5JG7A

Crystal structure of putative periplasmic binding protein from salmonella typhimurium lt2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
160
structure length
148
Chain Sequence
EKFKVITTFTVIADMAKNVAGDAAEVSSITKPGEIHEYQPTPGDIKRAQGAQLILANGLNLERWFARFYQHLSGVPEVVVSTGVKPMGIHAWMSAENALIYVDNIRDALVKYDPDNAQIYKQNAERYKAKIRQMADPLRAELEKIPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative periplasmic binding protein from Salmonella typhimurium LT2
rcsb
source organism Salmonella typhimurium (strain lt2 / sgsc1412 / atcc 700720)
molecule tags Metal transport
molecule keywords Fur regulated Salmonella iron transporter
total genus 38
structure length 148
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5jg7A00
3AEQB 3AEQA 1M1NA 4G09A 4WESA 1QH1B 1K75A 3AEKB 1M34A 2PRSA 4WNAB 3LI2A 4BBPA 3MWGA 4OXRA 1M1YA 3R5SA 4FI3F 4HMPA 4CL2A 4NNPA 5BVGA 4M7OA 3EIXA 4H0FA 5JJ5A 4GICA 2AFIB 4INOA 5BVHA 4WN9A 3U7QA 4K3VA 2YNMD 3HH8A 4TKVA 5JOQA 2XDQA 1N4AA 2R7AA 1G20A 2R79A 4TKUB 3ZK8A 3K1AA 1L5HB 4HN9A 4H59A 4LJSA 2QI9F 2O1EA 1PSZA 2AFIA 5FLYA 4TKVB 5CR9A 5JG7A 3AETA 2PHZA 5GGYA 5KHLB 1EFDN 5GGXA 1PQ4A 2Q8PA 2WHYA 3PSAA 4PAGA 2XDQB 3BE5A 4MDYA 5BVGB 3G9QA 4WESB 3PDIA 2WI8A 4WN9B 3MFQA 4HMQA 1QGUA 2OGWA 3CX3A 3TLKA 3R5TA 1M1NB 2OSVA 4WZBB 2PS9A 2M6KA 1K7SN 4FKMA 4PM4A 1H1LB 3BE6A 3UJPA 3MINA 2RG7A 2MINB 5JPDA 3AERA 3AERB 1MIOA 4OVKA 5HX7A 4MO9A 1QGUB 1QH8A 4WZBA 3PSHA 5KOHB 1XVLA 4G07A 4ND8A 5M3BA 5CX1A 1H1LA 2M6LA 4B8YA 4UTPA 3PDIB 3TEFA 1KAEA 5KOJA 4MX8A 4MLZA 4NNOA 3MINB 3AESA 2X4LA 5M29A 2OV3A 4XPIB 5I4KA 1G21B 1KARA 4WZAA 3AETB 3K1AB 1FP4B 4OXQA 5B58T 2AFHA 1G20B 4UTOA 3AEUA 5M2QA 1L5HA 2OV1A 2AFHB 2Q8QA 4UDNA 1KAHA 1G21A 2PS0A 4XPIA 3HXPA 4FILA 4TKUA 3TNYA 4DBLE 3HJTA 4UDOA 1ESZA 2XH8A 2XUZA 3AEUB 1M34B 4WNAA 3ZK7A 3ZTTA 1K0FA 3AESB 3MD9A 4ND8B 4WZAB 1QH1A 5AFSA 5KOHA 3GI1A 1TOAA 3U7QB 4FNAA 2PS3A 5CX1B 1FP4A 1K2VN 1N2CB 3MWFA 1MIOB 5BVHB 4IRMA 5KOJB 5M34A 2XV1A 3AEKA 3NU1A 3ZK9A 5HDQA 1M1YB 4INPA 3ZKAA 2YNMC 4N01A 2MINA 1QH8B 1N2CA 2XY4A 3EIWA 3LHSA 2XQVA 2ETVA 4HMOA 4LS3A 1N2ZA 1N4DA
chains in the Genus database with same CATH superfamily
3ET5A 2Y1DA 4UMVA 1L7QA 3BXGA 1SMKA 3K73O 4JMPA 4RY2A 3CWZA 2RHTA 2YXEA 3WYGA 2LNDA 4FD2A 4GM1A 3B5EA 2W37A 1W36D 1BW9A 4J7CA 1UM9B 3PVZA 4Y1RA 4N48A 1ZUD1 1QOPB 2A58A 2NVBA 1W88B 2QM8A 1NW9B 1QHHB 4ID9A 3TR0A 5LQAA 1TQ6A 4DCSA 1KEEA 4FR2A 2OCXA 4ZN6A 2VQDA 3HDTA 3SIPA 2ZU6A 3ESXA 5DTEA 4Q18A 3RBZA 1NXTA 3CSSA 3FY4A 1RACA 1ZH2A 2GO1A 4GOLD 1TUBA 3MRSA 4ETMA 4EVRA 5ILQA 4U2DA 5HBGA 1JFTA 1GG8A 2JGDB 4L4SA 4C4SA 4G1UC 2ZGVA 3LQQA 4JH0A 1YZVA 3KQMA 4QFCA 3IODA 2GBLA 3LBYA 4OMUA 5EP4A 2NO0A 3KJQA 1WMFA 4MDYA 2D74A 3T06B 1JJAA 2OLKA 2VAXA 3C8MA 4AF8A 2XVYA 5CVUA 3SDZA 5B6IA 2O3TA 1BN6A 4LTDA 5EE3A 2BM9A 5KCZA 4D4MA 2CMFA 2Q3JA 3S70A 3FUWA 3BWEA 1TQDA 4IGAA 4GYJA 2QV7A 4NJOA 4RHCA 2BF4A 4PPGA 1Y6FA 1HT3A 3KZOA 1R74A 4RD2A 2Q1YA 1GZ7A 2RG7A 3RANA 3CNOA 5IEJA 5GV7A 3WNVA 2YWXA 1I7DA 4EA8A 1YXMA 1S01A 5EHIA 5LBIA 4C6SA 2A33A 3DZHA 1ZCFA 3PSHA 3ZDBA 1ORDA 2ZB2A 3OZDA 5A1JA 4KBYA 2ZIFA 4LOHA 3MCAA 3GF4A 4RXTA 4X92A 3SCZA 5KQGA 1N0WA 2B7LA 1YI8A 1U0EA 4AS2A 3VDQA 3IHWA 3CNLA 2QW8A 4C0BA 4DWVA 4MZXA 4Y0AA 3IDZA 4BZQA 3HPRA 3IT3A 3BBLA 3WOHA 2H4YA 4HDSA 3LBFA 3ZUPA 2GARA 4BZPA 3K1ZA 2B0JA 1E92A 4AJHA 5DNVA 1L0BA 1TZKA 3I8OA 1HE2A 5KYVA 1T5LA 3LPAA 3VNRA 3CNNA 2KQUA 2AZ4A 2FF5A 3DBIA 4F9TA 4N40A 1XKXA 2H9IA 2P9FA 4FMBB 2XWJI 4M60A 4EELA 4BGVA 2H51A 1GFIA 3F0TA 4IVRA 3TTVA 5B30A 3ZXUB 4X44A 5C8VA 3PLRA 1GGKA 4RKRA 3HCNA 3CVVA 4RQAA 2AMVA 3KKLA 3R7WB 1AKEA 2C1ZA 1QH0A 2VRBA 3FPKA 1MAVA 3PNPA 1V4BA 4K9SA 4J3NA 3QTTA 5AI4A 2Q2VA 1X7GA 1ZGGA 4UTRA 3E3OA 4QXOA 3H3JA 1V5FA 3D4BA 3GUYA 4JVSB 5JD6A 2REXB 4AQYB 3U19A 3P9IA 3E3LA 1T8RA 2ZDGA 4WSOA 5K01A 5KMGB 2VYQA 4OHZA 1CRPA 3G13A 1N2GA 2WU8A 1ODTC 3EHDA 1C0KA 2QXUA 1J5EB 5JFTA 3G5UA 3HS3A 2BY4A 1SVLA 1C7ZA 1NBHA 2PX6A 1WXEA 4IIJF 1KI3A 4J7XA 3OD5A 2D3TA 5CFPA 4YN3A 3M5CA 2IY9A 4QO7A 3IPRA 2F6RA 3ZQKA 4MQMA 1UJ2A 4I6EA 4MW2A 5AXAA 1PF7E 1YQ9A 5AP9A 3ELUA 1IAVA 3TTUA 2CSXA 1YBMA 4YONB 2WIBA 4MVJE 4RDHA 2H4FA 1LF5A 3E58A 2WSSD 2XDQA 3KELA 4HGPA 5F9MA 2PJDA 2HU5A 2FW7A 1UQUA 2IYOA 3K35A 1RW4A 4I7EA 5GONA 3QUSA 3OUUA 1FSSA 1H2YA 2GDJA 1WOMA 2IYAA 3R0IA 4N9WA 3ELDA 3WGNA 4N49A 2R1ZA 3FFAA 5EZ6B 4MRPA 4ZJYA 2P4HX 3EGOA 4QEKA 5DT2A 3RVMA 4BKRA 4PN3A 5AOVA 1QBKC 3TUZC 3L0ZA 3ORFA 4NDAA 3HDHA 2O19A 5B1YA 4RESA 2Q07A 1N8NA 3K6KA 3EAFA 3EOAI 3FHOA 2IZ7A 4PC7A 1F7VA 4ZZ3A 1HK7A 4MVJP 5LYJA 4M8IA 3PI7A 2QE7D 4WESB 5C46F 2ZZMA 3ESBA 4Q6BA 5JTUA 5J58A 1SURA 3OEED 1TZBA 3G0CA 3TRKA 4EO7A 4PE5B 1KS9A 1CWUA 1TVMA 1TZJA 3GVXA 5K0LA 2O8BB 1M5TA 3UMFA 5EXEA 4G41A 3U7EB 3W4KA 2QHXA 3NI2A 1IONA 1K7YA 2XODA 2FCRA 3HI6A 4G1EB 4I3GA 4MQLA 4RAOA 5HRAA 3H9JA 4ALJA 4N6NA 3R7LA 5ES3A 3FDFA 1XZCA 4JB3A 2IBMA 4EI7A 5TPZD 1F6BA 2BTQA 3DDHA 1Y3FE 4AS3A 2TMYA 2FMFA 1XDZA 4G0NA 3Q0TA 1I3MA 1WE2A 4QYWA 4YV0A 4BVFA 3RTGA 3ZG6A 2JLAA 5CBPA 1G19A 5AKGA 5HE8A 1SNYA 1KARA 4YUYA 3CF6R 4MTCA 3USES 1WM1A 3NYQA 2CLOB 2XQKA 2ZK7A 4NMXB 3BSYA 3TS1A 