5JFEA

Flavin-dependent thymidylate synthase with h2-dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Evaluating H2-dUMP as an Intermediate in the oxidation of Flavin-dependent Thymidylate Synthase
rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 80
structure length 213
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jfeA00
4GTAA 3G4AA 1O25A 1O2BA 4GTDA 3N0BA 5IOSA 1O27A 4KARA 1O28A 4GTLA 4KATA 5CHPA 1O24A 5IOQA 4P5AA 5IORA 1O2AA 3N0CA 5IOTA 2CFAB 2CFAA 1KQ4A 3AH5A 4FZBA 5JFEA 1O29A 4GTCA 3G4CA 4GTBA 1O26A 4GTFA 4KASA 4P5BA 4GT9A 3N3YA 4GTEA
chains in the Genus database with same CATH superfamily
3A8JA 4A93C 1G51A 2JA5A 2JA5C 1WSVA 2E2JK 4KB2A 3S1RC 3S1NC 1R9TK 4X6AC 3GTPA 1VGXA 4BKWA 1F7VA 5M3FK 3GTMA 4WJ3M 1EFWA 1EI6A 1BS2A 5C44C 2D6FC 3H0GA 3HOVK 3H0GC 3S2HK 4A3LK 1TWAA 3AD9C 3G4CA 1TWAC 1IS1A 2NVYK 2WAQL 3IPJA 3TFJA 1TWHA 1VH2A 5TJ3A 2EBBA 3N0BA 4A3JC 4KC6A 2NVXC 2B63K 1ISEA 5M3MK 1SFOK 4BY1K 3S14K 1V5VA 3A8KA 4WILA 5IP9C 3PO2K 4WJ4A 5C4JC 3FKIC 2Y0SL 4GTEA 4LK1A 2GSUA 3V4GA 4P9SA 4A3CC 1JQWA 2GAGC 4KARA 5E68A 2E2HA 2E2HC 2ZFZA 4LQYA 3S1MC 2RH6A 3T00A 2PMZL 3GTQK 3M3YC 2JA6K 3HOYK 4BY7C 1ZYRA 1DD5A 1K83A 1K83C 5IYBC 2CFAA 4A3DC 1WIHA 1Y1VK 4LK0A 4QIWL 4QJVA 4A3KC 2GSOA 4BLBA 4OIOA 1IW7A 1ZQ1C 1Y1WC 4A3BC 4DDQA 3RZDC 1XZQB 5M5XK 4LLGA 2NVQC 4A3JK 5CHPA 4C3IK 4Y52C 3AQOA 4XLNA 4BBSK 1TWGK 4C2MK 4OIRA 2NVTK 3GTOA 1TWFA 3GTOC 4MEXA 1TWFC 3HOUC 3S0XA 3LPXA 1F9NA 2VUMA 3GTLC 2VUMC 3BP8C 3S15C 4PAAA 3RZOC 2PPBA 4J3NA 2PA8L 1XZPB 3HOXC 1VJEA 1BDFA 5IYDK 4A3GK 4Q4ZA 1I6VA 5IYCC 3VA7A 2JA7K 1J6WA 2YU9C 4P5AA 5IORA 5D4DA 4A3FK 2R92A 2R93A 3GEHA 1TWCK 3LAPA 2R7ZK 5JFEA 2GSNA 2A69A 2P5MA 4A3MK 2V6TA 4OIQA 1O26A 4XSXA 4C3HK 3GTKA 3GTKC 4AH6A 1USMA 3OEPA 4Y7NC 2RGRA 3G4AA 1O25A 3GTGK 1Y1WK 4O2DA 5EGHA 2FQTA 5FLMK 4GTLA 4KATA 3HOWK 4KMUA 1XXAA 4C3JK 2XCRB 4FM9A 3CAGA 2JA8C 3GTPC 3GTMC 5C4XC 2FQOA 1XXBA 2A68A 4G0WA 2WB1D 3GTLK 4YFKA 3AD7C 4GTBA 3CQZK 3FOFA 3HKZL 3S17C 4P5BA 5CJ9A 4BBRK 1VRQC 3S16C 1EH1A 1TWHC 1F93A 4GTDA 3PO3C 1ZBSA 5IOSA 5IP7C 4A3IC 1XZQA 3T02A 5C3EC 