5JFEA

Flavin-dependent thymidylate synthase with h2-dump
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
217
structure length
213
Chain Sequence
b'HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRFFWTVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase ThyX
molecule tags Transferase
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
publication title Evaluating H2-dUMP as an Intermediate in the oxidation of Flavin-dependent Thymidylate Synthase
rcsb
total genus 80
structure length 213
sequence length 217
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 5jfeA00
4GTBA 3N0CA 3G4AA 3N0BA 1O24A 1O28A 4KATA 5IORA 5IOTA 4GTEA 5IOSA 1O29A 4P5BA 4KARA 3AH5A 4FZBA 5CHPA 4GTDA 4GTCA 4KASA 4GTLA 1O25A 3N3YA 5JFEA 1O2AA 1O27A 3G4CA 1O2BA 4GTFA 4P5AA 5IOQA 4GT9A 2CFAA 1KQ4A 2CFAB 4GTAA 1O26A
chains in the Genus database with same CATH superfamily
3S1RK 4GZYA 1J6XA 4MQ9A 1R9TA 1WQFA 1I3QC 4ILDA 3GTJA 1IE0A 1XXCA 3A8JA 3N0CA 3S17C 1O24A 2GSNA 3A8IA 3FHZA 2E2HA 4KDDA 2VUMC 3RZOK 1K83K 4KARA 4XSZA 5IYBK 5IYDC 3WODA 5CHPA 3H0GC 5JFEA 1TWCK 5E68A 4G0WA 4A3EC 4MEYA 1O2FB 2JA8C 2P5MA 2JA6A 3S1QK 2E2IC 2V6TA 4O2DA 2A68A 3BP3A 2RGRA 5C4JK 1WSRA 4LR2A 1K83A 3GTLC 5IYDK 1F7UA 1DCPA 2V6SA 1SFOK 1PJ5A 1IW7A 2JA5C 4QIWL 3HOUC 1XPPA 3FKIC 2E2IK 3S0XA 1BGWA 1Y1VC 1WIHA 1TWFK 5IP9K 4J3NA 3GTMC 3AQPA 4Q4ZA 3ERED 4BY7K 1VGXA 3OPFA 4QJVA 1J6VA 2Y0SD 3S1MK 1I50K 4AH6A 3GTQK 4X6AC 2VUMK 3FKIA 3FOEA 1TWFC 2E2IA 3SZZA 3GTGK 4A3DK 4YFXA 3QX3A 4GFQA 3I4MK 1L0WA 1I3QA 3TFIA 3S1QC 1IQ0A 3S14K 3BUEA 1F9NA 2PA8L 3V4GA 2VUMA 5C4JC 3GTLK 1PJ7A 4LLGA 3CQZC 2V6UA 3S2HC 1EH1A 2XCOA 4KN7A 2JA6K 1O28A 4OIRA 3GTKA 4C3JC 1WCMC 3HKZD 2W7VA 3GTQA 4A93C 4KMDA 3PO2K 5C3EK 2E2JC 4Y52C 2JA7K 1IL2A 3GTOA 1I6VA 5IP9C 1J98A 4DDQA 3GTPA 2RH6A 1O26A 3GEEA 5IP7K 3TFHA 1WSVA 4YFNA 1V5VA 1TWGA 4NOIA 2YU9A 2NVTK 1WORA 1PJ6A 4P5BA 2E2JK 1I50A 5C44K 3GTOK 2JA7A 1TWHC 4GTCA 1Y1WC 5IYBC 4XLPA 3HOZC 1AB4A 1HQMA 5TJ3A 1O2BA 2Y3PA 4GT9A 1R9TC 1Y1VK 2P8TA 3GTGA 5FLMC 4A3FC 2Y0SL 3OREA 3S2HK 5EGHA 4A3CK 5TMCA 3CQZK 1TWHK 3S15K 3S2DK 5L46A 1EQRA 1XZQA 5IOSA 4A3JK 