3ZY2A 5B6PA 2P2GA 4EPYA 4F0JA 5K3SA 2NVOA 4XYBA 1RI5A 1DRKA 4RHYA 3PYXA 4LHYA 5EIEA 2WWTA 3O0DA 3TLJA 1JKMA 1WEKA 2XEDA 4BMZA 2UKDA 1H4VB 1PS8A 3IAEA 1OPRA 4B3IA 2CLDX 3T38A 2WT4A 2QUZA 5HJEA 1R37A 4F93B 3LH5A 2CMGA 3QJYA 3E7FA 4L6CA 4I55A 4RACA 3I28A 4G1BA 3HHPA 3SE7A 1Z4JA 3U7QB 1K68A 4A5SA 5AVUA 4FZRA 1HYGA 1Q91A 1Z35A 2WIDA 2X4GA 3BREA 4RVHA 3V9PA 1AKUA 1K2VN 1INLA 2ZVQX 4UE6A 1DC5A 1VL2A 3UHFA 4BFXA 4QKQA 1MB0A 3NHRA 1W49A 4JR2A 4EJSC 1VA5A 4FSXA 2C0QA 5CHYA 2VBCA 4AG3A 3CIFA 4C4OA 5ESXA 3NVDA 2B7BA 1KDTA 1V2GA 3LUDA 5HDQA 2JCSA 3R5XA 1DUSA 1LU9A 5REQA 5CT5A 3FM9A 5C8XA 4QG3A 5AKZA 4TWBA 1ZD9A 3R8XA 1QKKA 5ALJA 4BPRA 3LRTA 1UXHA 4KB5A 1KO1A 3WRYA 2VJMB 1ENPA 5IARA 5KNDH 5A4IS 1F20A 3STHA 1DEHA 2BBTA 4JA2A 4JT8A 4E03A 5KC9A 1Y3IA 1YQGA 3ZE7A 3BRCA 6ADHA 4M0PA 1BQEA 2V5UA 3RARA 1N34B 2EERA 5DCWA 2WWGA 3GMIA 1Z0UA 5AICA 3CIOA 4CLRB 1G59A 1E7RA 2FYTA 3IP9A 3R3HA 2A5YB 3I9JA 3OJFA 1G5HA 3KPWA 3KQHA 1G8HA 4YUVA 1U3VA 4NQRA 5D51S 3DTTA 1OWNA 3G9UA 3CJRA 4M46A 4QLAA 3U4GA 2ZB8A 1SVNA 5C7IO 2EVWX 4P33A 3HB1A 3N3AC 3PQ7A 3WAGA 1A27A 2A9OA 2GXSA 2QQEA 3F9IA 3HCCA 2PWZA 2PD3A 3K16A 2AT1A 4NL4H 4UFOA 4E2YA 3BK7A 5LPNA 3OFND 2ZDQA 1VA4A 2QMQA 4IOLA 2GXUA 3CX8A 3SZUA 3TQCA 4BTEA 3DE7X 1GUDA 1USGA 5GONF 3AUJB 2Z6AA 3UJ7A 2GKGA 2Y6UA 3I5AA 1QZTA 2V7PA 2LDBA 5FTWA 2B1IA 2PA0A 2X8LA 3LFTA 3O3CA 4J3JA 1E9BA 1HUQA 2C3UA 5IKOA 5GTDA 3HJNA 2I87A 2M6KA 4X1OA 4L9WA 3UJBA 4E7OA 5JY1A 3QK7A 1UOEA 3Q41A 1RWPA 4ZCSA 2C7QA 3BGWA 4M1QA 4M1KA 2CJWB 4UTVA 4Y2UA 1BHO1 1DBQA 1NDHA 2GWRA 3P27A 4W1QA 5I8ZA 3RRXA 4B2PA 2YHBA 2FZGA 4CVNA 1AO0A 1M1ZA 5IVDA 1Z08A 2RBGA 1FFWA 1UL1X 3FYCA 3QE3A 4X54A 4BVHA 3UGTA 1DQSA 2JZOA 6CHYA 5IXSA 1NI3A 5J4HA 1MAAA 4NZ9A 3JQFA 3THXB 3DW1X 1QO0D 3TSCA 2P8SA 3AUTA 1P7CA 3DYVA 4X85A 3K0SA 3TN7A 4HRAA 4IRXA 2W00A 4BMYA 1G21B 3SGLA 3ZHOA 1G6HA 1RCUA 1ULSA 4OQMA 4PO9A 1IEQA 1GTZA 2R6HA 4OF4A 4PZAA 3CMCO 1VM6A 4B31A 4FKZA 2QRVB 3NC1C 5F35A 2JFQA 2ENUA 4M0EA 5JH7A 2QTFA 2GUWA 3CZCA 3UUGA 1TMKA 1O0SA 5KKNB 3N7TA 1GKUB 4Y9TA 4ZMSA 4J0HA 1QK3A 4QEZA 1RC1A 1WG8A 4Y2TA 3FOAA 3AFIA 4YDHB 3QXJA 1XMXA 1KOFA 3AEUB 3LY5A 4YDSA 1YDHA 4YYZA 3R3YA 4IDEA 3K3PA 1KVTA 1GZ4A 2Q45A 1WHTA 4HDRA 4X93A 2DTXA 4OJNA 3C16C 4AW9A 2YRFA 4IIGA 5AVQA 3I72A 1ZUIA 1E2UA 3VR6D 1RYEA 2BISA 3ABZA 3DAOA 4J43A 3ZIDA 3JWJA 4R83A 1XG5A 5AJTA 2IOYA 3EVDA 4Z9BA 1EUDB 5ELLA 4H77A 4ZYUA 3EDMA 4I0WB 3ZTYA 3A3KA 2FQWA 4HNHA 1C1YA 4BVEA 1KI4A 1IM8A 1GPJA 5AVYA 2NMVA 2ETVA 3INGA 1T6ZA 3MJSA 4N6GA 3RK1A 1AQNA 1QHFA 2Z3ZA 3PWZA 1N36B 4C2UA 2HX1A 3I09A 1T5IA 1NQUA 4IUYA 3OOYA 1M34A 4K9OA 1CZHA 3N5KA 3QFHA 4KAXA 2W93A 1PU2A 1UDBA 3KFVA 4JVLA 2XDAA 4KITB 2HQBA 3FN4A 5E4FA 4Q3DA 1XTUA 3K20A 3L0DA 4RORA 5TSDA 2WM9B 3ETHA 4BCDA 4MUFA 5FORA 4UATA 1LB1B 4YV2A 3A3OA 5AD1A 1UBGA 1KJWA 3SSAA 3GA7A 3PDJA 3BIOA 4H7KA 4JITA 4Q0MA 1KNXA 3EUEA 2YY6A 3QENA 3ZD9A 4US2R 5G1PA 1I30A 4EO4A 4I14A 1A5SB 3N7UA 1CPYA 3BHIA 3OFNA 1TK2A 4FE4A 4EEKA 3SF0A 4BMNA 2IYFA 4LZAA 3BSFA 3D0RA 2EL7A 1ZJZA 2BBOA 3GA5A 3GARA 2WSYB 4M9XA 4EVQA 1R2QA 4BO9A 1NJ6A 1Y3HA 3QW4B 1IIBA 1PR2A 3KT8A 4FLEA 3ZWAA 1SUEA 2QYSA 2I1LA 1HETA 4JMLA 4TT8A 5K0SA 4XB2A 4RA6B 3WLLA 4JD5A 3MJEA 3MWKA 1N6KA 1QB8A 3L0YA 4M89A 1DP4A 1QTRA 2W7TA 2PRKA 4ZT7A 1R9GA 1NYRA 2WAAA 3V80A 4NPAA 4KLNA 3UPDA 1W1UA 3I76A 1YBVA 2NU8A 5JBIA 4DCUA 3DMNA 1U2TA 4K1XA 3MSXA 4EYSA 1KMQA 2Q4OA 4FBMA 4FXPA 4OOEA 4EO9A 4DWJA 1SVOA 5FI1B 1ZS9A 2C2KA 2GK3A 2V7WA 4LRTB 3VU0A 5B1DA 3KAKA 5EJ2A 3ZWDA 4J9UE 1XYYA 1RM0A 2PBRA 1GILA 3LQ2A 5F21A 5K5EA 1NURA 3GZTB 1YHZA 1NF9A 1X2EA 3HB7A 4MPTA 4WI1A 1ODIA 3DM9B 4GKKB 4XXHA 3GDOA 4UVGA 4DDKA 3LLVA 4R8LA 3EDCA 5JCZA 4ZCQA 1USWA 4YYEA 3B48A 1FL9A 2XA1A 1KO8A 4I9HA 4JOQA 1YZLA 3O82A 2NX2A 4HZUB 3VDRA 5EAIA 2FWNA 3GBPA 4EYQA 2PS0A 2QN1A 1U7ZA 2HFKA 1D4OA 1XAJA 2FGJA 4KFRA 4L6IA 3I8SA 3UWSA 1PJLA 2G04A 2X9LA 1R4ZA 4UAJA 1ZI9A 3I0MA 4GPAA 5DTMA 3W34A 4UHDA 2UYQA 5A3SA 1EMDA 1C7JA 2X9QA 5T6BA 5E1OA 1CK4A 3E05A 3W1WA 1GXSA 3P2IA 3GV0A 2P1RA 2O52A 4JJ8A 1UBEA 4X3CA 4BY9E 2A9PA 1N0UA 3UFXB 2WMNB 4C7JA 4WFIA 2DSNA 1RMTA 1QQBA 1MF7A 1Z2EA 1UWKA 4MPRA 1BJTA 4EY8A 1FA9A 3ZK9A 2A5LA 1Z88A 1LJUA 1WNTA 2YNMC 3BTUA 3IA7A 1GDTA 3TLZA 4B87A 3INTA 2JFNA 2QV0A 1Y7HA 4II2A 3F7TA 1NBME 2BUBA 3FDIA 5I9BA 3KSDO 1LQUA 5LCXA 3VKGA 3JW8A 5KTPA 1EDEA 1ZBDA 3AB8A 4YMVA 3BT7A 2Y05A 1ZIYA 1UMBB 2DY1A 3P5SA 4L73A 3GCWA 4RFSB 2Y3IA 3ZWXA 2P3LA 6ABPA 5IDYA 1GAJA 3CT4A 2W2TA 3KBOA 3LQYA 2OFFA 2X0JA 1QH9A 5JJKA 5JCJD 3ROZA 4YRIA 4LSZA 2JD0A 1CJTC 2G5TA 821PA 4TKVA 3UAZA 4DZTA 5DYTA 1RHMA 4EG8A 3DNMA 4KXVA 3H0CA 4IMIB 2NM0A 5BNWA 4HB3A 3QPCA 1PT6A 2OAP1 4TL7A 3NNDA 3RS4A 3SJBA 5BY2A 1P60A 2IEYA 5DOVA 4WZZA 3WG9A 5AVSA 3GU3A 3ZDCA 4K9DA 3U56A 1XIVA 2P9CA 3V42A 4MKRA 3I6QA 5KHLB 3ND8A 5EYPB 5AW9A 3OM8A 1LFDB 2H52A 1GWNA 1XROA 2QT9A 3A9CA 2O5RA 3HSSA 5CHEA 4RMHA 2PXAA 5BVGB 3AP2A 1TAGA 3ROTA 1JTEA 5TQ2A 3I2HA 5C1OA 4LDPA 4LJKA 2VT3A 3W8NA 5CXSA 1CR6A 2X14A 1SQGA 2V6MA 4J16A 4PAOA 2HL6A 2W2PA 3H0EA 4HH1A 3I05A 4XOIA 1NUPA 1U2DA 3FHCB 4LVNA 1IWPB 2OPBA 1GZHB 2Q46A 1PWHA 3DBHB 3F3SA 4L4XA 4ZAWA 