5JFEA

Flavin-dependent thymidylate synthase with h2-dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
publication title Evaluating H2-dUMP as an Intermediate in the oxidation of Flavin-dependent Thymidylate Synthase
rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
total genus 80
structure length 213
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jfeA00
2CFAA 3G4AA 1O25A 4GTCA 4FZBA 4GTDA 4GT9A 5IOTA 3N3YA 3G4CA 2CFAB 4GTBA 5CHPA 1O26A 1O29A 1O27A 5JFEA 1O2BA 4KASA 4P5BA 5IOSA 1O28A 1KQ4A 1O2AA 4P5AA 3N0BA 4GTFA 4GTAA 5IORA 5IOQA 3N0CA 4GTLA 4KARA 4KATA 3AH5A 1O24A 4GTEA
chains in the Genus database with same CATH superfamily
4DDQA 4A3JC 2PA8D 4KDDA 5C4JC 3PO3K 1HQMA 3H3VL 5C3EK 4Q5SA 3GTKK 4YG2A 1B4BA 1J6VA 5M3FK 2NVTK 3GTGA 3S1RK 4A3BK 3PO3C 3RZDC 4RMFA 5C3EC 4A3KK 1O2FB 3BP3A 3S15K 4OIRA 5TMFA 2NVTC 2WB1D 4GTFA 3S1RC 1XXBA 4BXXK 1TWHK 2NVQK 4A3KC 4G7ZA 5M5XK 2JA5K 5FLMK 4KMAA 1EI6A 1SMYA 2XCQA 1INNA 2E2JK 1XZQA 4BXXC 1TWHC 2NVQC 1I3QK 4NOIA 3GTLA 2FQOA 4KB4A 2V6UA 1O2BA 5IYBK 5FLMC 2JA5C 4P5BA 2JA8K 1Y1WK 2E2JC 4M1XA 4QIWL 1SFOK 3GTOA 5IOQA 3N0CA 5IYBC 1TWGA 1O24A 3RZOK 3T01A 1RU0A 2JA8C 3G4AA 4BY7K 1Y1WC 3BUEA 3FKIA 1R9TK 1SFOC 1I6HC 3CQZA 4KN7A 3RZOC 4G0WA 3H3VD 1R9TC 1GE9A 4KASA 4G7OA 3FOFA 2R7ZA 1WORA 1ZXOA 3I4MK 2GSNA 3M3YC 4Q4ZA 3TFHA 4KB2A 3AQPA 4BLBA 1WIHA 2ZUEA 4P9SA 4YFNA 3I4MC 3HOWK 1BDFA 3BP8C 4A3DK 1ISEA 3DXJA 5TJ3A 4A93C 2A68A 3GTKA 3HKZL 5M5WK 3S16K 2JA6K 3GTQK 5CJ9A 2RGRA 3TFJA 3HOWC 2O5JA 4A3DC 3WODA 3S1QK 1WSVA 1V5VA 3S16C 5IORA 2JA6C 3GTQC 4KARA 4AH6A 4KATA 5IYDK 1G51A 2NVYK 4QIWD 1YNJA 2XCRB 5HL8A 2E2IA 4GZYA 3GDZA 4KM8A 5IYDC 2NVYC 3A8KA 1I3QA 1O29A 1F7UA 1DCOA 2O5IA 2P8TA 1F7VA 1KQ4A 4A3JK 2GAHC 3V4GA 1VRQC 4GTAA 3A8IA 4LQYA 5C4JK 4GTLA 5M3MK 3HOXK 1WCMC 5C4XK 4MEYA 2W7VA 3HOXC 4LK1A 3RZDK 1UV7A 3S1MK 5C4XC 1IW7A 1TWCC 4A3EC 1TWFK 2E2HK 4C3HK 4OIOA 3K7AC 3GSIA 4KAWX 3HKZD 3S1MC 2B63K 3ADAC 1TWFC 3H0GA 4C3HC 2FQTA 2E2HC 1Y1VK 1I50A 3LAJA 3OPFA 3T02A 1TWAK 2B63C 1VGXA 4GTDA 2ZFZA 4FZBA 3GTPA 2CFAB 4J3NA 3HOUC 1XXAA 3MMLB 1PJ7A 1Y1VC 2NVXA 