5JGGA

X-ray sequence and high resolution crystal structure of persian sturgeon methemoglobin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
142
structure length
142
Chain Sequence
TLTSADKSHVKSIWSKASGKAEELGAEALGRMLEVFPNTKTYFSHYADLSVTSGQVHTHGKKILDAITTAVNHIDDITGVLTALSTLHAKTLRVDPANFKILSHTILVVLALYFPADFTPEVHLACDKFLASVSHTLATKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray sequence and high resolution crystal structure of Persian sturgeon methemoglobin
rcsb
molecule tags Oxygen binding/transport protein
molecule keywords Alpha chain
total genus 57
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2016-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 5jggA00
4KN3A 1MLRA 4G1VA 1OFKA 3EDBA 3HF4A 1Y85A 4MQGB 3WCTD 5SW7A 2H8DB 2NSRA 1XY0B 3GQGB 1Y7CB 4L7YA 2G0SA 2G0RA 5F2AA 3ZHWA 3WI8A 1A6MA 1X9FC 1XZ5A 2D2MB 2OIFA 3PI2A 1Y7ZA 1HGCA 1Y7GA 3D7OA 2D2MA 2YRSB 3BCQA 1YIHA 1XZVB 1A4FA 3VREA 1HV4A 2GRFA 5EQMA 1YGFA 1ECOA 1XZ4A 1MLHA 2YRSA 2AURA 6HBWB 3ZJLA 1DXTB 3W4UB 2LH3A 1Y4RA 1MNIA 2V1IA 3QJEA 4H07A 3OZUA 6HBWA 4MQJA 2BLHA 2VRYA 4NS2A 1X9FA 1URVA 1GLIA 2HBFA 1HGAA 2ZLUB 5AB8A 3G53A 3ODQB 3DHRB 5KERA 1NZ2A 3S48C 3AQ6A 3GKVB 1FDHG 3ODQA 3R0GA 4WJG1 1O1LB 2ZLXA 3VRFA 2ZSRA 1MKOB 2MYDA 1MBOA 1Y0AB 1IRDB 1XZUA 5JOMA 2AV3A 1HCOB 1GVHA 5CN4A 1DXDA 1NZ5A 1HBGA 1A01B 1V4WA 1V75A 2O5LX 3IC2B 3E5OA 1XQ5A 1S0HA 1DLWA 1HCOA 2H35A 3A5BA 3UBVA 1JDOA 1MZ0A 2MHBA 1S0HB 1MLUA 2C0KA 2MGCA 3HHBA 2FRIX 1M9PB 1YE2A 5CNDA 1AZIA 3UHSA 1XCHA 3D4XA 1MLMA 1BZ1A 2PGHA 3RGKA 4UIQA 5CNGA 3QM5A 4HRTA 4ROLA 1QSHB 1HABA 1MOCA 2Z6NB 1NS9A 2QSPA 3HXNB 3WHMA 2PEGB 3QQRA 3FS4A 3EDAA 2NSSA 2DN1A 1J7YB 1B86A 2EF2A 1X3KA 2D2NC 1DO1A 1J40A 2R1HB 3QM6A 1YOIA 1CBLA 1F5OA 3BA2A 1V4XB 3S66A 1DKEA 1HACB 5KDQA 4O35A 3KUOA 1Y31A 1Y4BA 1DKEB 2ZFOA 1YIHB 5KDQB 1MWDA 1N9XA 2MGIA 3ASEA 3MJPB 1Y31B 3OO5A 2V1GA 3ZJQA 1OR4A 4ODCA 2HBGA 1Y7DA 5CHQA 4NXAA 2H8FA 2AV0A 5JGGA 1Y2ZA 3MN0A 1HDSB 1EMYA 1HGAB 3FH9B 3RJNB 2OLPA 2VYWA 2ZLUA 3O89A 1Y46A 1ASHA 2MGDA 3BJ2B 1DXUA 4XS0A 1K1KB 3GYSB 2QMBA 1UMOA 1IT3A 1YIEB 1YG5B 1QSIA 1I3DA 3ZJOA 1BBBA 1RTEA 1MKOA 1JF3A 1A3NA 2G10A 2LH6A 1YIEA 3AT6A 1YHRB 2DN3B 2BLJM 1A3OA 2RAOB 4HSXA 5EV5A 2ZLTB 4U8UD 2G0XA 1GDIA 1C7DB 4HRRA 1GBVA 1JP8A 3UHQA 1MLSA 2MHBB 1HHOA 1YZIB 1UFJA 2FRJX 2JHOA 1YEUB 3PI8B 4MQIB 2HBEA 3HHBB 2WTGA 1EBTA 2GDMA 3VAUA 1YHEA 2HBCB 1OUTB 3UHHA 1J3FA 3NMMB 1COHA 5E6EB 4ESAB 4WCHD 1S69A 1O1IB 1HABB 3EOKB 1YOHA 3WHMB 1EW6A 3QM8A 1HBBB 2Z6TA 2HBSB 2AUOA 3WCUD 2HHEB 1G0BB 1Y0CA 1AJHA 1C7CA 1MTIA 3DUTA 5CNEA 1Y01B 3GQGA 4FH7A 1YDZA 3AQ5A 1BJEA 1Y7CA 2R4WA 1Y0CB 1RTXA 1CG5A 3HC9A 5CN9A 1GCVB 1VWTA 1K0YA 3R5IB 1CH9A 1CP5A 3K8BA 4N7PB 3BOMA 1Y7GB 5C6EB 1VRFA 4G1BA 1BZRA 2G0VA 1KR7A 4N7NA 5HY8A 1HDAB 1DO7A 2GTLA 1HV4B 1O1OB 2QU0B 1JZMA 3S65B 1CQ2A 1CLSA 1SDKB 3PI3A 1MLKA 2QU0A 2NX0A 3WCPB 1Y4QA 2OHAA 2ZT1A 1RQ3A 3WFUA 3LQDA 1ABYB 1NQPB 4H2LA 2LH1A 3UHEA 3D1AB 2AA1A 1O1MA 2BW9M 1MBIA 1K1KA 3MYMA 3HYUA 1DTMA 2M6ZB 1JF4A 4XDIA 4PQCA 1Y45B 2D5XA 4MXKA 3OVUC 5JDOC 1A0UA 1JWNA 1ABWA 1H1XA 1MYFA 1WVPA 4F6DA 1Y4VA 3ARLA 1N9HA 3HENA 1PMBA 1MTKA 3K3UA 4MBAA 2MGHA 3UHIA 2HBEB 1UX9A 1WMUA 1YMAA 4YU3B 1FSLA 1LUEA 4JACA 2G11A 1S5XB 3UHKA 1OUTA 1Y0TB 5E83A 1SHRA 1J7WB 1YE2B 1G09B 3NG6B 1HBSA 2W6VA 4QAUA 4PQ6A 1MLOA 2MGGA 5CNCA 5KKKA 1HBIA 2HCOB 5JDOE 1LH7A 4F69A 1UVXA 1Y4GB 2HBSA 2ZT4A 1HGBB 3UGYA 1LJWB 2EVKA 3DUTB 3ARKA 6HBIA 4ZVBA 3KMFA 4VHBA 3ZJHA 1L2KA 1AJ9A 2OHBA 2R1HA 3ZJNA 1SDLA 2R4ZA 4O4ZA 1FHJB 5AZQA 3AQ9A 3GQRB 2DXMB 1NIHB 1BABB 1Y4BB 111MA 2IG3A 1Y7ZB 4IT8A 2HZ3A 1WLAA 1TU9A 2GTLB 1DLYA 3BJ1B 3ZJSA 1NPFA 4F4OA 1VXAA 3OO5B 3QZZA 2ZT0A 4N8TB 3A0GA 2MYAA 3WFWA 2ZS1A 3WCUC 3A5AA 1LFLB 3S1IA 3ONZB 2HHBA 3QMAA 3UH6A 3IC0A 1XYEB 3IA3B 4C44A 4NK1A 1OR6A 4U8UB 3IC0B 2MGJA 2LHBA 1NS6B 1Y46B 1QPWB 2HZ2A 5HLQA 2MGAA 3GDJA 1A4FB 3VREB 1ABWB 1YGFB 1A3NB 1G0AA 1Y4VB 1O1LA 1DXTA 3VRFB 3UHZA 4F6GA 5CN6A 2QFKA 1OJ6A 1FSXB 3PI9B 1XZ2A 1IBEB 4F6BA 2EKUA 2VLYA 2HBFB 3ZJMA 5CN8A 4MQCA 1MNOA 104MA 1D8UA 1OBMA 5ILPA 4MQCB 1LA6B 2MGEA 3UHDA 3NMMA 1S6AA 2ZS1D 2ZT3A 3V2VA 4F6FA 2ZLWB 2IN4A 2ZLVA 4UURA 1KD2A 3P5QB 2W6YA 1QSHA 2LH5A 1A01A 1Y8WA 2NRLA 2G3HA 3S1JA 2GRHA 3WCWD 3A59B 2CMMA 3TM9A 1B86B 5HLUA 4M4BB 3D17A 5HBIA 1MBCA 3PIAB 1YEOA 1ECNA 3SDHA 1H97A 1MLFA 2ZSZA 4ZVAA 4PNJA 3BJ1A 1MLJA 1CH1A 4MQHB 3GOUA 4MPMA 5ILRA 4N8TA 1RPSA 1NPGA 4B3WA 5EOHA 1Z8UB 2DN2B 1YH9A 1JZLA 2ZFOD 1SPGA 1Y7DB 1S5YA 2GKNA 1DUOA 2MYEA 3WCPA 1Y85B 2O5OX 3GQPB 1BIJB 1G9VA 3GLNA 4H2LB 1Y5JB 4H0BA 1NS6A 1O1MB 3S66B 1HACA 3NL7A 5D5RA 4HHBB 3PELA 2ZFBA 1SI4A 1N9IA 4PQBA 4HHBA 5E29A 2ZFBB 3LHBA 1DXCA 2VEBA 4MQGA 2ZSSA 5AZRA 5SW7B 1CIOA 5JGGB 2O58X 1CP0A 3G52A 4C0NA 2W72A 3HEPA 1GBVB 3FH9A 3G4UA 3UHCA 1URYA 1UC3A 1YCAA 2GRZA 3NFEB 1NEJB 5EYJA 4MAXA 4NI0A 4F6JA 3D7OB 1UX8A 1J7WA 4MQKB 1NGKA 1YG5A 1BBBB 2ZLVB 2BK9A 4NI1A 1MLLA 3A9MA 3KMFC 5E6EA 1JEBA 3B75B 3GKTA 1JP6A 2D60A 3QQQA 1YGDA 1VREA 3AT5B 1Y5FA 4SDHA 3QJDA 2D60B 1JY7A 1J3ZA 1LHSA 1MLQA 3D17B 3MJUA 1YEOB 4FH6A 1LFVB 2E2YA 3OO4A 1M6MA 1UVYA 3PT7B 1HBHA 2GKMA 1FDHA 5EUIA 4YU4B 1LFVA 1ABSA 1OUUA 3PT7A 3GOUB 1HDBB 5EU2A 1VXCA 1A6NA 4F4OB 3CY5A 3G4QA 1SPEA 3VRGB 2ZS1B 3ECLA 1MYJA 3WR1B 1U7SA 3S65A 1CG8A 1C7CB 1CLSB 1CPWA 1S56A 2D2ND 3LR7A 1XYEA 3WR1A 3QJBB 1JPBA 2ZSPA 1Y09A 3NMLA 2MYBA 1RQ3B 3OZVA 3PI4A 1X46A 1K0YB 4MXLA 3QJBA 4NXCA 1F63A 2AA1B 1YHUD 4HSWA 2ZSXA 3GDJB 1YVTB 1EBCA 1HGCB 1BUWB 3UHWA 1NS9B 1YE0B 1O1OA 1RQAB 4G51A 2MGFA 4KMVA 1BUWA 4G51B 3LB2A 1QI8A 1IDRA 1Y4QB 3IXFA 5M3SA 1QI8B 4TYXA 3WCUB 1CMYB 1NEJA 4KMWA 4NI0B 1BZZA 3QM7A 1BVDA 1GLIB 3A5GA 1ITHA 2LH2A 4U8UC 1LA6A 2VEEA 1XXTA 2ZFOC 4NI1B 2D5ZA 1MLNA 1QSIB 1LH6A 1C40B 3OZWA 1JEBB 1XXTB 1EWAA 3P5QA 2D5ZB 1DO3A 2ZLXB 1Y4GA 3WCVA 1FAWA 1Y8WB 4FC3B 1J3YB 1DTIA 3AG0A 1RVWA 112MA 4TWUA 1LJWA 3E55A 3BJ2A 1Y0DA 1BVCA 2VLXA 3KUNA 3WCWC 1CQXA 1FN3B 1SDLB 1Y8IA 3ZJPA 4TWVA 2GTLD 1GDKA 2RAOA 1COHB 1YEQA 3MKBA 1BZ6A 1IRCA 1JW8A 2ZT2A 2B7HA 2HHDB 3UHBA 1V4WB 1SPGB 3M3AA 1HHOB 3ZJRA 3PI1A 4M4AB 1LFQB 1MLGA 1BZ0B 3HRWB 1KFRA 1LH1A 1Y4FA 2DN1B 4AVDA 1LFQA 3UH7A 1R1XA 1CH5A 1T1NB 3UHGA 1YDZB 5HLXA 2EKTA 1FHJA 109MA 4BJAA 1Y4PA 1NIHA 1R1XB 1O1PB 1A9WE 1V5HA 3CIUB 3E5IA 4ROMB 3MVCA 1MYZA 1Y0WA 4O2GA 1SI4B 5C6EA 1Y8HA 1MYIA 1YVQB 2HZ1A 5E29B 4ROLB 2V1EA 1LFYA 103MA 1MODA 2HHEA 3G46A 3MJPA 2EB8A 1Y8HB 3ZOMA 5MBAA 2PEGA 3BCQB 4N7OB 3H57A 1I3EA 3U3EA 3UHXA 1A6GA 2HHBB 1O16A 2FALA 1YHUC 3M38A 1LTWA 1J40B 4DWTA 1J7SB 3WCTB 1IBEA 1ABYA 4L7YB 3MOUA 4N7PA 2AUQA 1F5PA 1XZ5B 2MGLA 3ZOLA 1F65A 1IWHB 2OH9A 1IOPA 1HBAA 4B4YA 3UHYA 3WCWB 1HBRA 1A00B 1MOHA 3LR9A 3PT8A 2HBDB 5EYSA 1HSYA 1YENA 2ZWJA 1A00A 5F0BA 1QXEB 2HBDA 5IKSA 110MA 1VXBA 1YMCA 1QXDA 3G4RA 1FSXA 1NQPA 1A3OB 1LFTB 1QXEA 1XZ2B 3MBAA 3D1KA 3QJEB 1IRDA 1R1YB 1HLBA 1UT0A 2OH8A 1C7DA 1WMUB 4F6IA 3WCTC 1MOBA 2R80A 1XQ5B 2M6ZA 3OO4B 4DC7A 1LFZB 5CN5A 4YU4A 4NZIA 2G12A 1LH3A 1CO9A 3QJCB 1Y35B 5KERB 1BINA 3EU1B 1VXGA 2QRWA 2D2MC 2D6CA 3WTGB 3ECZA 2HCOA 1THBA 4O4TA 2B7HB 3UGZA 1XZUB 1YOGA 2SPNA 2MGBA 3VRGA 3WTGA 2QSSB 4HRRB 1BZ1B 4X0LA 1GBUB 2ZS0D 3HRWA 1V75B 1Y83B 3OGBA 1HBBA 1S5YB 2EVPA 3GQPA 5CNFA 3UBCA 1LHTA 3NG6A 2HBCA 4DC8A 1YFFA 1CG5B 3WCVC 4ROMA 1NWNA 2DXMA 1GCVA 4WJGA 1RSEA 3UH3A 1GZXB 3G4YA 4FWYA 1DXVB 1RQAA 1MWBA 3DR9A 5MBNA 4O1TA 2ZFOB 1NXFA 2MB5A 5HY8B 1Y22A 4N7NB 2QSPB 3HXNA 1JL6A 3M39A 1BIJA 1G9VB 1CH7A 1S61A 3WCTA 5CNBA 5HU6B 1HJTA 2ZSOA 1Y5JA 2BNLA 1XY0A 1VWTB 2WTHA 3UHVA 5HU6A 2GLNA 1Y2ZB 3NFEA 3LB1A 3PELB 1Q1FA 1HDSA 1V9QA 1HBRB 2G0ZA 3ECXA 3QM9A 2O5MX 1HDAA 1O1NA 107MA 1JL7A 1V07A 1VXEA 3HF4B 4JYQA 3D1KB 3B75A 1A0ZA 1V4UA 1M6CA 5ILEA 3W4UA 1Y5FB 3UHUA 1A0ZB 3O7NA 2NRMA 1YMBA 