3Q9SA 5T4EA 4F9FA 1DAMA 2J6HA 2WG1A 4IXTA 4QUJA 5HKKD 1IY8A 3RFVA 2A5FA 5G3YA 1AA9A 1S96A 2CHQA 1AHIA 1GDDA 4ARZA 1E61A 4G07A 2PJRA 2WWYA 3KD3A 1EX7A 3K7EA 3PQDA 3ZGLA 3QIAA 2YASA 1KDPA 1WCYA 2VAMA 4FINA 1B43A 1QQ5A 4J07A 1XVUA 3BS4A 2NTEA 3CCCA 2CLLB 1OREA 1QHIA 1R4AA 3I83A 3JVIA 1E7WA 2X8JA 5DMXA 4XVUA 3D6JA 1M2VA 5KHAA 3RUCA 2ZT7A 4X41A 3AETB 2RD2A 2PPVA 2BFMA 1ESCA 2JLVA 2XUQA 3FYHA 3HJUA 4P4TA 4RCVA 4ER5A 1K06A 1DIRA 2Q8QA 3VO9A 4XTCS 3TNLA 5CB6A 4AS1A 4TYWA 1VHLA 2QX7A 1SBHA 1VZ3A 3PCRB 2VXOA 4IJ5A 4MGYR 4ESHA 1EFAA 5HXAA 1ODFA 1Y63A 5ADUS 5BPHA 5DHTA 3Q3CA 1IEVA 2ZRHA 5GM1A 1I36A 4PZYA 1PK9A 4HAWA 4CLXA 2WQ6A 3R3UA 1L1EA 1PHRA 1WW8A 2GX6A 3C24A 3PLAE 1VI2A 5KWEA 1SWWA 2G08A 2Z4TA 2HXGA 3CVJA 1EYZA 5SZJA 1ECJA 3O4RA 4GQBA 4HB4A 3O8RA 4YLGA 4QYMA 3C7TA 1Y5LA 3H6HA 4D6PA 5CH3A 3K32A 3DEKA 2UZ1A 3J7TA 1IXRC 1TTHA 4MW5A 4GIBA 3TNDA 4MUHA 3A4MA 4Y9SA 1CYEA 3WJAA 3LF2A 3H6KA 3HA7A 3KD2A 4EP1A 6AT1A 5BW5A 3DCNA 5GJCA 5U9CA 5HS4A 2YIMA 4UZSA 5J4KA 3CZMA 3NRBA 4DJTA 4BQRA 4DB2A 3AHCA 3K5PA 3PGVA 1YS1X 3QSGA 2QLFA 3ESQA 3O3MB 5DWVA 4N0QA 2FG5A 5E9WA 2VDUE 3DZDA 5IZCA 3AGPA 2PX5A 1UOQA 2GCIA 2XMGA 4QU5A 4BBPA 4DUPA 2DYKA 3K0FA 3C15C 4HNAA 3FAKA 5BORA 2XGMA 4ZI5A 4U7TB 3QA3E 4OM8A 1J49A 5DT9A 3GJRA 4LXTA 3WR5A 4CKEA 3T7DA 1BGWA 1GY8A 2OHVA 3LQ4A 5F5LA 4LFAB 3QUCA 4XQ0A 2O2HA 3MMPA 4KWHA 3SYMA 4BGIA 4Z0NA 1YA6A 3CONA 3DEJA 5JW6A 4DR5B 4FFPA 4FCCA 3AW9A 3LXMA 1HE1C 2YBEA 3RYFA 3C2QA 3H19A 1DOZA 4L85A 2FWJA 2QL9A 3BGDA 3F71A 1Z6YA 4F9EA 3TFOA 4TLBA 2I7VA 5FBQB 4PAGA 2I6UA 2WHYA 4A3SA 2ZZKA 3VR6H 5BSMA 2WUEA 1XMPA 3TE7A 2VIIA 2ORED 3UYKA 3AUAA 3GJ6A 3AB3A 1XTBA 4ZICA 2OBXA 4CKZA 1I3LA 1W94A 3QY9A 2OGSA 3J81A 1IZ7A 2FEOA 4MQ5A 2XSZA 3KSMA 4HL6A 3ESRA 3A1TA 3B2QA 2P9ZA 2HDNB 4FC6A 4MWZA 2NU8B 5B1EA 3A6KA 1QG4A 4BZXA 2DHRA 3DMDA 2O57A 5JLAA 3ZIUA 3EX7C 2C4VA 2WD7A 4QWMA 3B12A 4YCLA 4Q3OA 2VUUA 3Q8LA 2X5OA 4CV3A 3CLTC 1SUCA 1QRTA 2P2LA 4LBZA 5HILA 2VSFA 2P2SA 3FNGA 4BPBA 2IEIA 2BR4A 1O9GA 3LM8A 4GW3A 4ND8A 1IAQA 3VU9A 3EW7A 3IIEA 4P34A 4TL6A 2Q6LA 1SXQA 1SIUA 3COZA 2QWXA 4JL8A 4QDKA 5HFJA 4OY3A 4BQFA 2WJ6A 1AMNA 1GUBA 4AULA 2JEOA 4PVCA 2X0RA 5K4GA 2QI9C 3ZWWA 1R15A 1HE4A 1K8YB 5JYBA 4RK7A 2OXTA 4BEWA 4CM1A 3N8KA 2HC9A 2WJAA 2CD7A 3CVYA 4BNYA 1X7WA 3RT7A 3HYTA 4AZ0A 4YQFA 1E0JA 4QOEA 1G8GA 2MR5A 5K1ZA 3WDSA 3WKDA 1LD3A 1CT9A 1XD9A 1NV9A 1OC2A 4GRIA 1X1DA 4W9NA 5EIOA 1GKKA 3T54A 2J08A 3NWOA 4JL5A 3WLEA 4KR0A 1UK9A 3UM9A 3PLNA 1JHMA 4JI2B 4MW0A 1C9JA 2P3OA 3NYRA 5FHRA 1IBMB 3U62A 3ADDA 2ZIVB 4WVFA 2IPXA 3OAAD 3VC7A 1VL6A 3GFFA 1M34B 3BHMA 4UOEA 3UHJA 4PYNA 1QGZA 3DUFB 1GPKA 3HKCB 1L6IA 1VJ0A 3TQOA 3WI7A 2XBMA 1EXWA 1V4NA 4JDPA 2RGNA 4Q9JA 2XCRB 1ZOSA 1YNSA 2ZW9A 3G1WA 5J63A 5LIRA 4DSNA 1IBKB 4JT4A 4FNMA 4P8RA 1XTSA 1XVIA 4ARAA 4ID3A 4U9HS 4F11A 3ZQUA 1F4PA 1MVLA 3H5TA 3QNUA 1P8AA 3D6FA 4WGGA 3U1BA 4PZCA 1NZFA 3TJZA 2CFCA 2OYCA 1SWVA 1J23A 1UJ5A 1L4KA 1K88A 2HSEA 2R1UA 2M1XA 3ED5A 3HWX1 3Q72A 1DBWA 2FLWA 4OREX 1KWKA 1U04A 2J9FB 3OIUA 1ESEA 1OAAA 1WHTB 3EODA 4HDRB 4IICA 1LCIA 3MMSA 1U28C 2O7QA 2DY0A 3HE3A 5EINA 4ERXA 5MFZA 1DWUA 2OK8A 4TWZA 4XX0A 5DBIA 4C4XA 1ADGA 1KK3A 4A26A 4OQFA 1MV8A 3P2MA 5AXBA 3CLSC 1JJIA 3ZVMA 1E9CA 3OWHA 5DASA 5HQ3A 4IDCA 4K86A 5DTRA 2PIDA 4ZQGA 5LU8A 1KHTA 1U6KA 4XWOA 5ULLA 4JYMA 4HYEA 1P33A 3MWLA 4J0CA 4OTZA 4XSVA 4ILEA 4F9GA 1NJ1A 2EEPA 2ZI4A 1V1JA 2HWUA 3G0BA 4Y2HA 5DCYA 4Z5XA 3PT9A 4P1ZA 3OU2A 5CW2A 2NZ8A 2RH8A 3HG7A 1HEIA 3D31A 1TYCA 1MDBA 2EWVA 2XOEA 4LJSA 4RSHA 4I99A 4URVR 4BQNA 4I1SA 3C7AA 2CVQA 3OZVA 3BXZA 4WKGA 2VDVE 3GBSA 2OE2A 2OK7A 3STTA 2NPOA 3THXA 4I2VA 5FTLA 2CCJA 3D2CA 3N8GA 3CXRA 5CD1A 3NT4A 3OQPA 4R40A 1SRQA 3EFOB 5BPFA 4BNUA 2RHCA 4ZOLF 2OAEA 3PR1A 1H2FA 2YWRA 3PDIA 4CMEA 3BJIC 5CA0A 1HKHA 2DCMA 1EIZA 4DLWA 4WFQA 4AVYA 4OHFA 4HUQA 3NKLA 2F3UA 2EW8A 2AN5A 3FMFA 4RZQA 3UA3A 3W9YA 3DBRA 1WY5A 1T4CB 3FPCA 4DNXA 4WFJA 1P2GA 1D5WA 1VE5A 1AKTA 5D1NA 3R5FA 5DBGA 5CG2A 3L04A 4PHCA 4N8DA 5BV1A 1P7WA 3Q8XB 1OFHA 2FN4A 4RFVA 4YDQA 1U98A 1X42A 3GGPA 4L16A 1VBKA 5ALZA 4D43A 3ZHZA 4DUGD 5JCOA 2A0YA 1TAQA 2QN3A 2ZRMA 3D9QX 3GCDA 2C77A 1U2ZA 2GLTA 1RJGA 5CJJA 3QE9Y 1A9SA 1AUQA 1V11A 3HVHA 2FHPA 1KVUA 4KWCA 1F17A 1GZSA 4ZODA 3V2IA 5E6SA 3I92A 5DSXA 5AM5A 5K6AA 2HBYA 2FRVA 1F8GA 1W8DA 4ZOLA 4ASUD 1CR2A 3TKYA 5IKPA 3EUFA 4I4TA 3A4TA 1M10A 2ZB3A 1FS4A 4DLTA 4F04A 1NJSA 1U8AA 3W5AA 3ZGZA 4QASA 2DPHA 4WLUA 3W4JA 1QUFA 3RG2A 4ALMA 2ZSAA 1SHZA 4OQZA 4I5EA 4JEUA 1QYRA 2AN4A 4PNZA 5FD8A 4TMTA 3WSVA 1DKUA 1REQA 2FK8A 1GAQA 1DNPA 1Z6TA 2L82A 1TQHA 4RIIA 3HM9A 1LBTA 1E1RD 3HJBA 2ZYVX 5KAPA 3LBIA 1UBRS 5ARDA 3VPXA 3LWDA 4DV1B 4TVKA 4UBJA 4DDUA 4G4SP 4UDOA 4G1CA 1ENZA 2RHRA 3NEAA 3ZX5A 3GZNA 4B44A 2ZRIA 2WFLB 3WK7A 2G80A 4HGOA 1EUQA 5JQGB 4Q93A 2FP4A 4EHKA 2C9MA 2GSWA 1K8ZB 4TXJA 5DX8A 1DJNA 1ZGZA 1C8BA 3WHIA 3JYPA 3OECA 5C31A 3SZLA 2ZU0C 1TD9A 4BNKA 1IG3A 4MMZB 3ITNA 4QREA 1I9CA 2JIMA 1J8YF 3X2SA 2DAPA 4LHXA 3TZHA 4BBAA 3UMJA 5B2EA 2RONA 3QEMA 3UK7A 1IZZA 2H9AA 1E9RA 2VT2A 3H1BA 2IZOA 3N2GA 4EKIA 3RS8A 1KBOA 5LDDC 4QOJA 5H3HA 3IUEA 1BKYA 3UB4A 5LQNA 4I55B 4GE3A 