3GEIA 5C3EC 1ZBSA 3EQLA 3NUHA 4AYBD 4GTLA 2B63C 1UV7A 2NVXA 2PA8D 4WILA 4KMAA 4A3KK 3TFJA 4LOWA 2WAQD 2R92K 4A3LK 4XCHA 2PMZD 2D6FC 5C4XK 5FJ8K 2R7ZA 1F7VA 2GSOA 3HKZL 2GAHC 3G4AA 4BLBA 3I4NC 3DXJA 1F93A 2WAQL 1JVIA 2A69A 3CQZA 2O5JA 3L4KA 2A6EA 5EGEA 5M5XK 2B63K 1Y1VA 2O5IA 2WB1D 4KASA 5FLMK 4A3FK 4P5AA 1I6HK 3TTGA 1WOPA 3T02A 3I4NK 2WB1L 4BLAA 3S1NK 3S2DC 2NVYC 4G0VA 3L4JA 1TWFA 3RZDC 5M5YK 3RZOC 3S16C 4Y7NK 4KATA 2ZFZA 3LAJA 2JA6C 1XZPA 4A3GK 3AH5A 1Y1WK 1J6WA 3S1MC 4A3IK 3GSIA 4QJVB 3S1NC 3SZYA 4BXXK 2R7ZK 1TWHA 4A3BC 3LAPA 3MMLB 3I4MC 4A3CC 5IP7C 3GTGC 4A3DC 2R93A 1DCOA 1EFWA 4AYBL 2PPBA 3K7AK 3H0GK 3T00A 1BS2A 3M4OK 2ZUFA 5M3MK 3GTMK 1XXAA 3G4CA 4KMHA 1IBAA 2CFAA 4A3KC 3AD7C 1WOOA 4KAWX 2CFAB 2R93K 2YU9C 4XSXA 3M4OC 3HOXK 2XCQA 3HOYK 1SFOC 4WJ3M 1YNJA 2PMZL 3H3VL 1XXBA 4Y52K 4A3IC 3S15C 4PAAA 3HOVK 2JH3A 2YU9K 3PO3K 1TWGC 1O2AA 1TWAC 1JOEA 2R93C 4BBSC 4YG2A 3T01A 3GTKC 1ISEA 3GTJK 1WOSA 1VJEA 4KB4A 4BY1K 3BP8C 3GTQC 1TWCC 4LQYA 4GTBA 2E2HK 4Q5SA 3GIRA 2NVYK 3AD9C 2JA5A 3N0BA 3K7AC 2EBBA 4PABA 5IORA 1GE9A 3A8KA 1O29A 3GTPC 1TWAK 5TMFA 3IPJA 4KB2A 3AQOA 3FKIK 4G7HA 4GTFA 4ZH4A 4A3BK 2R7ZC 1YNNA 1ZXOA 1YCLA 3HOXC 2NVQK 4BBRC 4KMUA 1JQWA 5CJ9A 1TWAA 1ZYRA 3H0GA 2NVXC 1VLOA 4JK1A 5IOTA 2NVTC 1WCMK 4Y7NC 3GTMA 3HOZK 5JVOA 4X6AK 3PO3C 1TWGK 1WQHA 1DCHA 5C4XC 3HOVC 4QIWD 1O25A 3LPXA 4KC6A 3JSTA 4OIOA 2JA5K 3HOUK 1C0AA 2JA7C 1KQ4A 1SMYA 5IYCK 4OIPA 4M1XA 4GTAA 3HXAA 4G0UA 4KM9A 1WQGA 4P9SA 4OIQA 4KM8A 1RU0A 1WCMA 1XZPB 3GTPK 2FQTA 2PHCB 1X31C 3HOYC 4A3EK 1XZQB 3Q3QA 1USOA 4A3MK 3RZDK 4YFKA 1SFOA 2R92C 4A3LC 4A93K 1O27A 4LK0A 3H3VD 4BY1C 1IS1A 1R9TK 4LK1A 3GTJC 3GTKK 3GEHA 4RMFA 4FM9A 4GTEA 1B4AA 2NVXK 3ADAC 3GDZA 1I3QK 3OEPA 4BBRK 3M3YC 3S1RC 4C3HC 4C45A 2A6HA 2GAGC 4OINA 5M3FK 4BXXC 2XCRB 3AD8C 4XLNA 4FZBA 2BE5A 4GTDA 1INNA 1DD5A 4BY7C 4C2MC 1YX2A 1HI9A 1EI6A 2JA8K 5IOQA 4C3IC 4BKWA 1ZVUA 4C3JK 1EK8A 4BBSK 3VA7A 3S16K 1G51A 1I50C 1VRQC 1ZQ1C 3PO2C 2NVQC 4A3GC 4G7ZA 4C3IK 2GSUA 2CW0A 4MEXA 1BDFA 3N3YA 1B4BA 1BJTA 5IYCC 4KN4A 2FQOA 4WJ4A 1I6HC 5M5WK 4G7OA 5HL8A 4C3HK 3HOWC 5C44C 3GTOC 3M3YK 1VH2A 1Y1WA 2B63A 2R92A 2KWAA 1TWCA 3S17K 4C2MK 4LJZA 3HOWK 4A3MC 3CAGA 2E2HC 2ZUEA 1K83C 3GTLA 2NVYA 4A3JC 3FOFA 5D4DA 3S14C 1USMA
