5JFEA

Flavin-dependent thymidylate synthase with h2-dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluating H2-dUMP as an Intermediate in the oxidation of Flavin-dependent Thymidylate Synthase
rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Transferase
molecule keywords Thymidylate synthase ThyX
total genus 80
structure length 213
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jfeA00
4P5BA 1O2AA 3G4CA 5IOSA 4GTDA 4GTAA 2CFAA 5JFEA 1O26A 4GTLA 3N0BA 4GTFA 4KARA 4GTBA 3G4AA 1KQ4A 3N3YA 2CFAB 1O24A 5IOTA 1O25A 4KATA 4FZBA 4P5AA 1O29A 4KASA 4GTCA 3N0CA 5CHPA 5IOQA 1O27A 3AH5A 1O2BA 1O28A 4GT9A 5IORA 4GTEA
chains in the Genus database with same CATH superfamily
2RH6A 4A3JC 5TMFA 1J6VA 2XCQA 5L46A 2B63K 3GTOK 4BY1C 4A93C 3GTGC 4A3JK 3PO3C 4A3KC 2R93A 3GTPC 1BS2A 1WSVA 4C2MK 1O24A 2PHCB 4KATA 1HI9A 2WAQL 4PABA 4YFNA 1ISEA 3TFJA 4GT9A 2A68A 5CJ9A 3GTQK 4ZH4A 1I50K 1WCMA 2NVQK 4O2DA 2A69A 3G4AA 4A3EC 4LR2A 4XLNA 2NVXA 3HOUC 1I3QK 5C4JK 1G51A 1TWFA 3S1MC 4LK1A 4BBSC 2E2JK 4BY7K 3GTMC 1ZBSA 2NVTK 3GTGA 3SZZA 2NVYA 2GSOA 1IQ0A 1B4BA 1YCLA 3ADAC 1J6WA 1TWAC 2R93K 4NOIA 3HOXK 4KB2A 4FM9A 3GIRA 2A6EA 3S14C 5IYCK 1TWHA 3RZDK 4A3CC 1O25A 4DDQA 4J3NA 2V6SA 3LAPA 1JOEA 1K83C 4G0WA 3S1NC 5IP7K 1WQFA 4P9SA 3GTKC 5EGEA 3AD9C 3PO2C 1V5VA 1IBAA 2BE5A 3HKZL 4C3IC 1O2FB 5E68A 1O26A 1J6XA 2E2JC 4BY7C 4XLPA 4ILDA 2WAQD 1USOA 4C3JK 4KDDA 2XCRB 3S17C 4KN7A 5FLMC 3HOVK 1SFOA 1I3QA 3HOWK 4P5AA 4GTCA 1K83A 3CQZC 4OINA 3HOYK 2O5IA 4A3BK 3JSTA 4A3FK 5C44C 1WOOA 3HXAA 1O2AA 4GTAA 3S17K 1AB4A 2GSNA 2NVYK 5JVOA 1PJ7A 1TWAK 3N3YA 2D6FC 4A93K 4MQ9A 4XSZA 3GTLC 2ZUFA 3MMLB 1TWCC 3H3VL 1RU0A 1WSRA 1I3QC 4MEXA 3AH5A 1O2BA 4GTEA 3GTOC 4BBSK 3RZOC 5IYCC 1TWFK 3HOYC 2P5MA 4OIRA 4A3MC 4A3LK 4KAWX 3N0BA 2E2IA 1Y1VA 2FQOA 2PMZL 2R93C 1WQHA 3GTQA 1BGWA 3V4GA 3HOXC 2W7VA 3GTKA 1XZPA 1PJ6A 2JA6C 1VGXA 1XXAA 3VA7A 3S2HC 4FZBA 2GSUA 1GE9A 2RGRA 4YG2A 5IOQA 3S15K 3OREA 4G0UA 2JA6K 1BJTA 2V6TA 1DCHA 4A3DK 4WILA 5FJ8K 3GTMK 2B63A 4A3IC 4OIOA 5IP7C 4GZYA 1IL2A 1VRQC 3GTPK 1R9TA 3FHZA 2PPBA 2KWAA 4C3HK 1USMA 1JVIA 5IP9K 