3DBRB 4YCCA 2EX0A 3KG2A 1V3QE 1M76A 3HUFA 1CUVA 5A7GA 4D8YA 2PU5A 5FOUA 1G8JA 4HMPA 4F2HA 2YS6A 2WU3A 4RMJA 5A3QA 4DC9A 2CDBA 4HUQB 5U1PA 1G7SA 1K7XB 1V9CA 2C97A 4E5KA 4YMIA 1R4NB 3NVAA 4IHAA 3H83A 1ZBQA 4E7PA 2HEGA 2J32A 4YJFB 5COAA 1EWKA 3ZDYB 1WVMA 2NQTA 2HRZA 2A86A 3KV1A 4M8LA 2RGGA 1Z3IX 4TTAA 4QSHA 1HX7A 3ETGA 4MJ7A 5DGIA 1K7CA 2WWRA 3GWZA 4AUMA 2QJRA 1B0PA 4XH9B 1GL9B 3JQEA 4JU9A 1NVBA 4J90A 4KYVA 1DRVA 1LS1A 5ER6A 3CVUA 2A3NA 3F96A 2C78A 2X7XA 1WTAA 1KYXA 3L8MA 4J1NA 1ETHA 2EX4A 3K2IA 3THSA 3UW3A 3OCYA 4KIUA 1BMFA 4OPMA 4PZUA 2FW0A 2V7EA 1NQ5A 2PWPA 4KKXB 4X0EA 2BTQB 4AQDA 2BH2A 3BZBA 4MKHA 4QPNA 5THKA 4BVBA 4Z7OB 3CWCA 4LDNA 2R0QC 4DANA 3VTZA 4XGNA 4MS4A 1YULA 3JX9A 1E2QA 2I7TA 3A36A 1JI3A 3WWCA 4C01A 1CUZA 3D6UA 5IULC 4LRSB 2X1HA 1LF0A 3LT4A 2EP7A 3CRQA 3I9FA 2Z09A 4YP7A 4IG9A 4I50A 3U4QB 3T0IA 2O8BA 4NXNB 4D9FA 4YR7A 1AXGA 1TK9A 1UEJA 2CB9A 4EG6A 4LTNA 4D97A 4ER3A 3RGWS 5T57A 4EA9A 4AN1A 1GP2A 5KQPA 5KYXB 1KBQA 2DKNA 2XBLA 4NULA 4FYYA 1T0JB 3ZCTA 3SHFA 5CFOA 3P19A 1A9YA 1N1DA 3A9SA 1OZHA 3OX3A 3U0VA 4J7AA 4XWYA 3V00A 2WV9A 4MYRA 3V4FA 2QRKA 1NLZA 2OBYA 3TLXA 4ZVKA 2CV1A 3ZWOA 3F6PA 1K9SA 1VJRA 3BD9A 2QM0A 4JEHA 2Y76A 2YV5A 3HCRA 2ZAYA 3RTAA 5BWCA 3HU1A 1FFHA 5FTMA 2JIDA 3TTXA 1YTUA 4IF6A 1MEEA 1SKYB 4NPCA 5P8WA 1TD1A 1TMGE 1W6RA 2OP0A 1NMXA 3CR3C 1VSUA 1LRKA 3JZDA 1RLJA 3NBQA 1D7OA 4KXYA 3WP0A 3WGLA 4ND4A 3L7KA 1NI4B 1CQZA 5ITWA 2Z5FA 1OILA 2WJGA 4WHMA 5JYDA 5JIBA 1JWAB 1F12A 2CNDA 5HCNA 1XZKA 2XRYA 3ZV3A 4K05A 1ZK2A 4P98A 3DMRA 4PNEA 1XOIA 3B7GA 2ZTLA 2W2LA 4UM5A 4ZP1A 1WZEA 3MUOA 4DR7B 2VN8A 3HO6A 2GZ3A 1CQJA 4DA4A 4LRUA 3I6BA 3JAMA 2JKYA 1XZFA 1PSDA 1TX4B 1MNQA 1KA9H 4PLFA 4AZVA 2N0SA 3KQVA 1DXYA 4C1BA 1O03A 3TRHA 3NKVA 4DZZA 2CNNA 2R1VB 1O8BA 2Q3FA 3KWLA 4C29A 4DSOA 4WOJA 2JCGA 3PFHA 4INPA 2QX8A 4YP9A 5B3LA 2JHFA 5AVTA 3FWZA 2V0GA 3SYRA 3X2FA 4P3XA 2CMKA 2Z30A 1H69A 1P1FA 4ZAXA 5NLLA 1WKCA 4D6YA 3PNOA 1KZ6A 2P65A 1A5ZA 1QCYA 4TTSA 3W6PA 2EQ5A 3E8MA 1GGFA 1EFCA 2ADFA 4AX8A 1AH2A 1Q22A 3I5UA 4B6OA 3ASUA 4QUDA 3SS7X 2IVFA 3GPLA 4KRXA 5CH5A 2EJVA 4U2GA 4B3TB 5AM0A 4D4GA 1EEHA 1DC4A 2VXBA 4CQLB 1XA3A 3MAAC 2SECE 1U5CA 1I94B 1E79A 2VK2A 3OOEA 4AG5A 1KK2A 1N4AA 3I04A 3IB3A 3H11A 3MJHA 4PCUA 1HTBA 3AVVA 2QI9F 3D7SA 3IP5A 1RYYA 4NATA 4DDMA 4I50F 4K40A 2X22A 4URWR 5FBWB 3NFYA 3N2IA 1RWOA 1VE9A 1BWPA 1HT1E 1Z5VA 2GTHA 4OQLA 5CU7A 5ELMA 3GEEA 3NW9A 4Z0HO 1X77A 1WDTA 2XUFA 2ZRNA 2DH6A 3ZZ0A 1DEKA 1W87A 3TL6A 3SDSA 4IJQA 4RVCA 1FNDA 1CY4A 3T5MA 4CODB 1MOPA 2PUTA 4E5VA 3C3PA 2Y1LA 1JL3A 3VGPA 4GYWA 3OE5A 3K0FB 4LYHA 5E7QA 1TJ4A 1W2WB 3GJXC 4J6EA 1AF4A 1XTZA 3KXDA 3S44A 1K92A 4LI0A 4PPNA 2MINB 3WNBA 4UVIA 1RIIA 3RAFC 3VM6A 4GZMA 4FZJA 1F2TA 5EZYF 1GM5A 3N70A 4YO7A 1QFSA 3W5UA 3V1TC 4OH1A 4FWTA 4BFWA 1XEFA 1OR8A 3EJ6A 3IKJA 3Q8MA 2C9OA 4RKFA 1RM3A 1ZSVA 3PQ6A 1K9VF 2WDZA 3O74A 5BNFA 1GCIA 3EASA 2C54A 2BLNA 1ACJA 2ZJAA 1Z4LA 5IG2A 1OQAA 1F1BA 4A91A 1Y34E 1EGHA 1PZNA 1GPH1 3C6QA 2WPDD 2D2XA 1UKVY 1GG9A 2MMCA 4LZZA 5DFAA 1SBYA 1VLHA 3NDJA 5TX7A 1NASA 1L5HA 2R60A 3ZV4A 2JNWA 2HFJA 1NW7A 1WWKA 4TXHA 2OCAA 3Q1KA 3FDXA 1XVAA 2WB2A 2PUCA 2MYTA 1JU9A 2YKGA 3ICPA 4ND1A 1YOVA 1W88A 2A1IA 3HBMA 4HX5A 7MDHA 5FJJA 1WR8A 3JD0A 3L1KA 4NDNE 5KVSA 2AXEA 2CMDA 3WLHA 3UJHA 3TW8B 1X8LA 2Y68A 1HT2E 5AFSA 3DONA 2L17A 4KE6A 4PCAA 3AR7A 4KX3A 2BWJA 4O2BB 4X7RA 8MHTA 1HOXA 2C29D 3C8ZA 2RGAA 4MW7A 4L0QA 4M76B 4TQAA 4HVLA 4TX1A 1QF9A 1VE7A 4D0LB 4CETA 5AVWA 3CKLA 3GT3A 4MDFA 4ZVPA 3SPXA 2O8FB 2XHZA 1RPZA 4ARZB 3Q8WA 3U6BA 3TPZA 1SBQA 4AJEA 4TXMA 3QVLA 1O08A 1QFXA 3TVTA 4POAA 2GS9A 1J25A 2OGTA 4COOA 1B8VA 2YZNA 1CR4A 4EI2A 4F3CA 1CG6A 2P5YA 1EFRA 1QGDA 2HYIC 4GDFA 3QX7A 4ZI7F 4ES6A 3QVVA 2XUHA 1DDGA 4X97A 1VE3A 4M7OA 2DU8A 4AY2A 2B30A 2GJ9A 1WSAA 5AKIA 2DHCA 4KDRA 4LNUA 5EIAA 2O54A 4MK4A 5DSZA 1EFVA 2OB2A 1JI0A 2CXHA 3A4VA 4MWGA 5EYPA 4Y1FA 4GOKA 3RUDA 4X1IA 2EJUA 3SEQA 2XYPA 4OHVA 4IO0A 3ET4A 2HCTA 2IHNA 2YMPA 4D99A 4R9RA 5THXA 3I9MA 2GKSA 1U0OC 2J0UA 3QLVC 1KPHA 2VPTA 4HLDA 3G8CA 4CDNA 1JPUA 1GAXA 3E7DA 3IBYA 3KL4A 1DRWA 1RTKA 2V6BA 3FPGA 4U7GA 5ETJA 1Z62A 4RF4A 4L2IA 1GD1O 5JMOA 1A2QA 5JLJA 3RSCA 5EJ7A 1Y5MA 3R7NA 3RYIB 1R5NA 2JPDA 2ZR9A 2ZRLA 2J5BA 2LIVA 1BDBA 1YAHA 1ZICA 3Q2IA 4MW6A 4B81A 1QG0A 3L77A 4OLAA 1MTZA 2V4UA 4WKNA 1FF9A 1USUA 2OB1A 2HLDD 2XVZA 1X19A 3BWCA 5DDIP 4CPDA 3TF5A 4HAIA 1W6UA 5F77A 3X1JA 5J1TB 4BO8A 4C3ZA 1DC6A 1JIUA 2BGWA 4RF2A 4BWGA 5E1BA 1RJEA 1QMGA 2CL0X 4PC1A 3UYLA 3VV3A 3GLGA 2DCUA 1UFQA 2I6FA 1QC5B 3PL1A 5TPWA 3K8ZA 1K1EA 1KBZA 2QAIA 3NPMA 1MEJA 2R8BA 2R8ZA 3CA8A 1WP4A 2Z2ZA 2GJ8A 3IDQA 4ND2A 4O8ZA 3JATA 3A31A 1JMYA 1A8IA 1XFDA 1Y7TA 1P0QA 3ML1A 4Q1CA 5EQTA 3HY3A 3T5DA 2J87A 2EG5A 4O4JA 4LQCA 3MELA 2P2DA 3PD7A 4H4DA 2Z9DA 1YHNA 5J2TB 5F9HA 3TBFA 2VQ6A 3D7MA 1NQOA 3LECA 2CHUA 3JPYA 4Z53A 2ZZNA 4M1SA 1VL0A 3RWOA 1S9HA 2H2IA 1RHJA 5CVVA 3T3PB 1HF3A 3S2YA 1JPVA 3RS5A 4G0ZA 4E51A 3RFCA 4JLJA 4PF1A 4BE9A 2VTBB 2LR0A 3DBVO 1W5FA 1YSCA 5EMKA 4YJHB 5FBVB 1XSEA 1DBVO 4OKIA 4QOFA 4KUGA 4M0LA 2ZSJA 1Y6QA 3VX4A 3UAOA 4N65A 2WSMA 1GLVA 1Z15A 2JI9A 3VZQA 6NULA 2BD0A 2UUOA 