chains in the Genus database with same CATH topology
3LAPA 4G0UA 4KM9A 1WQGA 3MMLB 4KM8A 1WCMA 1R9TA 1WQFA 4ILDA 3GTJA 3N0CA 1XXCA 1O24A 1TWGA 2R93A 2GSNA 3FHZA 2YU9A 2PHCB 2E2HA 4KDDA 4P5BA 3Q3QA 4KARA 1I50A 5CHPA 2JA7A 4GTCA 1SFOA 5JFEA 1AB4A 1O27A 1XXAA 1O2BA 3G4CA 4KMHA 2Y3PA 5TJ3A 4G0WA 4GT9A 1IS1A 2CFAA 2P5MA 2JA6A 3GTGA 4KAWX 2CFAB 4FM9A 4GTEA 1B4AA 3OREA 5EGHA 3OEPA 2RGRA 4LR2A 4C3HC 1K83A 2XCQA 5IOSA 1XXBA 2XCRB 1ZBSA 4FZBA 3NUHA 4GTDA 2JH3A 1DD5A 4GTLA 4C2MC 1O2AA 2NVXA 3S0XA 4KMAA 1BGWA 5IOQA 1ISEA 1WIHA 4C3IC 4BKWA 1ZVUA 4J3NA 4KB4A 1EK8A 3VA7A 3AQPA 3ERED 3OPFA 4LQYA 4GTBA 2JA5A 2R7ZA 2GSOA 4BLBA 3G4AA 3N0BA 5IORA 3FKIA 1GE9A 3FOEA 3CQZA 1O29A 3L4KA 2E2IA 5EGEA 2GSUA 1Y1VA 4KB2A 3AQOA 3QX3A 4KASA 4GFQA 3N3YA 1I3QA 1B4BA 4GTFA 1BJTA 4P5AA 3BUEA 1F9NA 1ZXOA 3V4GA 2VUMA 4BLAA 4G0VA 3L4JA 1TWFA 5CJ9A 1Y1WA 1TWAA 2B63A 1EH1A 2XCOA 3H0GA 2R92A 1O28A 4KATA 5IOTA 3GTKA 2KWAA 4C3JC 2ZFZA 3LAJA 3GTMA 3GTQA 1TWCA 5JVOA 3AH5A 1WQHA 4KMDA 3CAGA 1O25A 3LPXA 3GTLA 2NVYA 4KC6A 3FOFA 3GTOA 1KQ4A 1TWHA 4DDQA 3GTPA 4M1XA 2RH6A 4GTAA 1O26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTB A;  3N0C A;  3G4A A;  3N0B A;  1O24 A;  1O28 A;  4KAT A;  5IOR A;  5IOT A;  4GTE A;  5IOS A;  1O29 A;  4P5B A;  4KAR A;  3AH5 A;  4FZB A;  5CHP A;  4GTD A;  4GTC A;  4KAS A;  4GTL A;  1O25 A;  3N3Y A;  5JFE A;  1O2A A;  1O27 A;  3G4C A;  1O2B A;  4GTF A;  4P5A A;  5IOQ A;  4GT9 A;  2CFA A;  1KQ4 A;  2CFA B;  4GTA A;  1O26 A; 
#chains in the Genus database with same CATH topology
 3S1R K;  4GZY A;  1J6X A;  4MQ9 A;  1R9T A;  1WQF A;  1I3Q C;  4ILD A;  3GTJ A;  1IE0 A;  1XXC A;  3A8J A;  3N0C A;  3S17 C;  1O24 A;  2GSN A;  3A8I A;  3FHZ A;  2E2H A;  4KDD A;  2VUM C;  3RZO K;  1K83 K;  4KAR A;  4XSZ A;  5IYB K;  5IYD C;  3WOD A;  5CHP A;  3H0G C;  5JFE A;  1TWC K;  5E68 A;  4G0W A;  4A3E C;  4MEY A;  1O2F B;  2JA8 C;  2P5M A;  2JA6 A;  3S1Q K;  2E2I C;  2V6T A;  4O2D A;  2A68 A;  3BP3 A;  2RGR A;  5C4J K;  1WSR A;  4LR2 A;  1K83 