3GTQC 2CFAB 4QJVB 2JA6A 3HOZK 3AD8C 2R92A 2Y3PA 4KASA 3GTMA 4AYBL 3ERED 4XCHA 3BUEA 4X6AC 5EGHA 2ZUEA 3TTGA 1SMYA 3OEPA 5M5WK 2R7ZC 4PAAA 3PO3K 5IOSA 1ZYRA 3GTKK 1IW7A 4LQYA 1VLOA 1XPPA 3LAJA 2NVTC 1TWFC 3FOEA 1IS1A 4KN4A 3L4KA 2PA8L 3S16C 2EBBA 4XSXA 4A3IK 3CAGA 1YNJA 5IYDC 2R92C 1EFWA 1I50C 3SZYA 2NVQC 3S1QC 5IYBK 3HOWC 2JA5A 4G7ZA 1TWAA 5C3EC 4P5BA 3S1RC 4GTDA 2CFAA 3EQLA 3S2HK 3TFHA 3PO2K 2WB1L 3K7AC 1XXCA 2A6HA 3AD7C 4MEYA 3S1QK 4A3BC 1TWGC 5TJ3A 4G0VA 4YFKA 3RZOK 1I6VA 1UV7A 3CQZA 3A8IA 1ZXOA 4KM8A 2JH3A 1DCPA 3S16K 2B63C 1F7UA 3T01A 3H3VD 1WCMK 1I50A 3H0GC 4AH6A 1XZPB 3M4OK 3GTPA 5C4XC 3S15C 1VJEA 1Y1VC 1EK8A 1JQWA 5JFEA 1TWCA 1YNNA 4A3DC 4BBRC 1TWCK 5M5YK 2YU9C 4G7OA 3T00A 1HQMA 2VUMC 3A8JA 4BY1K 1I6HC 4QJVA 3GTJC 4WJ3M 5C3EK 1EQRA 3H0GK 3GDZA 1L0WA 2E2HC 3HOZC 2Y0SD 1EH1A 1DD5A 1YX2A 3GTOA 3WODA 2FQTA 4C3HC 3CQZK 3HOUK 4BXXC 1Y1WK 2XCOA 1TWHK 3FOFA 4RMFA 5M5XK 4KC6A 3AQOA 4GFQA 5TMCA 5M3FK 1WQGA 3AQPA 1WCMC 1DCOA 1O27A 3GEEA 2JA7K 4LOWA 2Y0SL 4BXXK 1Y1WA 2O5JA 1SFOC 3GEIA 4A3EK 3GTGK 1K83K 4A3KK 2E2IK 2NVXC 1ZVUA 1R9TC 3T02A 5D4DA 4QIWD 2CW0A 3HOVC 1WOSA 4GTBA 1B4AA 4G7HA 3S2DK 3FKIA 4KMHA 1BDFA 4OIQA 1X31C 3S14K 1SFOK 2WB1D 4KMDA 5HL8A 4WJ4A 3I4MC 2JA8K 3GTLK 4AYBD 1TWHC 4KMUA 3NUHA 2ZFZA 2NVYC 1J98A 2GAHC 3S1NK 3S2DC 3I4NK 3OPFA 4GTLA 4GTFA 3S0XA 3BP8C 4LLGA 2V6UA 5IYDK 4QIWL 2PA8D 1EI6A 4JK1A 1XXBA 5CHPA 4C3JC 3GTLA 3I4NC 1O28A 3GSIA 5IORA 4X6AK 3LPXA 4A3GK 3G4CA 2JA5K 3GEHA 4Q5SA 2YU9A 2VUMK 1C0AA 4A3FC 1WIHA 5C4XK 1F93A 1Y1VK 1Y1WC 1PJ5A 4YFXA 1O29A 3A8KA 5IP9C 3RZDC 5M3MK 4A3CK 2NVXK 3M3YK 1TWGK 3L4JA 1I6HK 1F7VA 2JA7A 3BP3A 2YU9K 2VUMA 3FKIC 3IPJA 3I4MK 4KM9A 4KARA 1VH2A 2GAGC 4Y52K 4OIPA 3QX3A 4A3GC 3M4OC 1F9NA 3S1RK 2JA5C 2R92K 1TWGA 4A3MK 4A3LC 4LJZA 3DXJA 5IOTA 3M3YC 5IYBC 4KMAA 5C44K 2PMZD 4BKWA 3N0CA 5C4JC 4LK0A 2E2IC 1R9TK 3Q3QA 3S1MK 1XZQB 4BLAA 2JA7C 4Y7NK 3K7AK 2E2HK 5FLMK 3TFIA 2P8TA 1WOPA 3H0GA 4M1XA 3GTJK 1KQ4A 4C3IK 2JA8C 4KB4A 2R7ZA 4BLBA 4BBRK 4Y52C 2R7ZK 1IE0A 1XZQA 3HKZD 4Q4ZA 1INNA 2E2HA 3FKIK 4Y7NC 4C2MC 1WORA 3GTJA 4C45A 1ZQ1C