1YNNA 4XLPA 1F93A 1VLOA 3Q3QA 3S1NK 1TWAC 1WQFA 4KN4A 2JA7K 1O27A 3GTMK 1DD5A 5EGHA 3GTJK 5E68A 1B4AA 1O2AA 4GFQA 3ERED 2CW0A 3S1NC 2YU9A 4AYBL 2JA7C 1I6HK 3S2DK 3GTMC 3GEEA 2VUMK 1IBAA 4X6AK 3GTJC 2Y0SL 4XLNA 3HOYC 3VA7A 2R93K 5IP9K 4KMUA 4PABA 3S2DC 2A6HA 1HI9A 2VUMC 4X6AC 2BE5A 4G0UA 2R93C 1O26A 1EK8A 3M3YK 5JFEA 5IP9C 3T00A 1BS2A 2R92A 1IQ0A 1VJEA 3FHZA 1JVIA 5D4DA 4A93K 1O25A 3M4OC 4WILA 5M5YK 1WQHA 3S2HK 1J6XA 4A3LK 1BJTA 1WOOA 1ZBSA 1ZVUA 3GTGC 3PO2K 3AD8C 4BLAA 2PA8L 2PMZL 3JSTA 3S2HC 1XZPB 1DCHA 3OREA 4LLGA 4BY1K 4WJ3M 4AYBD 1TWHA 1XXCA 4A3LC 4C2MK 1EQRA 3PO2C 4GT9A 1ZYRA 3EQLA 3HOZK 2JA5A 2Y0SD 1WOSA 4QJVB 3GTLK 4BY1C 4C2MC 1JOEA 3HOZC 1WCMK 2D6FC 4ILDA 4FM9A 3GTLC 1Y1WA 3N0BA 3AD7C 1EFWA 2XCOA 1SFOA 1J6WA 4QJVA 3FKIK 2GSOA 4G0VA 3CQZK 1TWCK 4C45A 4A3EK 1R9TA 1USOA 3G4CA 3K7AK 4Y52C 3GIRA 5FJ8K 5IYCK 4XSZA 5EGEA 3FKIC 3CQZC 1IE0A 2GAGC 2R7ZK 4KMDA 3IPJA 3HOVK 1YX2A 5C44K 4P5AA 5IYCC 1JQWA 1IS1A 3TTGA 4OIPA 3OEPA 3AH5A 3HOUK 2WAQL 2R7ZC 4GTEA 3HOVC 2PMZD 5C44C 4OIQA 4C3JK 3NUHA 3QX3A 2A69A 3A8JA 4G7HA 1F9NA 4YFKA 5CHPA 4ZH4A 4C3JC 2JA6A 3GTQA 4XSXA 1XZQB 4OINA 3TFIA 4PAAA 1I6VA 4A3IK 2A6EA 1VH2A 3L4JA 3GTKC 3AD9C 3HOYK 3S17K 4A3BC 3I4NK 4Y7NK 4A3MK 2CFAA 1K83K 3S15C 4LK0A 4A3IC 4LOWA 2NVYA 2E2IK 1EH1A 5IOTA 3S17C 3I4NC 4Y7NC 4A3MC 2V6TA 1K83C 2E2IC 4O2DA 2PPBA 1WQGA 4BKWA 1O28A 1WCMA 1I3QC 5L46A 3M4OK 2GSUA 1IL2A 4A3FK 4KC6A 3SZYA 4BBSK 1BGWA 1WOPA 4GTCA 4C3IK 1TWCA 2WAQD 4LJZA 3CAGA 4GTBA 4A3FC 4BY7C 2JH3A 4BBSC 3GTGK 1C0AA 4C3IC 1L0WA 4BBRK 1WSRA 1TWFA 2E2HA 5IOSA 4YFXA 2P5MA 4A3CK 3SZZA 1YCLA 3FOEA 3GEHA 3H0GK 4A3GK 2B63A 1I50K 4BBRC 1Y1VA 4XCHA 4A3CC 3AQOA 3HXAA 3LAPA 1TWAA 3GTPK 3H0GC 4A3GC 3N3YA 2NVXK 1I50C 4LR2A 1PJ6A 5IP7K 4KMHA 2KWAA 3GTPC 1AB4A 3GEIA 2JA7A 2NVXC 2WB1L 3GTMA 1XZPA 3GTJA 2YU9K 2Y3PA 5IP7C 3GTOK 1X31C 1TWGK 3L4KA 4Y52K 3LPXA 5JVOA 3S14K 2VUMA 1USMA 1K83A 3S1QC 3S0XA 1PJ5A 2YU9C 2R93A 3GTOC 2EBBA 4JK1A 2PHCB 1TWGC 1XPPA 3S14C 4WJ4A 1DCPA 2R92K 1ZQ1C 2V6SA 2ZUFA 2RH6A 1J98A 4KM9A 4MQ9A 5TMCA 2R92C 4MEXA
chains in the Genus database with same CATH topology
