5JFVA

Crystal structure of trka in complex with pf-05206283
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
305
structure length
277
Chain Sequence
MHHHHHHLVPRGSVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Discovery of a Potent, Selective, and Peripherally Restricted Pan-Trk Inhibitor (PF-06273340) for the Treatment of Pain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords High affinity nerve growth factor receptor
total genus 84
structure length 277
sequence length 305
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jfvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jfvA01
1U59A 4GU6A 3FPQA 3Q5ZA 1K9AA 2P2HA 3AGLA 2UZVA 2XYUA 2IG7A 4C4JA 2HCKA 4MBIA 3EQIA 5A54A 3CJFA 3I6UA 4X3FC 5JSMA 1H24A 3UO5A 4DT9A 4OTRA 3EL7A 3EL8A 2JFMA 4R6VA 5C4LA 1PXJA 4TWCA 4G2FA 4WA9A 1XBAA 2PTKA 1IEPA 2R4BA 2WU7A 4R8QA 4IAZA 3TKIA 4MD8E 3U6JA 2PUPA 3NCZA 3SG9A 2XKEA 3DB6A 2WQNA 4P7EA 5C9CA 1XR1A 4IIRA 3EKKA 2DYLA 3LCDA 4IX4A 2QG5A 3F2NA 2VTLA 4U97A 4FSQA 4YHFA 5EH0A 4AZTA 3W1FA 2GPHA 4QP1A 2WTIA 3EQDA 1V0OA 3OWJA 3PXFA 5D12A 2X2LA 3RHXA 1APME 2QNJA 3P1AA 2R3JA 2X8DA 4YPDA 2UZOA 1VR2A 3MBLA 3ULIA 3IO7A 3O96A 5ANKA 2JAVA 2PMLX 3FQHA 3TKUA 3V3VA 5HQ0A 5KBQA 2HZ0A 4ORKA 5HG7A 2R3IA 5FUTA 2CKPA 4MBJA 1PXKA 4W4YA 3W32A 4OLIA 4ANQA 2EB3A 3DJ6A 1SYKA 4JX7A 4M15A 5FEQA 3LMHA 5AIRA 3N51A 3OP5A 1JKTA 4YJPA 5ANIA 5J7BA 3UGCA 1PKGA 2ITOA 4FKLA 4HPTE 3NNVA 1ZARA 4MF1A 2WMAA 2XK7A 4XBRA 5JFWA 3UVRA 2R3FA 3SRVA 2QQ7A 3E64A 2YIXA 4A9SA 4IVDA 4A4LA 3BX5A 4V05A 4AW5A 3MWUA 4D4SA 4L53A 1W84A 3WF7A 1DM2A 2J0KA 4JDHA 5IZFA 5CEQA 4A9TA 4RZWA 3QA8A 4QQTA 2HELA 4RGJA 3HRCA 1V1KA 4FKRA 4L7FA 4RJ7A 1GIHA 5FTGA 1YXVA 3ZFYA 3U54A 3B2TA 4N6YA 5CT0A 5AP0A 4YTCA 4NL0A 2YN8A 4GRBA 4RVMA 5DWRA 4C34A 5IUGA 5L4QA 3DFAA 4D58A 3ZLWA 2JKKA 3F7WA 4LL0A 2CMWA 5EDRA 3LCSA 4C8BA 3DXQA 3D14A 4IZAA 4YNOA 5LVPA 2PZRA 5CAOA 2CKQA 5CNOA 3E5AA 4IZ7A 3HDNA 4FV3A 3P9JA 3U87A 3ZO2A 4YLKA 5HO8A 3KL8A 3KRXA 2XM8A 3VUGA 2BRHA 5HU3A 4E5BA 4RIWB 1OL7A 3EFJA 1MRYA 3IGOA 3FHRA 3I81A 1H1PA 4JBQA 3DU8A 5A3XA 4E73A 4XBUA 1W0XC 3R22A 4EK8A 2E2BA 3NUNA 4JAIA 2J6MA 4MF0A 1OKVA 3EFWA 4XG2A 3QUPA 3U6IA 4XG8A 2BAJA 1M2QA 2VWUA 4DEEA 4EHVA 1ZLTA 2C4GA 4KKHA 1KWPA 3FDNA 3OS3A 4F4PA 5EI2A 5I9UA 3MIYA 2YZLA 3Q2JA 1LR4A 4S32A 2HXLA 1P2AA 3HVCA 4XUFA 4V0GA 5AUWA 1XH4A 3FQEA 3H4JA 3UYSA 2UZTA 3GBZA 3R8MA 3LZBA 1RQQA 4QOXA 4WG4A 1QPCA 5FEDA 5DYJA 4YZMA 5IEVA 2YITA 4LI5A 4RA4A 2PVNA 3K5VA 1S9JA 4K33A 3RNIA 5B7VA 2QOOA 5D11A 4ZTMA 4YJQA 4EOPA 4FBXA 3DLSA 5FM3A 4MVFA 3TM0A 4XP2A 5M51A 5M08A 5GZ9A 5JGBA 4ASZA 3SVVA 1PHKA 2PE1A 2BR1A 3EN7A 5C4KA 2G15A 4M66A 1KE7A 3I0OA 2VWYA 2J90A 1ZMWA 3QHRA 5CX9A 3ZZEA 5M06A 4AW0A 5IU2A 3L8SA 4USEA 3R7GA 3D5WA 4N4SA 1ZYJA 2WQEA 3BWJA 3JVSA 3ZSGA 4GIIA 4UN0C 1U54A 2C3IB 1YQJA 1KE6A 4IM0A 5D9HA 5TO8A 3WZUA 4BZDA 3GCVA 4J7BA 4ZTHA 4QMQA 2X2KA 4BN1A 4EOMA 3G2FA 4M84A 2XJ0A 2RFNA 3IS5A 3R0TA 3ZBFA 4I4FA 4WO5A 3F5UA 4LV8A 3WE4A 5AEPA 3HP5A 3KRRA 3Q32A 2YIRA 3QKLA 1TKIA 4GK3A 2WMSA 3HA6A 3LAUA 2VWIA 3PWYA 3QTWA 4CFNA 4W4VA 1R78A 4FKWA 2C3KA 4GKHA 3ORNA 4Z9LA 3UQFA 3QCQA 4R5YA 3HGKA 4FVRA 3VS4A 3HV3A 4AZSA 4JI9A 3TZMA 2X2MA 5E8WA 3UTOA 2BTSA 4OTGA 4RFYA 4ACHA 4ZP5A 4CKIA 2V62A 2OI4X 2WOTA 3ZUTA 3HMPA 2GDOA 3DZQA 2R3QA 1WCCA 4YLJA 5EM8A 2YHVA 1FPUA 2VU3A 4S31A 5C27A 1IA9A 4FTKA 3PSBA 1GZ8A 3VVHA 3OVVA 1J1CA 5CSPA 2WTKB 4WBBB 4AWIA 3KFAA 1GZNA 4UX9A 2VTOA 4KWPA 3TZ9A 5BX0A 2R3PA 2ZAZA 2BKZA 2P2IA 3NWWA 5EDPA 2HY0A 4YMJA 5K5NA 3PXZA 3DBFA 1Z9XA 3GCPA 5L2TA 4HJOA 4O27B 5FM2A 1PMVA 2OJ9A 1IAHA 4EJNA 3OY1A 3ZM9A 1G3NA 1OBGA 2X7OA 3WF6A 3BQCA 3DB8A 3JY0A 3VNTA 2CGXA 1M17A 2OO8X 3QLGA 3VJNA 3VS3A 4FG9A 4AGDA 2X8IA 5KX8A 4R77A 3GC8A 3KK9A 3D7ZA 4OT5A 3R2YA 4EOQA 4JRNA 4YU2A 2W5AA 3ORPA 2F7ZE 4BL1A 4X2KA 3KXZA 3GFEA 3DKFA 4DGOA 2Y9QA 4E6QA 3LXKA 2VTMA 5CI6A 5A6NA 4FTTA 2BZKB 3FUPA 4FGRA 3ZSIA 3MY5A 1UU7A 5H2UA 4RIWA 4W9WA 5AAEA 2YJSA 3R8LA 4TYHA 4Y85A 1U46A 4U8ZA 5TKDA 4KNBA 4F0GA 2P0CA 3PVBA 4ALWA 3HEGA 3GP0A 3NIEA 1STCE 2WGJA 2EB2A 4PMTA 3B8RA 4RWKA 4UZHA 5EHYA 5AUZA 4KIQA 3CLYA 2QU6A 2VV9A 4C3FA 3PPZA 5DT3A 4CZUA 2XIKA 4FKUA 5E92A 1B6CB 1JBPE 3A7JA 4FYOA 4C59A 4UALA 3T3VA 4I92A 1UU8A 1Q24A 2PVRA 4PF4A 3VS2A 5HORA 1ATPE 5EYCA 4CG9A 2DS1A 2HAKA 1SVHA 2BKKA 4PDPA 4FT9A 4W8EA 2I0HA 3SD0A 3MI9A 5A46A 1CMKE 4LRKA 2RGPA 3FLWA 2ZM1A 5IQDA 4WSQA 3AMBA 4I23A 4WHZA 4F9AA 1OUYA 3QXOA 4UYAA 3O7LD 3UPZA 1WBWA 4MKCA 2QO2A 4BI2A 3A2CA 4BIEA 1EH4A 5J1WA 1UWHA 2YACA 2YABA 4QQCA 5H8EA 1Q5KA 4JX3A 3AT2A 3VBYA 3CGOA 3ZH8A 4IX6A 3RKBA 3TWJA 3C4EA 2GS6A 1M52A 2C6MA 2HW7A 2NRUA 1FGKA 4FIFA 4GT3A 2P55A 3G6GA 4A4OA 3Q5IA 3DY7A 4DFXE 3WF8A 4O7SA 4BGHA 1G8AA 5BVFA 5IMXA 2RSVA 3MV5A 3ZTXA 3QCYA 2LAVA 5HTBA 3DS6A 4QMNA 3W2PA 2X39A 5CU6A 1O6KA 1QCFA 4UBAA 4C36A 2I0VA 3ROYA 4BCQA 4LUEA 4U80A 4O38A 5CNNA 3KY2A 2G2HA 4O7LA 1UVRA 4MXCA 5CEIA 3WZEA 1ZY5A 5CSHA 5DIAA 3A8XA 1O6YA 3IDCA 4U40A 3Q52A 1PW2A 3I6WA 3QQKA 5EK7A 5FDPA 4ZLOA 4C33A 4JOAA 5JGDA 4HVHA 2UW9A 3ZUVA 2W99B 2EXEA 4L68A 4AT4A 4AGCA 5M07A 2ITXA 3QALE 2CHLA 1FMOE 