1YZFA 3LL4A 4JZKA 1DMRA 4RKWA 3CH5A 1RKUA 3BSWA 1UXKA 5BRNA 1ZVMA 1YU6A 1UMDB 1DQRA 3A14A 3JPWA 3MJVA 3AG5A 1N57A 3E1KA 1G55A 3O3NB 3SHQA 3AGQA 3E81A 1E8DA 3M3HA 4XFJA 1TJPB 5SICE 1OYOA 5EJ9A 1M6YA 2GN6A 3A1EA 4NJMB 2IYYA 3HADA 3DZGA 1KPIA 3CVOA 2P41A 1BG6A 3ZGNA 2HDWA 3L07A 1PG2A 4YCAA 3ZKAA 5G40A 2XYVA 1VLVA 3FNRA 1N2CA 1J8VA 2EZTA 2YVLA 3LFHA 4K8RB 2G0NA 4QL3A 2MU1A 3TZCA 2GAJA 3AEQB 2JIBA 4WMLA 1TJ3A 5K4AA 2PUBA 4XEHA 4U7JA 5THQA 3WDKA 3I37X 2YJZA 1JEOA 5J40A 3R8CA 4MWBA 4L8YA 5AM3A 2UU9B 1DAPA 4QEDA 5EHQA 2FV8A 2VYND 2WWIA 3AP3A 3RAJA 2FCAA 4GPIB 5BSEA 1M1UA 5A3VA 1BYUA 3OAAA 3O8BA 4NR0A 3WGHA 4LF7B 1Z4IA 2GFHA 4MH0R 1Q77A 2EZ9A 2ILVA 3PICA 4D98A 1CRQA 5KPJA 1UZMA 1X2BA 1LBEA 2B1QA 3GGOA 3ZYCA 1FP2A 1OXBB 2ZI9A 4HWKA 1IPFA 3P2OA 4AYTA 1J1ZA 2CE2X 1EXMA 1E6MA 1U3GA 1YC2A 2AKYA 1N8SA 3F7OA 2DKOA 3FHJA 3OKPA 4L4RA 3GEIA 4EKNB 1C8LA 1T5TA 3D8RA 2H5JA 4J4HA 2HXYA 2A2ZA 4M86A 5BN5B 5MN5A 1I7SB 3CX6A 1FB5A 5JS2A 5FLYA 4KBGA 3DNPA 4ZWNA 2ODEA 2V58A 3ZH2A 3T3IA 4DPLA 2NYAA 1U9JA 2B4YA 3HCBA 2Z3VA 1PWYE 5JYEA 3ETNA 3HY4A 2AK2A 2OQVA 3FFXA 3GNTA 4RYDA 4B4VA 1YJAA 2F55A 1DQPA 2ZSBA 1UIMA 1LDYA 1GG2A 1HLGA 1V1MB 1I3OA 2AJCA 2CDNA 2Y1CA 1X1TA 2ERCA 4KSBA 5A0FA 2II6A 3QVKA 4DGQA 2W2QA 3PYLA 4MRNA 2D0DA 5AUOB 2ES4A 5HUJA 1RZRD 1ECLA 1QIHA 3U39A 4G89A 4LZJA 3RJMA 3G02A 5ALOA 4X45A 1UXIA 2Y99A 3NHWA 5E7JA 1M8KA 4IZIA 2ZR7A 2GPYA 3KJZA 1IMJA 1WX1A 2CDCA 3A9VA 3WGTA 3FAZA 2G70A 2CK3D 3VSAA 2IDZA 4QIHA 4ITRC 4RO0A 1VHDA 3IT1A 1WKVA 1C9NA 3A0UA 1ZINA 3ELYA 3G5AA 4GKBA 1T3GA 5AOCA 3PUHA 5FQOA 1IHPA 1GNSA 1NW6A 1TKAA 3A6LA 2H1LA 4GQAA 5BYBA 4BFYA 3G6WA 2WINI 3A6DA 3M2PA 4ZO6A 1FU8A 2IE8A 4HH3C 3O84A 4IVPA 1Q0SA 3AW8A 1ZQ9A 3JU3A 2YFKA 3S28A 1EI9A 2JFUA 2YZ2A 2BN4A 3TUJC 1J8QA 4HX9A 3DXYA 3N76A 2BP7A 3FHTA 3AEUA 4A6DA 2AXNA 3KFLA 1YB7A 1Z4KA 3FNBA 4P4LA 1U1CA 1WCWA 2I9PA 2O14A 3TLGB 1Z74A 4WJKB 1Z75A 3MJRA 4E1VA 3UIEA 4RZHA 2Z1DA 3D0QA 2W6MA 4HLCA 2NZJA 5JH7B 5E9JA 1M54A 4YJKA 1X7DA 2CZGA 5AHRA 4OUDA 5I4IA 1DADA 3TNYA 3TEMA 3KZXA 4N3BA 5CH8A 4S1TA 1AURA 2P6PA 3EVAA 4IIEA 4IILA 4ZVUA 4JI6B 3VH2A 3A6JA 1USVA 3QKWA 3MWDB 1BN7A 1G7CA 3DDWA 3MJ4A 1NRWA 5JARA 2WT8A 2EYUA 3ZBUA 4EENA 2CHVA 2QZ4A 2FPSA 2B8JA 2EDCA 2OMKA 2BKEA 4H7EA 3FSRA 4C4RA 3UJNA 3RIEA 3V8RA 4M4SA 1LJLA 1AK2A 1U5BA 1VCIA 2BKLA 2FWPA 2YXBA 3NU1A 4FFRA 2E4WA 4OJQA 5I48A 1NOKA 2C88A 2AOWA 4PR0A 1EFKA 3M6FA 4GC9A 4KIGA 4MR8B 4DLYA 1WJGA 2D54A 4YRPA 4M3NA 5EUMA 3PITA 2EG9A 4PG7A 4RD4A 2FWIA 3PBKA 5JAHA 2A1TS 4OX9B 3WXBA 2H3EA 3BHNA 4LIPD 4AKIA 4ZT3A 4IHKA 3S8EA 2B78A 4YRGA 2ZTMA 3QF4A 2ACEA 1ABEA 1XDUA 2QQ5A 2O2JA 1DKLA 1E63A 3TECE 1JBQA 3MB8A 5DYGA 4UE2A 2BEWB 1R0KA 1ZK1A 2ODBA 3KJGA 2QSUA 3HABA 3PHCA 5LBUA 2LCQA 3RKRA 3I61A 2O3SA 3HNPA 1ZH8A 4XDYA 4XSHA 5DVZA 3UMSA 4HUJA 2GERA 1MO5A 3U3MA 1Z6QA 3HKEB 2IV7A 3JYQA 1HY3A 3C1UA 4KDEA 1U0NA 5G0VA 1Z2DA 3RRMA 4PQGA 4AU1A 2ABWA 1TECE 2FX3A 4TRJA 1T4MA 2CVOA 1RQRA 3NQ41 1CNFA 4ZOAA 1AZSC 5CPBA 1F6WA 2AI3A 3WBBA 3H4MA 3DLBA 2RHMA 4LCJA 2YWEA 1Z26A 4PCVA 4PBRA 3GFBA 1YUBA 4CG2A 1NLFA 2NZYA 3PXGA 3DBLB 5D3QA 1NXQA 3PR2B 2JH8A 4DV4B 5K0ZA 4CZ2A 3EIEA 1Y89A 4UBNA 1QGUA 1CZLA 3CB2A 3AINA 1BH6A 2QYHA 2VPWA 5HNKA 3RQSA 4AUEA 4FDUA 3EY4A 2DUMA 4DUGA 5CITA 2WF7A 4UUMA 2RH9B 3ST7A 4W5WA 4OQNA 4EPTA 3BE6A 3NBUA 5LDHA 4AF7A 1IFXA 3ZYZA 5FH9A 4C7OA 3G0DA 1BSVA 3QZUA 4JI5B 5A02A 3VR2A 4UEQA 2OT3B 1R1DA 3JQAD 3M49A 4M6WB 5KYUA 2ZULA 2E85A 4CCWA 4G23A 5REQB 4KACA 2PH7A 4GKJB 1Z82A 3DFMA 4JEMA 5LOVF 5E9QA 1OT3A 5J43A 2V54A 4KXWA 1I2BA 1PJZA 1Y4DE 1C30A 5EVCA 4M1YA 1UT8A 3IFSA 3DEAA 3FVTA 1HG1A 1A98A 3MTBA 1VOTA 2WA1A 5LM3A 1O8CA 1SXJD 2AN9A 2XB2A 1W5EA 1O9BA 1WZUA 5ALDA 2ZT6A 5I4BA 5IM4A 5DHQA 3LBNA 3DE2X 3JQ9A 2I7DA 1MEOA 1P9WA 3AVTA 1FYFA 3DTVB 2XWQA 4JC4A 3JALA 1UZLA 5H3LA 1CTQA 1M9NA 3PRKE 2P91A 5KNDA 1RWKA 3PL5A 3HYNA 2O06A 1U3UA 2H59A 5A06A 2XITA 4RPGA 3UTCA 3UUWA 4BV2A 4PC3A 4EFKA 4BB6A 3NHMA 4HUTA 3C43A 3Q3EA 2DECA 2UZAA 3FOCA 5KTSA 5JCJA 1FTYA 4H7JA 3DR3A 4UUOA 2QLTA 1Z17A 4XD2A 4FMDF 1T6BY 4IHJA 5C9ZA 1K8XB 2FHSA 3KQUA 2AEFA 3CX4A 2XB9A 3JWIA 3KFXA 4PZ9A 4YUAA 2GEFA 2QPOA 3L7LA 2VOEA 4DNFA 1TOAA 1TM1E 3COYA 3G2JA 3EVZA 4OB7A 1IMOA 3SQXA 5EJ8A 5AJHA 1VB3A 3WIUA 3A2LA 3ZGXA 1M6EX 2PIAA 2PSHA 1FUEA 3F6RA 4PGMA 2NV2B 1BCSA 4KAFA 5CG1A 1Q3KA 4ND3A 4ZVVA 2VDLB 3N2KA 5BV8A 5EFOA 1K8RA 2VZLA 4EHJA 5AUNB 5AW6A 5CDTA 2B5WA 4HQRA 5LWQA 2A84A 4Q3CA 4PAQA 2ZJ5A 5EWJA 2W43A 3TD2A 3OX4A 4JHLA 2XDYA 3L7JA 2ZAIA 2YDYA 2OKGA 4I1VA 1YUMA 2FR8A 3PNLA 3COSA 3LI2A 1PUJA 4XOUA 4B6EA 2C4KA 2QRHA 2FI1A 3DCYA 1EM8A 1FSZA 1HDIA 2Y2UA 4JC0A 1CVLA 3I2FA 2ACKA 1YL6A 1FFAA 4N3NA 2LV8A 2BTEA 4JI8B 4AL4A 2B4RO 1HURA 1TZCA 4HYYA 4TPKA 1GKIA 3QBVA 5H4HA 2H4JA 4FQ5A 5TMEA 4OQEA 2OGZA 1KDVA 1I51A 3C3XA 4F2WA 1PLLA 1OFGA 2R79A 1V43A 3NP7A 1BDJA 1QANA 1P4SA 3AU8A 2QTGA 1VQ1A 4YLEA 1KFEB 1AQ6A 4CLHA 4J4TA 1XU9A 3EDYA 4R8RA 3KL2A 5I47A 4J29A 4KO8A 5GONB 1O97C 4O4IF 3DLIA 4AKSA 2VYVA 3S4YA 1SIWA 3EXIA 3NIBA 2JC3A 2XDQB 2EW2A 3T4PA 1PT9A 3RSOA 3AFGA 3ETCA 5FNVB 4AJJA 4GX5A 4CDRA 2PLRA 2VBGA 1U1EA 2WKRA 3IP8A 2AXQA 5DH9A 3CKYA 