2CFAA 4DDQA 2XCRB 2NVYA 1O25A 1EH1A 4KDDA 5IOTA 2E2IA 4KM8A 1B4BA 1I3QA 1WQHA 3GTGA 1O29A 1WQGA 4BKWA 1O28A 1WCMA 1KQ4A 1BJTA 1ZBSA 1ZVUA 4GTFA 4GTAA 3V4GA 4BLAA 4LQYA 2GSUA 4GTLA 1XXBA 3OREA 4KC6A 1TWHA 1XXCA 1BGWA 4GTCA 4GT9A 1TWCA 4KMAA 3CAGA 2JA5A 2XCQA 4GTBA 2JH3A 3GTLA 4KB4A 4C2MC 4C3IC 1O2BA 1TWFA 4P5BA 2E2HA 4KAWX 5IOSA 4ILDA 2P5MA 4FM9A 4M1XA 1Y1WA 3N0BA 3FOEA 3GTOA 2XCOA 5IOQA 1SFOA 2B63A 3N0CA 3H0GA 4C3HC 1TWGA 1O24A 1I50A 3LAJA 1Y1VA 3G4AA 3OPFA 3BUEA 3AQOA 2GSOA 3FKIA 4G0VA 3LAPA 1TWAA 4GTDA 2ZFZA 4FZBA 1R9TA 3N3YA 3CQZA 3G4CA 3GTPA 2CFAB 4J3NA 1XXAA 3MMLB 2NVXA 4LR2A 5EGEA 4KMHA 3Q3QA 4G0WA 1WQFA 1O27A 1GE9A 2KWAA 1AB4A 2JA7A 4KASA 1DD5A 4KMDA 5EGHA 3FOFA 3GTMA 1B4AA 2R7ZA 1O2AA 4GFQA 3ERED 4P5AA 3GTJA 1ZXOA 2Y3PA 2YU9A 1IS1A 2GSNA 3L4KA 3OEPA 3AH5A 3LPXA 4KB2A 4GTEA 3AQPA 5JVOA 2VUMA 1K83A 4BLBA 1WIHA 3S0XA 3VA7A 3NUHA 3QX3A 2R93A 2PHCB 1ISEA 1F9NA 5TJ3A 3GTKA 4G0UA 5CHPA 1O26A 4C3JC 1EK8A 5CJ9A 2RGRA 5JFEA 2JA6A 3GTQA 2R92A 2RH6A 3L4JA 3FHZA 5IORA 4KARA 4KM9A 4KATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFA A;  3G4A A;  1O25 A;  4GTC A;  4FZB A;  4GTD A;  4GT9 A;  5IOT A;  3N3Y A;  3G4C A;  2CFA B;  4GTB A;  5CHP A;  1O26 A;  1O29 A;  1O27 A;  5JFE A;  1O2B A;  4KAS A;  4P5B A;  5IOS A;  1O28 A;  1KQ4 A;  1O2A A;  4P5A A;  3N0B A;  4GTF A;  4GTA A;  5IOR A;  5IOQ A;  3N0C A;  4GTL A;  4KAR A;  4KAT A;  3AH5 A;  1O24 A;  4GTE A; 
#chains in the Genus database with same CATH topology
 4DDQ A;  4A3J C;  2PA8 D;  4KDD A;  5C4J C;  3PO3 K;  1HQM A;  3H3V L;  5C3E K;  4Q5S A;  3GTK K;  4YG2 A;  1B4B A;  1J6V A;  5M3F K;  2NVT K;  3GTG A;  3S1R K;  4A3B K;  3PO3 C;  3RZD C;  4RMF A;  5C3E C;  4A3K K;  1O2F B;  3BP3 A;  3S15 K;  4OIR A;  5TMF A;  2NVT C;  2WB1 D;  4GTF A;  3S1R C;  1XXB A;  4BXX K;  1TWH K;  2NVQ K;  4A3K C;  4G7Z A;  5M5X K;  2JA5 K;  5FLM K;  4KMA A;  1EI6 A;  1SMY A;  2XCQ A;  1INN A;  2E2J K;  1XZQ A;  4BXX C;  1TWH C;  2NVQ C;  1I3Q K;  4NOI A;  3GTL A;  2FQO A;  4KB4 A;  2V6U A;  1O2B A;  5IYB K;  5FLM C;  2JA5 C;  4P5B