2C5XA 2FSMX 4U43A 3QD3A 2ZMCA 5FBOA 3U6HA 2W9ZB 2HXQA 2O63A 3LQ8A 1OZ1A 3EQBA 4DBXA 5EM7A 4BDBA 2YISA 2V22A 3E88A 4FKQA 5TE0A 2H34A 4M3QA 4EBWA 5AP5A 3QLFA 4J52A 2GNHA 2P3GX 3Q04A 5DR9A 3PRIA 5B0XA 4APPA 5JH6A 3BZ3A 1IG1A 4KABA 5C1QB 4TKSA 1DAWA 2UZWE 4FKVA 2WB8A 1Q61A 4D1XA 3IDPA 3GB2A 1LP4A 1QMZA 2VTSA 5EOBA 3E87A 4YSMA 4E4MA 2VZ6A 3Q53A 4ITIA 3KEXA 4YC6A 2BVAA 1UU9A 1ZYCA 2UV2A 3F9NA 4RQVA 5AM6A 2WO6A 3C4XA 4ZTNA 4QO9A 4FL2A 3LFEA 3P7BA 3VULA 4L46A 1ZYLA 3NYOA 3R28A 2B4SB 3UE4A 3R8PA 4O7NA 4EL9A 5E9EA 2Z8CA 1NW1A 5HZNA 2B1PA 2C6LA 4LUDA 5AIKA 4R7HA 4ZSGA 2X7FA 5IG1A 2OF4A 3E62A 3NMUF 1KOBA 4GYIA 5LVNA 2E9VA 2PUIA 2JGZA 5JGAA 3BHHA 3NIZA 4ZMFA 4LGDA 2BROA 4Y72A 3TKHA 3V5TA 3LM0A 1RDQE 4NJDA 2QHMA 3PA3A 4XRLA 4I20A 3TZ8A 2GTMA 1J91A 4FK3A 1ZYDA 4E6DA 2VNYA 5IA5A 4XV2A 4IC8A 4QMOA 4DH1A 2OLCA 3PPJA 2IVVA 1XWSA 3SW7A 5CEOA 3PZEA 4FTNA 4L3PA 1H4LA 4UEUA 1JLUE 4RLKA 3SKCA 3TUCA 4U45A 1SNXA 3ID6C 2W4OA 2J0LA 3FLSA 4UB7A 1PXIA 4Q2AA 5KHWA 4LMNA 3SQQA 1SVEA 4QNAA 4BDCA 4ZAUA 3RPVA 5IA2A 3FSFA 2BFYA 2GMXA 3DDQA 5HOAA 3OD6X 4I5PA 3LPBA 4IAKA 4EYMA 4EZ5A 3HL7A 1PY5A 3EN5A 3FMLA 5HCYA 5A9UA 2ONLA 2ERKA 4AE6A 3NNXA 4IB0A 5CY3A 3UYTA 3FBVA 3AOXA 2KULA 5KE0A 4IAFA 4F9YA 5IDPA 5A14A 5FG8A 4YJOA 3KXHA 4GYGA 2H9VA 3LLTA 4IFCA 4YZNA 2I1MA 4C02A 1QPEA 4FKIA 4W4WA 4Q9SA 5F4NA 4XHKB 2Y4PA 4DC2A 2B54A 3JY9A 4E26A 2W4KA 1SZMA 4QD6A 3MIAA 2VWXA 2OXYA 5KMNA 2WMQA 3QC9A 3I4BA 2YAAA 3KRJA 4PL5A 4E6CA 3NVKI 4D0XA 2IVSA 3FC2A 4XEYA 4XOYA 5LOHA 2CNQA 1YOJA 1MRVA 4FTJA 2B52A 3UOHA 3R7UA 2EVAA 2W7XA 1WAKA 4U7ZA 4KSPA 5B2KA 2ITVA 1AQ1A 2OW3A 2F57A 3HMMA 4O6LA 4O0YA 2ZDTA 2RL5A 5EI6A 4XG6A 2CGVA 1P14A 3FMNA 1H25A 3V8SA 4YR8A 5IISA 3OCSA 2QOQA 4B0GA 3BWFA 2ITPA 4TYEA 3ZS5A 5BVWA 3SG8A 3C7QA 4GVJA 3BV2A 4LG4A 3NW7A 2B9FA 4FNXA 5J9LA 4BCGA 4D9TA 2O65A 4MCVA 1MRUA 2QHNA 5L2QA 2O2UA 2C3LA 4XS2A 3IQ7A 4EC8A 2W1GA 2CCHA 4FT7A 2B0QA 4EH7A 4G31A 5EM5A 2DQ7X 2W17A 3IPHA 2W1DA 4YNEA 5KMIA 4FTRA 1W8CA 1KOAA 5AA8A 3I7BA 3KXNA 3PP0A 4HVGA 4NTTA 4D4RA 4RPVA 4QT1A 3VUDA 1J7LA 4EHEA 5DPVA 5EW9A 4FZ7A 2BALA 3KVWA 1NVQA 2WEIA 3ZC5A 3TDVA 5BVKA 5JMSA 4MHAA 4D9UA 5D1JA 3MA3A 3I0QA 3OT8A 1YXUA 3CPCA 3PIZA 3RHKA 3FEGA 3A4OX 4FG7A 2JDVA 4EQUA 2FB8A 4RC4A 1YOMA 4PP9A 4CT1A 2NP8A 4F7LA 1XH9A 4GVAA 5CEMA 3LXPA 3E92A 4N70A 3OY3A 4AZFA 4DFNA 4A9RA 3TIYA 4B8LA 3I1AA 2W1EA 5AAFA 2FSLX 3GU5A 4IWPA 2A1AB 2PMIA 1OPLA 3PG3A 4RJ5A 3RAWA 2I0YA 3UIUA 3R02A 4BKYA 4DLJA 4EOIA 3F3ZA 3LJ1A 3PRFA 4IB5A 3V8TA 5TT7A 4A9YA 4PUZA 4C38A 4XP0A 2E9UA 4FV5A 4Z3VA 4H58A 3UBDA 4PTCA 4R1YA 4RFMA 3AC1A 4B7TA 4OTWA 3OROA 4UZDA 2R7IA 2HOGA 2WMWA 3D94A 4K11A 4LOOA 1H0VA 4EOJA 4FOBA 3VRZA 3DZOA 4CFMA 3EQPA 4QMUA 4EONA 4ID7A 1YHSA 3F5PA 3FI4A 2XNBA 5LQFA 2F4JA 5ACKA 2FSOX 4F0FA 4DGMA 4UXLA 3NUPA 4K18A 3QGYA 2BRGA 2RIOA 4CV9A 1OB3A 2R3MA 3DLZA 2V55A 4NEUA 5E8UA 3DTCA 2BRBA 2IWIA 3PE1A 4WOVA 3MVMA 3AT4A 4BDJA 4CGAA 4TRLA 5AP3A 4O7VA 3PY0A 3CY3A 4H1JA 5EKNA 2FVDA 3V04A 2YCSA 3P79A 1W7HA 5BYZA 1UNLA 2W9FB 4EEVA 3DQWA 3FWQA 4WNKA 4IX5A 3R7EA 4USFA 3UZRA 3AC5A 2E9OA 1YI4A 4HYUA 3BRBA 4H36A 4JBPA 1L3RE 1REJA 1ZWSA 3ZXTA 3RINA 2JDRA 1YW2A 1OIYA 1ZXEA 4DCAA 3FI8A 4I5HA 2PZPA 5ANOA 3QD0A 4ZMEA 4FVPA 5KMJA 5CSVA 3VW8A 1ZY4A 3BE2A 3WARA 5AFVA 4EUTA 4XMOA 3A7GA 1ZOGA 3L8VA 3TUBA 5IA1A 1WZYA 2PHKA 2EU9A 3PWDA 3TV6A 1UU3A 2YERA 2YIYA 4FTUA 5CYIA 3O23A 4X6QC 3R8UA 1U5QA 3O2MA 1CKPA 3EYHA 3BGZA 4LOPA 2HK5A 4BKJA 2QOHA 2JIUA 4M69B 4G16A 5CS6A 5K9IA 4JLCA 5FDXA 4OBPA 3CIKA 4GG7A 4NZWB 5E1SA 5GZAA 3PY3A 3COIA 3BHYA 3ZONA 1MUOA 3CD8A 4CNHA 4ANMA 4EK3A 2JKMA 5LCKA 1OL1A 1YI3A 3DCVA 4TL0A 3WYYA 1U5RA 2XBJA 1M14A 4ACMA 5CQWA 4BCMA 1LEZA 4PPBA 1R1WA 1PXOA 4CTCA 5IQEA 2PU8A 2QR8A 3QXPA 4ZS4A 2ONLC 3FZOA 3N4TA 4EC9A 4R7IA 4CYJA 2PSQA 4HZRA 5L6WL 5AR7A 2VTQA 5HVKA 2JC6A 3OTVA 4RSSA 3NUSA 4LGHA 4CMOA 3PYYA 4FT0A 3BLRA 2VTAA 1JSUA 3PA5A 2CGWA 2X9EA 1PKDA 3GNIB 4XV3A 3U8WA 5EHOA 2GFCA 3OCBA 3U4UA 3RPYA 4F9CA 2VX0A 2FGIA 2G2IA 5I4NA 3F2RA 3KXXA 4AT5A 3BV3A 4NW6A 4RT7A 4OTFA 3FXZA 1RJBA 3G51A 2XK4A 3VS0A 3DGKA 2I6LA 3FSKA 3G9NA 5EM6A 2VTPA 4UMRA 4M68A 3MH2A 1FBNA 3HAMA 4ACDA 3AG9A 2R2PA 4EWHA 2F7XE 2YCRA 4BDDA 5EQPA 3O17A 4CRLA 1H00A 2UW4A 3OOGA 5BQ0A 4UWCA 5J95A 2R0UA 5KZ0A 3U4WA 3A62A 5TOZA 1NT2A 1JKLA 4YBKA 3UG2A 2AUHA 2F7EE 3H30A 2VWBA 4CFVA 2UZDA 4WUNA 3F6XA 3BEGA 3KQ7A 3R7IA 2R3GA 3K2LA 4O83A 5CANA 2Z02A 1YHVA 4C62A 5HX8A 4TT7A 3DKGA 3EQFA 4DITA 5E8TA 2IZRA 3A7IA 3R7OA 4ASEA 2A19B 4YTHA 5LARA 4BI1A 2QKRA 4BCFA 3TIZA 5A4EA 5I9VA 4WUAA 2WEVA 5HE2A 3P78A 3W8QA 4GUEA 2XS0A 3AQVA 3QRUA 5LWMA 2W5BA 3IGGA 4BYJA 4DH3A 5AUUA 4AW1A 3H0YA 3RK5A 5DR6A 3FI3A 4O0VA 3V5WA 4MEDA 5H8GA 4IB1A 2BAQA 3MFSA 4S30A 5HO7A 3MY1A 2YM7A 4HNIA 3MW1A 4I3ZA 2ITZA 3E3BX 2ZOQA 5J9YA 3QD2B 2I0EA 1FVRA 5AUVA 5T68A 2RG6A 4F65A 3G15A 2ZB0A 3SDJA 3EWHA 3II5A 1K2PA 4JQEA 4MX9A 4XG3A 2RKUA 3AC8A 4ZSLA 3TT0A 4QPAA 1KUTA 4MH7A 5DT0A 4M8TA 1U4DA 4CFFA 4ZY4A 4EHGA 4CG8A 2WMRA 3QA0A 5F9EA 3MESA 3Q6UA 3P7AA 4N57A 4D55A 2A2AA 1W98A 3BEAA 5JFSA 3QZIA 4IAAA 4MWIA 5F94A 5DNRA 2XF0A 3ZU7A 3KK8A 3FC1X 4M0YA 1MQ4A 