1YHUB 3MJUB 1FN3A 1G08B 1YZIA 1DWRA 1MCYA 2DHBA 5EUIB 1YHUA 3OK5A 1Y35A 2D5XB 1G08A 3UH5A 3DHRA 3ZJIA 2XKGA 1THBB 3ARJA 4F68A 101MA 1YHRA 2EB9A 2D2NA 3LB4A 2V1FA 3PI9A 3CY5B 1Y4RB 2VM0A 2VYYA 1IT2A 3QJDB 4M4AA 1J3ZB 1BZ0A 1CG8B 2O5SX 1Y4FB 1C7BB 1T1NA 4M4BA 1YEUA 3PI8A 4MQIA 1NWIA 1Y09B 7HBIA 1YFFB 2V1JA 3DHTA 1MWCA 1MBSA 1C7BA 1YHEB 1O1PA 2BWHA 3AQ8A 2QFNA 1M9PA 2MYCA 3ED9A 1HRMA 3GQRA 1BABA 1J52A 3LB3A 4ESAA 3SZKB 1YVQA 1MNKA 2V1HA 5CMVA 4MU5A 2FRFA 3EOKA 3BOMB 1O1KA 2W31A 1Y0AA 4HRTB 2ZS0C 1PBXB 4UZVA 2KSCA 1BZPA 1AJGA 2H35B 1LFLA 3FS4B 1MYTA 3V2ZA 2Z6SA 1DWTA 1RQ4B 1PBXA 1DM1A 2R4YA 1CMYA 2G14A 1J41A 3G4WA 3BJ3B 3LQDB 2O5QX 3A2GA 3BJ3A 2ZSYA 1MYGA 1DWSA 1YH9B 2PGHB 3PT8B 2ZS0A 3G4VA 3A0GB 2QLSA 2SPOA 2ZS0B 3ONZA 1OFJA 3WFTA 3E4NA 2QLSB 1MYMA 1MGNA 2O5BX 4OF9A 5JDOD 5EE4C 2D2MD 2AUPA 1RVWB 3D1AA 1MBAA 1NZ3A 3H58A 2R80B 1Y0DB 1FCSA 1QPWA 5CN7A 2DHBB 1MTJA 1UIWA 3HYUB 1GJNA 4YU3A 1Y8IB 1VHBA 1NZ4A 4XS0B 3HEOA 106MA 1XZ7A 2QMBB 1LH2A 2XYKA 105MA 2W6VB 1XZVA 2D2NB 1MNHA 1A6KA 1YEQB 3MKBB 1XZ4B 2R4XA 2ZLWA 2VHBA 1CIKA 2H8FB 4FC3A 1X9FD 1ECAA 4HBIA 3UHRA 1Y8KA 2Z85A 1MDNA 1X9FB 4MQKA 3A59A 1UFPA 1S5XA 1DXUB 1Y8KB 3PIAA 1G09A 1B0BA 1OUUB 3SZKA 3ZH0A 1GDJA 1O1JB 2W6XA 2BKMA 3GKVA 1Y0WB 1W92A 1YGDB 2DN3A 1DXVA 2W72C 3TM3A 1O1IA 1VXHA 2MGKA 1MOAA 2ZLTA 1LFYB 2HHDA 2GTLC 2V1KA 1JY7B 5C6YA 1HGBA 1MNJA 4N7OA 5JDOF 4GZGA 3IC2A 2GNWA 2FRKX 2SPMA 1J41B 1J7SA 1Y4PB 1VXFA 5HAVA 4OODA 102MA 3R5IA 4U8UA 1MBDA 2WY4A 1IWHA 3WCWA 1GDLA 2VYZA 1YE0A 2FAMA 1SWMA 1YENB 2GL3A 5EE4D 1MYHA 2Z6NA 1GCWB 1G0BA 1V4UB 2XKIA 1QXDB 1J7YA 2VLZA 4IROA 1MBNA 1GCWA 2H8DA 5D1VA 1YEVB 4IROB 3K8BB 1UIWB 2ZSTA 1V4XA 1YVTA 2MBWA 1YEVA 1HBAB 1FLPA 2W6WA 1XZ7B 1LFZA 5CHRA 3VHBA 1VXDA 3QJCA 1LH5A 2LH7A 1JZKA 1C40A 3UHTA 1TESA 5ILMA 1G0AB 2MGMA 2O5TX 2XKHA 1CH2A 1ECDA 4ODCB 1A0UB 2DC3A 1SDKA 4MBNA 1LFTA 2BMMA 2ZS1C 3WCUA 3WCVB 2W72B 4FWXA 3M3BA 1R1YA 1GBUA 1BZZB 3AT5A 2Z8AA 1N9FA 4MQJB 3SDNA 4AVEA 1JP9A 3DHTB 2ZSQA 4L2MA 5E83B 1Y0TA 1HBHB 1SHRB 1Y45A 1NAZA 1O1JA 3GYSA 1HBSB 2BLIA 3EU1A 1Y5KB 4FWZA 1CH3A 3AQ7A 3GK9A 1CH4A 1FAWB 1HDBA 1KD2B 1DO4A 2SPLA 1O1KB 1Y5KA 3AT6B 3QZXA 1J3YA 1U7RA 2QSSA 4X0LB 1DUKA 1Y83A 4NK2A 4KJTA 2DN2A 2GNVA 3UI0A 5B84A 1A9WA 2ZSNA 1RQ4A 2RI4A 1AJ9B 3RJ6A 3ORDA 3CIUA 2RI4B 3MYNA 3TLDA 1CBMA 4DWUA 1YCBA 108MA 3ZJJA 1CO8A 1HLMA 4MQHA 1GZXA 4ILZA 5B85A 3NL7B 4LPIA 2R50A 3WCVD 3UHNA 3OJ1A 3D4XB 3K9ZA 1RPSB 5EETA 1Y22B 1O1NB 3WFXA
chains in the Genus database with same CATH superfamily
4KN3A 1MLRA 4G1VA 1OFKA 3EDBA 3HF4A 1Y85A 4MQGB 3WCTD 5SW7A 2H8DB 2NSRA 1XY0B 4B02A 3GQGB 4A8KA 1Y7CB 4L7YA 2G0SA 2G0RA 5F2AA 3ZHWA 3WI8A 1A6MA 1X9FC 1XZ5A 2D2MB 2OIFA 3PI2A 1Y7ZA 1XDTT 1HGCA 1Y7GA 3D7OA 2D2MA 2YRSB 3BCQA 1YIHA 1XZVB 1A4FA 3VREA 1HV4A 2GRFA 5EQMA 1YGFA 1ECOA 1XZ4A 3PMDA 1MLHA 2YRSA 4RMPA 2AURA 6HBWB 1ON7B 3ZJLA 1DXTB 3W4UB 2LH3A 1Y4RA 1MNIA 2V1IA 3QJEA 4H07A 3OZUA 6HBWA 4MQJA 1QGWC 2BLHA 2VRYA 4NS2A 4A8WA 1X9FA 1URVA 1GLIA 2HBFA 1HGAA 2JLGA 2ZLUB 5AB8A 3G53A 3ODQB 3DHRB 5KERA 1NZ2A 3S48C 3AQ6A 3GKVB 1FDHG 3ODQA 3R0GA 4WJG1 1O1LB 2ZLXA 3VRFA 2ZSRA 1MKOB 2MYDA 3O2CB 1MBOA 1Y0AB 1IRDB 1XZUA 5JOMA 2AV3A 1HCOB 1GVHA 5CN4A 1DXDA 1NZ5A 1HBGA 1A01B 1V4WA 1V75A 2O5LX 3IC2B 3E5OA 1XQ5A 1S0HA 3A5BA 1DLWA 1HCOA 2H35A 3UBVA 1JDOA 1MZ0A 2MHBA 1S0HB 1MLUA 2C0KA 2MGCA 3GIOA 3HHBA 1KN1B 2FRIX 1M9PB 1YE2A 5CNDA 1AZIA 3UHSA 1XCHA 3D4XA 1MLMA 1BZ1A 2PGHA 3RGKA 4UIQA 5CNGA 3QM5A 4HRTA 4ROLA 1QSHB 1HABA 1MOCA 2Z6NB 1NS9A 2QSPA 3HXNB 3WHMA 2PEGB 3QQRA 3FS4A 3EDAA 2NSSA 2DN1A 1J7YB 1B86A 2EF2A 4ZIZB 1X3KA 2D2NC 1DO1A 1J40A 2R1HB 3QM6A 1YOIA 1CBLA 4ZIZA 1F5OA 3BA2A 1V4XB 4Q70B 1DKEA 3S66A 1HACB 5KDQA 4O35A 3KUOA 1Y31A 1Y4BA 1DKEB 2ZFOA 1YIHB 5KDQB 1MWDA 1N9XA 2MGIA 5AQDA 3ASEA 3MJPB 4PO5A 1Y31B 3OO5A 2V1GA 3ZJQA 1OR4A 4ODCA 2HBGA 1Y7DA 5CHQA 4NXAA 2H8FA 2AV0A 5JGGA 1Y2ZA 2UULC 3MN0A 1HDSB 1EMYA 1HGAB 3FH9B 3RJNB 2OLPA 2VYWA 2ZLUA 3O89A 1Y46A 1ASHA 2MGDA 3BJ2B 1DXUA 4XS0A 1F99A 1K1KB 3GYSB 2QMBA 1UMOA 1IT3A 1YIEB 1YG5B 1QSIA 1I3DA 3ZJOA 1BBBA 1RTEA 3MWNA 1MKOA 1JF3A 1A3NA 2G10A 2LH6A 1YIEA 3AT6A 1YHRB 2DN3B 2BLJM 1A3OA 2RAOB 4HSXA 5EV5A 2ZLTB 4U8UD 2G0XA 1GDIA 1C7DB 4HRRA 5FVBM 1GBVA 1JBOA 1JP8A 3UHQA 1MLSA 2MHBB 1HHOA 1YZIB 1UFJA 2FRJX 2JHOA 3DBJB 1YEUB 3PI8B 4MQIB 2HBEA 3HHBB 2WTGA 1EBTA 2GDMA 3VAUA 1UVMA 5AQDM 3DBJA 1YHEA 2HBCB 1OUTB 3UHHA 1J3FA 3NMMB 2YSKA 1COHA 5E6EB 4ESAB 4WCHD 1S69A 1O1IB 1HABB 3EOKB 2BV8B 1YOHA 3WHMB 1EW6A 3QM8A 1RH1A 1HBBB 2Z6TA 2HBSB 2AUOA 3WCUD 2HHEB 1G0BB 1Y0CA 2X4AA 1AJHA 1C7CA 1MTIA 3DUTA 5CNEA 1Y01B 3GQGA 4FH7A 1YDZA 3AQ5A 2VJTB 1BJEA 1Y7CA 3L0FB 1Y0CB 1RTXA 2R4WA 1CG5A 3HC9A 5CN9A 1GCVB 1VWTA 1K0YA 3R5IB 1CH9A 1CP5A 3K8BA 4N7PB 1SGKA 3BOMA 1UVLA 1Y7GB 1EYXB 3O18A 5C6EB 1VRFA 4G1BA 1BZRA 2G0VA 1KR7A 4N7NA 5HY8A 1HDAB 1DO7A 2GTLA 1HV4B 1O1OB 2QU0B 1JZMA 3S65B 1CQ2A 1CLSA 1SDKB 3PI3A 1MLKA 2QU0A 2NX0A 3WCPB 1Y4QA 2OHAA 2ZT1A 1RQ3A 3WFUA 3LQDA 1ABYB 1NQPB 4H2LA 2LH1A 3UHEA 3D1AB 2AA1A 1O1MA 2BW9M 2VJHA 1MBIA 1K1KA 3MYMA 3HYUA 1DTMA 2M6ZB 1JF4A 4XDIA 4PQCA 1Y45B 2D5XA 4MXKA 3OVUC 5JDOC 1A0UA 1JWNA 1H1XA 1ABWA 1MYFA 1WVPA 2VMLA 4F6DA 1Y4VA 3ARLA 1N9HA 3HENA 1PMBA 1MTKA 3K3UA 4MBAA 2MGHA 3UHIA 2HBEB 1UX9A 1WMUA 1YMAA 4YU3B 1FSLA 1LUEA 4JACA 2G11A 1S5XB 3UHKA 1OUTA 1Y0TB 5E83A 2J96A 1SHRA 1J7WB 1YE2B 1G09B 3NG6B 1HBSA 2W6VA 4QAUA 4PQ6A 4N6SB 1MLOA 2MGGA 5CNCA 5KKKA 4LM6B 1HBIA 2HCOB 5JDOE 1LH7A 4F69A 1UVXA 1Y4GB 2HBSA 2ZT4A 4ESUA 1HGBB 3UGYA 1LJWB 2EVKA 3DUTB 3ARKA 6HBIA 4ZVBA 3KMFA 3L0FA 4VHBA 3ZJHA 1L2KA 1AJ9A 2OHBA 2R1HA 3ZJNA 1SDLA 2R4ZA 4O4ZA 1FHJB 4XXIA 5AZQA 3AQ9A 3GQRB 2DXMB 1NIHB 1BABB 1Y4BB 111MA 2IG3A 1Y7ZB 4IT8A 2HZ3A 1WLAA 2UULH 1TU9A 2GTLB 1DLYA 3BJ1B 3ZJSA 1NPFA 4F4OA 1VXAA 3OO5B 3QZZA 2ZT0A 4N8TB 3A0GA 1UVKA 2MYAA 3WFWA 2ZS1A 3WCUC 3A5AA 1LFLB 3S1IA 3ONZB 2HHBA 3QMAA 3UH6A 3IC0A 1XYEB 3IA3B 4C44A 4NK1A 1OR6A 4U8UB 3IC0B 2MGJA 2LHBA 2C7KA 1NS6B 1Y46B 1QPWB 2HZ2A 1HI8A 5HLQA 2MGAA 3GDJA 4YJJA 1A4FB 3VREB 1ABWB 1HA7B 1YGFB 1A3NB 4RMPB 1G0AA 1Y4VB 1O1LA 1DXTA 3VRFB 3UHZA 4F6GA 3LQ9A 5CN6A 2DKDA 2QFKA 1OJ6A 1FSXB 3PI9B 1XZ2A 4LMXB 1IBEB 3ZTAA 4F6BA 2EKUA 2JL9A 2VLYA 2HBFB 3ZJMA 5CN8A 4MQCA 1MNOA 104MA 1D8UA 1OBMA 5ILPA 3V57B 4MQCB 1LA6B 2MGEA 3UHDA 3NMMA 1S6AA 2ZS1D 2ZT3A 3V2VA 4F6FA 2ZLWB 2IN4A 2ZLVA 4UURA 1KD2A 3P5QB 2BV8A 2DKCA 4F0TA 2W6YA 1QSHA 2LH5A 1A01A 1Y8WA 2NRLA 2G3HA 3S1JA 2GRHA 3WCWD 3A59B 2CMMA 3TM9A 1B86B 5HLUA 4M4BB 2VJTA 3D17A 5HBIA 1MBCA 3PIAB 1YEOA 1ECNA 3SDHA 1H97A 1MLFA 2ZSZA 4ZVAA 4PNJA 3BJ1A 1MLJA 1CH1A 4MQHB 3GOUA 4MPMA 5ILRA 4N8TA 1RPSA 1NPGA 4B3WA 5EOHA 1Z8UB 2DN2B 1YH9A 1JZLA 2ZFOD 1SPGA 1Y7DB 1S5YA 2GKNA 1DUOA 2MYEA 3WCPA 1Y85B 2O5OX 3GQPB 4ETUA 1BIJB 1G9VA 3GLNA 4H2LB 1XG0C 1Y5JB 4H0BA 1NS6A 1O1MB 4Q70A 3S66B 1HACA 3NL7A 5D5RA 4HHBB 3PELA 2ZFBA 4TMAB 1SI4A 1N9IA 4PQBA 4HHBA 5E29A 2ZFBB 3LHBA 1DXCA 4AE0A 4GY3B 2VEBA 4MQGA 2V8AA 1TOXA 2ZSSA 5AZRA 5SW7B 1CIOA 4L1EB 5JGGB 2O58X 1CP0A 3G52A 4C0NA 2W72A 3HEPA 1GBVB 3FH9A 4HH1A 3G4UA 3UHCA 1URYA 1UC3A 1YCAA 2GRZA 3NFEB 1NEJB 5EYJA 1UVIA 4MAXA 4NI0A 4F6JA 3D7OB 1UX8A 1J7WA 4MQKB 1NGKA 1YG5A 4ERVA 1BBBB 2ZLVB 2BK9A 4NI1A 1MLLA 3A9MA 3KMFC 5E6EA 1JEBA 3B75B 3GKTA 1JP6A 2D60A 3QQQA 1YGDA 1VREA 3AT5B 1Y5FA 4SDHA 3QJDA 2D60B 1JY7A 1J3ZA 1LHSA 1MLQA 3D17B 1NY9A 2UULD 3MJUA 1YEOB 4FH6A 1LFVB 2E2YA 3OO4A 1M6MA 1UVYA 3PT7B 1HBHA 2GKMA 1FDHA 5EUIA 4YU4B 1CPCA 1LFVA 1ABSA 1OUUA 3PT7A 3GOUB 1HDBB 5EU2A 1EYXA 1VXCA 1A6NA 4F4OB 3CY5A 3G4QA 1DDTA 1SPEA 3VRGB 2ZS1B 3ECLA 1MYJA 3WR1B 1U7SA 3S65A 1CG8A 1C7CB 1CLSB 1CPWA 1S56A 2D2ND 3LR7A 1XYEA 3WR1A 3QJBB 1JPBA 2ZSPA 1Y09A 3NMLA 2MYBA 1RQ3B 3OZVA 3PI4A 1X46A 1K0YB 4MXLA 3QJBA 4NXCA 1F63A 