1SC4A 4UXIA 3BMQA 1J06A 1D8TA 1A8HA 1SOVA 5ADWA 3GIWA 1P1JA 1OI2A 1EH5A 2J45A 2Q2QA 4TV8A 3U5ZB 4PM4A 3KB6A 3I4FA 4EBBA 1CY1A 2D8AA 3N8NA 4A16A 4YUZA 3LYAA 3R41A 3W5VA 3RYCA 4IZ6A 3SQWA 1P7YA 4WXMA 2DUUA 4BFCA 1WKBA 4LDRA 3N05A 4CFYA 1C3OA 1PDOA 4OLFA 3CTPA 1E9DA 3D4OA 5SY4A 3MT7A 1SPXA 4PPYA 1AHPA 1FZQA 3DFUA 1FMLA 2BV3A 1I2DA 1ZZEA 2PBLA 1UWLA 4X7MA 2WW8A 5DCLA 4HWGA 1NW8A 3O4GA 4M9QA 4V39A 4B6FA 4YHHB 4IV8A 2HU8A 3LGSA 2BCJQ 3KR0A 1EWVA 3HN6A 3G2NA 4FDTA 4RWEA 4QLOA 4FFLA 5K0EA 2V96A 4FNGA 2H1VA 3AFNA 3U60B 4REQA 4RTQA 3HNOA 1T5DX 2QXYA 4LNHA 4LXUA 3A7DA 5EPEA 2ZS9A 2Z9BA 1XHEA 3E9QA 3P0EA 1DCTA 2WHPB 2C7BA 2OESA 1T5SA 1XDSA 3LBAA 1H2RS 1GV1A 1LSUA 3ZWQA 3BZWA 1D9ZA 1FFXA 1RKVA 3DMTC 4DIMA 3T3DA 2J5QA 1GRVA 2OQ2A 3L0BA 3UH1A 3EWNA 2EAUA 5IX8A 3Q2KA 1QV6A 4MV4A 1OHHA 2PRYA 3E2IA 1E89A 2X7HA 4R16A 3WFZA 3LPLA 1G4AE 2CCGA 3HKDB 2FMHA 1BS2A 3AMVA 1R6UA 5LD2C 5GINE 1DKNA 9GPBA 2WIGA 2X5NA 2GTPA 5M34A 3HWWA 1T6YA 3AEKA 2JBWA 2BGKA 2P7IA 3SX2A 4EAQA 2VQFB 3KHKA 1W0JA 1KMMA 3FX2A 3Q3HA 4H7HA 1W9HA 5DNEA 5EHGA 3WYBA 2VNAA 4C88A 6Q21A 2A3RA 3W5SA 4FLMA 2O8NA 3V9AA 5ABPA 1RPTA 1FYVA 2XQVA 1KZGB 4QC2A 5FJIA 1J33A 3PF8A 4OHMA 2IEBA 4DA8A 4GLJA 1DRUA 5FFFA 5FUBA 1BYIA 4LJLA 4FEEA 4HQ0A 1MB4A 1FXWA 2WNIA 4FFWA 4G5QA 2J0QA 1ICEA 1G6Q1 3DE1X 3NBZC 1CEXA 1RI4A 2LTAA 1TEHA 3PCTA 3QLJA 4QYXA 3BMCA 4GG1A 4EHDA 2WV7A 1P0MA 1X94A 1AIPA 4M1OA 5FP0A 4QYTA 2XNSA 5FEMA 3F5MA 2PM8A 4QGHA 3FZEA 1PZGA 3G6KA 4HPWA 4N0MA 3CB4A 2AK3A 2WF6A 3A2NA 1SVIA 1LSSA 5LA6A 3KT6A 3T5GA 4E46A 1CLEA 4AY6A 5CDUA 2D7JA 4FHCA 4C3OB 4D9CA 1EP9A 1LPAB 2DP4E 4OQPA 3WWEA 4QRDA 3NRJA 2NSJA 4UEKA 1UWVA 2J7PD 3I9V6 1VZ2A 3ENWA 3NMUF 3ZCPA 5JS8A 2IDMA 5GOTA 1FMTA 2GPBA 3VKWA 1XWIA 2WILA 3E3MA 2WIKA 2O1SA 5J3JA 2PMWB 5TS2A 1ESMA 3WFIA 5EZSA 1CJCA 4UHKA 3FROA 4G2NA 3H86A 4ARVA 3AHEA 3DGEC 2ACVA 4HDQB 4W5QA 2BSAA 1EGMB 4IFTA 4KYTA 2JJ8A 4K26A 4O1HA 4OQYA 4Q4AB 4ZO7A 3R75A 3V3TA 4BC0A 2RGRA 3KQLA 3W8DA 5TMBA 2YIJA 2CVZA 4O25A 1E4OA 5GM2A 5I9MA 2IY7A 3I9LA 4WCVA 3OZRA 5EWMB 1HO3A 3SR4A 1NQAO 1LW7A 3G89A 4JGBA 3DE0X 1TM3E 1T2FA 2JGFA 1Z0FA 4FMCF 1JLKA 3GRRA 1E94E 3SSOA 3G2MA 2BMFA 4EKDA 3FF1A 1CP3A 3QELA 3PHLA 5HUHA 1RPNA 3ZWCA 3H8SA 2ZOSA 4N8SA 5KX5B 2TYSB 4CUJA 5C1PA 5FYQA 4NRDA 4RD1A 3K9CA 5LBTA 5DOZA 1BXRA 5K9ZA 3O4JA 1W9MA 1Q20A 2XVMA 1Z7WA 2OV1A 2M1ZA 3DCIA 4M8KA 1J0CA 1ZRNA 1XTTA 2CXQA 3LXUX 5L3SA 4EPXA 4DRYA 5B4UA 1FP7A 3NDRA 1XTRA 3IUQA 4FILA 1XK6A 3MGGA 2PZGA 1D4AA 4HJRA 3T1OA 4KQHA 4EGCB 1R16A 1UOOA 1BZYA 3GLTA 4N54A 1RM4A 2I2DA 5KI6A 5LC1A 2NP6A 4BB0A 1UPTA 3C6ZA 1RVV1 4DCOA 1RRFA 1RRPA 4TZKA 1A71A 1VJ5A 3DAGA 4ODIA 5EE0A 2PD4A 1NLMA 1ATIA 2R5FA 2YCBA 4NYMR 4PYQA 4Q9NA 2QU8A 4Q4LA 5FXMA 1S2DA 2H00A 5E2AA 4BQSA 3IOEA 5IM4F 4UDXX 3DMYA 4E2FA 2OWEA 3KSZO 5JO0A 3LYLA 5IANA 4TTPA 3TM4A 3M5WA 3LVQE 3EGEA 1Q2XA 3K1JA 3OEHA 4QECA 5K3CA 4YI3A 5DM70 3IIIA 3W1VA 1NUTA 1GNVA 1TJYA 4OAPA 4AJPA 2Y1OA 3OZAA 1QYVA 1XN4A 3DV9A 2GN1A 1QFJA 2QTVB 2ZIEA 3AI3A 3OPMA 1U8ZA 4GR9A 3KQOA 2FJ0A 1GPBA 1NXVA 3I32A 2WIFA 4U7FA 5DNWA 4J3FA 3P1JA 4V0KA 5L3ZA 4M98A 4URHA 2CSUA 3LL7A 4RF5A 3QVJA 1PJ3A 3EK2A 3X1XA 4HOYA 5DNUA 1FDTA 3F4KA 1EQAA 2UVPB 4XCVA 5KU7A 2FJPA 3OQHA 4IOMA 4BMDA 3QJGA 1PWEA 1KFCB 2R7LA 5FV4A 5DHPA 2DHQA 1KVRA 1RRGA 3RIGA 3DA8A 2WKQA 1GLNA 1ZA1A 2HSJA 2WD8A 4P2GA 1DTWA 2Q7OE 5IBCA 5K8TA 4OFBA 1PKXA 3SQMA 1RFLA 2OLJA 2FDRA 4Z3KA 3Q88A 2PHZA 2C2OA 2A5GA 5GGXA 2XQGA 3DOFA 3QFFA 5B3JA 3N0RA 3C5CA 3CZ4A 2ZRJA 4RD3A 1ML3A 3IDOA 3RVLA 5IDXA 3OEHD 1P4GA 1HL7A 1EWYA 1P18A 3MFQA 1C0PA 5KAMA 1YVPA 3W7AA 1W5AA 1A5BB 3NBKA 1XCOA 2GZDA 2H54A 1JE1A 2FSUA 1DBIA 2A9JA 2MSKA 2N3ZA 2O2YA 5CVDA 4NZPA 1L5MA 1JIIA 3VZSA 2RIRA 2ZWPA 3TNJA 2LDXA 3B5IA 2J59A 3TOCA 1U0BB 1DAIA 4OIFA 3IL2A 5B58C 1GRCA 1QO7A 5IJ0B 3K92A 1LZKA 3VTKA 4ZVLA 1Q1EA 3ES9A 3SBEA 4OD0A 2BZ1A 3M6WA 4IX1A 4IP0A 4BCBA 2A92A 1NQTA 2G1PA 4LWQA 2OTCA 1UP6A 2ZRBA 2IL1A 1CE8B 4ACAA 1VPWA 3NHKA 5K51A 4FTWA 1CDOA 3CBGA 3KDAA 4I36A 4JJAA 4DCJA 5KOJA 1Z0SA 1R5OA 2XZTA 3H5NA 5A5FA 4TQ9A 2ETXA 2I1QA 3QFSA 4QXAA 1SOUA 5ITZB 3TZ6A 4LYFA 4XB6B 2OFPA 4PRKA 4XGRA 1E1YA 5DI3A 3A3NA 3Q11A 1GCUA 4TMZA 1CJSA 4KOEC 1GZUA 5B55A 4PX5A 4B71A 5EUBA 1J8MF 5CNKA 2HJHA 4BN0A 3VPFA 4DLPA 4WJLA 5ICEA 2ZM6B 4CEHA 3WWOA 1XL0A 2WSSA 1EWRA 1Z8HA 3DR5A 3E22B 4IF4A 4U0JA 3JY6A 4U6NA 3RUPA 3W6UA 1VI6A 4KQCA 1Y1KE 3VZCA 2CVHA 2C92A 4QM7A 3IUBA 5EJ6A 4LGYA 2VAVA 1CD5A 2ECQA 4O59O 5K7SA 2JL1A 4RMNA 3T5TA 4ZU3A 2GA8A 2L69A 1AKRA 1IH8A 1N9ZA 1MC4A 1ZCZA 1W4RA 3AIOA 3CT6A 4FFOA 1ZCAA 2O2ZA 4HKTA 2REBA 2YDXA 4P4SB 4GEKA 3AF3A 3U44B 1PYOA 1O7JA 1U1IA 2I2XB 2P9HA 2W2KA 4QBHA 1NAIA 2QLBA 2A9RA 3EC7A 5DF1A 4F91B 2YYAA 2Y0PA 2PNJA 3D3KA 4G25A 1G0NA 5A4AA 2NTNA 1P0PA 3NM4A 3KKNA 1XMOB 1SU8A 1QH1B 2X8AA 2AW3A 2YOHA 4J76A 3QVOA 1X7YB 4WNAB 1F2VA 4QODA 4RDXA 1RYMA 1DMSA 4PZZA 2W4IA 3DLTA 4IKEA 3C3KA 1DPGA 2QY6A 3N6XA 3T3OA 1FUIA 3BFPA 4D8XA 2F4VB 1HDOA 2A0UA 2Y92A 2PEZA 3KUKA 2FZ5A 3OBBA 1JWLA 1ZD8A 1BTOA 2OVBA 4H4EA 1GOTA 3E6AA 3O2NA 1U7HA 2DXIA 3LPMA 1VIYA 1DJPA 3AEYA 1CSEE 1G20A 3IIKA 4CIYA 7GPBA 5ALTA 1IHOA 4OHRA 