4D1SA 2W1IA 2QC6A 5CVHA 5FGKA 3GOPA 2X9FA 5CSXA 4F9WA 4I0SA 4FKJA 4FL1A 3BQRA 4C2WA 1B38A 1IRKA 2XVDA 3DXPA 4M0ZA 3AGMA 4EKKA 4F1TA 2X1NA 2UZBA 4H05A 1I44A 5CENA 1JOWB 3O8TA 3QYZA 1VYWA 4LMUA 3P7CA 4LRJA 5AUTA 5HG9A 2VGPA 5HE3A 2R3KA 3UO6A 2WMTA 3LFAA 4BTFA 3ANRA 4ALUA 4F63A 3F3UA 3MA6A 4O82A 2ACXA 4FODA 2W4JA 1XO2B 2GTNA 4IVAA 4F7JA 3GXLA 3THBA 5M09A 3UIBA 3ORTA 5DFPA 1GOLA 1OECA 4ASXA 3WF9A 3VF8A 1H01A 2CGUA 2WIPA 3NGAA 3NUXA 4YC3A 2F2UA 3ENMA 3TACA 4KKEA 5E8SA 2C47A 3GC9A 2W1FA 3EZVA 3W2OA 3RAHA 4QYEA 4A4XA 4O0SA 2QOIA 3OHTA 5AR3A 2GCDA 2ZVAA 2BILB 4I4EA 3E3PA 4RRVA 3CP9A 5CAQA 4PPCA 3ORIA 5EDQA 2J9MA 4FVQA 1H26A 2Z7LA 4AX8A 2XIRA 4DCEA 3N4VA 3ZZWA 2B7AA 5BVDA 3LLAA 1Y57A 4JDJA 4QP6A 2OJJA 2HWOA 3H9FA 3VJOA 4R5SA 4KUJA 3AD6A 2YM6A 2YA9A 3LFQA 3O7LB 4IDVA 4RC3A 4AA0A 1Z5MA 4ZZOA 3OF0A 4NCTC 1CM8A 3Q3BA 3TJCA 3BGQA 5IDNA 2I40A 1WMKA 2QURA 1YRPA 3O71A 3MH0A 4HGSA 5TF9A 2OIBA 2XJ2A 3GCUA 2NO3A 5DR2A 3EJ1A 5AUXA 4HYSA 2GHLA 1OPKA 2JBOA 3BU6A 3DV3A 4D28A 4G3CA 3KN6A 4KIOA 3BLHA 2UVZA 1BKXA 3EZRA 2F2CB 1O9UA 2PE2A 4JVGA 4Q5EA 4XG4A 4O81A 2H96A 3R7YA 1P5EA 5M56A 1RE8A 2G2FA 1JSTA 3LW0A 4BDKA 4NKAA 1M2RA 4LM5A 4XJ0A 3N4UA 4ZJVA 3UMXA 1RW8A 2JDSA 3FZSA 4P5ZA 1J7UA 4BHNA 3LMIA 2ZDUA 3ZRLA 4ZOGA 2BDFA 5HIDA 4ZZMA 3FXXA 3ALNA 2OIQA 4RQKA 4ZJIA 2GNJA 3OBJA 4MNEA 4G1WA 5J8IA 4I6FA 5IA3A 3DAKA 1IAJA 1ZRZA 5FXRA 5JEBA 4CEGA 3QX2A 5BYLA 2F49A 2X6DA 4GJ2A 2X7GA 4J8NA 4QYHA 4RWJA 1TQIA 5I5ZA 3MB7A 4ZSJA 3SGCA 1ZYSA 3HECA 3NUYA 4YURA 4JDKA 3WF5A 3ORLA 5EQYA 3EFLA 4E4LA 3NYVA 3S95A 3ORMA 4I1ZA 3NUUA 3VUHA 3SXFA 5E8VA 1PF8A 4F64A 1P4FA 3OUNB 4C4HA 4AN9A 3VS5A 5AV3A 3C5IA 3MFTA 2SRCA 3PSDA 2OIDA 4M67A 5KO1A 3UQGA 2EWAA 2HENA 2ZMDA 3QCXA 4L42A 4AOIA 1TQPA 3CC6A 1WBTA 5HGIA 4O2ZA 2CNVA 4PQNA 4BCKA 2CPKE 2GSFA 1CTPE 2IN6A 4LOQA 4DFUA 5BUEA 1PYEA 4NM3A 4JG7A 3IK3A 4FTIA 4GK2A 1PYXA 2OZOA 2ETMA 2BDJA 1CKIA 2XKDA 3FY0A 4CCBA 3SX9A 3FPMA 3LFDA 3F3WA 4D2RA 5IQBA 2JLDA 3FKOA 3WIKA 3ZO4A 3TXOA 4I0RA 4E93A 4C0TA 4USDA 4X2GA 1XH6A 3HUCA 3FLZA 4FT3A 4R3CA 4WT6A 3QD4A 4DBNA 2XM9A 3BYSA 4OAUC 3LM5A 3EQHA 1W82A 3FMEA 3BI6A 3HYHA 2YM4A 4U6RA 2OH0E 5ANEA 1Q8ZA 3DBQA 3FZRA 3UZTA 2C69A 5B2LA 5IH4A 4EH6A 3DBEA 3L8XA 4ASDA 2BFXA 3A7HA 2X4FA 3R04A 1Q62A 2R5TA 4ACCA 5JK3A 4G3GA 2JAMA 4HCTA 4I5CA 4JAJA 4KIKB 3W2QA 3Q4ZA 3QZGA 1REKA 4AE9A 4PMSA 4C4FA 4L7SA 2VRXA 2JEDA 4FTCA 5EI8A 4TYIA 4G9CA 4EH5A 1FGIA 4FSTA 5CF8A 4GL9A 5GNKA 4GS6A 3M11A 1BYGA 2UW6A 1YWNA 2BZJA 4L8MA 3VRYA 4FSNA 3G9LX 1Y91A 4C3RA 4D4VA 3AXWA 4IE9A 1JPAA 4BCOA 4FNWA 1WFCA 2WZJA 4GT4A 4FR4A 2C0IA 2YM3A 4O91A 4QMWA 4XP3A 5EG3A 4C4EA 3NLBA 3GC0A 3FMKA 4FIHA 2Y0AA 5IF1A 3C4WA 2BRMA 5M4FA 4O86A 4HYIA 2P4IA 1BI7A 5HVYA 3FLNC 3QZFA 3TNHA 3GU6A 4QMLA 4D5KA 5GZ8A 2RFSA 3EOCA 3RZBA 3QUEA 3OEZA 4AACA 4DEIA 4Y95A 2ZV7A 1YDTE 3A60A 4TY1A 3LJ2A 4IAIA 4IZ5A 4GCJA 4DG0E 4MK0A 2XYNA 3QKKA 3ZEPA 4D0WA 5CQUA 3Q4TA 4UWYA 4Z55A 5AX3A 4MXYA 3BHVA 5HNGA 1WVYA 3PJ3A 3IONA 4CMTA 3GVUA 3PUPA 5JQ8A 3NEWA 3Q96A 2QU5A 4MD7E 2HZIA 3W33A 4GFMA 4EH2A 5GIOE 4FZ6A 5CU4A 4QP2A 4CFXA 4PNKA 3KRLA 5HG8A 3CTQA 1YDSE 3OOMA 1XQZA 3RI1A 2IO6A 1PMNA 1UNHA 2XCKA 3DJ5A 3MB6A 4EQMA 1M7NA 4O6EA 4DF3A 4UMPA 2WHBA 2FH9A 4F6UA 4FKTA 3FAAA 4GFOA 2Y4IC 4BBMA 1OIRA 3NAXA 1Y8GA 3FZPA 4M12A 3K5UA 3Q6WA 4CXAA 3R6XA 4FUYA 1CDKA 4NKSA 3Q9YA 2E9PA 3FLYA 3D2IA 2XIYA 4NT4A 5CVFA 1Q8TA 4E4NA 4F08A 4CLJA 5JFXA 3HLLA 3R1SA 1FVTA 1LPUA 4FICA 4QQJA 3GC7A 4QP4A 4AZWA 5A6OA 3TNPC 1H27A 2YCFA 2HYYA 5FRIA 3D9VA 4IVBA 1FMKA 3PE2A 2Y7JA 2XNMA 4AN2A 4BF2A 4X3FB 3BU3A 2NPQA 1ZZ2A 2QVSE 5FXQA 3RPSA 1VZOA 3QHWA 2WNTA 3NX8A 4BCPA 4CKRA 3R1YA 3KCKA 3RCDA 1NXKA 3QUDA 4PDOA 1OGUA 3RMFA 2FYSA 4YBJA 3FE3A 4J97A 3BPRA 4BDAA 4PTEA 2OICA 4YP8A 2ITQA 4LYNA 5CVGA 4PMMA 2QKWB 4ZK5A 2O3PA 3K54A 3C5UA 5M4IA 2OJFE 2PVFA 4U41A 5KCVA 4G9RA 4E7WA 3C1XA 3BLQA 5IMEA 2WTVA 3DT1A 3LQ5A 2WFYA 2GS7A 3IDBA 5ANDA 1DAYA 1PXNA 2IJMA 4FYNA 2YM8A 4FKPA 5EKOA 5FP5A 4JG6A 4NSTA 3ACKA 3SAYA 1JQHA 3C4FA 2OU7A 3OT3A 4NYEA 4U5JA 5AP7A 5CEKA 5CAUA 4DGLC 5JQ5A 3OXTA 3QGWA 4L9IA 5DMZA 4F0IA 4FK6A 4BDHA 4O0WA 3RPRA 2O0UA 2XCHA 3VUMA 3ZCLA 4ACGA 4JQ7A 4BC6A 2C6EA 2FO0A 2ERZE 4OTQA 3C0HA 1YWRA 3TN8A 4AZEA 3TDWA 4MAOA 4DTBA 3KULA 2QI8A 3QZHA 3CGFA 4NM5A 4F70A 5AR8A 3NUAA 4O84A 4GKIA 1M7QA 4H3PA 4LV5A 3PVGA 3DKCA 3ZO3A 5KUPA 4TYHB 1E9HA 4BIBA 5CU0A 2WMUA 4GV1A 2WTJA 5CEPA 4YC8A 3NDMA 4NU1A 3E8DA 4BY9E 3CD3A 4CYIA 2AC5A 4QPSA 1H1QA 4AAAA 3R01A 4TTHB 4Y8DA 5DG5A 4RZVA 2Y6OA 4UYNA 3JXWA 3WI6A 2NNWB 4GJ3A 1OITA 5BMMA 1ZMUA 4ZXTA 3VQHA 2UW8A 5K5XA 1KE5A 5HNIX 2Z2WA 4QMTA 2DUVA 5AV4A 2ETKA 4YTFA 2XBAA 3QF9A 2YZAA 3HX4A 3PY1A 3VAPA 3CS9A 3IW6A 3OWLA 5E8YA 5LXMA 4RMZA 3V01A 5M4CA 2C6KA 4J98A 3GUBA 3QTIA 3DK3A 5G1XA 5J7HA 3FV8A 3PP1A 3KMWA 5L6OA 4FV8A 1KV1A 3QRTA 4E5WA 5HBJA 3KREA 3ULZA 5K0XA 3V6SA 2B55A 2CLQA 5CU3A 5FBNC 3SV0A 4AGUA 3FKLA 3ORKA 3GQIA 4PDYA 4BDEA 4D2PA 4QMMA 2JDTA 3R1QA 5FXSA 4X0MA 2OKRA 3VBTA 3IKAA 5I3OA 3DBCA 4HGEA 5A4TA 1WBSA 3BYOA 3R00A 1GY3A 1H1RA 4U3ZA 2PK9A 2ITUA 3VBVA 4V04A 3GU4A 4MNEB 2W1CA 4WKQA 1Q41A 4DINA 1GIIA 3W2CA 3MTFA 