4KAWX 4YFNA 5EGEA 1Y1VA 3M4OC 4KB4A 2E2IA 2E2IC 1KQ4A 4BXXK 3I4MK 1I3QA 1I3QC 3ERED 1WOPA 3HKZD 1O2FB 1WCMK 1JVIA 3TFIA 3HOZK 1I6HK 1XZPA 1TWGA 3GTJA 1IBAA 1I50K 4LR2A 1WORA 4A93K 3I4NC 2JA5K 3NUHA 1PJ6A 4JK1A 1YNNA 4XLPA 3JSTA 4G7OA 3S1RK 3S1NK 4X6AK 3GTPK 3S2DC 3GTMK 5TMCA 3S1QC 5C44K 3Q3QA 3DXJA 1WSRA 2V6UA 3H0GK 3K7AC 4AYBD 5TMFA 1TWAK 4GTAA 1J98A 2ZUEA 4MQ9A 4GFQA 2NVXK 1GE9A 1J6VA 1XXCA 5L46A 1VLOA 3FHZA 1O29A 1F7UA 2O5IA 3GTGA 1R9TA 5M5WK 1R9TC 5IP9K 4G0VA 4GZYA 5C4JK 3FKIK 4PABA 3GEEA 4KMAA 3L4KA 1WOOA 3ADAC 4A3CK 4BLAA 1O2AA 2E2HK 3S1MK 3HOVC 2R92C 3EQLA 1RU0A 3S2HC 3CQZA 3M3YK 4A3LC 2R93C 1WOSA 4BY7K 2NVYA 2NVYC 1K83K 4C45A 5IYBK 2WB1L 4A3DK 3LAJA 2B63A 4A3EC 2B63C 3N3YA 4A3KK 1SFOA 1O2BA 1SFOC 3FOEA 4BY1C 4OINA 3L4JA 4A3BK 2GAHC 3RZDK 1IE0A 4XCHA 2NVQK 1X31C 1YNJA 4Y52K 5IOTA 2CFAB 4RMFA 3AQPA 4YFXA 3GTOK 1TWFK 3PO2C 3HOUK 1WCMA 4QJVB 2VUMK 3S15K 3RZOK 1PJ5A 1WQGA 3A8IA 1BJTA 3H3VD 3HOXK 4G0UA 3GTQA 2P8TA 3GSIA 3GDZA 2XCQA 3QX3A 2JA6C 4KN4A 3GTQC 3HOYC 2JA6A 1L0WA 2KWAA 5IYCK 2YU9K 3MMLB 1Y1VC 1B4AA 1EQRA 2R92K 1INNA 3WODA 2R93K 4GTFA 4AYBL 2A6EA 4Q5SA 2NVXA 4A3EK 4C3IC 3GTKK 1UV7A 4BBSC 1TWGC 4C2MC 4Y7NK 3GTJC 2CW0A 2NVTC 4KM9A 5M5YK 5IOQA 3N0CA 3SZYA 1DCHA 3OREA 2ZUFA 4KMHA 2A6HA 4XSZA 1ZVUA 2JA8K 1EK8A 5C4XK 4GTCA 3FKIA 2WAQD 5IYDC 3SZZA 4G7HA 4A3GC 2JA7A 2JA7C 3S17K 2Y3PA 3S16K 1HQMA 1TWHK 4LJZA 4A3FC 3PO3K 5IP7K 4A3IK 2XCOA 4KM8A 1JOEA 1HI9A 2PHCB 3TTGA 1TWCA 5C3EK 2R7ZA 1TWCC 2R7ZC 4NOIA 3AD8C 3M4OK 4A3MC 4LOWA 3AH5A 4FZBA 2E2IK 4C3HC 1YX2A 3GEIA 3HXAA 1WQHA 3GTGC 1I3QK 2Y0SD 1Y1WA 1ZXOA 5FLMC 3HOWC 4KMDA 4C3JC 1O27A 2E2JC 1C0AA 5FJ8K 1DCPA 1AB4A 1O28A 1IL2A 3GTJK 1WQFA 1O24A 2PMZD 3I4NK 1BGWA 3GIRA 3GTLA 1YCLA 3CQZC 4QIWD 1J6XA 4KDDA 2O5JA 3S2DK 4BBRC 2JH3A 3S1QK 4KASA 4ZH4A 2V6SA 3K7AK 1XPPA 3H3VL 3T01A 2YU9A 3S14C 4G7ZA 1SMYA 2W7VA 4KN7A 4ILDA 4M1XA 4MEYA 4BXXC 3I4MC 5JVOA 3TFHA 1B4BA 1PJ7A 1WCMC 5HL8A 3BP3A 1USOA 3HOZC 1IQ0A 1I6HC 2PA8D 2BE5A 3OPFA 4GT9A 4OIPA 3BUEA 1I50A 4YG2A 1I50C 1DCOA
chains in the Genus database with same CATH topology