chains in the Genus database with same CATH topology
4P5BA 1O2AA 2RH6A 4GTDA 4GTAA 2CFAA 2XCQA 1AB4A 3OPFA 4GTLA 2GSNA 4GTFA 3S0XA 5JVOA 3N3YA 2R93A 1XXCA 1O24A 2PHCB 4KATA 3MMLB 5TJ3A 4G0VA 1XXBA 3CQZA 5CHPA 4C3JC 3GTLA 1ZXOA 1ISEA 4KM8A 2JH3A 3AH5A 1O2BA 1O28A 4GT9A 5IORA 4GTEA 1I50A 3LPXA 3GTPA 3G4CA 5CJ9A 2P5MA 2YU9A 1WCMA 1EK8A 5JFEA 1TWCA 4KAWX 3N0BA 2E2IA 3G4AA 4LR2A 1Y1VA 2NVXA 1WIHA 1WQHA 3GTQA 1BGWA 3V4GA 3GTKA 1TWFA 1XXAA 3VA7A 4FZBA 2GSUA 1O29A 1ZBSA 1GE9A 2RGRA 3GTGA 5IOQA 3OREA 4G0UA 1BJTA 2NVYA 1EH1A 1DD5A 2GSOA 3L4JA 3GTOA 2JA7A 1B4BA 2B63A 4C3HC 2VUMA 1R9TA 2XCOA 4KB2A 4FM9A 4KM9A 3FHZA 4KARA 3FOFA 2KWAA 3QX3A 4KC6A 1F9NA 1TWHA 2CFAB 3AQOA 1TWGA 2JA6A 5IOTA 4GFQA 1O25A 2R92A 4DDQA 2Y3PA 4J3NA 4KASA 4KMAA 3GTMA 1WQGA 3AQPA 4BKWA 3ERED 3BUEA 3LAPA 3N0CA 5EGHA 1O27A 4G0WA 1WQFA 1Y1WA 3OEPA 3Q3QA 5EGEA 4BLAA 5IOSA 1ZVUA 4C3IC 1O26A 4LQYA 3H0GA 4GTBA 4M1XA 3LAJA 1KQ4A 1B4AA 4ILDA 3FOEA 1IS1A 3FKIA 4KDDA 4KMHA 2XCRB 3L4KA 4KB4A 1SFOA 4BLBA 2R7ZA 1I3QA 4P5AA 4GTCA 4KMDA 2E2HA 3CAGA 1K83A 4C2MC 3GTJA 2JA5A 3NUHA 1TWAA 2ZFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P5B A;  1O2A A;  3G4C A;  5IOS A;  4GTD A;  4GTA A;  2CFA A;  5JFE A;  1O26 A;  4GTL A;  3N0B A;  4GTF A;  4KAR A;  4GTB A;  3G4A A;  1KQ4 A;  3N3Y A;  2CFA B;  1O24 A;  5IOT A;  1O25 A;  4KAT A;  4FZB A;  4P5A A;  1O29 A;  4KAS A;  4GTC A;  3N0C A;  5CHP A;  5IOQ A;  1O27 A;  3AH5 A;  1O2B A;  1O28 A;  4GT9 A;  5IOR A;  4GTE A; 
#chains in the Genus database with same CATH topology
 2RH6 A;  4A3J C;  5TMF A;  1J6V A;  2XCQ A;  5L46 A;  2B63 K;  3GTO K;  4BY1 C;  4A93 C;  3GTG C;  4A3J K;  3PO3 C;  4A3K C;  2R93 A;  3GTP C;  1BS2 A;  1WSV A;  4C2M K;  1O24 A;  2PHC B;  4KAT A;  1HI9 A;  2WAQ L;  4PAB A;  4YFN A;  1ISE A;  3TFJ A;  4GT9 A;  2A68 A;  5CJ9 A;  3GTQ K;  4ZH4 A;  1I50 K;  1WCM A;  2NVQ K;  4O2D A;  2A69 A;  3G4A A;  4A3E C;  4LR2 A;  4XLN A;  2NVX A;  3HOU C;  1I3Q K;  5C4J K;  1G51 A;  1TWF A;  3S1M C;  4LK1 A;  4BBS C;  2E2J K;  4BY7 K;  3GTM C;  1ZBS A;  2NVT K;  3GTG A;  3SZZ A;  2NVY A;  2GSO A;  1IQ0 