5LVOA 5M57A 2WIHA 2OZAA 5C8MA 4K77A 4TW9A 4M13A 5JRSA 2GQGA 2CCIA 1OL6A 5DN3A 5JRQA 1FOTA 3I79A 3OBGA 3UMWA 3W2RA 3A99A 1CKJA 1YI6A 5B2MA 4C58A 4CFUA 2H8HA 5HVJA 3V5QA 3HV4A 4A9UA 3DQXA 4L00A 4AXAA 3TV7A 4XV9A 2OGVA 2X6EA 4A7CA 5D7AA 5K0KA 4FSUA 1OL5A 1WBPA 5C8KA 2JBPA 4FGBA 3KCFA 3COKA 3QTZA 2CKOA 3PVUA 4IDTA 3AD4A 4WSYA 3ZUUA 5A4LA 1JKKA 4AW2A 5J5SA 5ETIA 4I24A 2C6OA 5AP1A 3MYGA 3E7VA 4ZZNA 4E8AA 4IZYA 3HMNA 3PG1A 3PXQA 4Y46A 3W2SA 3P5KA 4FOCA 5HCXA 2F9GA 4O7WA 1E1VA 1YDRE 2UZUE 4ZY6A 3ZLYA 5LMKC 4R3PA 4Z7GA 3H3CA 3S1HA 4BR3A 4FX3A 5I9YA 3V6RA 3MN3A 2GQSA 2CLXA 3QBNA 2QD9A 2XNNA 4DGGA 4B99A 1YXXA 5D7VA 3TL8A 4EK6A 2QOBA 3S2PA 5A4CA 3R8ZA 1OKYA 1ZMVA 4QTDA 2JKQA 4UXQA 2E9NA 5EOLA 4R1VA 1YKRA 3L9PA 3AMYA 1Q8WA 4FEVA 4F09A 3V51A 4XNEA 4J53A 5CF6A 1X8BA 1NY3A 5HU9A 5KMKA 5HE1A 1F3MC 1L8TA 3PXRA 2X4ZA 5GINE 3SXSA 2VO7A 4FF8A 4QNYA 2OG8A 4A07A 3D0EA 4PL4A 5GJGA 1O6LA 2ETRA 2ITYA 2Z7RA 4DH8A 5CASA 4W9XA 4S2ZA 3S4QA 4C4GA 2VGOA 5L8JA 4YZCA 2V0DA 3AC2A 5JN2A 4EOSA 4AA5A 4MD9E 2H6DA 3F2AA 2VX1A 3DAEA 2BTRA 1R3CA 3ZO1A 5CWZA 5DA3A 4CD0A 2VTNA 5DBXA 4V0GB 3PXKA 4K2RA 5AV0A 1OVEA 2CKEA 2FSTX 3LHJA 4FTQA 1JWHA 4LGGA 3OCGA 5ETCA 5HCZA 4BGGA 1GZKA 4PL3A 4NUSA 3HKOA 4FEWA 2VO3A 3H0ZA 1U54B 3G6HA 4MXZA 2VTRA 2OWBA 5KMMA 1YXTA 4F6SA 5FP6A 1DI9A 3DTWA 3F69A 3Q4CA 2XNPA 3A61A 4HCUA 4RJ8A 2OZAB 5L8LA 3LFNA 4KS7A 3CCNA 5KHXA 2W0JA 1MQBA 4EWQA 1OMWA 5CZIA 3EQCA 2ZV9A 3SC1A 3VS7A 3K3JA 4WNOA 2Z60A 3LXLA 4W4XA 4I93A 3BKBA 4EH8A 5CF4A 3F66A 4M69A 4G6NA 3R7VA 4QPMA 2C5NA 4G6OA 5IH5A 4AZVA 1J7IA 2PMNX 2PMOX 4EH4A 2LGCA 2V5QA 3MDYA 3E8EA 3EQRA 3TTIA 5CAVA 4DFYA 3ZYAA 5DHJA 3ENHA 4HVDA 3R8VA 1H07A 3FY2A 3HMOA 4G5JA 4RIYA 5E8ZA 4F6WA 4L52A 4X21A 2XRWA 4QMYA 3Q9ZA 4IM2A 2IW9A 3I7CA 4XV1A 4GFGA 5HICA 2J5FA 4RIOA 3VW6A 4C7TA 4B9DA 3PDTA 2ZV8A 1NA7A 2OK1A 5EQEA 2UW7A 5C03A 4JBVA 2O8YA 3NW5A 2W1ZA 5E8XA 4KAOA 4ZSAA 2CN5A 1ZZLA 1R39A 3I5ZA 4FZFB 4IBMA 5KZIA 3ZSHA 5LVMA 3UC4A 1OPJA 4EH3A 1HCKA 2ITTA 4XYFA 2A27A 5EW8A 3SOCA 4DE4A 2V7AA 3DK6A 3CJGA 4ITJA 4OR5A 4DG3E 1PXLA 3CXWA 4RVKA 3QFVA 2QODA 4KKGA 3LCOA 4X3JA 2PVMA 4O0UA 1VYZA 3T9IA 3ITZA 4Y83A 2GU8A 3VUTA 2CSNA 4OTHA 4F1MA 5HLNA 3DNDA 4L67A 4D1ZA 2HZNA 3VWAA 2XK8A 4G5PA 4TWPA 5KKRC 2IW8A 3W55A 4TYGA 2IVUA 5JZJA 2WQMA 3HNGA 5I9WA 4U3YA 3QCSA 4FV7A 2ZYBA 4FEQA 5G6VA 5AV2A 1K3AA 1KV2A 2UVYA 5I9XA 4UMQA 3VC4A 4MYGA 5DEWA 4BCHA 5JT2A 1UKIA 3MJ1A 4S33A 3F61A 3BELA 5HX6A 4O7TA 2PZIA 3CTJA 2XEYA 3W16A 5HLWA 2ZM4A 3FI2A 4TWOA 4X2NA 3HV5A 3O51A 4FG8A 5J9ZA 4A06A 3NRMA 3ZEWA 3IW4A 3PJ8A 3IECA 4GMYA 2B9JA 3I5NA 1URCA 2OXXA 3MJ2A 3CQEA 3F5XA 4IHPA 4JDIA 4QP3A 5CU2A 3QRKA 2J50A 1SVGA 3KXMA 1M2PA 2NRYA 2BIYA 4IW0A 4RJ4A 5AR5A 4FV1A 4TN6A 4GG5A 4ZIMA 4KRDA 1KE8A 4JS8A 5AMNA 3G0FA 3SOAA 3CSVA 4NIFB 4BRXA 3QWJA 1OI9A 4YJNA 3QTXA 4QMVA 5BMSA 4FUXA 2XZSA 4IH8A 1ND4A 2PVLA 2UW3A 3OZ6A 2BHHA 2XK3A 4YUQA 2BRNA 4RX8A 2VN9A 5CF5A 2YIWA 4O7YA 1HOWA 5LWNA 2XNGA 3FJQE 2J0IA 3Q4UA 1Q8UA 3KULB 4ANLA 4FSWA 5AR4A 2VX3A 3PJCA 4JRVA 4BBEA 3EIDA 3B8QA 4RBLA 2JD5A 3JPVA 3VUKA 4CFWA 2PPQA 4BB4A 3LOKA 2Q83A 4DTAA 2ITNA 3RALA 4RA5A 2WMBA 4EZ3A 1WBNA 3SHEA 4BZOA 5CXZA 3LXNA 2HY81 3M2WA 4XX9A 2YCQA 4DA5A 4FSZA 3QQJA 4GT5A 4ANNA 5D41A 3OFMA 4YHTA 3CKWA 4KBCA 1PRYA 3A4PA 1F5QA 1WVWA 3PSCA 4KBAA 1AGWA 2J0JA 3E63A 3ATSA 1XKKA 3HV6A 3LFBA 4J96A 4ANSA 4YO4A 3EH9A 3IW8A 3QRIA 5LMAA 3UOLA 3KKVA 3BIZA 1H8FA 4E3CA 2PY3A 4OW8A 5K3YA 3R9RA 2Q0BA 2O64A 4XG9A 4XLIA 1GJOA 5FD2A 3WZKA 1OM1A 4NH1A 3KB7A 4WNPA 3C4ZA 3ODZX 4PTGA 3LCTA 4NM0A 4CZYB 3DA6A 1I09A 2C0OA 4L45A 3ZRKA 4RX7A 3ZLXA 3FXWA 4HGTA 4FTAA 4QMXA 3QQUA 4AU8A 3WILA 2EXMA 4KB8A 4FV4A 3LFFA 2HWPA 4IWDA 5FWKK 4KD1A 3ELJA 2VAGA 3IW5A 2YIQA 2RF9A 2R3LA 3NVMB 3HA8A 1JSVA 3V5JA 4AG8A 4S34A 4ZJJA 2ZB1A 1URWA 3RWQA 4K8AA 5LMKA 3FZ1A 1OKWA 4NW5A 4DEBA 3D15A 3CPBA 4CCUA 3DDPA 2QG7A 2QR7A 3GEQA 4KSQA 2A4LA 2UW0A 4L43A 3JR1A 3QL8A 3EQGA 5T3QA 3D2KA 2OF2A 3TI1A 2AYPA 4QP9A 3UOJA 3F3VA 3DAJA 2GNGA 2FUMA 2XJ1A 3AC3A 4KRCA 3JYAA 3ALOA 2R3RA 3WBLA 3R2BA 3WE8A 4DFZE 2R3NA 2ESMA 5BUIA 5BNJA 2QLQA 4UMTA 4AOTA 4Z16A 5JFVA 1OUKA 4CRSA 1Y6BA 2BZHB 2YLFA 4DLIA 4BDIA 3R71A 1ZAOA 3VBQA 4FKOA 4CLIA 3CBLA 3RBWA 2OH4A 4J99A 2UZEA 3HMIA 3D5UA 3CEKA 5CT7A 4E20A 3VS6A 3MTLA 2BPMA 5EW3A 2XRUA 3OW3A 2VTJA 4JL9A 3RM7A 3RVGA 3TTJA 2WOUA 3KGAA 4IWOA 3DBDA 3EKNA 4HCVA 3A7FA 2C1AA 3RJCA 3OMVA 4EJ7A 4F99A 3QTUA 4C35A 5F1ZA 4I6QA 2WTDA 3CR0A 5H3QA 4EYJA 3AMAA 3ZDUA 5CALA 2R64A 1T46A 2PZ5A 3L1SA 5AV1A 1XHAA 2VUWA 1JKSA 1P4OA 4RC2A 3ZRMA 3EB0A 4DN5A 3LE6A 2WMXA 2YDIA 2RG5A 4BWPA 5DH3A 1NVRA 2WAJA 3GI3A 4TWNA 4YZDA 4K1BA 2PUUA 4M97A 3NYXA 3R73A 4PNIA 4U81A 3VUIA 5KBRA 4L6QA 2C0TA 2KTYA 3OUKA 3KA0A 3SA0A 3LVPA 1R0EA 5IEXA 3P4KA 4QP8A 3W8LA 3GCQA 3QTSA 3BU5A 4KBKA 1WBOA 3L9MA 4EUUA 4EH9A 2FA2A 3R9NA 5LCJA 4R7BA 2PWLA 5J5TA 4X2JA 2QLUA 4FSYA 4L01A 5H8BA 3NYNA 4XH6A 2WQOA 2BMCA 2YAKA 4FI1A 3CTHA 4XOZA 2W1HA 3AC4A 5E1EA 3MS9A 2VTTA 5BUJA 3KRWA 4ALVA 3ZM4A 5ETFA 5HBEA 5C01A 2C5VA 4DEGA 3D5VA 3S00A 4OTPA 4JNWA 4DTKA 3FZTA 5AP4A 4CSVA 3ERKA 3ACJA 3ZXZA 2B53A 3C50A 4ZTRA 