4GTAA 2NVXA 4C3IC 2JA5A 4C2MC 3VA7A 4GFQA 4KM9A 1GE9A 4KB2A 5IOQA 4P5AA 5IORA 3N0CA 3GTPA 1XXCA 4BKWA 3OREA 2R92A 3GTMA 4KMHA 2R93A 1ZVUA 1EK8A 3H0GA 3LAPA 3FHZA 5JFEA 1O29A 3GTGA 2GSNA 1TWAA 2P5MA 3G4CA 3FKIA 4GTCA 1R9TA 1O26A 1IS1A 3GTKA 4G0VA 1TWHA 3OEPA 2RGRA 3G4AA 1O25A 5TJ3A 2JA7A 3N0BA 2Y3PA 4KC6A 4KMAA 5EGHA 1ISEA 3L4KA 4GTLA 4KATA 1XXAA 2XCOA 4KM8A 4BLAA 2XCRB 2PHCB 1O2AA 4FM9A 3CAGA 1TWCA 2R7ZA 3CQZA 1XXBA 3AH5A 4FZBA 2NVYA 4G0WA 4C3HC 1WQHA 4GTBA 3FOFA 3LAJA 4P5BA 2B63A 1Y1WA 1ZXOA 5CJ9A 3N3YA 4GTEA 1EH1A 2GSUA 1O2BA 3V4GA 4GTDA 3FOEA 1SFOA 1ZBSA 4KMDA 4C3JC 5IOSA 1O27A 3L4JA 4KARA 1AB4A 1O28A 2E2HA 2ZFZA 4LQYA 1WQFA 1O24A 4KAWX 5EGEA 2RH6A 1Y1VA 4KB4A 2E2IA 5IOTA 1BGWA 1DD5A 2CFAB 1K83A 3GTLA 3AQPA 2CFAA 1WIHA 1KQ4A 1WCMA 4KDDA 1I3QA 2JH3A 3ERED 2GSOA 4KASA 1WQGA 4BLBA 1BJTA 4DDQA 1TWGA 3GTJA 4LR2A 2YU9A 5CHPA 4G0UA 3GTQA 3AQOA 3QX3A 2JA6A 2XCQA 3NUHA 2KWAA 3GTOA 1TWFA 4ILDA 4M1XA 3MMLB 3S0XA 3LPXA 1B4AA 1F9NA 5JVOA 2VUMA 1B4BA 4J3NA 4GTFA 3Q3QA 3OPFA 4GT9A 3BUEA 1I50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTA A;  3G4A A;  1O25 A;  1O2B A;  4GTD A;  3N0B A;  5IOS A;  1O27 A;  4KAR A;  1O28 A;  4GTL A;  4KAT A;  5CHP A;  1O24 A;  5IOQ A;  4P5A A;  5IOR A;  1O2A A;  3N0C A;  5IOT A;  2CFA B;  2CFA A;  1KQ4 A;  3AH5 A;  4FZB A;  5JFE A;  1O29 A;  4GTC A;  3G4C A;  4GTB A;  1O26 A;  4GTF A;  4KAS A;  4P5B A;  4GT9 A;  3N3Y A;  4GTE A; 
#chains in the Genus database with same CATH topology
 3A8J A;  4A93 C;  1G51 A;  2JA5 A;  2JA5 C;  1WSV A;  2E2J K;  4KB2 A;  3S1R C;  3S1N C;  1R9T K;  4X6A C;  3GTP A;  1VGX A;  4BKW A;  1F7V A;  5M3F K;  3GTM A;  4WJ3 M;  1EFW A;  1EI6 A;  1BS2 A;  5C44 C;  2D6F C;  3H0G A;  3HOV K;  3H0G C;  3S2H K;  4A3L K;  1TWA A;  3AD9 C;  3G4C A;  1TWA C;  1IS1 A;  2NVY K;  2WAQ L;  3IPJ A;  3TFJ A;  1TWH A;  1VH2 A;  5TJ3 A;  2EBB A;  3N0B A;  4A3J C;  4KC6 A;  2NVX C;  2B63 K;  1ISE A;  5M3M K;  1SFO K;  4BY1 K;  3S14 K;  1V5V A;  3A8K A;  4WIL A;  5IP9 C;  3PO2 K;  4WJ4 A;  5C4J C;  3FKI C;  2Y0S L;  4GTE A;  4LK1 A;  2GSU A;  3V4G