A;  3GTL C;  5IYD K;  1F7U A;  1DCP A;  2V6S A;  1SFO K;  1PJ5 A;  1IW7 A;  2JA5 C;  4QIW L;  3HOU C;  1XPP A;  3FKI C;  2E2I K;  3S0X A;  1BGW A;  1Y1V C;  1WIH A;  1TWF K;  5IP9 K;  4J3N A;  3GTM C;  3AQP A;  4Q4Z A;  3ERE D;  4BY7 K;  1VGX A;  3OPF A;  4QJV A;  1J6V A;  2Y0S D;  3S1M K;  1I50 K;  4AH6 A;  3GTQ K;  4X6A C;  2VUM K;  3FKI A;  3FOE A;  1TWF C;  2E2I A;  3SZZ A;  3GTG K;  4A3D K;  4YFX A;  3QX3 A;  4GFQ A;  3I4M K;  1L0W A;  1I3Q A;  3TFI A;  3S1Q C;  1IQ0 A;  3S14 K;  3BUE A;  1F9N A;  2PA8 L;  3V4G A;  2VUM A;  5C4J C;  3GTL K;  1PJ7 A;  4LLG A;  3CQZ C;  2V6U A;  3S2H C;  1EH1 A;  2XCO A;  4KN7 A;  2JA6 K;  1O28 A;  4OIR A;  3GTK A;  4C3J C;  1WCM C;  3HKZ D;  2W7V A;  3GTQ A;  4A93 C;  4KMD A;  3PO2 K;  5C3E K;  2E2J C;  4Y52 C;  2JA7 K;  1IL2 A;  3GTO A;  1I6V A;  5IP9 C;  1J98 A;  4DDQ A;  3GTP A;  2RH6 A;  1O26 A;  3GEE A;  5IP7 K;  3TFH A;  1WSV A;  4YFN A;  1V5V A;  1TWG A;  4NOI A;  2YU9 A;  2NVT K;  1WOR A;  1PJ6 A;  4P5B A;  2E2J K;  1I50 A;  5C44 K;  3GTO K;  2JA7 A;  1TWH C;  4GTC A;  1Y1W C;  5IYB C;  4XLP A;  3HOZ C;  1AB4 A;  1HQM A;  5TJ3 A;  1O2B A;  2Y3P A;  4GT9 A;  1R9T C;  1Y1V K;  2P8T A;  3GTG A;  5FLM C;  4A3F C;  2Y0S L;  3ORE A;  3S2H K;  5EGH A;  4A3C K;  5TMC A;  3CQZ K;  1TWH K;  3S15 K;  3S2D K;  5L46 A;  1EQR A;  1XZQ A;  5IOS A;  4A3J K;  3GEI A;  5C3E C;  1ZBS A;  3EQL A;  3NUH A;  4AYB D;  4GTL A;  2B63 C;  1UV7 A;  2NVX A;  2PA8 D;  4WIL A;  4KMA A;  4A3K K;  3TFJ A;  4LOW A;  2WAQ D;  2R92 K;  4A3L K;  4XCH A;  2PMZ D;  2D6F C;  5C4X K;  5FJ8 K;  2R7Z A;  1F7V A;  2GSO A;  3HKZ L;  2GAH C;  3G4A A;  4BLB A;  3I4N C;  3DXJ A;  1F93 A;  2WAQ L;  1JVI A;  2A69 A;  3CQZ A;  2O5J A;  3L4K A;  2A6E A;  5EGE A;  5M5X K;  2B63 K;  1Y1V A;  2O5I A;  2WB1 D;  4KAS A;  5FLM K;  4A3F K;  4P5A A;  1I6H K;  3TTG A;  1WOP A;  3T02 A;  3I4N K;  2WB1 L;  4BLA A;  3S1N K;  3S2D C;  2NVY C;  4G0V A;  3L4J A;  1TWF A;  3RZD C;  5M5Y K;  3RZO C;  3S16 C;  4Y7N K;  4KAT A;  2ZFZ A;  3LAJ A;  2JA6 C;  1XZP A;  4A3G K;  3AH5 A;  1Y1W K;  1J6W A;  3S1M C;  4A3I K;  3GSI A;  4QJV B;  