A;  1B4B A;  1YCL A;  3ADA C;  1J6W A;  1TWA C;  2R93 K;  4NOI A;  3HOX K;  4KB2 A;  4FM9 A;  3GIR A;  2A6E A;  3S14 C;  5IYC K;  1TWH A;  3RZD K;  4A3C C;  1O25 A;  4DDQ A;  4J3N A;  2V6S A;  3LAP A;  1JOE A;  1K83 C;  4G0W A;  3S1N C;  5IP7 K;  1WQF A;  4P9S A;  3GTK C;  5EGE A;  3AD9 C;  3PO2 C;  1V5V A;  1IBA A;  2BE5 A;  3HKZ L;  4C3I C;  1O2F B;  5E68 A;  1O26 A;  1J6X A;  2E2J C;  4BY7 C;  4XLP A;  4ILD A;  2WAQ D;  1USO A;  4C3J K;  4KDD A;  2XCR B;  3S17 C;  4KN7 A;  5FLM C;  3HOV K;  1SFO A;  1I3Q A;  3HOW K;  4P5A A;  4GTC A;  1K83 A;  3CQZ C;  4OIN A;  3HOY K;  2O5I A;  4A3B K;  3JST A;  4A3F K;  5C44 C;  1WOO A;  3HXA A;  1O2A A;  4GTA A;  3S17 K;  1AB4 A;  2GSN A;  2NVY K;  5JVO A;  1PJ7 A;  1TWA K;  3N3Y A;  2D6F C;  4A93 K;  4MQ9 A;  4XSZ A;  3GTL C;  2ZUF A;  3MML B;  1TWC C;  3H3V L;  1RU0 A;  1WSR A;  1I3Q C;  4MEX A;  3AH5 A;  1O2B A;  4GTE A;  3GTO C;  4BBS K;  3RZO C;  5IYC C;  1TWF K;  3HOY C;  2P5M A;  4OIR A;  4A3M C;  4A3L K;  4KAW X;  3N0B A;  2E2I A;  1Y1V A;  2FQO A;  2PMZ L;  2R93 C;  1WQH A;  3GTQ A;  1BGW A;  3V4G A;  3HOX C;  2W7V A;  3GTK A;  1XZP A;  1PJ6 A;  2JA6 C;  1VGX A;  1XXA A;  3VA7 A;  3S2H C;  4FZB A;  2GSU A;  1GE9 A;  2RGR A;  4YG2 A;  5IOQ A;  3S15 K;  3ORE A;  4G0U A;  2JA6 K;  1BJT A;  2V6T A;  1DCH A;  4A3D K;  4WIL A;  5FJ8 K;  3GTM K;  2B63 A;  4A3I C;  4OIO A;  5IP7 C;  4GZY A;  1IL2 A;  1VRQ C;  3GTP K;  1R9T A;  3FHZ A;  2PPB A;  2KWA A;  4C3H K;  1USM A;  1JVI A;  5IP9 K;  3GTQ C;  2CFA B;  4QJV B;  2JA6 A;  3HOZ K;  3AD8 C;  2R92 A;  2Y3P A;  4KAS A;  3GTM A;  4AYB L;  3ERE D;  4XCH A;  3BUE A;  4X6A C;  5EGH A;  2ZUE A;  3TTG A;  1SMY A;  3OEP A;  5M5W K;  2R7Z C;  4PAA A;  3PO3 K;  5IOS A;  1ZYR A;  3GTK K;  1IW7 A;  4LQY A;  1VLO A;  1XPP A;  3LAJ A;  2NVT C;  1TWF C;  3FOE A;  1IS1 A;  4KN4 A;  3L4K A;  2PA8 L;  3S16 C;  2EBB A;  4XSX A;  4A3I K;  3CAG A;  1YNJ A;  5IYD C;  2R92 C;  1EFW A;  1I50 C;  3SZY A;  2NVQ C;  3S1Q C;  5IYB K;  3HOW C;  2JA5 A;  4G7Z A;  1TWA A;  5C3E C;  4P5B A;  3S1R C;  4GTD A;  2CFA A;  3EQL