2C7KB 2AA1B 1YHUD 4HSWA 3NUHB 2VJHB 2ZSXA 4ETVA 3GDJB 1YVTB 1EBCA 1HGCB 1BUWB 3UHWA 1NS9B 1YE0B 1O1OA 1RQAB 4G51A 2MGFA 4KMVA 1BUWA 4G51B 3LB2A 1QI8A 1IDRA 1Y4QB 3IXFA 1ALLB 5M3SA 4BS9A 1QI8B 4TYXA 3WCUB 1CMYB 1NEJA 4KMWA 4NI0B 1BZZA 3QM7A 1BVDA 1GLIB 3A5GA 1ITHA 2LH2A 4U8UC 2UUNB 1LA6A 2VEEA 1XXTA 2ZFOC 4NI1B 2D5ZA 1MLNA 1QSIB 1LH6A 1C40B 3OZWA 1JEBB 1XXTB 1EWAA 3P5QA 2D5ZB 1DO3A 1COLA 2ZLXB 1Y4GA 3WCVA 1FAWA 1HHTP 1Y8WB 4FC3B 1J3YB 1DTIA 3AG0A 1B33A 1RVWA 112MA 4TWUA 1LJWA 3E55A 3BJ2A 1Y0DA 1BVCA 2VLXA 3KUNA 3WCWC 1CQXA 1FN3B 1SDLB 4H0MA 1Y8IA 3ZJPA 4TWVA 2GTLD 1MDTA 1GDKA 2RAOA 1COHB 1YEQA 3MKBA 1HI1A 3FEWX 1BZ6A 1IRCA 1JW8A 3KVSB 2ZT2A 2B7HA 2HHDB 3UHBA 1V4WB 1SPGB 3M3AA 1HHOB 3ZJRA 3PI1A 4M4AB 1LFQB 1MLGA 4GXEB 1BZ0B 3HRWB 1KFRA 1LH1A 1Y4FA 2DN1B 5FVBA 1LFQA 3UH7A 4AVDA 1R1XA 1CH5A 1T1NB 3UHGA 1YDZB 5HLXA 2EKTA 1FHJA 109MA 4BJAA 1Y4PA 1NIHA 1R1XB 1O1PB 1A9WE 1V5HA 3CIUB 3E5IA 4ROMB 3MVCA 1MYZA 1Y0WA 4O2GA 1SI4B 3O18B 5C6EA 1Y8HA 1MYIA 1YVQB 2HZ1A 5E29B 4ROLB 2V1EA 1LFYA 103MA 1MODA 2HHEA 3G46A 3MJPA 2EB8A 1Y8HB 3ZOMA 5MBAA 2PEGA 3BCQB 4N7OB 3H57A 1I3EA 3U3EA 3UHXA 1A6GA 2HHBB 1O16A 2FALA 1YHUC 3M38A 1LTWA 1J40B 4DWTA 1J7SB 3WCTB 1IBEA 1ABYA 4L7YB 3MOUA 4N7PA 2AUQA 1F5PA 1XZ5B 2MGLA 3ZOLA 1F65A 1IWHB 2OH9A 1IOPA 1HBAA 4B4YA 3UHYA 3WCWB 1HBRA 4PO5B 1A00B 1MOHA 3LR9A 3PT8A 2HBDB 5EYSA 1HSYA 1YENA 2ZWJA 1A00A 5F0BA 1QXEB 3RQRA 2HBDA 5IKSA 110MA 1VXBA 1YMCA 1QXDA 2C7JA 4F0TB 3G4RA 1FSXA 1NQPA 1A3OB 1LFTB 1QXEA 1XZ2B 1B33B 3MBAA 3D1KA 3QJEB 1IRDA 1R1YB 1HLBA 1UT0A 2OH8A 1C7DA 1WMUB 4F6IA 3WCTC 1MOBA 2R80A 1XQ5B 2M6ZA 3OO4B 1F99B 4DC7A 1LFZB 5CN5A 4YU4A 4NZIA 2G12A 1LH3A 1CO9A 3QJCB 1Y35B 5KERB 1BINA 3EU1B 1VXGA 2QRWA 2D2MC 2D6CA 1UVJA 2VMLB 3WTGB 3ECZA 2HCOA 1THBA 4O4TA 2B7HB 3UGZA 1XZUB 1YOGA 2SPNA 2MGBA 3VRGA 3WTGA 2QSSB 4HRRB 1BZ1B 1KTPB 1GBUB 4X0LA 2ZS0D 3HRWA 1V75B 1Y83B 3OGBA 1HBBA 1S5YB 4A8SA 2EVPA 3GQPA 5CNFA 3UBCA 1LHTA 3NG6A 2HBCA 4DC8A 1YFFA 1CG5B 2WCQA 3WCVC 4ROMA 1NWNA 2DXMA 1GCVA 4WJGA 1RSEA 3UH3A 1GZXB 4A8QA 3G4YA 4FWYA 1DXVB 1RQAA 1MWBA 3DR9A 5MBNA 1F0LA 4O1TA 2ZFOB 1NXFA 2MB5A 4N7NB 1Y22A 5HY8B 2QSPB 3HXNA 1JL6A 4HH0A 3M39A 1BIJA 1G9VB 1CH7A 1S61A 3WCTA 5CNBA 5HU6B 1HJTA 2ZSOA 1Y5JA 2BNLA 1XY0A 1VWTB 2WTHA 3UHVA 5HU6A 2GLNA 1Y2ZB 3NFEA 3LB1A 3PELB 1Q1FA 1HDSA 1V9QA 1HBRB 3ECXA 2G0ZA 2UUNA 3QM9A 2O5MX 1HDAA 1O1NA 107MA 1JL7A 1V07A 1VXEA 1HI0P 3HF4B 4JYQA 1WACA 4L1EA 3D1KB 3B75A 1A0ZA 1V4UA 1M6CA 5ILEA 3W4UA 4XXKA 1Y5FB 3UHUA 1A0ZB 3O7NA 2NRMA 1YMBA 1YHUB 3MJUB 1FN3A 1G08B 1YZIA 1DWRA 5B13A 1MCYA 2DHBA 5EUIB 1YHUA 3OK5A 1Y35A 2D5XB 1G08A 3UH5A 3DHRA 3ZJIA 2XKGA 4A8FA 1THBB 3ARJA 4F68A 101MA 1YHRA 2EB9A 3KVSA 2D2NA 2C7LA 3LB4A 2V1FA 3PI9A 3CY5B 1Y4RB 3BRPB 4ERTA 2VM0A 2VYYA 1IT2A 3QJDB 4M4AA 1J3ZB 1BZ0A 1CG8B 2O5SX 2DKAA 1GH0B 1Y4FB 1C7BB 1T1NA 4M4BA 1YEUA 3PI8A 4MQIA 1NWIA 1Y09B 7HBIA 1YFFB 2V1JA 3DHTA 1MWCA 1MBSA 1C7BA 1YHEB 1O1PA 2BWHA 3AQ8A 2QFNA 1M9PA 2MYCA 3ED9A 1HRMA 3GQRA 1BABA 1J52A 3LB3A 4A8MP 4ESAA 3SZKB 1YVQA 1MNKA 5B13G 2V1HA 5CMVA 3O2CA 4MU5A 2FRFA 3EOKA 3BOMB 1O1KA 2W31A 1Y0AA 4HRTB 2ZS0C 4Z8KB 1PBXB 4UZVA 2KSCA 1BZPA 1AJGA 2H35B 1LFLA 3FS4B 1MYTA 1CIIA 3V2ZA 2Z6SA 1DWTA 1RQ4B 1PBXA 1DM1A 4F0UB 2R4YA 1CMYA 1KN1A 2G14A 1J41A 3G4WA 3BJ3B 3LQDB 2O5QX 4F0UA 3A2GA 3BJ3A 2ZSYA 1MYGA 2JLFA 1I7YB 1DWSA 1YH9B 2PGHB 3PT8B 2ZS0A 1UVNA 3G4VA 3A0GB 4YJJB 1I7YA 4ETTA 2QLSA 2I88A 2SPOA 2ZS0B 3ONZA 1A87A 1ALLA 1OFJA 3E4NA 3WFTA 2QLSB 1MYMA 1MGNA 2O5BX 4OF9A 5JDOD 5EE4C 2D2MD 4BJUA 2AUPA 1RVWB 3D1AA 1MBAA 1NZ3A 3H58A 2R80B 1Y0DB 1FCSA 1QPWA 4LMSB 5CN7A 2DHBB 1MTJA 1UIWA 3HYUB 1GJNA 4YU3A 1Y8IB 1VHBA 1NZ4A 4XS0B 3HEOA 4A8OA 106MA 1XZ7A 2QMBB 1LH2A 2XYKA 105MA 2W6VB 1XZVA 2D2NB 1MNHA 1A6KA 1YEQB 3MKBB 3BRPA 1XZ4B 2R4XA 2ZLWA 2VHBA 1CIKA 2H8FB 4FC3A 1X9FD 1ECAA 4HBIA 3UHRA 4GXEA 1Y8KA 2Z85A 1MDNA 1X9FB 4MQKA 3A59A 1UFPA 1S5XA 1DXUB 1Y8KB 3V57A 3PIAA 2UULA 1G09A 1B0BA 1OUUB 3SZKA 3ZH0A 1GDJA 1O1JB 2UULB 2W6XA 2BKMA 3GKVA 1Y0WB 1W92A 1YGDB 2DN3A 1DXVA 2W72C 3TM3A 1O1IA 1VXHA 2MGKA 1MOAA 2ZLTA 4Z8KA 1LFYB 2HHDA 2GTLC 2V1KA 1JY7B 5C6YA 1HGBA 1LIAB 1MNJA 4N7OA 1JBOB 5JDOF 4GZGA 3IC2A 2GNWA 2FRKX 2SPMA 1J41B 1J7SA 1Y4PB 1VXFA 5HAVA 4OODA 102MA 3R5IA 4U8UA 1MBDA 1PHNA 2WY4A 1IWHA 3WCWA 4AE1A 1GDLA 1PHNB 3V58A 2VYZA 1YE0A 2FAMA 2UUMX 1SWMA 1YENB 2GL3A 5EE4D 1MYHA 3V58B 2Z6NA 1HA7A 1GCWB 1G0BA 1V4UB 2XKIA 1QXDB 2C7JB 1J7YA 2VLZA 2VJRB 4IROA 1MBNA 1GCWA 2H8DA 5D1VA 1YEVB 2VJRA 3K8BB 4IROB 1UIWB 2X49A 2ZSTA 1V4XA 1YVTA 2MBWA 1YEVA 1HBAB 1FLPA 2W6WA 1XZ7B 1LFZA 5CHRA 3PMCA 4GY3A 3VHBA 3QJCA 1VXDA 1LH5A 2LH7A 1JZKA 2V8AB 1C40A 3UHTA 2UUMA 1TESA 5ILMA 1G0AB 2MGMA 2O5TX 2XKHA 1CH2A 1ECDA 4ODCB 2C7LB 1A0UB 2DC3A 1SDKA 4MBNA 2UUMB 1LFTA 2BMMA 2ZS1C 1B8DB 3WCUA 3WCVB 1ON7A 2W72B 4FWXA 3M3BA 1R1YA 1GBUA 1BZZB 3AT5A 2Z8AA 1B8DA 1N9FA 4A8YA 1GH0A 4MQJB 3SDNA 3VNCA 4AVEA 1JP9A 3DHTB 2UUND 2ZSQA 4L2MA 1Y0TA 5E83B 1HBHB 1SHRB 1Y45A 1NAZA 1O1JA 3GYSA 1HBSB 2BLIA 3EU1A 1Y5KB 4FWZA 1CH3A 3AQ7A 3GK9A 1CH4A 1FAWB 1HDBA 1KD2B 1DO4A 2SPLA 1O1KB 1Y5KA 3AT6B 3QZXA 1J3YA 1HHSA 1U7RA 1LIAA 2QSSA 1KTPA 4X0LB 1DUKA 1Y83A 4NK2A 4KJTA 2DN2A 2GNVA 3UI0A 5B84A 1A9WA 2ZSNA 1RQ4A 4H0MB 2RI4A 1AJ9B 1XF6C 3RJ6A 1CPCB 3ORDA 3CIUA 2RI4B 3MYNA 3TLDA 4N6SA 1CBMA 4DWUA 2WCRA 1YCBA 108MA 3ZJJA 1CO8A 1HLMA 4MQHA 1GZXA 4ILZA 5B85A 3NL7B 4LPIA 2R50A 3GUQA 3WCVD 3UHNA 3OJ1A 3D4XB 3K9ZA 1RPSB 5EETA 1Y22B 1O1NB 3WFXA
chains in the Genus database with same CATH topology
4KN3A 1MLRA 4G1VA 1OFKA 3EDBA 3HF4A 1Y85A 4MQGB 3WCTD 5SW7A 2H8DB 2NSRA 1XY0B 3GQGB 1Y7CB 4L7YA 2G0SA 2G0RA 5F2AA 3ZHWA 3WI8A 1A6MA 1X9FC 1XZ5A 2D2MB 2OIFA 3PI2A 1Y7ZA 1HGCA 1Y7GA 3D7OA 2D2MA 2YRSB 3BCQA 1YIHA 1XZVB 1A4FA 3VREA 1HV4A 2GRFA 5EQMA 1YGFA 1ECOA 1XZ4A 1MLHA 2YRSA 2AURA 6HBWB 3ZJLA 1DXTB 3W4UB 2LH3A 1Y4RA 1MNIA 2V1IA 3QJEA 4H07A 3OZUA 6HBWA 4MQJA 2BLHA 2VRYA 4NS2A 1X9FA 1URVA 1GLIA 2HBFA 1HGAA 2ZLUB 5AB8A 3G53A 3ODQB 3DHRB 5KERA 1NZ2A 3S48C 3AQ6A 3GKVB 1FDHG 3ODQA 3R0GA 4WJG1 1O1LB 2ZLXA 3VRFA 2ZSRA 1MKOB 2MYDA 1MBOA 1Y0AB 1IRDB 1XZUA 5JOMA 2AV3A 1HCOB 1GVHA 5CN4A 1DXDA 1NZ5A 1HBGA 1A01B 1V4WA 1V75A 2O5LX 3IC2B 3E5OA 1XQ5A 1S0HA 1DLWA 1HCOA 2H35A 3A5BA 3UBVA 1JDOA 1MZ0A 2MHBA 1S0HB 1MLUA 2C0KA 2MGCA 3HHBA 2FRIX 1M9PB 1YE2A 5CNDA 1AZIA 3UHSA 1XCHA 3D4XA 1MLMA 1BZ1A 2PGHA 3RGKA 4UIQA 5CNGA 3QM5A 4HRTA 4ROLA 1QSHB 1HABA 1MOCA 2Z6NB 1NS9A 2QSPA 3HXNB 3WHMA 2PEGB 3QQRA 3FS4A 3EDAA 2NSSA 2DN1A 1J7YB 1B86A 2EF2A 1X3KA 2D2NC 1DO1A 1J40A 2R1HB 3QM6A 1YOIA 1CBLA 1F5OA 3BA2A 1V4XB 3S66A 1DKEA 1HACB 5KDQA 4O35A 3KUOA 1Y31A 1Y4BA 1DKEB 2ZFOA 1YIHB 5KDQB 1MWDA 1N9XA 2MGIA 3ASEA 3MJPB 1Y31B 3OO5A 2V1GA 3ZJQA 1OR4A 4ODCA 2HBGA 1Y7DA 5CHQA 4NXAA 2H8FA 2AV0A 5JGGA 1Y2ZA 3MN0A 1HDSB 1EMYA 1HGAB 3FH9B 3RJNB 2OLPA 2VYWA 2ZLUA 3O89A 1Y46A 1ASHA 2MGDA 3BJ2B 1DXUA 4XS0A 1K1KB 3GYSB 2QMBA 1UMOA 1IT3A 1YIEB 1YG5B 1QSIA 1I3DA 3ZJOA 1BBBA 1RTEA 1MKOA 1JF3A 1A3NA 2G10A 2LH6A 1YIEA 3AT6A 1YHRB 2DN3B 2BLJM 1A3OA 2RAOB 4HSXA 5EV5A 2ZLTB 4U8UD 2G0XA 1GDIA 1C7DB 4HRRA 1GBVA 1JP8A 3UHQA 1MLSA 2MHBB 1HHOA 1YZIB 1UFJA 2FRJX 2JHOA 1YEUB 3PI8B 4MQIB 2HBEA 3HHBB 2WTGA 1EBTA 2GDMA 3VAUA 1YHEA 2HBCB 1OUTB 3UHHA 1J3FA 3NMMB 1COHA 5E6EB 4ESAB 4WCHD 1S69A 1O1IB 1HABB 3EOKB 1YOHA 3WHMB 1EW6A 3QM8A 1HBBB 2Z6TA 2HBSB 2AUOA 3WCUD 2HHEB 1G0BB 1Y0CA 1AJHA 1C7CA 1MTIA 3DUTA 5CNEA 1Y01B 3GQGA 4FH7A 1YDZA 3AQ5A 1BJEA 1Y7CA 2R4WA 1Y0CB 1RTXA 1CG5A 3HC9A 5CN9A 1GCVB 1VWTA 1K0YA 3R5IB 1CH9A 1CP5A 3K8BA 4N7PB 3BOMA 1Y7GB 5C6EB 1VRFA 4G1BA 1BZRA 2G0VA 1KR7A 4N7NA 5HY8A 1HDAB 1DO7A 2GTLA 1HV4B 1O1OB 2QU0B 1JZMA 3S65B 1CQ2A 1CLSA 1SDKB 3PI3A 1MLKA 2QU0A 2NX0A 3WCPB 1Y4QA 2OHAA 2ZT1A 1RQ3A 3WFUA 