4HVIA 3PIXA 4O7ZA 3DPKA 5HI2A 2XNEA 3C4CA 1Y6AA 4OBQA 1KSWA 2IZSA 2XP2A 5ANGA 3RWPA 4TPTA 4BCIA 1Q3WA 4FEUA 3ETAA 3BYUA 3WIGA 4O22A 4FA2A 1QPJA 3UP7A 3CQWA 4RJ6A 3TJDA 1KE9A 4BIDA 3LQ3A 4CMUA 1QL6A 4WIHA 4ZTLA 2BIKB 3RZFA 4E4XA 4XLVA 5HLPA 5L8KA 3H9RA 4MBLA 4APCA 4JBOA 4BGQA 1BLXA 3C0IA 4PP7A 4YZBA 3TV4A 3G90X 3MPTA 5D10A 4RIYB 1E1XA 4GK4A 2Y8OA 3E93A 2XKFA 3V8WA 4IVCA 2A0CX 4LRMA 5CLPA 1YWVA 5A4QA 5L2SA 2GHGA 3FYJX 2X81A 3RM6A 3RP9A 4D4YA 1GNGA 4P2KA 4C57A 4HNFA 4EBVA 5M53A 2B9HA 4BTMA 1OKZA 1GIJA 3H9OA 1IA8A 3M42A 2C30A 1XH7A 2UVXA 4CV8A 3GU7A 1VJYA 2YDKA 4UV0A 4EHZA 3B2WA 4D2TA 4KS8A 4DFBA 2XH5A 4FIEA 1PJKA 2Y4IB 3Q9WA 4FNYA 5TR6A 1ERKA 3OEFX 4JIKA 5DGZA 3LKMA 3C51A 4FC0A 5KMLA 4O0TA 4E1ZA 3FMJA 3RAIA 3R9OA 4QQ5A 2JDOA 5AM7A 3PTGA 3T8OA 5HKMA 3C9WA 4EKLA 4WRGA 3G5DA 1DI8A 3WYXA 3GU8A 3QAME 3FQSA 5HEZA 2PYWA 3V5PA 5EYKA 3QKMA 3DNEA 4FV9A 2XIXA 2GHMA 3OC1A 4YPSA 4QMZA 4RX5A 4LQMA 3HV7A 4DFLA 1FVVA 2QOFA 4FZDB 5EHLA 3ORZA 4FTLA 3FL4A 3MVLA 4PMPA 2VWZA 4QTBA 3UPXA 1JAMA 4X2FA 3UVQA 3NW6A 4NM7A 5CAPA 4AF3A 5KMOA 4X6RA 1B39A 1H1SA 3BYMA 5DRBA 2XNOA 1IASA 2PVJA 2UZNA 3MSSA 3P0MA 3QQLA 2JITA 4IM3A 5IUIA 2PE0A 2PVHA 4U79A 4FSMA 4DH5A 3ANQA 2CN8A 4FT5A 3JVRA 3NNUA 5EYMA 4AT3A 4BZNA 3PVWA 2QONA 4QRCA 5AA9A 1UV5A 4O96A 4NWMA 2X8EA 4K9YA 5FTQA 3TNQB 3FHIA 4DAWA 3V5LA 5IUHA 2G1TA 3DKOA 4ONAA 4D5HA 2IPXA 2BAKA 2GNFA 4Q9ZA 4RVTA 4BCJA 5K4JA 4YO6A 1YHWA 2JFLA 2R9SA 2YLEA 2Q0NA 5HIBA 4EK5A 3LFSA 4EQCA 5HTIA 3H10A 4IWQA 4GU9A 2WTCA 3R1NA 2RFDA 4NTSA 4X7QA 3RAKA 2XMYA 3NNWA 2QCSA 4PX6A 2XKCA 2YWPA 5IQFA 4BHZA 2C6IA 1UWJA 2W05A 3DFCB 3UIXA 4I41A 4AOJA 2CNUA 4HGLA 2GQRA 5FQDC 4KA3A 4R78A 3CKXA 1JVPP 2AC3A 3O8UA 5FEEA 2PVKA 4MQ1A 5DI1A 3UODA 4DH7A 1BX6A 5M4UA 4XRJA 1Q97A 4KINA 5EYDA 5CZHA 3ODYX 5GHVA 3U9CA 3EHAA 5AWMA 3DJ7A 4M14A 4DHFA 4HPUE 4O2PA 3DXNA 1TVOA 5I9ZA 2CDZA 4RFZA 4RIXB 4TNBA 2PUNA 3MVHA 4D2SA 4RJ3A 4YGAA 3EYGA 3S3IA 5CTPA 4FIJA 2W5HA 5C26A 4G6LA 3F7ZA 4PPAA 1GAGA 4ZTQA 1GZOA 3SRVB 3SXRA 3ZC6A 4BKZA 2J7TA 5I3RA 3HP2A 3D7TB 4DT8A 3GENA 1BMKA 2HW6A 5BVEA 3TUDA 3ZFXA 4RVLA 2WKMA 3PFQA 4MNFA 4ZS0A 5AUYA 1MP8A 5F20A 5L6PA 3CY2A 4FIIA 1A06A 1LUFA 4RLLA 3FMDA 4I0TA 4O21A 4TYJA 4H1MA 1XBCA 3ZDIA 2Z7QA 3Q2MA 4G3DA 3PA4A 4C2VA 4EK4A 1QPDA 2IZTA 4GH2A 1UKHA 3KXGA 3SW4A 3QQHA 4QMSA 2C5YA 3UNJA 1H28A 2BCJA 2OBJA 4LFIA 4DEAA 1PXMA 2QOLA 3ORXA 4IC7A 3TCPA 4B8MA 3IG7A 4HVSA 3CQUA 4ZLZA 4ERWA 3BE9A 4AP7A 4BDFA 3AT3A 5HNBA 4QTEA 4XG7A 3N9XA 2IW6A 3CE3A 4IMYA 1OL2A 3UNZA 4G17A 2GS2A 3O50A 4NFNA 3WZJA 4G34A 3RGFA 2JIIA 4ZLYA 3VF9A 4AUAA 3QC4A 5IQHA 3TZ7A 2WXVA 1UNGA 3GQLA 4N0SA 5ANJA 1S9IA 4ZTSA 4JG8A 4KIKA 2GNLA 4C61A 4AFJA 2BZIB 5DEYA 1G8SA 1XH8A 3QTRA 5IEYA 4P5QA 3MH1A 3OTUA 3PZHA 4XCUA 3D7TA 2XK6A 4L44A 5HBHA 3O8PA 3W10A 1OBDA 5IQCA 2J0MB 3WOWA 3F88A 3RCJA 4DGNA 1PMUA 2BHEA 5AP6A 2REIA 3HRFA 4YHJA 5CSWA 2R3OA 3HZTA 2PZYA 4O1PA 1BI8A 3C0GA 4FTMA 1SMHA 4E6AA 5ITAA 4IADA 3BHTA 4LL5A 4FV2A 2VO0A 4FV6A 3ZHPC 4YTIA 3ET7A 4DEHA 4AGWA 4OAVB 1XH5A 2QOCA 3L9NA 5L2WA 4MQ2A 1V0BA 4B4LA 4FE2A 4IEBA 3MFUA 4NIFA 3COHA 4U42A 3UZPA 3VS1A 5AX9A 4ZEGA 4QYYA 4CQEA 3G0EA 5J1VA 3D83A 4C37A 4BWKA 3L8PA 3EN6A 4MWHA 2ITWA 4QYGA 3ZBXA 1BUHA 4OT6A 3HDMA 4EOOA 4IFGA 3GOKA 4EZ7A 4ZY5A 5BPYA 5BYYA 5GJFA 5EFQA 5IKWA 4NCTA 1G5SA 3FL5A 4ANBA 4IQ6A 2O5KA 2OJIA 5AR2A 4RWIA 2VD5A 4TZRA 2OFUA 3MH3A 3KMMA 2YJRA 1WBVA 3G33A 3QQGA 3IOPA 3PXYA 3POOA 1H08A 5J87A 3LIJA 4FKGA 2YDJA 3EFKA 3WZDA 1V0PA 3HRBA 3P86A 3TEIA 3VQUA 5HIEA 4U0IA 4JR7A 2WPAA 4EI4A 3RK9A 1Q3DA 4I6BA 1YXSA 3IW7A 3VO3A 3TG1A 3A8WA 3QX4A 3TNIA 2ZM3A 3EMGA 4FEXA 3KU2A 3I60A 4O0RA 4AA4A 2J4ZA 3POZA 3VN9A 4Z7HA 2WQBA 2P33A 3QYWA 4OTDA 3JS2A 4UMUA 3OXZA 4FNZA 1Q99A 3OWKA 5DVRA 2C68A 2J2IB 2G01A 3PJ1A 4I6HA 2JIVA 3JUHA 3GGFA 4JR3A 5JKGA 4AFEA 2YEXA 1YVJA 2ZJWA 4NFMA 3MPMA 4BTKA 3F3TA 4AQCA 4BCNA 1TQMA 4BBFA 4EORA 3R9HA 4WD5A 2R0IA 4C3PA 4PWNA 2G9XA 3QTQA 4EOKA 3PLAE 3BYVA 2GNIA 3BGPA 3COMA 3MGYA 4J71A 4GUBA 4Y5QA 3M1SA 4L3LA 5LMBA 1FINA 3UC3A 1AD5A 4FIGA 3DK7A 4E5AX 4H3BA 3U51A 4Y73A 3KC3A 4FTOA 5HG5A 3Q60A 5HE0A 3K3IA 1CSNA 2CJMA 5E90A 5I0BA 2JKOA 4IXPA 3FMMA 3T3UA 3NAYA 2HZ4A 3TNWA 3NR9A 3UOKA 4YJVA 4FKSA 1SNUA 2OFVA 4QMPA 1HCLA 3VIDA 4QTAA 3QQFA 4BVUA 5KNJA 4PV0A 3NPCA 4DG2E 3KN5A 5AADA 2QO7A 3P23A 2ZV2A 3QRJA 2XA4A 1Z57A 4CQGA 4I94A 4UY9A 5HD7A 3RK7A 2WMVA 3UJGA 1ZOEA 3FKNA 3RPOA 4W8DA 5IQGA 4HYHA 4B6LA 2QO9A 3T9TA 1H1WA 2B9IA 4MXOA 4D2WA 4G3FA 3FMHA 2J5EA 5DRDA 3KMUA 4P90A 3R9DA 4IX3A 4RIXA 1H0WA 3KVXA 5LJJA 4J1RA 4F9BA 5ETAA 4JIAA 3PPKA 5IQAA 5KKRB 4EOLA 2VWVA 4FL3A 4PY1A 3IOKA 3UVPA 2PL0A 4HOKA 4YLLA 4MTAA 5AAGA 1Q8YA 4I5MA 5HESA 1XJDA 4I21A 4IAYA 5AP2A 5E4HA 4WBOA 4BYIA 4ANOA 3ATTA 3O0GA 5M44A 2IVTA 1A48A 4L3JA 4D2VA 4Q5HA 3UO4A 4IB3A 5DOSA 3ZMMA 2GFSA 3NSZA 4TNDA 4P4CA 5ACBC 4F1OA 4BDGA 3BBWA 3F5GA 3NS9A 4K0YA 3R21A 4WG3A 2Z7SA 4DYMA 3REPA 2VTIA 3AD5A 4YJUA 3RTPA 4ERKA 4O0XA 1T45A 3PIYA 4I22A 4CT2A 2I7QA 2YWVA 4OUCA 5IA4A 4HZSA 2VTHA 4KIPA 4WNMA 3W18A 2C6DA 3SLSA 4BICA 3F82A 1BL7A 4JXFA 5CI7A 2EUFB 3GT8A 3MPAA 3UDBA 3U9NA 3ZOSA 5L2IA 4CKJA 