3S1N C;  3SZY A;  4BXX K;  2R7Z K;  1TWH A;  4A3B C;  3LAP A;  3MML B;  3I4M C;  4A3C C;  5IP7 C;  3GTG C;  4A3D C;  2R93 A;  1DCO A;  1EFW A;  4AYB L;  2PPB A;  3K7A K;  3H0G K;  3T00 A;  1BS2 A;  3M4O K;  2ZUF A;  5M3M K;  3GTM K;  1XXA A;  3G4C A;  4KMH A;  1IBA A;  2CFA A;  4A3K C;  3AD7 C;  1WOO A;  4KAW X;  2CFA B;  2R93 K;  2YU9 C;  4XSX A;  3M4O C;  3HOX K;  2XCQ A;  3HOY K;  1SFO C;  4WJ3 M;  1YNJ A;  2PMZ L;  3H3V L;  1XXB A;  4Y52 K;  4A3I C;  3S15 C;  4PAA A;  3HOV K;  2JH3 A;  2YU9 K;  3PO3 K;  1TWG C;  1O2A A;  1TWA C;  1JOE A;  2R93 C;  4BBS C;  4YG2 A;  3T01 A;  3GTK C;  1ISE A;  3GTJ K;  1WOS A;  1VJE A;  4KB4 A;  4BY1 K;  3BP8 C;  3GTQ C;  1TWC C;  4LQY A;  4GTB A;  2E2H K;  4Q5S A;  3GIR A;  2NVY K;  3AD9 C;  2JA5 A;  3N0B A;  3K7A C;  2EBB A;  4PAB A;  5IOR A;  1GE9 A;  3A8K A;  1O29 A;  3GTP C;  1TWA K;  5TMF A;  3IPJ A;  4KB2 A;  3AQO A;  3FKI K;  4G7H A;  4GTF A;  4ZH4 A;  4A3B K;  2R7Z C;  1YNN A;  1ZXO A;  1YCL A;  3HOX C;  2NVQ K;  4BBR C;  4KMU A;  1JQW A;  5CJ9 A;  1TWA A;  1ZYR A;  3H0G A;  2NVX C;  1VLO A;  4JK1 A;  5IOT A;  2NVT C;  1WCM K;  4Y7N C;  3GTM A;  3HOZ K;  5JVO A;  4X6A K;  3PO3 C;  1TWG K;  1WQH A;  1DCH A;  5C4X C;  3HOV C;  4QIW D;  1O25 A;  3LPX A;  4KC6 A;  3JST A;  4OIO A;  2JA5 K;  3HOU K;  1C0A A;  2JA7 C;  1KQ4 A;  1SMY A;  5IYC K;  4OIP A;  4M1X A;  4GTA A;  3HXA A;  4G0U A;  4KM9 A;  1WQG A;  4P9S A;  4OIQ A;  4KM8 A;  1RU0 A;  1WCM A;  1XZP B;  3GTP K;  2FQT A;  2PHC B;  1X31 C;  3HOY C;  4A3E K;  1XZQ B;  3Q3Q A;  1USO A;  4A3M K;  3RZD K;  4YFK A;  1SFO A;  2R92 C;  4A3L C;  4A93 K;  1O27 A;  4LK0 A;  3H3V D;  4BY1 C;  1IS1 A;  1R9T K;  4LK1 A;  3GTJ C;  3GTK K;  3GEH A;  4RMF A;  4FM9 A;  4GTE A;  1B4A A;  2NVX K;  3ADA C;  3GDZ A;  1I3Q K;  3OEP A;  4BBR K;  3M3Y C;  3S1R C;  4C3H C;  4C45 A;  2A6H A;  2GAG C;  4OIN A;  5M3F K;  4BXX C;  2XCR B;  3AD8 C;  4XLN A;  4FZB A;  2BE5 A;  4GTD A;  1INN A;  1DD5 A;  4BY7 C;  4C2M C;  1YX2 A;  1HI9 A;  1EI6 A;  2JA8 K;  5IOQ A;  4C3I C;  4BKW A;  1ZVU A;  4C3J K;  1EK8 A;  4BBS K;  3VA7 A;  3S16 K;  1G51 A;  1I50 