A;  2JA8 K;  1Y1W K;  2E2J C;  4M1X A;  4QIW L;  1SFO K;  3GTO A;  5IOQ A;  3N0C A;  5IYB C;  1TWG A;  1O24 A;  3RZO K;  3T01 A;  1RU0 A;  2JA8 C;  3G4A A;  4BY7 K;  1Y1W C;  3BUE A;  3FKI A;  1R9T K;  1SFO C;  1I6H C;  3CQZ A;  4KN7 A;  3RZO C;  4G0W A;  3H3V D;  1R9T C;  1GE9 A;  4KAS A;  4G7O A;  3FOF A;  2R7Z A;  1WOR A;  1ZXO A;  3I4M K;  2GSN A;  3M3Y C;  4Q4Z A;  3TFH A;  4KB2 A;  3AQP A;  4BLB A;  1WIH A;  2ZUE A;  4P9S A;  4YFN A;  3I4M C;  3HOW K;  1BDF A;  3BP8 C;  4A3D K;  1ISE A;  3DXJ A;  5TJ3 A;  4A93 C;  2A68 A;  3GTK A;  3HKZ L;  5M5W K;  3S16 K;  2JA6 K;  3GTQ K;  5CJ9 A;  2RGR A;  3TFJ A;  3HOW C;  2O5J A;  4A3D C;  3WOD A;  3S1Q K;  1WSV A;  1V5V A;  3S16 C;  5IOR A;  2JA6 C;  3GTQ C;  4KAR A;  4AH6 A;  4KAT A;  5IYD K;  1G51 A;  2NVY K;  4QIW D;  1YNJ A;  2XCR B;  5HL8 A;  2E2I A;  4GZY A;  3GDZ A;  4KM8 A;  5IYD C;  2NVY C;  3A8K A;  1I3Q A;  1O29 A;  1F7U A;  1DCO A;  2O5I A;  2P8T A;  1F7V A;  1KQ4 A;  4A3J K;  2GAH C;  3V4G A;  1VRQ C;  4GTA A;  3A8I A;  4LQY A;  5C4J K;  4GTL A;  5M3M K;  3HOX K;  1WCM C;  5C4X K;  4MEY A;  2W7V A;  3HOX C;  4LK1 A;  3RZD K;  1UV7 A;  3S1M K;  5C4X C;  1IW7 A;  1TWC C;  4A3E C;  1TWF K;  2E2H K;  4C3H K;  4OIO A;  3K7A C;  3GSI A;  4KAW X;  3HKZ D;  3S1M C;  2B63 K;  3ADA C;  1TWF C;  3H0G A;  4C3H C;  2FQT A;  2E2H C;  1Y1V K;  1I50 A;  3LAJ A;  3OPF A;  3T02 A;  1TWA K;  2B63 C;  1VGX A;  4GTD A;  2ZFZ A;  4FZB A;  3GTP A;  2CFA B;  4J3N A;  3HOU C;  1XXA A;  3MML B;  1PJ7 A;  1Y1V C;  2NVX A;  1YNN A;  4XLP A;  1F93 A;  1VLO A;  3Q3Q A;  3S1N K;  1TWA C;  1WQF A;  4KN4 A;  2JA7 K;  1O27 A;  3GTM K;  1DD5 A;  5EGH A;  3GTJ K;  5E68 A;  1B4A A;  1O2A A;  4GFQ A;  3ERE D;  2CW0 A;  3S1N C;  2YU9 A;  4AYB L;  2JA7 C;  1I6H K;  3S2D K;  3GTM C;  3GEE A;  2VUM K;  1IBA A;  4X6A K;  3GTJ C;  2Y0S L;  4XLN A;  3HOY C;  3VA7 A;  2R93 K;  5IP9 K;  4KMU A;  4PAB A;  3S2D C;  2A6H A;  1HI9 A;  2VUM C;  4X6A C;  2BE5 A;  4G0U A;  2R93 C;  1O26 A;  1EK8 A;  3M3Y K;  5JFE A;  5IP9 C;  3T00 A;  1BS2 A;  2R92 A;  1IQ0 A;  1VJE A;  