4IJPA 4YSJA 5IA0A 4NK9A 4M7IA 3EN4A 3OXIA 4RX9A 5FLFA 3E8CA 5C8NA 2RFEA 3LJ0A 2J51A 3QWKA 5M55A 5J79A 5CXHA 4IJ9A 2YM5A 2WU6A 3NCGA 4OBOA 1LEWA 5K4IA 1YOLA 3NZ0A 4GSBA 4O7RA 5JZNA 3HAVA 3DOGA 4CTBA 4YJSA 3VHKA 1Y8YA 2YFXA 4FSRA 4IANA 2IZUA 4V01A 5E91A 4Y5HA 5DT4A 5FTOA 4H3QA 2V7OA 1PMEA 3R63A 4FMQA 3EN9A 3L9LA 3ROCA 1JNKA 3MY0A 4O1OA 3BCEA 3D5XA 5H9BA 5HO6A 4ZSEA 3R83A 3VBWA 4II5A 4PRJA 2BDWA 1A9UA 1WVXA 2PULA 2OSCA 1F0QA 2XB7A 4BI0A 1FQ1B 3GCSA 3Q9XA 4WRSA 4CZTA 3D4QA 4U9AA 2WTWA 1DS5A 4N6ZA 5DE2A 4C4IA 4YZ9A 1OIUA 2HIWA 3P08A 4OGRA 3E7OA 2UUEA 3UG1A 3RNYA 5GJDA 2VNWA 4FZAB 1R0PA 1OIQA 4YJTA 3GFWA 2QOKA 4RG0A 2UZLA 3LMGA 2C1BA 5DLSA 3E8NA 3HUBA 2BUJA 3VHEA 5BVOA 4ENYA 3OW4A 3MFRA 2W96B 2C6TA 2XUUA 1J3HA 4FV0A 5L3AA 4GW8A 4F7SA 4WG5A 4BWXA 4R3RA 4J95A 4K6ZA 4G3EA 5AJQA 4DEDA 3R30A 2Y6MA 2OXDA 2VWWA 3VBXA 3UNKA 4F7NA 4QP7A 3OWPA 2WELA 3KF7A 2C5OA 4QYFA 3UQCA 1PXPA 3QU0A 1J1BA 3OCTA 2XEZA 5F95A 5E7RA 3ZFMA 3S0OA 5GIPE 5ICPA 5IH6A 1NVSA 2VO6A 4UWBA 4RWLA 5LVLA 4BFMA 4PDSA 1XBBA 3UIMA 4H39A 3KF4A 1ZOHA 4IACA 4NJ3A 1UA2A 2OJGA 4GIHA 5IQIA 4CVAA 5T6KA 5BVNA 3PJ2A 2EXCX 5IPJA 4HW7A 3BHUA 1Q4LA 2WTKC 4JJRA 3BBTB 4AN3A 1SM2A 1VEBA 5HTCA 3LCKA 2X0GA 2R3HA 4X3FA 2XK9A 4QTCA 3LFCA 3MVJA 1BL6A 2R7BA 4J8MA 2UW5A 3FLQA 4MXAA 4TXCA 4U44A 2W06A 4ITHA 2C3JA 4GEOA 3U55A 3PLSA 2DWBA 1W83A 4JT3A 4MXXA 4ARKA 4JQ8A 3UP2A 4ENXA 2WD1A 4YJRA 5HD4A 2PVYA 5HHWA 4OTIA 3C13A 4AS0A 1IR3A 3FYKX 3ZLSA 3OG7A 2XIZA 4BTJA
chains in the Genus database with same CATH superfamily
1U59A 4GU6A 3FPQA 3Q5ZA 1K9AA 2P2HA 3AGLA 2UZVA 2XYUA 2IG7A 4C4JA 2HCKA 4MBIA 3EQIA 5A54A 3CJFA 3I6UA 2X0OA 4X3FC 5JSMA 1H24A 3UO5A 4DT9A 4OTRA 3EL7A 3EL8A 2JFMA 4R6VA 2XANA 5C4LA 1PXJA 4TWCA 4G2FA 4WA9A 1XBAA 2PTKA 1IEPA 2R4BA 2WU7A 4R8QA 4IAZA 3TKIA 4MD8E 3U6JA 2PUPA 3NCZA 3SG9A 2XKEA 3DB6A 2WQNA 4P7EA 5C9CA 1XR1A 4IIRA 3EKKA 2DYLA 3LCDA 4IX4A 2QG5A 3F2NA 2VTLA 4U97A 4FSQA 4YHFA 5EH0A 4AZTA 3W1FA 2GPHA 4QP1A 2WTIA 3EQDA 1V0OA 3OWJA 3PXFA 5D12A 2X2LA 3RHXA 1APME 2QNJA 3P1AA 2R3JA 2X8DA 4YPDA 2UZOA 1VR2A 3MBLA 3ULIA 3IO7A 3O96A 5ANKA 2JAVA 2PMLX 3FQHA 3TKUA 3V3VA 5HQ0A 5KBQA 2HZ0A 4ORKA 5HG7A 2R3IA 5FUTA 2CKPA 4MBJA 1PXKA 4W4YA 3W32A 4OLIA 4ANQA 2EB3A 3DJ6A 1SYKA 4JX7A 4M15A 5FEQA 1VLRA 3LMHA 5AIRA 3N51A 3OP5A 1JKTA 4YJPA 5ANIA 5J7BA 3UGCA 1PKGA 2ITOA 4FKLA 3BL9A 4HPTE 3NNVA 1ZARA 4MF1A 2WMAA 2XK7A 4XBRA 5JFWA 3UVRA 3W0MA 2R3FA 3SRVA 2QQ7A 3E64A 2YIXA 4A9SA 4IVDA 4A4LA 3BX5A 4V05A 4AW5A 3MWUA 4D4SA 4L53A 1W84A 3WF7A 1DM2A 2J0KA 4JDHA 5IZFA 5CEQA 4A9TA 4RZWA 3QA8A 4QQTA 2HELA 4RGJA 3HRCA 1V1KA 4FKRA 4L7FA 4RJ7A 1GIHA 5FTGA 1YXVA 3ZFYA 3U54A 3B2TA 4N6YA 5CT0A 5AP0A 4YTCA 4NL0A 2YN8A 4GRBA 4RVMA 5DWRA 4C34A 5IUGA 5L4QA 3DFAA 4D58A 3ZLWA 2JKKA 3F7WA 4LL0A 2CMWA 5EDRA 3LCSA 4C8BA 3DXQA 3D14A 4IZAA 4YNOA 5LVPA 2PZRA 5CAOA 2CKQA 5CNOA 3E5AA 4IZ7A 3HDNA 4FV3A 3P9JA 3U87A 3ZO2A 4YLKA 5HO8A 3KL8A 3KRXA 2XM8A 3VUGA 4F78A 2BRHA 5HU3A 4E5BA 4RIWB 1OL7A 3EFJA 1MRYA 3IGOA 3FHRA 3I81A 1H1PA 4JBQA 3DU8A 5A3XA 4E73A 4XBUA 1W0XC 3R22A 4EK8A 2E2BA 3NUNA 4JAIA 2J6MA 4MF0A 1OKVA 3EFWA 4XG2A 3QUPA 3U6IA 4XG8A 2BAJA 1M2QA 2VWUA 4DEEA 4EHVA 1ZLTA 2C4GA 4KKHA 1KWPA 3FDNA 3OS3A 4F4PA 5EI2A 5I9UA 3MIYA 2YZLA 3Q2JA 1LR4A 4S32A 2HXLA 1P2AA 3HVCA 4XUFA 4V0GA 5AUWA 1XH4A 3FQEA 3H4JA 3UYSA 2UZTA 3GBZA 3R8MA 3LZBA 1RQQA 1XMMA 4QOXA 4DHZA 4WG4A 1QPCA 5FEDA 5DYJA 4YZMA 5IEVA 2YITA 4LI5A 4RA4A 2PVNA 3K5VA 1S9JA 4K33A 3RNIA 5B7VA 2QOOA 5D11A 4ZTMA 4YJQA 4EOPA 4FBXA 3DLSA 5FM3A 4MVFA 3TM0A 4XP2A 5M51A 5M08A 5GZ9A 5JGBA 4ASZA 3SVVA 1PHKA 2PE1A 2BR1A 3EN7A 5C4KA 2G15A 4M66A 1KE7A 3I0OA 2VWYA 2J90A 1ZMWA 3QHRA 5CX9A 3ZZEA 5M06A 4AW0A 5IU2A 3L8SA 4USEA 3R7GA 3D5WA 4N4SA 1ZYJA 2WQEA 3BWJA 3JVSA 3ZSGA 4GIIA 4UN0C 1U54A 2C3IB 1YQJA 1KE6A 4IM0A 5D9HA 5TO8A 3WZUA 4BZDA 3GCVA 4J7BA 4ZTHA 4QMQA 2X2KA 4BN1A 4EOMA 3G2FA 4M84A 2XJ0A 2RFNA 3IS5A 3R0TA 3ZBFA 4I4FA 4WO5A 3F5UA 4LV8A 3WE4A 5AEPA 3HP5A 3KRRA 3Q32A 2YIRA 3QKLA 1TKIA 4GK3A 2WMSA 3HA6A 3LAUA 2VWIA 3PWYA 3QTWA 4CFNA 4W4VA 1R78A 4FKWA 2C3KA 4GKHA 3ORNA 4Z9LA 3UQFA 3QCQA 4R5YA 3HGKA 4FVRA 3VS4A 3HV3A 4AZSA 4JI9A 3TZMA 2X2MA 5E8WA 3UTOA 2BTSA 4OTGA 4RFYA 4ACHA 4ZP5A 4CKIA 2V62A 2OI4X 2WOTA 3ZUTA 3HMPA 2GDOA 3DZQA 2R3QA 1WCCA 4YLJA 5EM8A 2YHVA 1FPUA 2VU3A 4S31A 5C27A 1IA9A 4FTKA 3PSBA 1GZ8A 3VVHA 3OVVA 1J1CA 5CSPA 2WTKB 4WBBB 4AWIA 3KFAA 1GZNA 4UX9A 2VTOA 4KWPA 3TZ9A 5BX0A 2R3PA 2ZAZA 2BKZA 2P2IA 3NWWA 5EDPA 2HY0A 4YMJA 5K5NA 3PXZA 3DBFA 1Z9XA 3GCPA 5L2TA 4HJOA 4O27B 5FM2A 4BJJB 1PMVA 2OJ9A 1IAHA 4EJNA 3OY1A 3ZM9A 1G3NA 1OBGA 2X7OA 3WF6A 3BQCA 3DB8A 3JY0A 3VNTA 2CGXA 1M17A 2OO8X 3QLGA 3VJNA 3VS3A 4FG9A 4AGDA 2X8IA 5KX8A 4R77A 3GC8A 3KK9A 3D7ZA 4OT5A 3R2YA 4EOQA 4JRNA 4YU2A 2W5AA 3ORPA 2F7ZE 4BL1A 4X2KA 3KXZA 3GFEA 3DKFA 1W2FA 4DGOA 2Y9QA 4E6QA 3LXKA 2VTMA 5CI6A 5A6NA 4FTTA 2BZKB 3FUPA 4FGRA 3ZSIA 3MY5A 1UU7A 5H2UA 4RIWA 4W9WA 5AAEA 2YJSA 3W0PA 3R8LA 4TYHA 4Y85A 1U46A 4U8ZA 5TKDA 4KNBA 4F0GA 2P0CA 3PVBA 4ALWA 3HEGA 3GP0A 3NIEA 1STCE 2WGJA 2EB2A 4PMTA 3B8RA 4RWKA 4UZHA 5EHYA 5AUZA 4KIQA 3CLYA 2QU6A 2VV9A 