3LQDA 1ABYB 1NQPB 4H2LA 2LH1A 3UHEA 3D1AB 2AA1A 1O1MA 2BW9M 1MBIA 1K1KA 3MYMA 3HYUA 1DTMA 2M6ZB 1JF4A 4XDIA 4PQCA 1Y45B 2D5XA 4MXKA 3OVUC 5JDOC 1A0UA 1JWNA 1ABWA 1H1XA 1MYFA 1WVPA 4F6DA 1Y4VA 3ARLA 1N9HA 3HENA 1PMBA 1MTKA 3K3UA 4MBAA 2MGHA 3UHIA 2HBEB 1UX9A 1WMUA 1YMAA 4YU3B 1FSLA 1LUEA 4JACA 2G11A 1S5XB 3UHKA 1OUTA 1Y0TB 5E83A 1SHRA 1J7WB 1YE2B 1G09B 3NG6B 1HBSA 2W6VA 4QAUA 4PQ6A 1MLOA 2MGGA 5CNCA 5KKKA 1HBIA 2HCOB 5JDOE 1LH7A 4F69A 1UVXA 1Y4GB 2HBSA 2ZT4A 1HGBB 3UGYA 1LJWB 2EVKA 3DUTB 3ARKA 6HBIA 4ZVBA 3KMFA 4VHBA 3ZJHA 1L2KA 1AJ9A 2OHBA 2R1HA 3ZJNA 1SDLA 2R4ZA 4O4ZA 1FHJB 5AZQA 3AQ9A 3GQRB 2DXMB 1NIHB 1BABB 1Y4BB 111MA 2IG3A 1Y7ZB 4IT8A 2HZ3A 1WLAA 1TU9A 2GTLB 1DLYA 3BJ1B 3ZJSA 1NPFA 4F4OA 1VXAA 3OO5B 3QZZA 2ZT0A 4N8TB 3A0GA 2MYAA 3WFWA 2ZS1A 3WCUC 3A5AA 1LFLB 3S1IA 3ONZB 2HHBA 3QMAA 3UH6A 3IC0A 1XYEB 3IA3B 4C44A 4NK1A 1OR6A 4U8UB 3IC0B 2MGJA 2LHBA 1NS6B 1Y46B 1QPWB 2HZ2A 5HLQA 2MGAA 3GDJA 1A4FB 3VREB 1ABWB 1YGFB 1A3NB 1G0AA 1Y4VB 1O1LA 1DXTA 3VRFB 3UHZA 4F6GA 5CN6A 2QFKA 1OJ6A 1FSXB 3PI9B 1XZ2A 1IBEB 4F6BA 2EKUA 2VLYA 2HBFB 3ZJMA 5CN8A 4MQCA 1MNOA 104MA 1D8UA 1OBMA 5ILPA 4MQCB 1LA6B 2MGEA 3UHDA 3NMMA 1S6AA 2ZS1D 2ZT3A 3V2VA 4F6FA 2ZLWB 2IN4A 2ZLVA 4UURA 1KD2A 3P5QB 2W6YA 1QSHA 2LH5A 1A01A 1Y8WA 2NRLA 2G3HA 3S1JA 2GRHA 3WCWD 3A59B 2CMMA 3TM9A 1B86B 5HLUA 4M4BB 3D17A 5HBIA 1MBCA 3PIAB 1YEOA 1ECNA 3SDHA 1H97A 1MLFA 2ZSZA 4ZVAA 4PNJA 3BJ1A 1MLJA 1CH1A 4MQHB 3GOUA 4MPMA 5ILRA 4N8TA 1RPSA 1NPGA 4B3WA 5EOHA 1Z8UB 2DN2B 1YH9A 1JZLA 2ZFOD 1SPGA 1Y7DB 1S5YA 2GKNA 1DUOA 2MYEA 3WCPA 1Y85B 2O5OX 3GQPB 1BIJB 1G9VA 3GLNA 4H2LB 1Y5JB 4H0BA 1NS6A 1O1MB 3S66B 1HACA 3NL7A 5D5RA 4HHBB 3PELA 2ZFBA 1SI4A 1N9IA 4PQBA 4HHBA 5E29A 2ZFBB 3LHBA 1DXCA 2VEBA 4MQGA 2ZSSA 5AZRA 5SW7B 1CIOA 5JGGB 2O58X 1CP0A 3G52A 4C0NA 2W72A 3HEPA 1GBVB 3FH9A 3G4UA 3UHCA 1URYA 1UC3A 1YCAA 2GRZA 3NFEB 1NEJB 5EYJA 4MAXA 4NI0A 4F6JA 3D7OB 1UX8A 1J7WA 4MQKB 1NGKA 1YG5A 1BBBB 2ZLVB 2BK9A 4NI1A 1MLLA 3A9MA 3KMFC 5E6EA 1JEBA 3B75B 3GKTA 1JP6A 2D60A 3QQQA 1YGDA 1VREA 3AT5B 1Y5FA 4SDHA 3QJDA 2D60B 1JY7A 1J3ZA 1LHSA 1MLQA 3D17B 3MJUA 1YEOB 4FH6A 1LFVB 2E2YA 3OO4A 1M6MA 1UVYA 3PT7B 1HBHA 2GKMA 1FDHA 5EUIA 4YU4B 1LFVA 1ABSA 1OUUA 3PT7A 3GOUB 1HDBB 5EU2A 1VXCA 1A6NA 4F4OB 3CY5A 3G4QA 1SPEA 3VRGB 2ZS1B 3ECLA 1MYJA 3WR1B 1U7SA 3S65A 1CG8A 1C7CB 1CLSB 1CPWA 1S56A 2D2ND 3LR7A 1XYEA 3WR1A 3QJBB 1JPBA 2ZSPA 1Y09A 3NMLA 2MYBA 1RQ3B 3OZVA 3PI4A 1X46A 1K0YB 4MXLA 3QJBA 4NXCA 1F63A 2AA1B 1YHUD 4HSWA 2ZSXA 3GDJB 1YVTB 1EBCA 1HGCB 1BUWB 3UHWA 1NS9B 1YE0B 1O1OA 1RQAB 4G51A 2MGFA 4KMVA 1BUWA 4G51B 3LB2A 1QI8A 1IDRA 1Y4QB 3IXFA 5M3SA 1QI8B 4TYXA 3WCUB 1CMYB 1NEJA 4KMWA 4NI0B 1BZZA 3QM7A 1BVDA 1GLIB 3A5GA 1ITHA 2LH2A 4U8UC 1LA6A 2VEEA 1XXTA 2ZFOC 4NI1B 2D5ZA 1MLNA 1QSIB 1LH6A 1C40B 3OZWA 1JEBB 1XXTB 1EWAA 3P5QA 2D5ZB 1DO3A 2ZLXB 1Y4GA 3WCVA 1FAWA 1Y8WB 4FC3B 1J3YB 1DTIA 3AG0A 1RVWA 112MA 4TWUA 1LJWA 3E55A 3BJ2A 1Y0DA 1BVCA 2VLXA 3KUNA 3WCWC 1CQXA 1FN3B 1SDLB 1Y8IA 3ZJPA 4TWVA 2GTLD 1GDKA 2RAOA 1COHB 1YEQA 3MKBA 1BZ6A 1IRCA 1JW8A 2ZT2A 2B7HA 2HHDB 3UHBA 1V4WB 1SPGB 3M3AA 1HHOB 3ZJRA 3PI1A 4M4AB 1LFQB 1MLGA 1BZ0B 3HRWB 1KFRA 1LH1A 1Y4FA 2DN1B 4AVDA 1LFQA 3UH7A 1R1XA 1CH5A 1T1NB 3UHGA 1YDZB 5HLXA 2EKTA 1FHJA 109MA 4BJAA 1Y4PA 1NIHA 1R1XB 1O1PB 1A9WE 1V5HA 3CIUB 3E5IA 4ROMB 3MVCA 1MYZA 1Y0WA 4O2GA 1SI4B 5C6EA 1Y8HA 1MYIA 1YVQB 2HZ1A 5E29B 4ROLB 2V1EA 1LFYA 103MA 1MODA 2HHEA 3G46A 3MJPA 2EB8A 1Y8HB 3ZOMA 5MBAA 2PEGA 3BCQB 4N7OB 3H57A 1I3EA 3U3EA 3UHXA 1A6GA 2HHBB 1O16A 2FALA 1YHUC 3M38A 1LTWA 1J40B 4DWTA 1J7SB 3WCTB 1IBEA 1ABYA 4L7YB 3MOUA 4N7PA 2AUQA 1F5PA 1XZ5B 2MGLA 3ZOLA 1F65A 1IWHB 2OH9A 1IOPA 1HBAA 4B4YA 3UHYA 3WCWB 1HBRA 1A00B 1MOHA 3LR9A 3PT8A 2HBDB 5EYSA 1HSYA 1YENA 2ZWJA 1A00A 5F0BA 1QXEB 2HBDA 5IKSA 110MA 1VXBA 1YMCA 1QXDA 3G4RA 1FSXA 1NQPA 1A3OB 1LFTB 1QXEA 1XZ2B 3MBAA 3D1KA 3QJEB 1IRDA 1R1YB 1HLBA 1UT0A 2OH8A 1C7DA 1WMUB 4F6IA 3WCTC 1MOBA 2R80A 1XQ5B 2M6ZA 3OO4B 4DC7A 1LFZB 5CN5A 4YU4A 4NZIA 2G12A 1LH3A 1CO9A 3QJCB 1Y35B 5KERB 1BINA 3EU1B 1VXGA 2QRWA 2D2MC 2D6CA 3WTGB 3ECZA 2HCOA 1THBA 4O4TA 2B7HB 3UGZA 1XZUB 1YOGA 2SPNA 2MGBA 3VRGA 3WTGA 2QSSB 4HRRB 1BZ1B 4X0LA 1GBUB 2ZS0D 3HRWA 1V75B 1Y83B 3OGBA 1HBBA 1S5YB 2EVPA 3GQPA 5CNFA 3UBCA 1LHTA 3NG6A 2HBCA 4DC8A 1YFFA 1CG5B 3WCVC 4ROMA 1NWNA 2DXMA 1GCVA 4WJGA 1RSEA 3UH3A 1GZXB 3G4YA 4FWYA 1DXVB 1RQAA 1MWBA 3DR9A 5MBNA 4O1TA 2ZFOB 1NXFA 2MB5A 5HY8B 1Y22A 4N7NB 2QSPB 3HXNA 1JL6A 3M39A 1BIJA 1G9VB 1CH7A 1S61A 3WCTA 5CNBA 5HU6B 1HJTA 2ZSOA 1Y5JA 2BNLA 1XY0A 1VWTB 2WTHA 3UHVA 5HU6A 2GLNA 1Y2ZB 3NFEA 3LB1A 3PELB 1Q1FA 1HDSA 1V9QA 1HBRB 2G0ZA 3ECXA 3QM9A 2O5MX 1HDAA 1O1NA 107MA 1JL7A 1V07A 1VXEA 3HF4B 4JYQA 3D1KB 3B75A 1A0ZA 1V4UA 1M6CA 5ILEA 3W4UA 1Y5FB 3UHUA 1A0ZB 3O7NA 2NRMA 1YMBA 1YHUB 3MJUB 1FN3A 1G08B 1YZIA 1DWRA 1MCYA 2DHBA 5EUIB 1YHUA 3OK5A 1Y35A 2D5XB 1G08A 3UH5A 3DHRA 3ZJIA 2XKGA 1THBB 3ARJA 4F68A 101MA 1YHRA 2EB9A 2D2NA 3LB4A 2V1FA 3PI9A 3CY5B 1Y4RB 2VM0A 2VYYA 1IT2A 3QJDB 4M4AA 1J3ZB 1BZ0A 1CG8B 2O5SX 1Y4FB 1C7BB 1T1NA 4M4BA 1YEUA 3PI8A 4MQIA 1NWIA 1Y09B 7HBIA 1YFFB 2V1JA 3DHTA 1MWCA 1MBSA 1C7BA 1YHEB 1O1PA 2BWHA 3AQ8A 2QFNA 1M9PA 2MYCA 3ED9A 1HRMA 3GQRA 1BABA 1J52A 3LB3A 4ESAA 3SZKB 1YVQA 1MNKA 2V1HA 5CMVA 4MU5A 2FRFA 3EOKA 3BOMB 1O1KA 2W31A 1Y0AA 4HRTB 2ZS0C 1PBXB 4UZVA 2KSCA 1BZPA 1AJGA 2H35B 1LFLA 3FS4B 1MYTA 3V2ZA 2Z6SA 1DWTA 1RQ4B 1PBXA 1DM1A 2R4YA 1CMYA 2G14A 1J41A 3G4WA 3BJ3B 3LQDB 2O5QX 3A2GA 3BJ3A 2ZSYA 1MYGA 1DWSA 1YH9B 2PGHB 3PT8B 2ZS0A 3G4VA 3A0GB 2QLSA 2SPOA 2ZS0B 3ONZA 1OFJA 3WFTA 3E4NA 2QLSB 1MYMA 1MGNA 2O5BX 4OF9A 5JDOD 5EE4C 2D2MD 2AUPA 1RVWB 3D1AA 1MBAA 1NZ3A 3H58A 2R80B 1Y0DB 1FCSA 1QPWA 5CN7A 2DHBB 1MTJA 1UIWA 3HYUB 1GJNA 4YU3A 1Y8IB 1VHBA 1NZ4A 4XS0B 3HEOA 106MA 1XZ7A 2QMBB 1LH2A 2XYKA 105MA 2W6VB 1XZVA 2D2NB 1MNHA 1A6KA 1YEQB 3MKBB 1XZ4B 2R4XA 2ZLWA 2VHBA 1CIKA 2H8FB 4FC3A 1X9FD 1ECAA 4HBIA 3UHRA 1Y8KA 2Z85A 1MDNA 1X9FB 4MQKA 3A59A 1UFPA 1S5XA 1DXUB 1Y8KB 3PIAA 1G09A 1B0BA 1OUUB 3SZKA 3ZH0A 1GDJA 1O1JB 2W6XA 2BKMA 3GKVA 1Y0WB 1W92A 1YGDB 2DN3A 1DXVA 2W72C 3TM3A 1O1IA 1VXHA 2MGKA 1MOAA 2ZLTA 1LFYB 2HHDA 2GTLC 2V1KA 1JY7B 5C6YA 1HGBA 1MNJA 4N7OA 5JDOF 4GZGA 3IC2A 2GNWA 2FRKX 2SPMA 1J41B 1J7SA 1Y4PB 1VXFA 5HAVA 4OODA 102MA 3R5IA 4U8UA 1MBDA 2WY4A 1IWHA 3WCWA 1GDLA 2VYZA 1YE0A 2FAMA 1SWMA 1YENB 2GL3A 5EE4D 1MYHA 2Z6NA 1GCWB 1G0BA 1V4UB 2XKIA 1QXDB 1J7YA 2VLZA 4IROA 1MBNA 1GCWA 2H8DA 5D1VA 1YEVB 4IROB 3K8BB 1UIWB 2ZSTA 1V4XA 1YVTA 2MBWA 1YEVA 1HBAB 1FLPA 2W6WA 1XZ7B 1LFZA 5CHRA 3VHBA 1VXDA 3QJCA 1LH5A 2LH7A 1JZKA 1C40A 3UHTA 1TESA 5ILMA 1G0AB 2MGMA 2O5TX 2XKHA 1CH2A 1ECDA 4ODCB 1A0UB 2DC3A 1SDKA 4MBNA 1LFTA 2BMMA 2ZS1C 3WCUA 3WCVB 2W72B 4FWXA 3M3BA 1R1YA 1GBUA 1BZZB 3AT5A 2Z8AA 1N9FA 4MQJB 3SDNA 4AVEA 1JP9A 3DHTB 2ZSQA 4L2MA 5E83B 1Y0TA 1HBHB 1SHRB 1Y45A 1NAZA 1O1JA 3GYSA 1HBSB 2BLIA 3EU1A 1Y5KB 4FWZA 1CH3A 3AQ7A 3GK9A 1CH4A 1FAWB 1HDBA 1KD2B 1DO4A 2SPLA 1O1KB 1Y5KA 3AT6B 3QZXA 1J3YA 1U7RA 2QSSA 4X0LB 1DUKA 1Y83A 4NK2A 4KJTA 2DN2A 2GNVA 3UI0A 5B84A 1A9WA 2ZSNA 1RQ4A 2RI4A 1AJ9B 3RJ6A 3ORDA 3CIUA 2RI4B 3MYNA 3TLDA 1CBMA 4DWUA 1YCBA 108MA 3ZJJA 1CO8A 1HLMA 4MQHA 1GZXA 4ILZA 5B85A 3NL7B 4LPIA 2R50A 3WCVD 3UHNA 3OJ1A 3D4XB 3K9ZA 1RPSB 5EETA 1Y22B 1O1NB 3WFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN3 A;  1MLR A;  4G1V A;  1OFK A;  3EDB A;  3HF4 A;  1Y85 A;  4MQG B;  3WCT D;  5SW7 A;  2H8D B;  2NSR A;  1XY0 B;  3GQG B;  1Y7C B;  4L7Y A;  2G0S A;  2G0R A;  5F2A A;  3ZHW A;  3WI8 A;  1A6M A;  1X9F C;  1XZ5 A;  2D2M B;  2OIF A;  3PI2 A;  1Y7Z A;  1HGC A;  1Y7G A;  3D7O A;  2D2M A;  2YRS B;  3BCQ A;  1YIH A;  1XZV B;  1A4F A;  3VRE A;  1HV4 A;  2GRF A;  5EQM A;  1YGF