A;  4P9S A;  4A3C C;  1JQW A;  2GAG C;  4KAR A;  5E68 A;  2E2H A;  2E2H C;  2ZFZ A;  4LQY A;  3S1M C;  2RH6 A;  3T00 A;  2PMZ L;  3GTQ K;  3M3Y C;  2JA6 K;  3HOY K;  4BY7 C;  1ZYR A;  1DD5 A;  1K83 A;  1K83 C;  5IYB C;  2CFA A;  4A3D C;  1WIH A;  1Y1V K;  4LK0 A;  4QIW L;  4QJV A;  4A3K C;  2GSO A;  4BLB A;  4OIO A;  1IW7 A;  1ZQ1 C;  1Y1W C;  4A3B C;  4DDQ A;  3RZD C;  1XZQ B;  5M5X K;  4LLG A;  2NVQ C;  4A3J K;  5CHP A;  4C3I K;  4Y52 C;  3AQO A;  4XLN A;  4BBS K;  1TWG K;  4C2M K;  4OIR A;  2NVT K;  3GTO A;  1TWF A;  3GTO C;  4MEX A;  1TWF C;  3HOU C;  3S0X A;  3LPX A;  1F9N A;  2VUM A;  3GTL C;  2VUM C;  3BP8 C;  3S15 C;  4PAA A;  3RZO C;  2PPB A;  4J3N A;  2PA8 L;  1XZP B;  3HOX C;  1VJE A;  1BDF A;  5IYD K;  4A3G K;  4Q4Z A;  1I6V A;  5IYC C;  3VA7 A;  2JA7 K;  1J6W A;  2YU9 C;  4P5A A;  5IOR A;  5D4D A;  4A3F K;  2R92 A;  2R93 A;  3GEH A;  1TWC K;  3LAP A;  2R7Z K;  5JFE A;  2GSN A;  2A69 A;  2P5M A;  4A3M K;  2V6T A;  4OIQ A;  1O26 A;  4XSX A;  4C3H K;  3GTK A;  3GTK C;  4AH6 A;  1USM A;  3OEP A;  4Y7N C;  2RGR A;  3G4A A;  1O25 A;  3GTG K;  1Y1W K;  4O2D A;  5EGH A;  2FQT A;  5FLM K;  4GTL A;  4KAT A;  3HOW K;  4KMU A;  1XXA A;  4C3J K;  2XCR B;  4FM9 A;  3CAG A;  2JA8 C;  3GTP C;  3GTM C;  5C4X C;  2FQO A;  1XXB A;  2A68 A;  4G0W A;  2WB1 D;  3GTL K;  4YFK A;  3AD7 C;  4GTB A;  3CQZ K;  3FOF A;  3HKZ L;  3S17 C;  4P5B A;  5CJ9 A;  4BBR K;  1VRQ C;  3S16 C;  1EH1 A;  1TWH C;  1F93 A;  4GTD A;  3PO3 C;  1ZBS A;  5IOS A;  5IP7 C;  4A3I C;  1XZQ A;  3T02 A;  5C3E C;  4KAW X;  4YFN A;  5EGE A;  1Y1V A;  3M4O C;  4KB4 A;  2E2I A;  2E2I C;  1KQ4 A;  4BXX K;  3I4M K;  1I3Q A;  1I3Q C;  3ERE D;  1WOP A;  3HKZ D;  1O2F B;  1WCM K;  1JVI A;  3TFI A;  3HOZ K;  1I6H K;  1XZP A;  1TWG A;  3GTJ A;  1IBA A;  1I50 K;  4LR2 A;  1WOR A;  4A93 K;  3I4N C;  2JA5 K;  3NUH A;  1PJ6 A;  4JK1 A;  1YNN A;  4XLP A;  3JST A;  4G7O A;  3S1R K;  3S1N K;  4X6A K;  3GTP K;  3S2D C;  3GTM K;  5TMC A;  3S1Q C;  5C44 K;  3Q3Q A;  3DXJ A;  1WSR A;  2V6U A;  3H0G K;  3K7A C;  4AYB D;  5TMF A;  