4C3FA 3PPZA 5DT3A 4CZUA 2XIKA 4FKUA 5E92A 1B6CB 1JBPE 3A7JA 4FYOA 4C59A 4UALA 3T3VA 4I92A 1UU8A 1Q24A 2PVRA 4PF4A 3VS2A 5HORA 1ATPE 5EYCA 4CG9A 2DS1A 2HAKA 1SVHA 2BKKA 4PDPA 4FT9A 4W8EA 2I0HA 3SD0A 3AKJA 3MI9A 5A46A 1CMKE 4LRKA 2RGPA 3FLWA 2ZM1A 5IQDA 4WSQA 3AMBA 4I23A 4WHZA 4F9AA 3NFGB 1OUYA 3QXOA 4UYAA 3O7LD 3UPZA 1WBWA 4MKCA 2QO2A 4BI2A 2XALA 3A2CA 4BIEA 1EH4A 5J1WA 1UWHA 2YACA 2YABA 4QQCA 5H8EA 1Q5KA 4JX3A 3AT2A 3VBYA 3CGOA 3ZH8A 4IX6A 3RKBA 3TWJA 3C4EA 2GS6A 1M52A 2C6MA 2HW7A 2NRUA 1FGKA 4FIFA 4GT3A 2P55A 3G6GA 4A4OA 3Q5IA 3DY7A 4DFXE 4QEBA 3WF8A 4O7SA 4BGHA 1G8AA 5BVFA 5IMXA 2RSVA 3MV5A 3ZTXA 3QCYA 2LAVA 5HTBA 3DS6A 4QMNA 3W2PA 2X39A 5CU6A 1O6KA 1QCFA 4UBAA 4C36A 2I0VA 3ROYA 4BCQA 4LUEA 4U80A 4O38A 5CNNA 3KY2A 2G2HA 4O7LA 1UVRA 4MXCA 5CEIA 3WZEA 1ZY5A 5CSHA 5DIAA 3A8XA 1O6YA 3IDCA 4U40A 3Q52A 1PW2A 3I6WA 3QQKA 5EK7A 5FDPA 4ZLOA 4C33A 4JOAA 5JGDA 4HVHA 2UW9A 3ZUVA 2W99B 2EXEA 4L68A 4AT4A 4AGCA 5M07A 2ITXA 3QALE 2CHLA 1FMOE 2C5XA 2FSMX 4U43A 3QD3A 2ZMCA 5FBOA 3U6HA 2W9ZB 2HXQA 2O63A 3LQ8A 1OZ1A 3EQBA 4DBXA 5EM7A 4BDBA 2YISA 2V22A 3E88A 4FKQA 5TE0A 2H34A 4M3QA 4EBWA 5AP5A 3QLFA 4J52A 2GNHA 2P3GX 3Q04A 5DR9A 3PRIA 5B0XA 4APPA 5JH6A 3BZ3A 1IG1A 4KABA 5C1QB 4TKSA 1DAWA 2UZWE 4FKVA 2WB8A 1Q61A 4D1XA 3IDPA 3GB2A 1LP4A 1QMZA 2VTSA 5EOBA 3E87A 4YSMA 4E4MA 2VZ6A 3Q53A 4ITIA 3KEXA 4YC6A 2BVAA 3W0NA 1UU9A 1ZYCA 2UV2A 3F9NA 4RQVA 5AM6A 2WO6A 3C4XA 4ZTNA 4QO9A 4FL2A 3LFEA 3P7BA 3VULA 4L46A 1ZYLA 3NYOA 3R28A 2B4SB 3UE4A 3R8PA 4O7NA 4EL9A 5E9EA 2Z8CA 1NW1A 5HZNA 2B1PA 2C6LA 4LUDA 5AIKA 4R7HA 4ZSGA 2X7FA 5IG1A 2OF4A 3E62A 3NMUF 1KOBA 4GYIA 5LVNA 2E9VA 2PUIA 2JGZA 5JGAA 3BHHA 3NIZA 4ZMFA 4LGDA 2BROA 4Y72A 3TKHA 3V5TA 3LM0A 1RDQE 4NJDA 2QHMA 3PA3A 4XRLA 4I20A 3TZ8A 2GTMA 1J91A 4FK3A 1ZYDA 4E6DA 2VNYA 5IA5A 4XV2A 4IC8A 4QMOA 4DH1A 2OLCA 3PPJA 2IVVA 1XWSA 3SW7A 5CEOA 3PZEA 4FTNA 4L3PA 1H4LA 4UEUA 1JLUE 4RLKA 3SKCA 3TUCA 4U45A 1SNXA 3ID6C 2W4OA 2J0LA 3FLSA 4UB7A 1PXIA 4Q2AA 5KHWA 4LMNA 3SQQA 1SVEA 4QNAA 4BDCA 4ZAUA 3RPVA 5IA2A 3FSFA 2BFYA 2GMXA 3DDQA 5HOAA 3OD6X 4I5PA 3LPBA 4IAKA 4EYMA 4EZ5A 3HL7A 1PY5A 3EN5A 3FMLA 5HCYA 5A9UA 2ONLA 2ERKA 4AE6A 3NNXA 4IB0A 5CY3A 3UYTA 3FBVA 3AOXA 2KULA 5KE0A 4IAFA 4F9YA 5IDPA 5A14A 5FG8A 4YJOA 3KXHA 4GYGA 2H9VA 3LLTA 4IFCA 4YZNA 2I1MA 4C02A 1QPEA 4FKIA 4W4WA 4Q9SA 5F4NA 4XHKB 2Y4PA 4DC2A 2B54A 3JY9A 4E26A 2W4KA 1SZMA 4QD6A 3MIAA 2VWXA 2OXYA 5KMNA 2WMQA 3QC9A 3I4BA 2YAAA 3KRJA 4PL5A 4E6CA 3NVKI 4D0XA 2IVSA 3FC2A 4XEYA 4XOYA 5LOHA 2CNQA 1YOJA 1MRVA 4FTJA 2B52A 3UOHA 3R7UA 2EVAA 2W7XA 1WAKA 4U7ZA 4KSPA 5B2KA 2ITVA 1AQ1A 2OW3A 2F57A 3HMMA 4O6LA 4O0YA 2ZDTA 2RL5A 5EI6A 4XG6A 2CGVA 1P14A 3FMNA 1H25A 3V8SA 4YR8A 5IISA 3OCSA 2QOQA 4B0GA 3BWFA 2ITPA 4TYEA 3ZS5A 5BVWA 3SG8A 3C7QA 4GVJA 4QDVA 3BV2A 4LG4A 3NW7A 2B9FA 4FNXA 5J9LA 4BCGA 4D9TA 2O65A 4MCVA 1MRUA 2QHNA 5L2QA 4QDEA 2O2UA 2C3LA 4XS2A 3IQ7A 4EC8A 2W1GA 2CCHA 4FT7A 2B0QA 4EH7A 4G31A 5EM5A 2DQ7X 2W17A 3IPHA 2W1DA 4YNEA 5KMIA 4FTRA 1W8CA 1KOAA 5AA8A 3I7BA 3KXNA 3PP0A 4HVGA 4NTTA 4D4RA 4RPVA 4QT1A 2XAOA 3VUDA 1J7LA 2ZFYA 4EHEA 5DPVA 5EW9A 4FZ7A 2BALA 3KVWA 1NVQA 2WEIA 3ZC5A 3TDVA 5BVKA 5JMSA 4MHAA 4D9UA 5D1JA 3MA3A 3I0QA 3OT8A 1YXUA 3CPCA 3PIZA 3RHKA 3FEGA 3A4OX 4FG7A 2JDVA 4EQUA 2FB8A 4RC4A 1YOMA 4PP9A 4CT1A 2NP8A 4F7LA 1XH9A 4GVAA 5CEMA 3LXPA 3E92A 4N70A 3OY3A 4AZFA 4DFNA 4A9RA 3TIYA 4B8LA 3I1AA 2W1EA 5AAFA 2FSLX 3GU5A 4IWPA 2A1AB 2PMIA 1OPLA 3PG3A 4RJ5A 3RAWA 2I0YA 3UIUA 3R02A 4BKYA 4DLJA 4EOIA 3F3ZA 3LJ1A 3PRFA 4IB5A 3V8TA 5TT7A 4A9YA 4PUZA 4C38A 4XP0A 2E9UA 4FV5A 4Z3VA 4H58A 3UBDA 4PTCA 4R1YA 4RFMA 3AC1A 4B7TA 4OTWA 3OROA 4UZDA 2R7IA 2HOGA 2WMWA 3D94A 4K11A 4LOOA 1H0VA 4EOJA 4FOBA 3VRZA 3DZOA 4CFMA 3EQPA 4QMUA 4EONA 4ID7A 1YHSA 3F5PA 3FI4A 2XNBA 5LQFA 2F4JA 5ACKA 2FSOX 4F0FA 4DGMA 3UDTA 4UXLA 3NUPA 4K18A 3QGYA 2BRGA 2RIOA 4CV9A 1OB3A 2R3MA 3DLZA 2V55A 4NEUA 5E8UA 3DTCA 2BRBA 2IWIA 3PE1A 4WOVA 3MVMA 3AT4A 4BDJA 4JMQA 4TRLA 4CGAA 5AP3A 4O7VA 3PY0A 3CY3A 4H1JA 5EKNA 2FVDA 3V04A 2YCSA 3P79A 1W7HA 5BYZA 1UNLA 2W9FB 4EEVA 3DQWA 3FWQA 4WNKA 4IX5A 3R7EA 4USFA 3UZRA 3AC5A 2E9OA 1YI4A 4HYUA 3BRBA 4H36A 4JBPA 1L3RE 1REJA 1ZWSA 3ZXTA 3RINA 2JDRA 1YW2A 1OIYA 1ZXEA 4DCAA 3FI8A 4I5HA 2PZPA 5ANOA 3QD0A 4ZMEA 4FVPA 5KMJA 5CSVA 3VW8A 1ZY4A 3BE2A 3WARA 5AFVA 4EUTA 4XMOA 3A7GA 1ZOGA 3L8VA 3TUBA 5IA1A 1WZYA 2PHKA 2EU9A 3PWDA 3TV6A 1UU3A 2YERA 2YIYA 4FTUA 5CYIA 3O23A 4X6QC 3R8UA 1U5QA 3O2MA 1CKPA 3EYHA 3BGZA 4LOPA 2HK5A 4BKJA 3PUFC 2QOHA 2JIUA 4M69B 4G16A 5CS6A 5K9IA 4JLCA 5FDXA 4OBPA 3CIKA 4GG7A 4NZWB 5E1SA 5GZAA 3PY3A 3COIA 3BHYA 3ZONA 1MUOA 3CD8A 4CNHA 4ANMA 4EK3A 2JKMA 5LCKA 1OL1A 1YI3A 3DCVA 4TL0A 3WYYA 1U5RA 2XBJA 1M14A 4ACMA 5CQWA 4BCMA 1LEZA 4PPBA 1R1WA 1PXOA 4CTCA 5IQEA 2PU8A 2QR8A 3PFYA 3QXPA 4ZS4A 2ONLC 3FZOA 3N4TA 4EC9A 4R7IA 4AXFA 4CYJA 2PSQA 4HZRA 5L6WL 5AR7A 2VTQA 5HVKA 2JC6A 3OTVA 4RSSA 3NUSA 4LGHA 4CMOA 3PYYA 4FT0A 3BLRA 2VTAA 1JSUA 3PA5A 2CGWA 2X9EA 1PKDA 3GNIB 4XV3A 3U8WA 5EHOA 2GFCA 3OCBA 3U4UA 3RPYA 4F9CA 2VX0A 2FGIA 2G2IA 5I4NA 3F2RA 3KXXA 3AKLA 4AT5A 3BV3A 4NW6A 4RT7A 4OTFA 3FXZA 