3FKI K;  3CQZ C;  2VUM A;  1J6W A;  2E2I A;  2JA6 C;  1F7V A;  4AH6 A;  2JA7 A;  2P5M A;  5M3M K;  5TJ3 A;  3FOE A;  3OPF A;  2A68 A;  2E2H A;  3TFH A;  4A3E C;  3GIR A;  1F7U A;  1WQG A;  3GTJ C; 
#chains in the Genus database with same CATH homology
 2XCQ A;  2ZFZ A;  5EGH A;  5CJ9 A;  3FHZ A;  3V4G A;  1O26 A;  4KM9 A;  1O28 A;  2GSO A;  1O24 A;  3LPX A;  4J3N A;  2R92 A;  4GTF A;  1ZBS A;  3GTP A;  1B4B A;  5IOR A;  1O29 A;  1WQH A;  3GTL A;  3GTQ A;  2GSU A;  1TWC A;  3N0C A;  5JFE A;  5JVO A;  1I3Q A;  4GTE A;  4LQY A;  3GTM A;  4DDQ A;  3CQZ A;  4FM9 A;  1BJT A;  2JA6 A;  1EK8 A;  4GFQ A;  3ERE D;  3N0B A;  1F9N A;  2R7Z A;  4C3H C;  1O25 A;  4FZB A;  3GTG A;  4KMH A;  2YU9 A;  2NVX A;  1K83 A;  3GTJ A;  1GE9 A;  1O27 A;  4KAW X;  3ORE A;  4G0U A;  4GTA A;  1TWG A;  3G4C A;  1XXA A;  4KAR A;  4C2M C;  3LAP A;  1ZVU A;  1O2A A;  2Y3P A;  3AH5 A;  5IOS A;  3GTK A;  4G0W A;  3MML B;  1Y1W A;  2PHC B;  4KDD A;  4BLB A;  3QX3 A;  2GSN A;  1B4A A;  1O2B A;  3AQO A;  1BGW A;  1WIH A;  4GTL A;  4KC6 A;  4KMA A;  4G0V A;  4KB2 A;  1AB4 A;  4GTB A;  1XXC A;  3AQP A;  3L4K A;  3FKI A;  4P5B A;  4KAS A;  4ILD A;  5IOT A;  2XCR B;  4P5A A;  3H0G A;  4BLA A;  4GT9 A;  2B63 A;  2KWA A;  2CFA B;  1R9T A;  4KB4 A;  1I50 A;  3S0X A;  1DD5 A;  1TWF A;  2NVY A;  4LR2 A;  1Y1V A;  2CFA A;  1WQF A;  4BKW A;  3VA7 A;  2JH3 A;  2XCO A;  1WCM A;  1ZXO A;  3CAG A;  1ISE A;  3L4J A;  1SFO A;  5EGE A;  4M1X A;  2RH6 A;  3Q3Q A;  1TWH A;  3LAJ A;  1EH1 A;  1XXB A;  1IS1 A;  5IOQ A;  2JA5 A;  4KM8 A;  3GTO A;  5CHP A;  2R93 A;  3FOF A;  2VUM A;  4GTD A;  2E2I A;  4C3I C;  3G4A A;  4C3J C;  2JA7 A;  2P5M A;  3N3Y A;  3NUH A;  2RGR A;  4KAT A;  1TWA A;  3BUE A;  5TJ3 A;  3FOE A;  1KQ4 A;  3OPF A;  3OEP A;  2E2H A;  4GTC A;  4KMD A;  1WQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...