1TWA K;  4GTA A;  1J98 A;  2ZUE A;  4MQ9 A;  4GFQ A;  2NVX K;  1GE9 A;  1J6V A;  1XXC A;  5L46 A;  1VLO A;  3FHZ A;  1O29 A;  1F7U A;  2O5I A;  3GTG A;  1R9T A;  5M5W K;  1R9T C;  5IP9 K;  4G0V A;  4GZY A;  5C4J K;  3FKI K;  4PAB A;  3GEE A;  4KMA A;  3L4K A;  1WOO A;  3ADA C;  4A3C K;  4BLA A;  1O2A A;  2E2H K;  3S1M K;  3HOV C;  2R92 C;  3EQL A;  1RU0 A;  3S2H C;  3CQZ A;  3M3Y K;  4A3L C;  2R93 C;  1WOS A;  4BY7 K;  2NVY A;  2NVY C;  1K83 K;  4C45 A;  5IYB K;  2WB1 L;  4A3D K;  3LAJ A;  2B63 A;  4A3E C;  2B63 C;  3N3Y A;  4A3K K;  1SFO A;  1O2B A;  1SFO C;  3FOE A;  4BY1 C;  4OIN A;  3L4J A;  4A3B K;  2GAH C;  3RZD K;  1IE0 A;  4XCH A;  2NVQ K;  1X31 C;  1YNJ A;  4Y52 K;  5IOT A;  2CFA B;  4RMF A;  3AQP A;  4YFX A;  3GTO K;  1TWF K;  3PO2 C;  3HOU K;  1WCM A;  4QJV B;  2VUM K;  3S15 K;  3RZO K;  1PJ5 A;  1WQG A;  3A8I A;  1BJT A;  3H3V D;  3HOX K;  4G0U A;  3GTQ A;  2P8T A;  3GSI A;  3GDZ A;  2XCQ A;  3QX3 A;  2JA6 C;  4KN4 A;  3GTQ C;  3HOY C;  2JA6 A;  1L0W A;  2KWA A;  5IYC K;  2YU9 K;  3MML B;  1Y1V C;  1B4A A;  1EQR A;  2R92 K;  1INN A;  3WOD A;  2R93 K;  4GTF A;  4AYB L;  2A6E A;  4Q5S A;  2NVX A;  4A3E K;  4C3I C;  3GTK K;  1UV7 A;  4BBS C;  1TWG C;  4C2M C;  4Y7N K;  3GTJ C;  2CW0 A;  2NVT C;  4KM9 A;  5M5Y K;  5IOQ A;  3N0C A;  3SZY A;  1DCH A;  3ORE A;  2ZUF A;  4KMH A;  2A6H A;  4XSZ A;  1ZVU A;  2JA8 K;  1EK8 A;  5C4X K;  4GTC A;  3FKI A;  2WAQ D;  5IYD C;  3SZZ A;  4G7H A;  4A3G C;  2JA7 A;  2JA7 C;  3S17 K;  2Y3P A;  3S16 K;  1HQM A;  1TWH K;  4LJZ A;  4A3F C;  3PO3 K;  5IP7 K;  4A3I K;  2XCO A;  4KM8 A;  1JOE A;  1HI9 A;  2PHC B;  3TTG A;  1TWC A;  5C3E K;  2R7Z A;  1TWC C;  2R7Z C;  4NOI A;  3AD8 C;  3M4O K;  4A3M C;  4LOW A;  3AH5 A;  4FZB A;  2E2I K;  4C3H C;  1YX2 A;  3GEI A;  3HXA A;  1WQH A;  3GTG C;  1I3Q K;  2Y0S D;  1Y1W A;  1ZXO A;  5FLM C;  3HOW C;  4KMD A;  4C3J C;  1O27 A;  2E2J C;  1C0A A;  5FJ8 K;  1DCP A;  1AB4 A;  1O28 A;  1IL2 A;  3GTJ K;  1WQF A;  1O24 A;  2PMZ D;  3I4N K;  1BGW A;  3GIR A;  3GTL A;  1YCL A;  3CQZ C;  4QIW D;  1J6X A;  