1RJBA 3G51A 2XK4A 3VS0A 3DGKA 2I6LA 3FSKA 3G9NA 5EM6A 2VTPA 4UMRA 4M68A 3MH2A 1FBNA 3HAMA 4ACDA 3AG9A 2R2PA 4EWHA 2F7XE 2YCRA 4BDDA 5EQPA 3O17A 3VONA 4CRLA 1H00A 2UW4A 3OOGA 5BQ0A 4UWCA 5J95A 2R0UA 5KZ0A 3U4WA 4DDGA 3A62A 5TOZA 1NT2A 1JKLA 4YBKA 3UG2A 2AUHA 2F7EE 3H30A 2VWBA 4DHIB 4CFVA 2UZDA 4WUNA 3F6XA 3BEGA 3KQ7A 3R7IA 2R3GA 3K2LA 4O83A 5CANA 2Z02A 1YHVA 4C62A 5HX8A 4TT7A 3DKGA 3EQFA 4DITA 5E8TA 2IZRA 3A7IA 3R7OA 2AEGA 4ASEA 4AXEA 2A19B 4YTHA 5LARA 4BI1A 2QKRA 4BCFA 3TIZA 5A4EA 5I9VA 4WUAA 2WEVA 5HE2A 3P78A 3W8QA 4GUEA 2XS0A 3AQVA 3W0QA 3QRUA 5LWMA 2W5BA 3IGGA 4BYJA 4DH3A 5AUUA 4AW1A 3H0YA 3RK5A 5DR6A 3FI3A 4O0VA 3V5WA 4MEDA 5H8GA 4IB1A 2BAQA 3MFSA 4S30A 5HO7A 3MY1A 2YM7A 4HNIA 3MW1A 4I3ZA 2ITZA 3E3BX 2ZOQA 5J9YA 3QD2B 2I0EA 1FVRA 1TZDA 5AUVA 5T68A 2RG6A 4F65A 3G15A 2ZB0A 3SDJA 3EWHA 3II5A 1K2PA 4JQEA 4MX9A 4XG3A 2RKUA 3AC8A 4ZSLA 3TT0A 4QPAA 1KUTA 4MH7A 5DT0A 4M8TA 1U4DA 4CFFA 4ZY4A 4EHGA 4CG8A 2WMRA 3QA0A 5F9EA 3MESA 3Q6UA 3P7AA 4N57A 4D55A 2A2AA 1W98A 3BEAA 5JFSA 3QZIA 4IAAA 4MWIA 5F94A 5DNRA 2XF0A 3ZU7A 3KK8A 3FC1X 4M0YA 1MQ4A 4D1SA 2W1IA 2QC6A 5CVHA 5FGKA 3GOPA 2X9FA 5CSXA 4F9WA 4I0SA 4FKJA 4FL1A 3BQRA 4C2WA 4FRFA 1B38A 1IRKA 2XVDA 3DXPA 4M0ZA 3AGMA 4EKKA 4F1TA 2NYAA 2X1NA 2UZBA 4H05A 1I44A 5CENA 1JOWB 3O8TA 3QYZA 1VYWA 4LMUA 3P7CA 4LRJA 5AUTA 5HG9A 2VGPA 5HE3A 2R3KA 3UO6A 2WMTA 3LFAA 4BTFA 3ANRA 4ALUA 4F63A 3F3UA 3MA6A 4O82A 2ACXA 4FODA 2W4JA 1XO2B 2GTNA 4IVAA 4F7JA 3GXLA 3THBA 5M09A 3UIBA 3ORTA 5DFPA 1GOLA 1OECA 4ASXA 3WF9A 3VF8A 1H01A 2CGUA 2WIPA 3NGAA 3NUXA 4YC3A 2F2UA 3ENMA 3TACA 4KKEA 5E8SA 2C47A 3GC9A 2W1FA 3EZVA 3W2OA 3RAHA 4QYEA 4A4XA 4O0SA 2QOIA 3OHTA 5AR3A 2GCDA 2ZVAA 2BILB 4I4EA 3E3PA 4RRVA 3CP9A 5CAQA 4PPCA 3ORIA 5EDQA 2J9MA 4FVQA 1H26A 2Z7LA 4AX8A 2XIRA 4DCEA 3N4VA 2XAMA 3ZZWA 2B7AA 5BVDA 3LLAA 1Y57A 4JDJA 4QP6A 2OJJA 2HWOA 3H9FA 3VJOA 4R5SA 4KUJA 3AD6A 2YM6A 2YA9A 3LFQA 3O7LB 4IDVA 4RC3A 4AA0A 1Z5MA 4ZZOA 3OF0A 4NCTC 1CM8A 3Q3BA 3TJCA 3BGQA 5IDNA 2I40A 1WMKA 2QURA 1YRPA 3O71A 3MH0A 4HGSA 5TF9A 2OIBA 2XJ2A 3GCUA 2NO3A 5DR2A 3EJ1A 5AUXA 4HYSA 2GHLA 1OPKA 2JBOA 3BU6A 3DV3A 4D28A 4G3CA 3KN6A 4KIOA 3BLHA 2UVZA 1BKXA 3EZRA 4MUQA 2F2CB 1O9UA 2PE2A 4JVGA 4Q5EA 4XG4A 4O81A 2H96A 3R7YA 1P5EA 5M56A 1RE8A 2G2FA 1JSTA 3LW0A 4BDKA 4NKAA 1M2RA 4LM5A 4XJ0A 3N4UA 4ZJVA 3UMXA 1RW8A 2JDSA 3FZSA 4AAYA 4P5ZA 1J7UA 4BHNA 3LMIA 2ZDUA 3ZRLA 4ZOGA 2BDFA 5HIDA 4ZZMA 3FXXA 3ML1A 3ALNA 2OIQA 4RQKA 4ZJIA 2GNJA 3OBJA 4MNEA 4G1WA 5J8IA 4I6FA 5IA3A 3DAKA 1IAJA 1ZRZA 5FXRA 5JEBA 4CEGA 3QX2A 5BYLA 1W2DA 2F49A 2X6DA 4GJ2A 2X7GA 4J8NA 4QYHA 4RWJA 1TQIA 5I5ZA 3MB7A 4ZSJA 3SGCA 1ZYSA 3HECA 3NUYA 4YURA 4JDKA 3WF5A 3ORLA 3O5AA 5EQYA 3EFLA 4E4LA 3NYVA 3S95A 3ORMA 4I1ZA 3NUUA 3VUHA 3SXFA 5E8VA 1PF8A 4F64A 1P4FA 3OUNB 4C4HA 4AN9A 3VS5A 5AV3A 3C5IA 3MFTA 2SRCA 3PSDA 2OIDA 4M67A 5KO1A 3UQGA 2EWAA 2HENA 2ZMDA 3QCXA 4L42A 4AOIA 1TQPA 3CC6A 1WBTA 5HGIA 4O2ZA 2CNVA 4PQNA 4BCKA 2CPKE 2GSFA 1CTPE 2IN6A 4LOQA 1TFFA 4DFUA 5BUEA 1PYEA 4NM3A 4JG7A 3IK3A 4FTIA 4GK2A 1PYXA 2OZOA 2ETMA 4BJJA 2BDJA 1CKIA 2XKDA 3FY0A 4CCBA 3SX9A 3FPMA 3LFDA 3F3WA 4D2RA 5IQBA 2JLDA 3FKOA 3WIKA 3ZO4A 3TXOA 4I0RA 4E93A 4C0TA 4USDA 4X2GA 1XH6A 3HUCA 3FLZA 4FT3A 4R3CA 4WT6A 3QD4A 4DBNA 2XM9A 3BYSA 4OAUC 3LM5A 3EQHA 1W82A 3FMEA 3BI6A 3HYHA 2YM4A 4U6RA 2OH0E 5ANEA 1Q8ZA 3DBQA 3FZRA 3UZTA 2C69A 5B2LA 5IH4A 4EH6A 3DBEA 3L8XA 4ASDA 2BFXA 3A7HA 2X4FA 3R04A 1Q62A 2R5TA 4ACCA 5JK3A 4G3GA 2JAMA 4HCTA 4I5CA 4JAJA 4KIKB 3W2QA 3Q4ZA 3QZGA 1REKA 4AE9A 4PMSA 4C4FA 4L7SA 2VRXA 2JEDA 4FTCA 5EI8A 4TYIA 4G9CA 4EH5A 1FGIA 4FSTA 5CF8A 4GL9A 5GNKA 4GS6A 3M11A 1BYGA 2UW6A 1YWNA 2BZJA 4L8MA 3VRYA 4FSNA 3G9LX 1Y91A 4C3RA 4D4VA 3AXWA 4IE9A 1JPAA 2X0QA 4FNWA 1WFCA 2WZJA 4BCOA 4GT4A 4FR4A 2C0IA 2YM3A 4O91A 4QMWA 4XP3A 5EG3A 4C4EA 3NLBA 3GC0A 3FMKA 4FIHA 2Y0AA 5IF1A 3C4WA 2BRMA 5M4FA 4O86A 4HYIA 2P4IA 1BI7A 5HVYA 3FLNC 3QZFA 3TNHA 3GU6A 4QMLA 4D5KA 5GZ8A 2RFSA 3EOCA 3RZBA 3QUEA 3OEZA 4AACA 4DEIA 4Y95A 2ZV7A 1YDTE 3A60A 4TY1A 3LJ2A 4IAIA 4IZ5A 1ST0A 4GCJA 4DG0E 4MK0A 2XYNA 3QKKA 3ZEPA 4D0WA 5CQUA 3Q4TA 4UWYA 4Z55A 5AX3A 4MXYA 3BHVA 5HNGA 1WVYA 3PJ3A 3IONA 4CMTA 3GVUA 3PUPA 5JQ8A 3NEWA 3Q96A 2QU5A 4MD7E 2HZIA 3W33A 4GFMA 4EH2A 5GIOE 4FZ6A 5CU4A 4QP2A 4CFXA 4PNKA 3KRLA 5HG8A 3CTQA 1YDSE 3OOMA 1XQZA 3RI1A 2IO6A 1PMNA 1UNHA 2XCKA 3DJ5A 3MB6A 4EQMA 1M7NA 4O6EA 4DF3A 4DDIA 4UMPA 2WHBA 2FH9A 4F6UA 4FKTA 3FAAA 4GFOA 2Y4IC 4BBMA 1OIRA 3NAXA 1Y8GA 3FZPA 4M12A 3K5UA 3Q6WA 4CXAA 3R6XA 4FUYA 1CDKA 4NKSA 3Q9YA 2E9PA 3FLYA 3D2IA 2XIYA 4NT4A 5CVFA 1Q8TA 4E4NA 4F08A 4CLJA 5JFXA 3HLLA 3R1SA 1FVTA 1LPUA 4FICA 4QQJA 3GC7A 4QP4A 4AZWA 5A6OA 3TNPC 1H27A 2YCFA 2HYYA 5FRIA 3D9VA 4IVBA 1FMKA 3PE2A 2Y7JA 2XNMA 4AN2A 4BF2A 4X3FB 3BU3A 2NPQA 1ZZ2A 2QVSE 5FXQA 3RPSA 1VZOA 3QHWA 2WNTA 3NX8A 4BCPA 4CKRA 3R1YA 3KCKA 3RCDA 1NXKA 3QUDA 4PDOA 1OGUA 3RMFA 2FYSA 4YBJA 3FE3A 4J97A 3BPRA 4BDAA 4PTEA 2OICA 4YP8A 2ITQA 4LYNA 5CVGA 4PMMA 2QKWB 4ZK5A 2O3PA 3K54A 3C5UA 5M4IA 2OJFE 2PVFA 4U41A 5KCVA 4G9RA 4E7WA 3C1XA 3BLQA 5IMEA 2WTVA 3DT1A 3LQ5A 2WFYA 2GS7A 3IDBA 5ANDA 1DAYA