A;  3S2H K;  3TFH A;  3PO2 K;  2WB1 L;  3K7A C;  1XXC A;  2A6H A;  3AD7 C;  4MEY A;  3S1Q K;  4A3B C;  1TWG C;  5TJ3 A;  4G0V A;  4YFK A;  3RZO K;  1I6V A;  1UV7 A;  3CQZ A;  3A8I A;  1ZXO A;  4KM8 A;  2JH3 A;  1DCP A;  3S16 K;  2B63 C;  1F7U A;  3T01 A;  3H3V D;  1WCM K;  1I50 A;  3H0G C;  4AH6 A;  1XZP B;  3M4O K;  3GTP A;  5C4X C;  3S15 C;  1VJE A;  1Y1V C;  1EK8 A;  1JQW A;  5JFE A;  1TWC A;  1YNN A;  4A3D C;  4BBR C;  1TWC K;  5M5Y K;  2YU9 C;  4G7O A;  3T00 A;  1HQM A;  2VUM C;  3A8J A;  4BY1 K;  1I6H C;  4QJV A;  3GTJ C;  4WJ3 M;  5C3E K;  1EQR A;  3H0G K;  3GDZ A;  1L0W A;  2E2H C;  3HOZ C;  2Y0S D;  1EH1 A;  1DD5 A;  1YX2 A;  3GTO A;  3WOD A;  2FQT A;  4C3H C;  3CQZ K;  3HOU K;  4BXX C;  1Y1W K;  2XCO A;  1TWH K;  3FOF A;  4RMF A;  5M5X K;  4KC6 A;  3AQO A;  4GFQ A;  5TMC A;  5M3F K;  1WQG A;  3AQP A;  1WCM C;  1DCO A;  1O27 A;  3GEE A;  2JA7 K;  4LOW A;  2Y0S L;  4BXX K;  1Y1W A;  2O5J A;  1SFO C;  3GEI A;  4A3E K;  3GTG K;  1K83 K;  4A3K K;  2E2I K;  2NVX C;  1ZVU A;  1R9T C;  3T02 A;  5D4D A;  4QIW D;  2CW0 A;  3HOV C;  1WOS A;  4GTB A;  1B4A A;  4G7H A;  3S2D K;  3FKI A;  4KMH A;  1BDF A;  4OIQ A;  1X31 C;  3S14 K;  1SFO K;  2WB1 D;  4KMD A;  5HL8 A;  4WJ4 A;  3I4M C;  2JA8 K;  3GTL K;  4AYB D;  1TWH C;  4KMU A;  3NUH A;  2ZFZ A;  2NVY C;  1J98 A;  2GAH C;  3S1N K;  3S2D C;  3I4N K;  3OPF A;  4GTL A;  4GTF A;  3S0X A;  3BP8 C;  4LLG A;  2V6U A;  5IYD K;  4QIW L;  2PA8 D;  1EI6 A;  4JK1 A;  1XXB A;  5CHP A;  4C3J C;  3GTL A;  3I4N C;  1O28 A;  3GSI A;  5IOR A;  4X6A K;  3LPX A;  4A3G K;  3G4C A;  2JA5 K;  3GEH A;  4Q5S A;  2YU9 A;  2VUM K;  1C0A A;  4A3F C;  1WIH A;  5C4X K;  1F93 A;  1Y1V K;  1Y1W C;  1PJ5 A;  4YFX A;  1O29 A;  3A8K A;  5IP9 C;  3RZD C;  5M3M K;  4A3C K;  2NVX K;  3M3Y K;  1TWG K;  3L4J A;  1I6H K;  1F7V A;  2JA7 A;  3BP3 A;  2YU9 K;  2VUM A;  3FKI C;  3IPJ A;  3I4M K;  4KM9 A;  4KAR A;  1VH2 A;  2GAG C;  4Y52 K;  4OIP A;  3QX3 A;  4A3G C;  3M4O C;  1F9N A;  3S1R K;  2JA5 C;  2R92 K;  1TWG A;  4A3M K;  4A3L C;  4LJZ A;  3DXJ A;  5IOT A;  3M3Y C;  5IYB