A;  1ECO A;  1XZ4 A;  1MLH A;  2YRS A;  2AUR A;  6HBW B;  3ZJL A;  1DXT B;  3W4U B;  2LH3 A;  1Y4R A;  1MNI A;  2V1I A;  3QJE A;  4H07 A;  3OZU A;  6HBW A;  4MQJ A;  2BLH A;  2VRY A;  4NS2 A;  1X9F A;  1URV A;  1GLI A;  2HBF A;  1HGA A;  2ZLU B;  5AB8 A;  3G53 A;  3ODQ B;  3DHR B;  5KER A;  1NZ2 A;  3S48 C;  3AQ6 A;  3GKV B;  1FDH G;  3ODQ A;  3R0G A;  4WJG 1;  1O1L B;  2ZLX A;  3VRF A;  2ZSR A;  1MKO B;  2MYD A;  1MBO A;  1Y0A B;  1IRD B;  1XZU A;  5JOM A;  2AV3 A;  1HCO B;  1GVH A;  5CN4 A;  1DXD A;  1NZ5 A;  1HBG A;  1A01 B;  1V4W A;  1V75 A;  2O5L X;  3IC2 B;  3E5O A;  1XQ5 A;  1S0H A;  1DLW A;  1HCO A;  2H35 A;  3A5B A;  3UBV A;  1JDO A;  1MZ0 A;  2MHB A;  1S0H B;  1MLU A;  2C0K A;  2MGC A;  3HHB A;  2FRI X;  1M9P B;  1YE2 A;  5CND A;  1AZI A;  3UHS A;  1XCH A;  3D4X A;  1MLM A;  1BZ1 A;  2PGH A;  3RGK A;  4UIQ A;  5CNG A;  3QM5 A;  4HRT A;  4ROL A;  1QSH B;  1HAB A;  1MOC A;  2Z6N B;  1NS9 A;  2QSP A;  3HXN B;  3WHM A;  2PEG B;  3QQR A;  3FS4 A;  3EDA A;  2NSS A;  2DN1 A;  1J7Y B;  1B86 A;  2EF2 A;  1X3K A;  2D2N C;  1DO1 A;  1J40 A;  2R1H B;  3QM6 A;  1YOI A;  1CBL A;  1F5O A;  3BA2 A;  1V4X B;  3S66 A;  1DKE A;  1HAC B;  5KDQ A;  4O35 A;  3KUO A;  1Y31 A;  1Y4B A;  1DKE B;  2ZFO A;  1YIH B;  5KDQ B;  1MWD A;  1N9X A;  2MGI A;  3ASE A;  3MJP B;  1Y31 B;  3OO5 A;  2V1G A;  3ZJQ A;  1OR4 A;  4ODC A;  2HBG A;  1Y7D A;  5CHQ A;  4NXA A;  2H8F A;  2AV0 A;  5JGG A;  1Y2Z A;  3MN0 A;  1HDS B;  1EMY A;  1HGA B;  3FH9 B;  3RJN B;  2OLP A;  2VYW A;  2ZLU A;  3O89 A;  1Y46 A;  1ASH A;  2MGD A;  3BJ2 B;  1DXU A;  4XS0 A;  1K1K B;  3GYS B;  2QMB A;  1UMO A;  1IT3 A;  1YIE B;  1YG5 B;  1QSI A;  1I3D A;  3ZJO A;  1BBB A;  1RTE A;  1MKO A;  1JF3 A;  1A3N A;  2G10 A;  2LH6 A;  1YIE A;  3AT6 A;  1YHR B;  2DN3 B;  2BLJ M;  1A3O A;  2RAO B;  4HSX A;  5EV5 A;  2ZLT B;  4U8U D;  2G0X A;  1GDI A;  1C7D B;  4HRR A;  1GBV A;  1JP8 A;  3UHQ A;  1MLS A;  2MHB B;  1HHO A;  1YZI B;  1UFJ A;  2FRJ X;  2JHO A;  1YEU B;  3PI8 B;  4MQI B;  2HBE A;  3HHB B;  2WTG A;  1EBT A;  2GDM A;  3VAU A;  1YHE A;  2HBC B;  1OUT B;  3UHH A;  1J3F A;  3NMM B;  1COH A;  5E6E B;  4ESA B;  4WCH D;  1S69 A;  1O1I B;  1HAB B;  3EOK B;  1YOH A;  3WHM B;  1EW6 A;  3QM8 A;  1HBB B;  2Z6T A;  2HBS B;  2AUO A;  3WCU D;  2HHE B;  1G0B B;  1Y0C A;  1AJH A;  1C7C A;  1MTI A;  3DUT A;  5CNE A;  1Y01 B;  3GQG A;  4FH7 A;  1YDZ A;  3AQ5 A;  1BJE A;  1Y7C A;  2R4W A;  1Y0C B;  1RTX A;  1CG5 A;  3HC9 A;  5CN9 A;  1GCV B;  1VWT A;  1K0Y A;  3R5I B;  1CH9 A;  1CP5 A;  3K8B A;  4N7P B;  3BOM A;  1Y7G B;  5C6E B;  1VRF A;  4G1B A;  1BZR A;  2G0V A;  1KR7 A;  4N7N A;  5HY8 A;  1HDA B;  1DO7 A;  2GTL A;  1HV4 B;  1O1O B;  2QU0 B;  1JZM A;  3S65 B;  1CQ2 A;  1CLS A;  1SDK B;  3PI3 A;  1MLK A;  2QU0 A;  2NX0 A;  3WCP B;  1Y4Q A;  2OHA A;  2ZT1 A;  1RQ3 A;  3WFU A;  3LQD A;  1ABY B;  1NQP B;  4H2L A;  2LH1 A;  3UHE A;  3D1A B;  2AA1 A;  1O1M A;  2BW9 M;  1MBI A;  1K1K A;  3MYM A;  3HYU A;  1DTM A;  2M6Z B;  1JF4 A;  4XDI A;  4PQC A;  1Y45 B;  2D5X A;  4MXK A;  3OVU C;  5JDO C;  1A0U A;  1JWN A;  1ABW A;  1H1X A;  1MYF A;  1WVP A;  4F6D A;  1Y4V A;  3ARL A;  1N9H A;  3HEN A;  1PMB A;  1MTK A;  3K3U A;  4MBA A;  2MGH A;  3UHI A;  2HBE B;  1UX9 A;  1WMU A;  1YMA A;  4YU3 B;  1FSL A;  1LUE A;  4JAC A;  2G11 A;  1S5X B;  3UHK A;  1OUT A;  1Y0T B;  5E83 A;  1SHR A;  1J7W B;  1YE2 B;  1G09 B;  3NG6 B;  1HBS A;  2W6V A;  4QAU A;  4PQ6 A;  1MLO A;  2MGG A;  5CNC A;  5KKK A;  1HBI A;  2HCO B;  5JDO E;  1LH7 A;  4F69 A;  1UVX A;  1Y4G B;  2HBS A;  2ZT4 A;  1HGB B;  3UGY A;  1LJW B;  2EVK A;  3DUT B;  3ARK A;  6HBI A;  4ZVB A;  3KMF A;  4VHB A;  3ZJH A;  1L2K A;  1AJ9 A;  2OHB A;  2R1H A;  3ZJN A;  1SDL A;  2R4Z A;  4O4Z A;  1FHJ B;  5AZQ A;  3AQ9 A;  3GQR B;  2DXM B;  1NIH B;  1BAB B;  1Y4B B;  111M A;  2IG3 A;  1Y7Z B;  4IT8 A;  2HZ3 A;  1WLA A;  1TU9 A;  2GTL B;  1DLY A;  3BJ1 B;  3ZJS A;  1NPF A;  4F4O A;  1VXA A;  3OO5 B;  3QZZ A;  2ZT0 A;  4N8T B;  3A0G A;  2MYA A;  3WFW A;  2ZS1 A;  3WCU C;  3A5A A;  1LFL B;  3S1I A;  3ONZ B;  2HHB A;  3QMA A;  3UH6 A;  3IC0 A;  1XYE B;  3IA3 B;  4C44 A;  4NK1 A;  1OR6 A;  4U8U B;  3IC0 B;  2MGJ A;  2LHB A;  1NS6 B;  1Y46 B;  1QPW B;  2HZ2 A;  5HLQ A;  2MGA A;  3GDJ A;  1A4F B;  3VRE B;  1ABW B;  1YGF B;  1A3N B;  1G0A A;  1Y4V B;  1O1L A;  1DXT A;  3VRF B;  3UHZ A;  4F6G A;  5CN6 A;  2QFK A;  1OJ6 A;  1FSX B;  3PI9 B;  1XZ2 A;  1IBE B;  4F6B A;  2EKU A;  2VLY A;  2HBF B;  3ZJM A;  5CN8 A;  4MQC A;  1MNO A;  104M A;  1D8U A;  1OBM A;  5ILP A;  4MQC B;  1LA6 B;  2MGE A;  3UHD A;  3NMM A;  1S6A A;  2ZS1 D;  2ZT3 A;  3V2V A;  4F6F A;  2ZLW B;  2IN4 A;  2ZLV A;  4UUR A;  1KD2 A;  3P5Q B;  2W6Y A;  1QSH A;  2LH5 A;  1A01 A;  1Y8W A;  2NRL A;  2G3H A;  3S1J A;  2GRH A;  3WCW D;  3A59 B;  2CMM A;  3TM9 A;  1B86 B;  5HLU A;  4M4B B;  3D17 A;  5HBI A;  1MBC A;  3PIA B;  1YEO A;  1ECN A;  3SDH A;  1H97 A;  1MLF A;  2ZSZ A;  4ZVA A;  4PNJ A;  3BJ1 A;  1MLJ A;  1CH1 A;  4MQH B;  3GOU A;  4MPM A;  5ILR A;  4N8T A;  1RPS A;  1NPG A;  4B3W A;  5EOH A;  1Z8U B;  2DN2 B;  1YH9 A;  1JZL A;  2ZFO D;  1SPG A;  1Y7D B;  1S5Y A;  2GKN A;  1DUO A;  2MYE A;  3WCP A;  1Y85 B;  2O5O X;  3GQP B;  1BIJ B;  1G9V A;  3GLN A;  4H2L B;  1Y5J B;  4H0B A;  1NS6 A;  1O1M B;  3S66 B;  1HAC A;  3NL7 A;  5D5R A;  4HHB B;  3PEL A;  2ZFB A;  1SI4 A;  1N9I A;  4PQB A;  4HHB A;  5E29 A;  2ZFB B;  3LHB A;  1DXC A;  2VEB A;  4MQG A;  2ZSS A;  5AZR A;  5SW7 B;  1CIO A;  5JGG B;  2O58 X;  1CP0 A;  3G52 A;  4C0N A;  2W72 A;  3HEP A;  1GBV B;  3FH9 A;  3G4U A;  3UHC A;  1URY A;  1UC3 A;  1YCA A;  2GRZ A;  3NFE B;  1NEJ B;  5EYJ A;  4MAX A;  4NI0 A;  4F6J A;  3D7O B;  1UX8 A;  1J7W A;  4MQK B;  1NGK A;  1YG5 A;  1BBB B;  2ZLV B;  2BK9 A;  4NI1 A;  1MLL A;  3A9M A;  3KMF C;  5E6E A;  1JEB A;  3B75 B;  3GKT A;  1JP6 A;  2D60 A;  3QQQ A;  1YGD A;  1VRE A;  3AT5 B;  1Y5F A;  4SDH A;  3QJD A;  2D60 B;  1JY7 A;  1J3Z A;  1LHS A;  1MLQ A;  3D17 B;  3MJU A;  1YEO B;  4FH6 A;  1LFV B;  2E2Y A;  3OO4 A;  1M6M A;  1UVY A;  3PT7 B;  1HBH A;  2GKM A;  1FDH A;  5EUI A;  4YU4 B;  1LFV A;  1ABS A;  1OUU A;  3PT7 A;  3GOU B;  1HDB B;  5EU2 A;  1VXC A;  1A6N A;  4F4O B;  3CY5 A;  3G4Q A;  1SPE A;  3VRG B;  2ZS1 B;  3ECL A;  1MYJ A;  3WR1 B;  1U7S A;  3S65 A;  1CG8 A;  1C7C B;  1CLS B;  1CPW A;  1S56 A;  2D2N D;  3LR7 A;  1XYE A;  3WR1 A;  3QJB B;  1JPB A;  2ZSP A;  1Y09 A;  3NML A;  2MYB A;  1RQ3 B;  3OZV A;  3PI4 A;  1X46 A;  1K0Y B;  4MXL A;  3QJB A;  4NXC A;  1F63 A;  2AA1 B;  1YHU D;  4HSW A;  2ZSX A;  3GDJ B;  1YVT B;  1EBC A;  1HGC B;  1BUW B;  3UHW A;  1NS9 B;  1YE0 B;  1O1O A;  1RQA B;  4G51 A;  2MGF A;  4KMV A;  1BUW A;  4G51 B;  3LB2 A;  1QI8 A;  1IDR A;  1Y4Q B;  3IXF A;  5M3S A;  1QI8 B;  4TYX A;  3WCU B;  1CMY B;  1NEJ A;  4KMW A;  4NI0 B;  1BZZ A;  3QM7 A;  1BVD A;  1GLI B;  3A5G A;  1ITH A;  2LH2 A;  4U8U C;  1LA6 A;  2VEE A;  1XXT A;  2ZFO C;  4NI1 B;  2D5Z A;  1MLN A;  1QSI B;  1LH6 A;  1C40 B;  3OZW A;  1JEB B;  1XXT B;  1EWA A;  3P5Q A;  2D5Z B;  1DO3 A;  2ZLX B;  1Y4G A;  3WCV A;  1FAW A;  1Y8W B;  4FC3 B;  1J3Y B;  1DTI A;  3AG0 A;  1RVW A;  112M A;  4TWU A;  1LJW A;  3E55 A;  3BJ2 A;  1Y0D A;  1BVC A;  2VLX A;  3KUN A;  3WCW C;  1CQX A;  1FN3 B;  1SDL B;  1Y8I A;  3ZJP A;  4TWV A;  2GTL D;  1GDK A;  2RAO A;  1COH B;  1YEQ A;  3MKB A;  1BZ6 A;  1IRC A;  1JW8 A;  2ZT2 A;  2B7H A;  2HHD B;  3UHB A;  1V4W B;  1SPG B;  3M3A A;  1HHO B;  3ZJR A;  3PI1 A;  4M4A B;  1LFQ B;  1MLG A;  1BZ0 B;  3HRW B;  1KFR A;  1LH1 A;  1Y4F A;  2DN1 B;  4AVD A;  1LFQ A;  3UH7 