4KDD A;  2O5J A;  3S2D K;  4BBR C;  2JH3 A;  3S1Q K;  4KAS A;  4ZH4 A;  2V6S A;  3K7A K;  1XPP A;  3H3V L;  3T01 A;  2YU9 A;  3S14 C;  4G7Z A;  1SMY A;  2W7V A;  4KN7 A;  4ILD A;  4M1X A;  4MEY A;  4BXX C;  3I4M C;  5JVO A;  3TFH A;  1B4B A;  1PJ7 A;  1WCM C;  5HL8 A;  3BP3 A;  1USO A;  3HOZ C;  1IQ0 A;  1I6H C;  2PA8 D;  2BE5 A;  3OPF A;  4GT9 A;  4OIP A;  3BUE A;  1I50 A;  4YG2 A;  1I50 C;  1DCO A; 
#chains in the Genus database with same CATH homology
 4GTA A;  2NVX A;  4C3I C;  2JA5 A;  4C2M C;  3VA7 A;  4GFQ A;  4KM9 A;  1GE9 A;  4KB2 A;  5IOQ A;  4P5A A;  5IOR A;  3N0C A;  3GTP A;  1XXC A;  4BKW A;  3ORE A;  2R92 A;  3GTM A;  4KMH A;  2R93 A;  1ZVU A;  1EK8 A;  3H0G A;  3LAP A;  3FHZ A;  5JFE A;  1O29 A;  3GTG A;  2GSN A;  1TWA A;  2P5M A;  3G4C A;  3FKI A;  4GTC A;  1R9T A;  1O26 A;  1IS1 A;  3GTK A;  4G0V A;  1TWH A;  3OEP A;  2RGR A;  3G4A A;  1O25 A;  5TJ3 A;  2JA7 A;  3N0B A;  2Y3P A;  4KC6 A;  4KMA A;  5EGH A;  1ISE A;  3L4K A;  4GTL A;  4KAT A;  1XXA A;  2XCO A;  4KM8 A;  4BLA A;  2XCR B;  2PHC B;  1O2A A;  4FM9 A;  3CAG A;  1TWC A;  2R7Z A;  3CQZ A;  1XXB A;  3AH5 A;  4FZB A;  2NVY A;  4G0W A;  4C3H C;  1WQH A;  4GTB A;  3FOF A;  3LAJ A;  4P5B A;  2B63 A;  1Y1W A;  1ZXO A;  5CJ9 A;  3N3Y A;  4GTE A;  1EH1 A;  2GSU A;  1O2B A;  3V4G A;  4GTD A;  3FOE A;  1SFO A;  1ZBS A;  4KMD A;  4C3J C;  5IOS A;  1O27 A;  3L4J A;  4KAR A;  1AB4 A;  1O28 A;  2E2H A;  2ZFZ A;  4LQY A;  1WQF A;  1O24 A;  4KAW X;  5EGE A;  2RH6 A;  1Y1V A;  4KB4 A;  2E2I A;  5IOT A;  1BGW A;  1DD5 A;  2CFA B;  1K83 A;  3GTL A;  3AQP A;  2CFA A;  1WIH A;  1KQ4 A;  1WCM A;  4KDD A;  1I3Q A;  2JH3 A;  3ERE D;  2GSO A;  4KAS A;  1WQG A;  4BLB A;  1BJT A;  4DDQ A;  1TWG A;  3GTJ A;  4LR2 A;  2YU9 A;  5CHP A;  4G0U A;  3GTQ A;  3AQO A;  3QX3 A;  2JA6 A;  2XCQ A;  3NUH A;  2KWA A;  3GTO A;  1TWF A;  4ILD A;  4M1X A;  3MML B;  3S0X A;  3LPX A;  1B4A A;  1F9N A;  5JVO A;  2VUM A;  1B4B A;  4J3N A;  4GTF A;  3Q3Q A;  3OPF A;  4GT9 A;  3BUE A;  1I50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...