C;  4KMA A;  5C44 K;  2PMZ D;  4BKW A;  3N0C A;  5C4J C;  4LK0 A;  2E2I C;  1R9T K;  3Q3Q A;  3S1M K;  1XZQ B;  4BLA A;  2JA7 C;  4Y7N K;  3K7A K;  2E2H K;  5FLM K;  3TFI A;  2P8T A;  1WOP A;  3H0G A;  4M1X A;  3GTJ K;  1KQ4 A;  4C3I K;  2JA8 C;  4KB4 A;  2R7Z A;  4BLB A;  4BBR K;  4Y52 C;  2R7Z K;  1IE0 A;  1XZQ A;  3HKZ D;  4Q4Z A;  1INN A;  2E2H A;  3FKI K;  4Y7N C;  4C2M C;  1WOR A;  3GTJ A;  4C45 A;  1ZQ1 C; 
#chains in the Genus database with same CATH homology
 4P5B A;  1O2A A;  2RH6 A;  4GTD A;  4GTA A;  2CFA A;  2XCQ A;  1AB4 A;  3OPF A;  4GTL A;  2GSN A;  4GTF A;  3S0X A;  5JVO A;  3N3Y A;  2R93 A;  1XXC A;  1O24 A;  2PHC B;  4KAT A;  3MML B;  5TJ3 A;  4G0V A;  1XXB A;  3CQZ A;  5CHP A;  4C3J C;  3GTL A;  1ZXO A;  1ISE A;  4KM8 A;  2JH3 A;  3AH5 A;  1O2B A;  1O28 A;  4GT9 A;  5IOR A;  4GTE A;  1I50 A;  3LPX A;  3GTP A;  3G4C A;  5CJ9 A;  2P5M A;  2YU9 A;  1WCM A;  1EK8 A;  5JFE A;  1TWC A;  4KAW X;  3N0B A;  2E2I A;  3G4A A;  4LR2 A;  1Y1V A;  2NVX A;  1WIH A;  1WQH A;  3GTQ A;  1BGW A;  3V4G A;  3GTK A;  1TWF A;  1XXA A;  3VA7 A;  4FZB A;  2GSU A;  1O29 A;  1ZBS A;  1GE9 A;  2RGR A;  3GTG A;  5IOQ A;  3ORE A;  4G0U A;  1BJT A;  2NVY A;  1EH1 A;  1DD5 A;  2GSO A;  3L4J A;  3GTO A;  2JA7 A;  1B4B A;  2B63 A;  4C3H C;  2VUM A;  1R9T A;  2XCO A;  4KB2 A;  4FM9 A;  4KM9 A;  3FHZ A;  4KAR A;  3FOF A;  2KWA A;  3QX3 A;  4KC6 A;  1F9N A;  1TWH A;  2CFA B;  3AQO A;  1TWG A;  2JA6 A;  5IOT A;  4GFQ A;  1O25 A;  2R92 A;  4DDQ A;  2Y3P A;  4J3N A;  4KAS A;  4KMA A;  3GTM A;  1WQG A;  3AQP A;  4BKW A;  3ERE D;  3BUE A;  3LAP A;  3N0C A;  5EGH A;  1O27 A;  4G0W A;  1WQF A;  1Y1W A;  3OEP A;  3Q3Q A;  5EGE A;  4BLA A;  5IOS A;  1ZVU A;  4C3I C;  1O26 A;  4LQY A;  3H0G A;  4GTB A;  4M1X A;  3LAJ A;  1KQ4 A;  1B4A A;  4ILD A;  3FOE A;  1IS1 A;  3FKI A;  4KDD A;  4KMH A;  2XCR B;  3L4K A;  4KB4 A;  1SFO A;  4BLB A;  2R7Z A;  1I3Q A;  4P5A A;  4GTC A;  4KMD A;  2E2H A;  3CAG A;  1K83 A;  4C2M C;  3GTJ A;  2JA5 A;  3NUH A;  1TWA A;  2ZFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...