C;  1VRQ C;  1ZQ1 C;  3PO2 C;  2NVQ C;  4A3G C;  4G7Z A;  4C3I K;  2GSU A;  2CW0 A;  4MEX A;  1BDF A;  3N3Y A;  1B4B A;  1BJT A;  5IYC C;  4KN4 A;  2FQO A;  4WJ4 A;  1I6H C;  5M5W K;  4G7O A;  5HL8 A;  4C3H K;  3HOW C;  5C44 C;  3GTO C;  3M3Y K;  1VH2 A;  1Y1W A;  2B63 A;  2R92 A;  2KWA A;  1TWC A;  3S17 K;  4C2M K;  4LJZ A;  3HOW K;  4A3M C;  3CAG A;  2E2H C;  2ZUE A;  1K83 C;  3GTL A;  2NVY A;  4A3J C;  3FOF A;  5D4D A;  3S14 C;  1USM A; 
#chains in the Genus database with same CATH homology
 3LAP A;  4G0U A;  4KM9 A;  1WQG A;  3MML B;  4KM8 A;  1WCM A;  1R9T A;  1WQF A;  4ILD A;  3GTJ A;  3N0C A;  1XXC A;  1O24 A;  1TWG A;  2R93 A;  2GSN A;  3FHZ A;  2YU9 A;  2PHC B;  2E2H A;  4KDD A;  4P5B A;  3Q3Q A;  4KAR A;  1I50 A;  5CHP A;  2JA7 A;  4GTC A;  1SFO A;  5JFE A;  1AB4 A;  1O27 A;  1XXA A;  1O2B A;  3G4C A;  4KMH A;  2Y3P A;  5TJ3 A;  4G0W A;  4GT9 A;  1IS1 A;  2CFA A;  2P5M A;  2JA6 A;  3GTG A;  4KAW X;  2CFA B;  4FM9 A;  4GTE A;  1B4A A;  3ORE A;  5EGH A;  3OEP A;  2RGR A;  4LR2 A;  4C3H C;  1K83 A;  2XCQ A;  5IOS A;  1XXB A;  2XCR B;  1ZBS A;  4FZB A;  3NUH A;  4GTD A;  2JH3 A;  1DD5 A;  4GTL A;  4C2M C;  1O2A A;  2NVX A;  3S0X A;  4KMA A;  1BGW A;  5IOQ A;  1ISE A;  1WIH A;  4C3I C;  4BKW A;  1ZVU A;  4J3N A;  4KB4 A;  1EK8 A;  3VA7 A;  3AQP A;  3ERE D;  3OPF A;  4LQY A;  4GTB A;  2JA5 A;  2R7Z A;  2GSO A;  4BLB A;  3G4A A;  3N0B A;  5IOR A;  3FKI A;  1GE9 A;  3FOE A;  3CQZ A;  1O29 A;  3L4K A;  2E2I A;  5EGE A;  2GSU A;  1Y1V A;  4KB2 A;  3AQO A;  3QX3 A;  4KAS A;  4GFQ A;  3N3Y A;  1I3Q A;  1B4B A;  4GTF A;  1BJT A;  4P5A A;  3BUE A;  1F9N A;  1ZXO A;  3V4G A;  2VUM A;  4BLA A;  4G0V A;  3L4J A;  1TWF A;  5CJ9 A;  1Y1W A;  1TWA A;  2B63 A;  1EH1 A;  2XCO A;  3H0G A;  2R92 A;  1O28 A;  4KAT A;  5IOT A;  3GTK A;  2KWA A;  4C3J C;  2ZFZ A;  3LAJ A;  3GTM A;  3GTQ A;  1TWC A;  5JVO A;  3AH5 A;  1WQH A;  4KMD A;  3CAG A;  1O25 A;  3LPX A;  3GTL A;  2NVY A;  4KC6 A;  3FOF A;  3GTO A;  1KQ4 A;  1TWH A;  4DDQ A;  3GTP A;  4M1X A;  2RH6 A;  4GTA A;  1O26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...