3FHZ A;  1JVI A;  5D4D A;  4A93 K;  1O25 A;  3M4O C;  4WIL A;  5M5Y K;  1WQH A;  3S2H K;  1J6X A;  4A3L K;  1BJT A;  1WOO A;  1ZBS A;  1ZVU A;  3GTG C;  3PO2 K;  3AD8 C;  4BLA A;  2PA8 L;  2PMZ L;  3JST A;  3S2H C;  1XZP B;  1DCH A;  3ORE A;  4LLG A;  4BY1 K;  4WJ3 M;  4AYB D;  1TWH A;  1XXC A;  4A3L C;  4C2M K;  1EQR A;  3PO2 C;  4GT9 A;  1ZYR A;  3EQL A;  3HOZ K;  2JA5 A;  2Y0S D;  1WOS A;  4QJV B;  3GTL K;  4BY1 C;  4C2M C;  1JOE A;  3HOZ C;  1WCM K;  2D6F C;  4ILD A;  4FM9 A;  3GTL C;  1Y1W A;  3N0B A;  3AD7 C;  1EFW A;  2XCO A;  1SFO A;  1J6W A;  4QJV A;  3FKI K;  2GSO A;  4G0V A;  3CQZ K;  1TWC K;  4C45 A;  4A3E K;  1R9T A;  1USO A;  3G4C A;  3K7A K;  4Y52 C;  3GIR A;  5FJ8 K;  5IYC K;  4XSZ A;  5EGE A;  3FKI C;  3CQZ C;  1IE0 A;  2GAG C;  2R7Z K;  4KMD A;  3IPJ A;  3HOV K;  1YX2 A;  5C44 K;  4P5A A;  5IYC C;  1JQW A;  1IS1 A;  3TTG A;  4OIP A;  3OEP A;  3AH5 A;  3HOU K;  2WAQ L;  2R7Z C;  4GTE A;  3HOV C;  2PMZ D;  5C44 C;  4OIQ A;  4C3J K;  3NUH A;  3QX3 A;  2A69 A;  3A8J A;  4G7H A;  1F9N A;  4YFK A;  5CHP A;  4ZH4 A;  4C3J C;  2JA6 A;  3GTQ A;  4XSX A;  1XZQ B;  4OIN A;  3TFI A;  4PAA A;  1I6V A;  4A3I K;  2A6E A;  1VH2 A;  3L4J A;  3GTK C;  3AD9 C;  3HOY K;  3S17 K;  4A3B C;  3I4N K;  4Y7N K;  4A3M K;  2CFA A;  1K83 K;  3S15 C;  4LK0 A;  4A3I C;  4LOW A;  2NVY A;  2E2I K;  1EH1 A;  5IOT A;  3S17 C;  3I4N C;  4Y7N C;  4A3M C;  2V6T A;  1K83 C;  2E2I C;  4O2D A;  2PPB A;  1WQG A;  4BKW A;  1O28 A;  1WCM A;  1I3Q C;  5L46 A;  3M4O K;  2GSU A;  1IL2 A;  4A3F K;  4KC6 A;  3SZY A;  4BBS K;  1BGW A;  1WOP A;  4GTC A;  4C3I K;  1TWC A;  2WAQ D;  4LJZ A;  3CAG A;  4GTB A;  4A3F C;  4BY7 C;  2JH3 A;  4BBS C;  3GTG K;  1C0A A;  4C3I C;  1L0W A;  4BBR K;  1WSR A;  1TWF A;  2E2H A;  5IOS A;  4YFX A;  2P5M A;  4A3C K;  3SZZ A;  1YCL A;  3FOE A;  3GEH A;  3H0G K;  4A3G K;  2B63 A;  1I50 K;  4BBR C;  1Y1V A;  4XCH A;  4A3C C;  3AQO A;  3HXA A;  3LAP A;  1TWA A;  3GTP K;  3H0G C;  4A3G C;  3N3Y A;  2NVX K;  1I50 C;  4LR2 A;  1PJ6 A;  5IP7 K;  4KMH A;  2KWA A;  3GTP C;  1AB4 A;  3GEI