A;  1R1X A;  1CH5 A;  1T1N B;  3UHG A;  1YDZ B;  5HLX A;  2EKT A;  1FHJ A;  109M A;  4BJA A;  1Y4P A;  1NIH A;  1R1X B;  1O1P B;  1A9W E;  1V5H A;  3CIU B;  3E5I A;  4ROM B;  3MVC A;  1MYZ A;  1Y0W A;  4O2G A;  1SI4 B;  5C6E A;  1Y8H A;  1MYI A;  1YVQ B;  2HZ1 A;  5E29 B;  4ROL B;  2V1E A;  1LFY A;  103M A;  1MOD A;  2HHE A;  3G46 A;  3MJP A;  2EB8 A;  1Y8H B;  3ZOM A;  5MBA A;  2PEG A;  3BCQ B;  4N7O B;  3H57 A;  1I3E A;  3U3E A;  3UHX A;  1A6G A;  2HHB B;  1O16 A;  2FAL A;  1YHU C;  3M38 A;  1LTW A;  1J40 B;  4DWT A;  1J7S B;  3WCT B;  1IBE A;  1ABY A;  4L7Y B;  3MOU A;  4N7P A;  2AUQ A;  1F5P A;  1XZ5 B;  2MGL A;  3ZOL A;  1F65 A;  1IWH B;  2OH9 A;  1IOP A;  1HBA A;  4B4Y A;  3UHY A;  3WCW B;  1HBR A;  1A00 B;  1MOH A;  3LR9 A;  3PT8 A;  2HBD B;  5EYS A;  1HSY A;  1YEN A;  2ZWJ A;  1A00 A;  5F0B A;  1QXE B;  2HBD A;  5IKS A;  110M A;  1VXB A;  1YMC A;  1QXD A;  3G4R A;  1FSX A;  1NQP A;  1A3O B;  1LFT B;  1QXE A;  1XZ2 B;  3MBA A;  3D1K A;  3QJE B;  1IRD A;  1R1Y B;  1HLB A;  1UT0 A;  2OH8 A;  1C7D A;  1WMU B;  4F6I A;  3WCT C;  1MOB A;  2R80 A;  1XQ5 B;  2M6Z A;  3OO4 B;  4DC7 A;  1LFZ B;  5CN5 A;  4YU4 A;  4NZI A;  2G12 A;  1LH3 A;  1CO9 A;  3QJC B;  1Y35 B;  5KER B;  1BIN A;  3EU1 B;  1VXG A;  2QRW A;  2D2M C;  2D6C A;  3WTG B;  3ECZ A;  2HCO A;  1THB A;  4O4T A;  2B7H B;  3UGZ A;  1XZU B;  1YOG A;  2SPN A;  2MGB A;  3VRG A;  3WTG A;  2QSS B;  4HRR B;  1BZ1 B;  4X0L A;  1GBU B;  2ZS0 D;  3HRW A;  1V75 B;  1Y83 B;  3OGB A;  1HBB A;  1S5Y B;  2EVP A;  3GQP A;  5CNF A;  3UBC A;  1LHT A;  3NG6 A;  2HBC A;  4DC8 A;  1YFF A;  1CG5 B;  3WCV C;  4ROM A;  1NWN A;  2DXM A;  1GCV A;  4WJG A;  1RSE A;  3UH3 A;  1GZX B;  3G4Y A;  4FWY A;  1DXV B;  1RQA A;  1MWB A;  3DR9 A;  5MBN A;  4O1T A;  2ZFO B;  1NXF A;  2MB5 A;  5HY8 B;  1Y22 A;  4N7N B;  2QSP B;  3HXN A;  1JL6 A;  3M39 A;  1BIJ A;  1G9V B;  1CH7 A;  1S61 A;  3WCT A;  5CNB A;  5HU6 B;  1HJT A;  2ZSO A;  1Y5J A;  2BNL A;  1XY0 A;  1VWT B;  2WTH A;  3UHV A;  5HU6 A;  2GLN A;  1Y2Z B;  3NFE A;  3LB1 A;  3PEL B;  1Q1F A;  1HDS A;  1V9Q A;  1HBR B;  2G0Z A;  3ECX A;  3QM9 A;  2O5M X;  1HDA A;  1O1N A;  107M A;  1JL7 A;  1V07 A;  1VXE A;  3HF4 B;  4JYQ A;  3D1K B;  3B75 A;  1A0Z A;  1V4U A;  1M6C A;  5ILE A;  3W4U A;  1Y5F B;  3UHU A;  1A0Z B;  3O7N A;  2NRM A;  1YMB A;  1YHU B;  3MJU B;  1FN3 A;  1G08 B;  1YZI A;  1DWR A;  1MCY A;  2DHB A;  5EUI B;  1YHU A;  3OK5 A;  1Y35 A;  2D5X B;  1G08 A;  3UH5 A;  3DHR A;  3ZJI A;  2XKG A;  1THB B;  3ARJ A;  4F68 A;  101M A;  1YHR A;  2EB9 A;  2D2N A;  3LB4 A;  2V1F A;  3PI9 A;  3CY5 B;  1Y4R B;  2VM0 A;  2VYY A;  1IT2 A;  3QJD B;  4M4A A;  1J3Z B;  1BZ0 A;  1CG8 B;  2O5S X;  1Y4F B;  1C7B B;  1T1N A;  4M4B A;  1YEU A;  3PI8 A;  4MQI A;  1NWI A;  1Y09 B;  7HBI A;  1YFF B;  2V1J A;  3DHT A;  1MWC A;  1MBS A;  1C7B A;  1YHE B;  1O1P A;  2BWH A;  3AQ8 A;  2QFN A;  1M9P A;  2MYC A;  3ED9 A;  1HRM A;  3GQR A;  1BAB A;  1J52 A;  3LB3 A;  4ESA A;  3SZK B;  1YVQ A;  1MNK A;  2V1H A;  5CMV A;  4MU5 A;  2FRF A;  3EOK A;  3BOM B;  1O1K A;  2W31 A;  1Y0A A;  4HRT B;  2ZS0 C;  1PBX B;  4UZV A;  2KSC A;  1BZP A;  1AJG A;  2H35 B;  1LFL A;  3FS4 B;  1MYT A;  3V2Z A;  2Z6S A;  1DWT A;  1RQ4 B;  1PBX A;  1DM1 A;  2R4Y A;  1CMY A;  2G14 A;  1J41 A;  3G4W A;  3BJ3 B;  3LQD B;  2O5Q X;  3A2G A;  3BJ3 A;  2ZSY A;  1MYG A;  1DWS A;  1YH9 B;  2PGH B;  3PT8 B;  2ZS0 A;  3G4V A;  3A0G B;  2QLS A;  2SPO A;  2ZS0 B;  3ONZ A;  1OFJ A;  3WFT A;  3E4N A;  2QLS B;  1MYM A;  1MGN A;  2O5B X;  4OF9 A;  5JDO D;  5EE4 C;  2D2M D;  2AUP A;  1RVW B;  3D1A A;  1MBA A;  1NZ3 A;  3H58 A;  2R80 B;  1Y0D B;  1FCS A;  1QPW A;  5CN7 A;  2DHB B;  1MTJ A;  1UIW A;  3HYU B;  1GJN A;  4YU3 A;  1Y8I B;  1VHB A;  1NZ4 A;  4XS0 B;  3HEO A;  106M A;  1XZ7 A;  2QMB B;  1LH2 A;  2XYK A;  105M A;  2W6V B;  1XZV A;  2D2N B;  1MNH A;  1A6K A;  1YEQ B;  3MKB B;  1XZ4 B;  2R4X A;  2ZLW A;  2VHB A;  1CIK A;  2H8F B;  4FC3 A;  1X9F D;  1ECA A;  4HBI A;  3UHR A;  1Y8K A;  2Z85 A;  1MDN A;  1X9F B;  4MQK A;  3A59 A;  1UFP A;  1S5X A;  1DXU B;  1Y8K B;  3PIA A;  1G09 A;  1B0B A;  1OUU B;  3SZK A;  3ZH0 A;  1GDJ A;  1O1J B;  2W6X A;  2BKM A;  3GKV A;  1Y0W B;  1W92 A;  1YGD B;  2DN3 A;  1DXV A;  2W72 C;  3TM3 A;  1O1I A;  1VXH A;  2MGK A;  1MOA A;  2ZLT A;  1LFY B;  2HHD A;  2GTL C;  2V1K A;  1JY7 B;  5C6Y A;  1HGB A;  1MNJ A;  4N7O A;  5JDO F;  4GZG A;  3IC2 A;  2GNW A;  2FRK X;  2SPM A;  1J41 B;  1J7S A;  1Y4P B;  1VXF A;  5HAV A;  4OOD A;  102M A;  3R5I A;  4U8U A;  1MBD A;  2WY4 A;  1IWH A;  3WCW A;  1GDL A;  2VYZ A;  1YE0 A;  2FAM A;  1SWM A;  1YEN B;  2GL3 A;  5EE4 D;  1MYH A;  2Z6N A;  1GCW B;  1G0B A;  1V4U B;  2XKI A;  1QXD B;  1J7Y A;  2VLZ A;  4IRO A;  1MBN A;  1GCW A;  2H8D A;  5D1V A;  1YEV B;  4IRO B;  3K8B B;  1UIW B;  2ZST A;  1V4X A;  1YVT A;  2MBW A;  1YEV A;  1HBA B;  1FLP A;  2W6W A;  1XZ7 B;  1LFZ A;  5CHR A;  3VHB A;  1VXD A;  3QJC A;  1LH5 A;  2LH7 A;  1JZK A;  1C40 A;  3UHT A;  1TES A;  5ILM A;  1G0A B;  2MGM A;  2O5T X;  2XKH A;  1CH2 A;  1ECD A;  4ODC B;  1A0U B;  2DC3 A;  1SDK A;  4MBN A;  1LFT A;  2BMM A;  2ZS1 C;  3WCU A;  3WCV B;  2W72 B;  4FWX A;  3M3B A;  1R1Y A;  1GBU A;  1BZZ B;  3AT5 A;  2Z8A A;  1N9F A;  4MQJ B;  3SDN A;  4AVE A;  1JP9 A;  3DHT B;  2ZSQ A;  4L2M A;  5E83 B;  1Y0T A;  1HBH B;  1SHR B;  1Y45 A;  1NAZ A;  1O1J A;  3GYS A;  1HBS B;  2BLI A;  3EU1 A;  1Y5K B;  4FWZ A;  1CH3 A;  3AQ7 A;  3GK9 A;  1CH4 A;  1FAW B;  1HDB A;  1KD2 B;  1DO4 A;  2SPL A;  1O1K B;  1Y5K A;  3AT6 B;  3QZX A;  1J3Y A;  1U7R A;  2QSS A;  4X0L B;  1DUK A;  1Y83 A;  4NK2 A;  4KJT A;  2DN2 A;  2GNV A;  3UI0 A;  5B84 A;  1A9W A;  2ZSN A;  1RQ4 A;  2RI4 A;  1AJ9 B;  3RJ6 A;  3ORD A;  3CIU A;  2RI4 B;  3MYN A;  3TLD A;  1CBM A;  4DWU A;  1YCB A;  108M A;  3ZJJ A;  1CO8 A;  1HLM A;  4MQH A;  1GZX A;  4ILZ A;  5B85 A;  3NL7 B;  4LPI A;  2R50 A;  3WCV D;  3UHN A;  3OJ1 A;  3D4X B;  3K9Z A;  1RPS B;  5EET A;  1Y22 B;  1O1N B;  3WFX A; 
#chains in the Genus database with same CATH topology
 4KN3 A;  1MLR A;  4G1V A;  1OFK A;  3EDB A;  3HF4 A;  1Y85 A;  4MQG B;  3WCT D;  5SW7 A;  2H8D B;  2NSR A;  1XY0 B;  4B02 A;  3GQG B;  4A8K A;  1Y7C B;  4L7Y A;  2G0S A;  2G0R A;  5F2A A;  3ZHW A;  3WI8 A;  1A6M A;  1X9F C;  1XZ5 A;  2D2M B;  2OIF A;  3PI2 A;  1Y7Z A;  1XDT T;  1HGC A;  1Y7G A;  3D7O A;  2D2M A;  2YRS B;  3BCQ A;  1YIH A;  1XZV B;  1A4F A;  3VRE A;  1HV4 A;  2GRF A;  5EQM A;  1YGF A;  1ECO A;  1XZ4 A;  3PMD A;  1MLH A;  2YRS A;  4RMP A;  2AUR A;  6HBW B;  1ON7 B;  3ZJL A;  1DXT B;  3W4U B;  2LH3 A;  1Y4R A;  1MNI A;  2V1I A;  3QJE A;  4H07 A;  3OZU A;  6HBW A;  4MQJ A;  1QGW C;  2BLH A;  2VRY A;  4NS2 A;  4A8W A;  1X9F A;  1URV A;  1GLI A;  2HBF A;  1HGA A;  2JLG A;  2ZLU B;  5AB8 A;  3G53 A;  3ODQ B;  3DHR B;  5KER A;  1NZ2 A;  3S48 C;  3AQ6 A;  3GKV B;  1FDH G;  3ODQ A;  3R0G A;  4WJG 1;  1O1L B;  2ZLX A;  3VRF A;  2ZSR A;  1MKO B;  2MYD A;  3O2C B;  1MBO A;  1Y0A B;  1IRD B;  1XZU A;  5JOM A;  2AV3 A;  1HCO B;  1GVH A;  5CN4 A;  1DXD A;  1NZ5 A;  1HBG A;  1A01 B;  1V4W A;  1V75 A;  2O5L X;  3IC2 B;  3E5O A;  1XQ5 A;  1S0H A;  3A5B A;  1DLW A;  1HCO A;  2H35 A;  3UBV A;  1JDO A;  1MZ0 A;  2MHB A;  1S0H B;  1MLU A;  2C0K A;  2MGC A;  3GIO A;  3HHB A;  1KN1 B;  2FRI X;  1M9P B;  1YE2 A;  5CND A;  1AZI A;  3UHS A;  1XCH A;  3D4X A;  1MLM A;  1BZ1 A;  2PGH A;  3RGK A;  4UIQ A;  5CNG A;  3QM5 A;  4HRT A;  4ROL A;  1QSH B;  1HAB A;  1MOC A;  2Z6N B;  1NS9 A;  2QSP A;  3HXN B;  3WHM A;  2PEG B;  3QQR A;  3FS4 A;  3EDA A;  2NSS A;  2DN1 A;  