4RTMA 5EEHA 3OQJA 3H87A 4IMPA 4L4YA 3LP5A 4LUCA 9ABPA 4CT5A 5HF6A 2A5DA 3B52X 2VJKA 4CCYA 4C1NA 1GKLA 1M67A 1UBTS 2F1JA 1XCJA 1I6KA 1S8NA 1UPCA 3JD4A 4F8JA 5B12A 2FF7A 5G0SA 3U61B 1FW8A 1XCLA 2XCTB 4UD6A 4EMTA 3D3WB 4MRMA 4GMKA 4OCZA 1GA1A 4AJLA 3KYDB 3VH1A 2GNOA 5TGTA 2ZYIA 2VAPA 3QPUA 4GD3Q 2PS9A 3CUEF 1AE1A 4PAMA 1KY5A 2Q50A 1RVDA 4PSDA 1XCMA 2BDTA 4DMMA 5I01A 4W5JA 5AM2A 3DZ8A 3GDFA 4ZAYA 4I4NA 2JAUA 2PUVA 3TUIC 2P3QA 5BQ5A 5JJBA 4Z4FA 4S0ZA 3PDWA 1AGYA 1G18A 4ZI7B 4Q1BA 2NG1A 3PQFA 2P6RA 5DGCA 3GY0A 3THWA 4FYHA 1EQUA 5F23A 4QXMA 2Y6VA 5CX1A 4XPZA 5H68A 1ORIA 4G1FA 3BD6A 1JZTA 5LYYA 2ZUDA 2SCUB 5K20A 2G1JA 2BVNA 1J1IA 1U5AA 2XEXA 3EGVA 1M83A 2QZSA 3DO5A 3L0CA 4ZXFA 4GOOD 3KQTA 4DC1A 3GJ0A 3FWYA 3ZVKA 2J9ZB 5IT9A 1QK4A 3H7IA 4S12A 3ZDXB 5C8YB 3KVRA 3V3KA 4R1QA 3VOTA 1SFRA 2C00A 3BFXA 3BMOA 4ZHSA 3GDWA 3HB0A 1KSHA 1AK1A 4L74A 2E4UA 3D7LA 2GETA 1U80A 2P4EA 3ZR4B 2QTLA 4GU5A 3LGAA 2BMEA 1UEIA 3A28A 4L51A 1OJLA 4AJ9A 4MVCA 3ZBPA 1L8AA 5LMUB 1QS0A 3BL5A 4C43A 5IP5A 3IOMA 2UYHA 1WCXA 1TA0A 1SA0A 1V8OA 3TLMA 4QBIA 4JSRA 1CJUC 2DQSA 3FYUC 4DBVO 4WEQA 4NY1A 4XYMA 4B73A 1LLDA 3OPYA 4BLUA 4LSMA 2TMKA 4HJXA 4M7WA 3T7RA 3DUWA 2WT9A 2A9FA 4JBIA 3CVWA 2FB9A 3FWNA 4D5EA 3EPJA 3A1FA 4IFIA 2G71A 1TTQB 3NDPA 3D3QA 4HX2A 1GSAA 5B3KA 1XDDA 2FFHA 1TM5E 5IJ9A 4G0PA 5DIZA 4ZARA 3JTEA 4CGYA 2I2CA 1JLSA 1XDGA 4Q12A 3KVNA 5DSTA 4NZZA 2HPAA 2PUHA 1JA9A 4FMCB 3QKUA 1YZQA 2D4AA 1X7ZB 1C5KA 4IDBA 4ND5A 4K5QA 3TZLA 4IIUA 5INTA 2J09A 1R27A 1DX6A 2XMRA 1JPJA 3MTGA 3EG9A 2IIBA 3O4HA 3DT6A 2EKZA 2Y2VA 4L0CA 1IC6A 2QOEA 3JAKA 4QDZA 5TQVA 4LDQA 3V5NA 4X20B 2G25A 3AKEA 4WCDA 2BGTA 2G1AA 3L8CA 4RC9A 3CF0A 3DZFA 1KSJA 2FE1A 2IHVA 3IJRA 4MS1A 3RVJA 3T7KA 4WA8A 1GZ6A 5D6OA 3L1HA 1EUCB 2GEBA 3SEFA 3P2YA 3PCXA 3TAHA 4QU8A 2YXPX 3DQQA 2Z2JA 4HVCA 3ROPA 5LQSA 2FKNA 4B6JA 1IEXA 3K1AA 1CY0A 4TMFA 3TTTA 3VU3A 1JQAA 1NXXA 4C0HA 4CWAA 4RXMA 2J6BA 1UAGA 2JLSA 4V0SA 3H18A 4QDOA 5LQRA 2A4MA 3ICEA 5MF6A 2FLKA 4ILKA 4HSEA 3TNFA 3VAYA 4FFMA 2IPNA 3W2IA 5A05A 2X4DA 3FVVA 3H75A 1CS4C 1SN7A 4S1VA 2K2WA 4UUPA 1OZGA 3TSWA 2I0FA 3ROGA 3VO8A 3WMWA 4LF4B 5JUWA 4HATA 4F56A 5CDGA 4RCZA 3KSRA 1OLSB 3W9SA 3BCSA 3TBKA 3A05A 3NHJA 3FJOA 4UC0A 1V3UA 4CMGA 4IIFA 5CRIA 2ZFUA 3HUDA 3JSAA 4C0KA 3FTEA 4EUEA 4NBUA 5IDQA 3C97A 2JFOA 3OG9A 3OIYA 4H31A 2GWHA 4GWKA 1P0FA 2J3JA 3HA5A 3G2OA 5CVTA 5D86A 4DQXA 1XRLA 3HVJA 4TTVA 4YRSA 1D3AA 4O4IB 1TZ2A 3QRWA 1Y42X 2RG1A 5BW4A 2BI8A 1ZM3A 2P77A 3QGMA 4P5DA 2OCPA 2Q4EA 3BQNB 1KR2A 4JJZA 1A95A 5EJGA 3U5TA 5EIXA 1F2UB 2HNAA 3S7ZA 1MOSA 1ATZA 4JXJA 4BLQA 1EX9A 4EFMA 3ZZ1A 3TDNA 3WZMA 1GFSA 4LCBA 1P7VA 3KHUA 2O59A 1A4XA 3BFVA 3TW6A 4QULA 2BBSA 4DXDA 4ZTUB 3K96A 3DTNA 1SXJA 3D5EA 3JYNA 5CNIA 5CT8A 5AI6A 4QZVA 1IY2A 4KPGA 3QXSA 1R0CA 1E7QA 1QE3A 2I1VB 4MUXA 1T15A 2ZLBA 4KO4S 4UNIA 2A94A 1E9FA 2JFPA 3SJAA 2JFHA 2NUBA 2DKFA 1EBBA 4MV3A 4PO1A 2V7UA 5AK3A 2CFOA 3NCTA 1CUBA 4GM0A 3TX6A 3IMFA 1FVHA 5DTQA 4UTZA 5CA0F 1Y6GA 1B23P 4OATA 2GF0A 4J0QA 4KYUA 4G5YA 1I2CA 1V6SA 2HK8A 3M1LA 2FMTA 2XUJA 5EKDA 4MDEA 5K3FB 2XXAA 4YT2A 4E2WA 4L8GA 2JJ1D 2RI1A 2P8JA 4HDMB 3DSRA 2FSHA 3PQCA 5DE3A 1VBMA 5JSYA 2HDHA 2FW1A 3ZKWA 5DEOA 2ZXFA 5DI9A 4LOJA 1NSYA 4XI9A 3QPVA 1ONBA 2JDID 4HLQB 4OH7A 3RTEA 2AE2A 2VZ9A 2QDKA 1ADCA 3O4IA 4HFJA 4KMRA 4DQ0A 3TG2A 3NGLA 3FJ1A 1LS6A 1W36B 1DG9A 1QMPA 1BE6A 3UAXA 4Y1EA 1LA2A 4CG1A 3VPCA 2JJYA 2ROQA 2UV8A 4RENA 2VK4A 1ZKDA 2QTZA 3NWJA 4TVBA 4WXHA 2VBFA 4W7SA 4RELA 5EPOA 3RV3A 4C0WA 5A6SB 1KMHA 4LK3A 3I62A 3WLJA 4Q7JB 2F7SA 3G1UA 1CUDA 1E2DA 4XWAA 2OO7A 3SYNA 1VIDA 3PX7A 4XUEA 4ZCTA 1UFOA 2H29A 4G2TA 3L3BA 1FQJA 3NM5A 2YXNA 2PN1A 1XJCA 4WKBA 3TQIA 4O4LB 4A2PA 5CLGA 2NU6A 2GZ1A 1WQ1R 2PWBA 3AM3A 3EXHA 3K6RA 1NNI1 4IIJA 4MLCA 3O8LA 4V03A 3ZWVA 2Y4NA 2E21A 2QAGB 1WMAA 1KQ3A 3ZN2A 4A73A 1W36C 3RADC 1NT2A 3BJZA 3L6DA 3QQ5A 3WLAA 5IYZB 3LBHA 4EJSB 1WPXA 2OHHA 3MRVA 1UMCB 4RH1A 4XYGA 4KXQA 4MP3A 2ZIXB 1IRIA 4DVGA 5MHTA 4BWFB 4JBXA 4L5YA 3CRMA 3KQWA 4HTFA 2PV0A 3TAUA 5LJIA 2IHYA 2QEQA 3JQQA 3WVNA 1UXGA 3IJPA 2XD9A 4BLPA 1XXHB 2ZRGA 3D8UA 3PC6A 4D9EA 2ZUEA 4EF4A 4K9KA 5D1HA 4ZQBA 5TARA 4BATA 4RA9B 2BMJA 2EARA 4TQGA 1TYBE 3RVKA 3SWWA 3P4XA 2OUIA 2UYOA 4WK4B 1M0SA 3DEHA 5D5PA 1MTOA 2EBHX 4UASA 4DW8A 4GNKA 5CM9C 1YZTA 3U0BA 1EHIA 1II8B 1Y9EA 3HVRA 1HNZB 1GV0A 4EGQA 1A8QA 1MO3A 4H17A 3V7WA 1KZ9A 1ARZA 2BHNA 2N1MA 3LO5A 1ECFA 1YQUA 4WTOA 2PZKA 4BMCA 2B36A 4G86A 2OYRA 4UBKA 4Y7CA 3AESA 3GNLA 2EX1A 2AZTA 3H3XA 3Q7TA 4M54A 3GYBA 5KTKA 3VNBA 3AOEA 4ZTBA 3K9NA 5C8DA 4RY9A 2VFAA 5AH0A 2G88A 1LPMA 4UJ3A 5JS7A 4EL0A 1SD1A 2CL7X 3BN3A 3DO6A 2AZXA 5EWLB 2CD9A 1JG1A 3EXFA 4NV3A 1H2XA 1UBMS 2XIJA 3MJCA 3SNKA 4BNTA 2GNAA 3MWEB 3C4JA 1S9DA 3ZU3A 1FTGA 2PTHA 3ZGYA 3OCWA 4Y8VA 3OHMA 4J1TA 3AJ8A 2GCPA 3K0HA 1TA9A 4DJJA 4HZGA 4R71A 5TNXA 2CK3A 3PGJA 2C94A 1DAEA 4YJ3A 2J0VA 2XKAA 1XEAA 5DPMA 1KXJA 1ZRSA 2RC5A 3ZHRA 1BD4A 4DPKA 2FPOA 1Z6PA 1ULBA 4RY0A 2QZ9A 5HRUA 1OGJA 4P35A 3ZU2A 3N0WA 3UVEA 2VL7A 3B2NA 4NEHB 3D5TA 5IM5A 5BVHB 4NOMA 1ZKMA 1ZWKA 3RROA 1HYQA 1QP0A 2OQIA 3FTCA 3N07A 4RIHA 1M6VB 4ZU6X 3P26A 3W5CA 3PJFA 2R84A 