A;  2JA7 A;  2NVX C;  2WB1 L;  3GTM A;  1XZP A;  3GTJ A;  2YU9 K;  2Y3P A;  5IP7 C;  3GTO K;  1X31 C;  1TWG K;  3L4K A;  4Y52 K;  3LPX A;  5JVO A;  3S14 K;  2VUM A;  1USM A;  1K83 A;  3S1Q C;  3S0X A;  1PJ5 A;  2YU9 C;  2R93 A;  3GTO C;  2EBB A;  4JK1 A;  2PHC B;  1TWG C;  1XPP A;  3S14 C;  4WJ4 A;  1DCP A;  2R92 K;  1ZQ1 C;  2V6S A;  2ZUF A;  2RH6 A;  1J98 A;  4KM9 A;  4MQ9 A;  5TMC A;  2R92 C;  4MEX A; 
#chains in the Genus database with same CATH homology
 2CFA A;  4DDQ A;  2XCR B;  2NVY A;  1O25 A;  1EH1 A;  4KDD A;  5IOT A;  2E2I A;  4KM8 A;  1B4B A;  1I3Q A;  1WQH A;  3GTG A;  1O29 A;  1WQG A;  4BKW A;  1O28 A;  1WCM A;  1KQ4 A;  1BJT A;  1ZBS A;  1ZVU A;  4GTF A;  4GTA A;  3V4G A;  4BLA A;  4LQY A;  2GSU A;  4GTL A;  1XXB A;  3ORE A;  4KC6 A;  1TWH A;  1XXC A;  1BGW A;  4GTC A;  4GT9 A;  1TWC A;  4KMA A;  3CAG A;  2JA5 A;  2XCQ A;  4GTB A;  2JH3 A;  3GTL A;  4KB4 A;  4C2M C;  4C3I C;  1O2B A;  1TWF A;  4P5B A;  2E2H A;  4KAW X;  5IOS A;  4ILD A;  2P5M A;  4FM9 A;  4M1X A;  1Y1W A;  3N0B A;  3FOE A;  3GTO A;  2XCO A;  5IOQ A;  1SFO A;  2B63 A;  3N0C A;  3H0G A;  4C3H C;  1TWG A;  1O24 A;  1I50 A;  3LAJ A;  1Y1V A;  3G4A A;  3OPF A;  3BUE A;  3AQO A;  2GSO A;  3FKI A;  4G0V A;  3LAP A;  1TWA A;  4GTD A;  2ZFZ A;  4FZB A;  1R9T A;  3N3Y A;  3CQZ A;  3G4C A;  3GTP A;  2CFA B;  4J3N A;  1XXA A;  3MML B;  2NVX A;  4LR2 A;  5EGE A;  4KMH A;  3Q3Q A;  4G0W A;  1WQF A;  1O27 A;  1GE9 A;  2KWA A;  1AB4 A;  2JA7 A;  4KAS A;  1DD5 A;  4KMD A;  5EGH A;  3FOF A;  3GTM A;  1B4A A;  2R7Z A;  1O2A A;  4GFQ A;  3ERE D;  4P5A A;  3GTJ A;  1ZXO A;  2Y3P A;  2YU9 A;  1IS1 A;  2GSN A;  3L4K A;  3OEP A;  3AH5 A;  3LPX A;  4KB2 A;  4GTE A;  3AQP A;  5JVO A;  2VUM A;  1K83 A;  4BLB A;  1WIH A;  3S0X A;  3VA7 A;  3NUH A;  3QX3 A;  2R93 A;  2PHC B;  1ISE A;  1F9N A;  5TJ3 A;  3GTK A;  4G0U A;  5CHP A;  1O26 A;  4C3J C;  1EK8 A;  5CJ9 A;  2RGR A;  5JFE A;  2JA6 A;  3GTQ A;  2R92 A;  2RH6 A;  3L4J A;  3FHZ A;  5IOR A;  4KAR A;  4KM9 A;  4KAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...