1J7Y B;  1B86 A;  2EF2 A;  4ZIZ B;  1X3K A;  2D2N C;  1DO1 A;  1J40 A;  2R1H B;  3QM6 A;  1YOI A;  1CBL A;  4ZIZ A;  1F5O A;  3BA2 A;  1V4X B;  4Q70 B;  1DKE A;  3S66 A;  1HAC B;  5KDQ A;  4O35 A;  3KUO A;  1Y31 A;  1Y4B A;  1DKE B;  2ZFO A;  1YIH B;  5KDQ B;  1MWD A;  1N9X A;  2MGI A;  5AQD A;  3ASE A;  3MJP B;  4PO5 A;  1Y31 B;  3OO5 A;  2V1G A;  3ZJQ A;  1OR4 A;  4ODC A;  2HBG A;  1Y7D A;  5CHQ A;  4NXA A;  2H8F A;  2AV0 A;  5JGG A;  1Y2Z A;  2UUL C;  3MN0 A;  1HDS B;  1EMY A;  1HGA B;  3FH9 B;  3RJN B;  2OLP A;  2VYW A;  2ZLU A;  3O89 A;  1Y46 A;  1ASH A;  2MGD A;  3BJ2 B;  1DXU A;  4XS0 A;  1F99 A;  1K1K B;  3GYS B;  2QMB A;  1UMO A;  1IT3 A;  1YIE B;  1YG5 B;  1QSI A;  1I3D A;  3ZJO A;  1BBB A;  1RTE A;  3MWN A;  1MKO A;  1JF3 A;  1A3N A;  2G10 A;  2LH6 A;  1YIE A;  3AT6 A;  1YHR B;  2DN3 B;  2BLJ M;  1A3O A;  2RAO B;  4HSX A;  5EV5 A;  2ZLT B;  4U8U D;  2G0X A;  1GDI A;  1C7D B;  4HRR A;  5FVB M;  1GBV A;  1JBO A;  1JP8 A;  3UHQ A;  1MLS A;  2MHB B;  1HHO A;  1YZI B;  1UFJ A;  2FRJ X;  2JHO A;  3DBJ B;  1YEU B;  3PI8 B;  4MQI B;  2HBE A;  3HHB B;  2WTG A;  1EBT A;  2GDM A;  3VAU A;  1UVM A;  5AQD M;  3DBJ A;  1YHE A;  2HBC B;  1OUT B;  3UHH A;  1J3F A;  3NMM B;  2YSK A;  1COH A;  5E6E B;  4ESA B;  4WCH D;  1S69 A;  1O1I B;  1HAB B;  3EOK B;  2BV8 B;  1YOH A;  3WHM B;  1EW6 A;  3QM8 A;  1RH1 A;  1HBB B;  2Z6T A;  2HBS B;  2AUO A;  3WCU D;  2HHE B;  1G0B B;  1Y0C A;  2X4A A;  1AJH A;  1C7C A;  1MTI A;  3DUT A;  5CNE A;  1Y01 B;  3GQG A;  4FH7 A;  1YDZ A;  3AQ5 A;  2VJT B;  1BJE A;  1Y7C A;  3L0F B;  1Y0C B;  1RTX A;  2R4W A;  1CG5 A;  3HC9 A;  5CN9 A;  1GCV B;  1VWT A;  1K0Y A;  3R5I B;  1CH9 A;  1CP5 A;  3K8B A;  4N7P B;  1SGK A;  3BOM A;  1UVL A;  1Y7G B;  1EYX B;  3O18 A;  5C6E B;  1VRF A;  4G1B A;  1BZR A;  2G0V A;  1KR7 A;  4N7N A;  5HY8 A;  1HDA B;  1DO7 A;  2GTL A;  1HV4 B;  1O1O B;  2QU0 B;  1JZM A;  3S65 B;  1CQ2 A;  1CLS A;  1SDK B;  3PI3 A;  1MLK A;  2QU0 A;  2NX0 A;  3WCP B;  1Y4Q A;  2OHA A;  2ZT1 A;  1RQ3 A;  3WFU A;  3LQD A;  1ABY B;  1NQP B;  4H2L A;  2LH1 A;  3UHE A;  3D1A B;  2AA1 A;  1O1M A;  2BW9 M;  2VJH A;  1MBI A;  1K1K A;  3MYM A;  3HYU A;  1DTM A;  2M6Z B;  1JF4 A;  4XDI A;  4PQC A;  1Y45 B;  2D5X A;  4MXK A;  3OVU C;  5JDO C;  1A0U A;  1JWN A;  1H1X A;  1ABW A;  1MYF A;  1WVP A;  2VML A;  4F6D A;  1Y4V A;  3ARL A;  1N9H A;  3HEN A;  1PMB A;  1MTK A;  3K3U A;  4MBA A;  2MGH A;  3UHI A;  2HBE B;  1UX9 A;  1WMU A;  1YMA A;  4YU3 B;  1FSL A;  1LUE A;  4JAC A;  2G11 A;  1S5X B;  3UHK A;  1OUT A;  1Y0T B;  5E83 A;  2J96 A;  1SHR A;  1J7W B;  1YE2 B;  1G09 B;  3NG6 B;  1HBS A;  2W6V A;  4QAU A;  4PQ6 A;  4N6S B;  1MLO A;  2MGG A;  5CNC A;  5KKK A;  4LM6 B;  1HBI A;  2HCO B;  5JDO E;  1LH7 A;  4F69 A;  1UVX A;  1Y4G B;  2HBS A;  2ZT4 A;  4ESU A;  1HGB B;  3UGY A;  1LJW B;  2EVK A;  3DUT B;  3ARK A;  6HBI A;  4ZVB A;  3KMF A;  3L0F A;  4VHB A;  3ZJH A;  1L2K A;  1AJ9 A;  2OHB A;  2R1H A;  3ZJN A;  1SDL A;  2R4Z A;  4O4Z A;  1FHJ B;  4XXI A;  5AZQ A;  3AQ9 A;  3GQR B;  2DXM B;  1NIH B;  1BAB B;  1Y4B B;  111M A;  2IG3 A;  1Y7Z B;  4IT8 A;  2HZ3 A;  1WLA A;  2UUL H;  1TU9 A;  2GTL B;  1DLY A;  3BJ1 B;  3ZJS A;  1NPF A;  4F4O A;  1VXA A;  3OO5 B;  3QZZ A;  2ZT0 A;  4N8T B;  3A0G A;  1UVK A;  2MYA A;  3WFW A;  2ZS1 A;  3WCU C;  3A5A A;  1LFL B;  3S1I A;  3ONZ B;  2HHB A;  3QMA A;  3UH6 A;  3IC0 A;  1XYE B;  3IA3 B;  4C44 A;  4NK1 A;  1OR6 A;  4U8U B;  3IC0 B;  2MGJ A;  2LHB A;  2C7K A;  1NS6 B;  1Y46 B;  1QPW B;  2HZ2 A;  1HI8 A;  5HLQ A;  2MGA A;  3GDJ A;  4YJJ A;  1A4F B;  3VRE B;  1ABW B;  1HA7 B;  1YGF B;  1A3N B;  4RMP B;  1G0A A;  1Y4V B;  1O1L A;  1DXT A;  3VRF B;  3UHZ A;  4F6G A;  3LQ9 A;  5CN6 A;  2DKD A;  2QFK A;  1OJ6 A;  1FSX B;  3PI9 B;  1XZ2 A;  4LMX B;  1IBE B;  3ZTA A;  4F6B A;  2EKU A;  2JL9 A;  2VLY A;  2HBF B;  3ZJM A;  5CN8 A;  4MQC A;  1MNO A;  104M A;  1D8U A;  1OBM A;  5ILP A;  3V57 B;  4MQC B;  1LA6 B;  2MGE A;  3UHD A;  3NMM A;  1S6A A;  2ZS1 D;  2ZT3 A;  3V2V A;  4F6F A;  2ZLW B;  2IN4 A;  2ZLV A;  4UUR A;  1KD2 A;  3P5Q B;  2BV8 A;  2DKC A;  4F0T A;  2W6Y A;  1QSH A;  2LH5 A;  1A01 A;  1Y8W A;  2NRL A;  2G3H A;  3S1J A;  2GRH A;  3WCW D;  3A59 B;  2CMM A;  3TM9 A;  1B86 B;  5HLU A;  4M4B B;  2VJT A;  3D17 A;  5HBI A;  1MBC A;  3PIA B;  1YEO A;  1ECN A;  3SDH A;  1H97 A;  1MLF A;  2ZSZ A;  4ZVA A;  4PNJ A;  3BJ1 A;  1MLJ A;  1CH1 A;  4MQH B;  3GOU A;  4MPM A;  5ILR A;  4N8T A;  1RPS A;  1NPG A;  4B3W A;  5EOH A;  1Z8U B;  2DN2 B;  1YH9 A;  1JZL A;  2ZFO D;  1SPG A;  1Y7D B;  1S5Y A;  2GKN A;  1DUO A;  2MYE A;  3WCP A;  1Y85 B;  2O5O X;  3GQP B;  4ETU A;  1BIJ B;  1G9V A;  3GLN A;  4H2L B;  1XG0 C;  1Y5J B;  4H0B A;  1NS6 A;  1O1M B;  4Q70 A;  3S66 B;  1HAC A;  3NL7 A;  5D5R A;  4HHB B;  3PEL A;  2ZFB A;  4TMA B;  1SI4 A;  1N9I A;  4PQB A;  4HHB A;  5E29 A;  2ZFB B;  3LHB A;  1DXC A;  4AE0 A;  4GY3 B;  2VEB A;  4MQG A;  2V8A A;  1TOX A;  2ZSS A;  5AZR A;  5SW7 B;  1CIO A;  4L1E B;  5JGG B;  2O58 X;  1CP0 A;  3G52 A;  4C0N A;  2W72 A;  3HEP A;  1GBV B;  3FH9 A;  4HH1 A;  3G4U A;  3UHC A;  1URY A;  1UC3 A;  1YCA A;  2GRZ A;  3NFE B;  1NEJ B;  5EYJ A;  1UVI A;  4MAX A;  4NI0 A;  4F6J A;  3D7O B;  1UX8 A;  1J7W A;  4MQK B;  1NGK A;  1YG5 A;  4ERV A;  1BBB B;  2ZLV B;  2BK9 A;  4NI1 A;  1MLL A;  3A9M A;  3KMF C;  5E6E A;  1JEB A;  3B75 B;  3GKT A;  1JP6 A;  2D60 A;  3QQQ A;  1YGD A;  1VRE A;  3AT5 B;  1Y5F A;  4SDH A;  3QJD A;  2D60 B;  1JY7 A;  1J3Z A;  1LHS A;  1MLQ A;  3D17 B;  1NY9 A;  2UUL D;  3MJU A;  1YEO B;  4FH6 A;  1LFV B;  2E2Y A;  3OO4 A;  1M6M A;  1UVY A;  3PT7 B;  1HBH A;  2GKM A;  1FDH A;  5EUI A;  4YU4 B;  1CPC A;  1LFV A;  1ABS A;  1OUU A;  3PT7 A;  3GOU B;  1HDB B;  5EU2 A;  1EYX A;  1VXC A;  1A6N A;  4F4O B;  3CY5 A;  3G4Q A;  1DDT A;  1SPE A;  3VRG B;  2ZS1 B;  3ECL A;  1MYJ A;  3WR1 B;  1U7S A;  3S65 A;  1CG8 A;  1C7C B;  1CLS B;  1CPW A;  1S56 A;  2D2N D;  3LR7 A;  1XYE A;  3WR1 A;  3QJB B;  1JPB A;  2ZSP A;  1Y09 A;  3NML A;  2MYB A;  1RQ3 B;  3OZV A;  3PI4 A;  1X46 A;  1K0Y B;  4MXL A;  3QJB A;  4NXC A;  1F63 A;  2C7K B;  2AA1 B;  1YHU D;  4HSW A;  3NUH B;  2VJH B;  2ZSX A;  4ETV A;  3GDJ B;  1YVT B;  1EBC A;  1HGC B;  1BUW B;  3UHW A;  1NS9 B;  1YE0 B;  1O1O A;  1RQA B;  4G51 A;  2MGF A;  4KMV A;  1BUW A;  4G51 B;  3LB2 A;  1QI8 A;  1IDR A;  1Y4Q B;  3IXF A;  1ALL B;  5M3S A;  4BS9 A;  1QI8 B;  4TYX A;  3WCU B;  1CMY B;  1NEJ A;  4KMW A;  4NI0 B;  1BZZ A;  3QM7 A;  1BVD A;  1GLI B;  3A5G A;  1ITH A;  2LH2 A;  4U8U C;  2UUN B;  1LA6 A;  2VEE A;  1XXT A;  2ZFO C;  4NI1 B;  2D5Z A;  1MLN A;  1QSI B;  1LH6 A;  1C40 B;  3OZW A;  1JEB B;  1XXT B;  1EWA A;  3P5Q A;  2D5Z B;  1DO3 A;  1COL A;  2ZLX B;  1Y4G A;  3WCV A;  1FAW A;  1HHT P;  1Y8W B;  4FC3 B;  1J3Y B;  1DTI A;  3AG0 A;  1B33 A;  1RVW A;  112M A;  4TWU A;  1LJW A;  3E55 A;  3BJ2 A;  1Y0D A;  1BVC A;  2VLX A;  3KUN A;  3WCW C;  1CQX A;  1FN3 B;  1SDL B;  4H0M A;  1Y8I A;  3ZJP A;  4TWV A;  2GTL D;  1MDT A;  1GDK A;  2RAO A;  1COH B;  1YEQ A;  3MKB A;  1HI1 A;  3FEW X;  1BZ6 A;  1IRC A;  1JW8 A;  3KVS B;  2ZT2 A;  2B7H A;  2HHD B;  3UHB A;  1V4W B;  1SPG B;  3M3A A;  1HHO B;  3ZJR A;  3PI1 A;  4M4A B;  1LFQ B;  1MLG A;  4GXE B;  1BZ0 B;  3HRW B;  1KFR A;  1LH1 A;  1Y4F A;  2DN1 B;  5FVB A;  1LFQ A;  3UH7 A;  4AVD A;  1R1X A;  1CH5 A;  1T1N B;  3UHG A;  1YDZ B;  5HLX A;  2EKT A;  1FHJ A;  109M A;  4BJA A;  1Y4P A;  1NIH A;  1R1X B;  1O1P B;  1A9W E;  1V5H A;  3CIU B;  3E5I A;  4ROM B;  3MVC A;  1MYZ A;  1Y0W A;  4O2G A;  1SI4 B;  3O18 B;  5C6E A;  1Y8H A;  