3OZSA 4IJ6A 1RBMA 1NVMB 1E1DA 2H5IA 4H15A 4MINA 1L7BA 4OSEA 4QHSA 3FB1A 4JVOA 4CLOA 2H3HA 2G17A 1WB6A 5TEWA 1WQ3A 4QDXA 1DWOA 5BV2P 2JVIA 2E4XA 1J7JA 3CPEA 4X61A 1HE3A 4MJXA 2D00A 1DC8A 3PNYA 5BN1A 2Z2XA 4WKCA 5CFQA 4IJVA 1XZPA 1IY1A 5GVSA 2YHAA 5KJEA 3VFDA 3OZWA 1P2FA 2BFCA 5CAEA 2L18A 2J4CA 1GZ5A 1JFFB 1GFZA 1H23A 1JVBA 5DGDA 2ID8A 1TJNA 3WLFA 4LOLA 2IHZA 2O8CB 2WOOA 3FE2A 4P7GA 5JOQA 3NETA 2E89A 3O2SB 4W9NC 4YAUA 2IZ6A 4CT0A 4BUCA 5HVNA 2GUGA 3K0CA 1EK5A 3I5YA 3CUWA 3OOWA 2G07A 2ZRFA 1UBFA 1HH4A 3IIMA 5F1KA 3X1MA 2MT9A 4BGUA 1PNTA 1XN1A 2V9PA 5FNVF 3S40A 3ZY6A 1Q7EA 1C9KA 3C45A 4GT1A 2P9TA 4BFVA 3ADCA 2GEKA 3IVMA 3ZWBA 1OZ0A 3QX9A 1Y4SA 4UU8A 4V38A 1FW6A 3GLGE 1O6BA 3M8KA 2EJWA 2QT0A 2Z1MA 3LKZA 4FDMA 1E1RA 3NC4A 5J1SB 1C7QA 4HFRA 6REQA 2XGGA 3IVXA 2R1TB 3FTPA 1TLTA 2DGDA 1CEYA 1V39A 1S3IA 4UBIA 2ATVA 2Q5QA 3VPSA 4XASA 1AXRA 1FTQA 2F3PA 5JANA 1IUPA 2F48A 2GN2A 2WHQA 1Y3CE 4J2HA 4KUHA 5I8PA 1AHHA 1K5PA 2BGMA 2P62A 1I5OA 4FGUA 3RE1A 1TGVA 5HIKA 1G64A 3N6VA 3SOZA 2IHBA 4EX6A 2V9CA 4MO9A 2JA2A 2XMQA 3M3PA 5JWHA 1A7KA 4F3NA 2ZYTX 4FCWA 1AN9A 3GUHA 3NVMB 1E1KA 1X70A 4H3HB 1NPTO 5DYIA 3VKVA 3IE0A 4YAIA 2BFWA 3DNFA 3Q85A 1ZESA 4DQKA 1Z56C 3BD8A 3GPIA 2GVNA 2ACWA 1F4VA 1PNQA 3GP5A 4JBWA 1UDWA 1FXSA 2J0EA 4JGGA 4WXPA 4ZHQA 5JADA 4X65B 4BQIA 5ALIA 4Z51A 1C0IA 2O07A 2FR8C 5TQ0B 4UFNA 4JXZA 3P96A 4LJAA 16PKA 1F3LA 3A3YA 4C6RA 4BX2A 3F9RA 4QQ8A 4PZ0A 1JH8A 2FPRA 3GFVA 4YRTA 5ITVA 1IN4A 3WYCA 3GEGA 3JYOA 4JLMA 2ADOA 1AS3A 1J4AA 3DE6X 4AUNA 3K6SB 1PWZA 1E32A 1U3WA 2FFRA 4V3CA 3HJFA 2F3TA 4TTJA 4P5EA 4X8LA 4EFLA 4FMDB 3IALA 2AOUA 1DJLA 1K6XA 2WJHA 4Q3EA 1B8UA 3VXKA 1Z36A 4FFBA 1E77A 5CEFA 1ZAYA 4PTYA 1US8B 1A9QA 1FLNA 2HLDA 2PA3A 4JP3A 1PQUA 4OJYA 3TJMA 3ECAA 3BH0A 5J5AA 1MIOB 5K8LA 2BFBB 4L5JA 4CM9D 1TEVA 1V9LA 4TZTA 5KKAA 2ERXA 4EHHA 3L1JA 1Q11A 3O21A 1C29B 4GVXA 5BRAA 3CGGA 3CKMA 4K6CA 3WLNA 4YUWA 4B9AA 4E4TA 2GB4A 3K70C 1U0RA 1L5WA 1VMIA 2FFQA 2JAHA 3FOBA 3NCHA 2IWHA 3UJDA 4F45A 3O1IC 3IHTA 2P2NA 2WE7A 2IOFK 1J97A 1Y5IA 2VJOA 3C6XA 1QZUA 3B9RA 1C81A 3VDNB 4RPKA 5HE9A 2OCDA 3OJCA 2GXAA 4E3WA 2CLFB 3C74A 4H6XA 4PLWA 5E1MA 4B0OA 3IIJA 4BN5A 4TM8A 1FYWA 3G85A 3M6MD 2PK3A 2DHDA 1EWTA 3GJ7A 5H83A 1VE6A 1Z8NA 4TMWA 3KLPX 4O02B 1JTVA 2WJVA 4ZVOA 4AZSA 1OIXA 1UKAA 2C1EA 1Z9BA 2UUCB 1M2GA 1EFRD 1V47A 2J9XB 2RB5A 2V45A 3EYAA 3H84A 3LY7A 3WKBA 5F3DA 4L27A 1GRQA 3ZWPA 2X6QA 1FLAA 3E9CA 3T4XA 3FB4A 2DPYA 4W8HA 4FB5A 5LMZA 3UWPA 5LP1A 3T3EA 1FSFA 3I34X 3KZKA 1BKDR 3FTDA 4OSOA 3GAMA 4PHHA 3IBTA 1JAXA 5BMOA 3IQGX 1GQRA 1I10A 1LC0A 2I1WA 2JA1A 2IHKA 2QZJA 5TJ9A 2VQ3A 2GSDA 4F2PA 4F6CA 1HR0B 5EHNA 2WHXA 5T67A 2JBAA 1LLQA 4EG1A 3TLEA 1PZXA 2HBRA 7AT1A 5D5HA 3HYSA 1KWGA 4BZZA 4G4SO 2P5SA 3TCXB 3C3WA 3WNQA 1K98A 2EJBA 3EHEA 1MFZA 3P9NA 1HV8A 1JUDA 1VLMA 4PICA 3RSHA 3ZHUA 3L1VA 2BFEB 2JS7A 4FHDA 4PSAA 4NTZA 4R2LA 2WWHA 3IMGA 3MQFA 4B1FA 4WBNF 3GLRA 1BAPA 1SK9A 3PJRA 1IRXA 2CUTA 4OB8A 2JGJA 8ATCA 4DB4A 1QPZA 4F84A 1PEDA 1QH8A 4EBFA 4ZYTA 4HNTA 1AY0A 1O4VA 4C0XA 3WLTA 5D5QA 2JRCA 4G4IA 2AOTB 1SBNE 1IB6A 4KLAA 2D1RA 4QVIA 1B6SA 1AGXA 3HK2A 1QM5A 4UULA 3FYTA 2C1XA 2GM9A 2PS1A 1PNOA 3CMMA 3ZU6A 1C14A 2B1JA 3BRQA 5KNCA 3MGCA 2CFRA 3F1LA 3RYTC 2J85A 4UNNA 1PJ8A 4QD3A 1PZFA 3CXUA 4UPEA 2IIVA 3LP6A 4RK0A 1S89A 5SZKB 4FCTA 1CZNA 1I5RA 3EEQA 2PZ8A 1JFRA 1VRCA 5K3EA 5FWNA 1HMPA 1RJFA 1XQ9A 5A9SA 2AI2A 1E0DA 3ECSA 4MV8A 3LT0A 1EJ6A 3OQIA 4YRZA 5KJ6A 2Q0HA 3FCOA 5D85A 2MSLA 4ND7A 1NVAA 1W85B 1E5VA 2JCYA 2PLNA 1NKVA 3VHQA 1U2GA 1UFVA 4FFVA 4EY5A 4DLZA 2B9VA 3LKBA 2UXCB 1Q0RA 3CNEA 2R8YA 2IDJA 3ADOA 1HZZC 1GYQA 3PHJA 5T8KC 1D2EA 2PRIA 3A7EA 1Q1AA 2FMXA 2VYFA 4IWXA 3RI3A 3TB6A 4DUZB 3A27A 2O3UA 1KDRA 3QNWA 4QA9A 3T34A 2UYYA 3PFBA 2G83A 2GPSA 4NIMA 1PBNA 3CTMA 1E6CA 1EFLA 3WRWA 5BSTA 1FUUA 1VDMA 3UJ3X 4Q3NA 4QQNA 4Q1FA 2G9ZA 4XQCA 3TR5A 2GPNA 4NYIQ 4UW9A 1FDIA 2I4OA 4MV0A 5IHXA 1SCUB 4XDZA 4B5KA 1E2NA 3R6LA 2XPCA 4G56A 5TS3A 2CUNA 5A6VA 1MZPA 3JZFA 5CEEA 1PR1A 1ZRHA 4BLSA 4RPLA 1QRSA 2HI0A 4PGHA 4YJ3F 4N18A 1V45E 1JHYA 1PR4A 2GYVA 1X1AA 1VJTA 2IF2A 2D5LA 2Z8YA 2REQA 4QDUA 4ESOA 1TYDE 4TKLA 1TT5A 3T12A 4BRUA 5G1OA 4Q03A 1BX3A 2XUAA 3H1TA 3W6OA 1X1QA 5KVVA 4A10A 5EIWA 3HB4X 2ZJYA 4LDZA 3A1CA 2PZMA 2VS1A 3O6VA 3RU3A 4TQUS 2H6EA 1AVTA 1DB3A 1ZAKA 4D96A 1P5JA 1IVNA 3G5LA 1NT4A 1R9JA 3PS9A 2R85A 4LEIA 4OMFG 3MILA 5EE5B 2MYPA 1H0SA 5E2BA 4DR2B 1J39A 4LXXA 4GI2A 4UOZA 3TJRA 3TOXA 3U3XA 1LNQA 1SVSA 1HMYA 3BRSA 3DM5A 5JCXA 4IH9A 1Z0AA 2AOTA 3KUDA 4D4IA 3IQFA 4QT0A 4C6TB 4RS3A 2YIDA 3HJHA 4BP3A 4P0PB 9LDTA 3DVAA 3MINA 4G8BA 4X1KA 4DLVA 4K8OA 4YJ2B 5JISA 3D4LA 4IV0A 5LZ9A 5A0TA 2VPPA 2JD1A 1AD2A 5EPUA 2ZANA 3EXG2 2ZEJA 1WULS 3KHSA 5F12A 1H8HA 3A0RB 5JD3A 1FRZA 3HGTA 1WBJB 1NLUA 3OC0A 2EC5A 4OP2A 4R3UC 3HJCA 2Z4RA 4PVDA 5F33A 4JI4B 4IJWA 1DU4A 3FR8A 3OY2A 4JLOA 4XGIA 2YHSA 2CC2A 2JJQA 5DXAA 5C32A 2QBYA 4CIDA 3TIXB 1RRMA 4NK4A 1JKFA 2CLIB 1SGWA 1LSJA 1H4SA 1EVZA 2IUTA 2X8BA 4N1AA 1RKXA 3RRZA 3CFYA 3HY6A 5T8KA 3NNNA 1EG2A 1VKNA 4DR4B 4XJVA 2ZAMA 3NJRA 2GHQA 4A8JA 4FOTA 2HMTA 1SUIA 3PC8A 3SVZA 1IN1A 3IMEA 1M66A 3GGSA 5AI8A