1MYI A;  1YVQ B;  2HZ1 A;  5E29 B;  4ROL B;  2V1E A;  1LFY A;  103M A;  1MOD A;  2HHE A;  3G46 A;  3MJP A;  2EB8 A;  1Y8H B;  3ZOM A;  5MBA A;  2PEG A;  3BCQ B;  4N7O B;  3H57 A;  1I3E A;  3U3E A;  3UHX A;  1A6G A;  2HHB B;  1O16 A;  2FAL A;  1YHU C;  3M38 A;  1LTW A;  1J40 B;  4DWT A;  1J7S B;  3WCT B;  1IBE A;  1ABY A;  4L7Y B;  3MOU A;  4N7P A;  2AUQ A;  1F5P A;  1XZ5 B;  2MGL A;  3ZOL A;  1F65 A;  1IWH B;  2OH9 A;  1IOP A;  1HBA A;  4B4Y A;  3UHY A;  3WCW B;  1HBR A;  4PO5 B;  1A00 B;  1MOH A;  3LR9 A;  3PT8 A;  2HBD B;  5EYS A;  1HSY A;  1YEN A;  2ZWJ A;  1A00 A;  5F0B A;  1QXE B;  3RQR A;  2HBD A;  5IKS A;  110M A;  1VXB A;  1YMC A;  1QXD A;  2C7J A;  4F0T B;  3G4R A;  1FSX A;  1NQP A;  1A3O B;  1LFT B;  1QXE A;  1XZ2 B;  1B33 B;  3MBA A;  3D1K A;  3QJE B;  1IRD A;  1R1Y B;  1HLB A;  1UT0 A;  2OH8 A;  1C7D A;  1WMU B;  4F6I A;  3WCT C;  1MOB A;  2R80 A;  1XQ5 B;  2M6Z A;  3OO4 B;  1F99 B;  4DC7 A;  1LFZ B;  5CN5 A;  4YU4 A;  4NZI A;  2G12 A;  1LH3 A;  1CO9 A;  3QJC B;  1Y35 B;  5KER B;  1BIN A;  3EU1 B;  1VXG A;  2QRW A;  2D2M C;  2D6C A;  1UVJ A;  2VML B;  3WTG B;  3ECZ A;  2HCO A;  1THB A;  4O4T A;  2B7H B;  3UGZ A;  1XZU B;  1YOG A;  2SPN A;  2MGB A;  3VRG A;  3WTG A;  2QSS B;  4HRR B;  1BZ1 B;  1KTP B;  1GBU B;  4X0L A;  2ZS0 D;  3HRW A;  1V75 B;  1Y83 B;  3OGB A;  1HBB A;  1S5Y B;  4A8S A;  2EVP A;  3GQP A;  5CNF A;  3UBC A;  1LHT A;  3NG6 A;  2HBC A;  4DC8 A;  1YFF A;  1CG5 B;  2WCQ A;  3WCV C;  4ROM A;  1NWN A;  2DXM A;  1GCV A;  4WJG A;  1RSE A;  3UH3 A;  1GZX B;  4A8Q A;  3G4Y A;  4FWY A;  1DXV B;  1RQA A;  1MWB A;  3DR9 A;  5MBN A;  1F0L A;  4O1T A;  2ZFO B;  1NXF A;  2MB5 A;  4N7N B;  1Y22 A;  5HY8 B;  2QSP B;  3HXN A;  1JL6 A;  4HH0 A;  3M39 A;  1BIJ A;  1G9V B;  1CH7 A;  1S61 A;  3WCT A;  5CNB A;  5HU6 B;  1HJT A;  2ZSO A;  1Y5J A;  2BNL A;  1XY0 A;  1VWT B;  2WTH A;  3UHV A;  5HU6 A;  2GLN A;  1Y2Z B;  3NFE A;  3LB1 A;  3PEL B;  1Q1F A;  1HDS A;  1V9Q A;  1HBR B;  3ECX A;  2G0Z A;  2UUN A;  3QM9 A;  2O5M X;  1HDA A;  1O1N A;  107M A;  1JL7 A;  1V07 A;  1VXE A;  1HI0 P;  3HF4 B;  4JYQ A;  1WAC A;  4L1E A;  3D1K B;  3B75 A;  1A0Z A;  1V4U A;  1M6C A;  5ILE A;  3W4U A;  4XXK A;  1Y5F B;  3UHU A;  1A0Z B;  3O7N A;  2NRM A;  1YMB A;  1YHU B;  3MJU B;  1FN3 A;  1G08 B;  1YZI A;  1DWR A;  5B13 A;  1MCY A;  2DHB A;  5EUI B;  1YHU A;  3OK5 A;  1Y35 A;  2D5X B;  1G08 A;  3UH5 A;  3DHR A;  3ZJI A;  2XKG A;  4A8F A;  1THB B;  3ARJ A;  4F68 A;  101M A;  1YHR A;  2EB9 A;  3KVS A;  2D2N A;  2C7L A;  3LB4 A;  2V1F A;  3PI9 A;  3CY5 B;  1Y4R B;  3BRP B;  4ERT A;  2VM0 A;  2VYY A;  1IT2 A;  3QJD B;  4M4A A;  1J3Z B;  1BZ0 A;  1CG8 B;  2O5S X;  2DKA A;  1GH0 B;  1Y4F B;  1C7B B;  1T1N A;  4M4B A;  1YEU A;  3PI8 A;  4MQI A;  1NWI A;  1Y09 B;  7HBI A;  1YFF B;  2V1J A;  3DHT A;  1MWC A;  1MBS A;  1C7B A;  1YHE B;  1O1P A;  2BWH A;  3AQ8 A;  2QFN A;  1M9P A;  2MYC A;  3ED9 A;  1HRM A;  3GQR A;  1BAB A;  1J52 A;  3LB3 A;  4A8M P;  4ESA A;  3SZK B;  1YVQ A;  1MNK A;  5B13 G;  2V1H A;  5CMV A;  3O2C A;  4MU5 A;  2FRF A;  3EOK A;  3BOM B;  1O1K A;  2W31 A;  1Y0A A;  4HRT B;  2ZS0 C;  4Z8K B;  1PBX B;  4UZV A;  2KSC A;  1BZP A;  1AJG A;  2H35 B;  1LFL A;  3FS4 B;  1MYT A;  1CII A;  3V2Z A;  2Z6S A;  1DWT A;  1RQ4 B;  1PBX A;  1DM1 A;  4F0U B;  2R4Y A;  1CMY A;  1KN1 A;  2G14 A;  1J41 A;  3G4W A;  3BJ3 B;  3LQD B;  2O5Q X;  4F0U A;  3A2G A;  3BJ3 A;  2ZSY A;  1MYG A;  2JLF A;  1I7Y B;  1DWS A;  1YH9 B;  2PGH B;  3PT8 B;  2ZS0 A;  1UVN A;  3G4V A;  3A0G B;  4YJJ B;  1I7Y A;  4ETT A;  2QLS A;  2I88 A;  2SPO A;  2ZS0 B;  3ONZ A;  1A87 A;  1ALL A;  1OFJ A;  3E4N A;  3WFT A;  2QLS B;  1MYM A;  1MGN A;  2O5B X;  4OF9 A;  5JDO D;  5EE4 C;  2D2M D;  4BJU A;  2AUP A;  1RVW B;  3D1A A;  1MBA A;  1NZ3 A;  3H58 A;  2R80 B;  1Y0D B;  1FCS A;  1QPW A;  4LMS B;  5CN7 A;  2DHB B;  1MTJ A;  1UIW A;  3HYU B;  1GJN A;  4YU3 A;  1Y8I B;  1VHB A;  1NZ4 A;  4XS0 B;  3HEO A;  4A8O A;  106M A;  1XZ7 A;  2QMB B;  1LH2 A;  2XYK A;  105M A;  2W6V B;  1XZV A;  2D2N B;  1MNH A;  1A6K A;  1YEQ B;  3MKB B;  3BRP A;  1XZ4 B;  2R4X A;  2ZLW A;  2VHB A;  1CIK A;  2H8F B;  4FC3 A;  1X9F D;  1ECA A;  4HBI A;  3UHR A;  4GXE A;  1Y8K A;  2Z85 A;  1MDN A;  1X9F B;  4MQK A;  3A59 A;  1UFP A;  1S5X A;  1DXU B;  1Y8K B;  3V57 A;  3PIA A;  2UUL A;  1G09 A;  1B0B A;  1OUU B;  3SZK A;  3ZH0 A;  1GDJ A;  1O1J B;  2UUL B;  2W6X A;  2BKM A;  3GKV A;  1Y0W B;  1W92 A;  1YGD B;  2DN3 A;  1DXV A;  2W72 C;  3TM3 A;  1O1I A;  1VXH A;  2MGK A;  1MOA A;  2ZLT A;  4Z8K A;  1LFY B;  2HHD A;  2GTL C;  2V1K A;  1JY7 B;  5C6Y A;  1HGB A;  1LIA B;  1MNJ A;  4N7O A;  1JBO B;  5JDO F;  4GZG A;  3IC2 A;  2GNW A;  2FRK X;  2SPM A;  1J41 B;  1J7S A;  1Y4P B;  1VXF A;  5HAV A;  4OOD A;  102M A;  3R5I A;  4U8U A;  1MBD A;  1PHN A;  2WY4 A;  1IWH A;  3WCW A;  4AE1 A;  1GDL A;  1PHN B;  3V58 A;  2VYZ A;  1YE0 A;  2FAM A;  2UUM X;  1SWM A;  1YEN B;  2GL3 A;  5EE4 D;  1MYH A;  3V58 B;  2Z6N A;  1HA7 A;  1GCW B;  1G0B A;  1V4U B;  2XKI A;  1QXD B;  2C7J B;  1J7Y A;  2VLZ A;  2VJR B;  4IRO A;  1MBN A;  1GCW A;  2H8D A;  5D1V A;  1YEV B;  2VJR A;  3K8B B;  4IRO B;  1UIW B;  2X49 A;  2ZST A;  1V4X A;  1YVT A;  2MBW A;  1YEV A;  1HBA B;  1FLP A;  2W6W A;  1XZ7 B;  1LFZ A;  5CHR A;  3PMC A;  4GY3 A;  3VHB A;  3QJC A;  1VXD A;  1LH5 A;  2LH7 A;  1JZK A;  2V8A B;  1C40 A;  3UHT A;  2UUM A;  1TES A;  5ILM A;  1G0A B;  2MGM A;  2O5T X;  2XKH A;  1CH2 A;  1ECD A;  4ODC B;  2C7L B;  1A0U B;  2DC3 A;  1SDK A;  4MBN A;  2UUM B;  1LFT A;  2BMM A;  2ZS1 C;  1B8D B;  3WCU A;  3WCV B;  1ON7 A;  2W72 B;  4FWX A;  3M3B A;  1R1Y A;  1GBU A;  1BZZ B;  3AT5 A;  2Z8A A;  1B8D A;  1N9F A;  4A8Y A;  1GH0 A;  4MQJ B;  3SDN A;  3VNC A;  4AVE A;  1JP9 A;  3DHT B;  2UUN D;  2ZSQ A;  4L2M A;  1Y0T A;  5E83 B;  1HBH B;  1SHR B;  1Y45 A;  1NAZ A;  1O1J A;  3GYS A;  1HBS B;  2BLI A;  3EU1 A;  1Y5K B;  4FWZ A;  1CH3 A;  3AQ7 A;  3GK9 A;  1CH4 A;  1FAW B;  1HDB A;  1KD2 B;  1DO4 A;  2SPL A;  1O1K B;  1Y5K A;  3AT6 B;  3QZX A;  1J3Y A;  1HHS A;  1U7R A;  1LIA A;  2QSS A;  1KTP A;  4X0L B;  1DUK A;  1Y83 A;  4NK2 A;  4KJT A;  2DN2 A;  2GNV A;  3UI0 A;  5B84 A;  1A9W A;  2ZSN A;  1RQ4 A;  4H0M B;  2RI4 A;  1AJ9 B;  1XF6 C;  3RJ6 A;  1CPC B;  3ORD A;  3CIU A;  2RI4 B;  3MYN A;  3TLD A;  4N6S A;  1CBM A;  4DWU A;  2WCR A;  1YCB A;  108M A;  3ZJJ A;  1CO8 A;  1HLM A;  4MQH A;  1GZX A;  4ILZ A;  5B85 A;  3NL7 B;  4LPI A;  2R50 A;  3GUQ A;  3WCV D;  3UHN A;  3OJ1 A;  3D4X B;  3K9Z A;  1RPS B;  5EET A;  1Y22 B;  1O1N B;  3WFX A; 
#chains in the Genus database with same CATH homology
 4KN3 A;  1MLR A;  4G1V A;  1OFK A;  3EDB A;  3HF4 A;  1Y85 A;  4MQG B;  3WCT D;  5SW7 A;  2H8D B;  2NSR A;  1XY0 B;  3GQG B;  1Y7C B;  4L7Y A;  2G0S A;  2G0R A;  5F2A A;  3ZHW A;  3WI8 A;  1A6M A;  1X9F C;  1XZ5 A;  2D2M B;  2OIF A;  3PI2 A;  1Y7Z A;  1HGC A;  1Y7G A;  3D7O A;  2D2M A;  2YRS B;  3BCQ A;  1YIH A;  1XZV B;  1A4F A;  3VRE A;  1HV4 A;  2GRF A;  5EQM A;  1YGF A;  1ECO A;  1XZ4 A;  1MLH A;  2YRS A;  2AUR A;  6HBW B;  3ZJL A;  1DXT B;  3W4U B;  2LH3 A;  1Y4R A;  1MNI A;  2V1I A;  3QJE A;  4H07 A;  3OZU A;  6HBW A;  4MQJ A;  2BLH A;  2VRY A;  4NS2 A;  1X9F A;  1URV A;  1GLI A;  2HBF A;  1HGA A;  2ZLU B;  5AB8 A;  3G53 A;  3ODQ B;  3DHR B;  5KER A;  1NZ2 A;  3S48 C;  3AQ6 A;  3GKV B;  1FDH G;  3ODQ A;  3R0G A;  4WJG 1;  1O1L B;  2ZLX A;  3VRF A;  2ZSR A;  1MKO B;  2MYD A;  1MBO A;  1Y0A B;  1IRD B;  1XZU A;  5JOM A;  2AV3 A;  1HCO B;  1GVH A;  5CN4 A;  1DXD A;  1NZ5 A;  1HBG A;  1A01 B;  1V4W A;  1V75 A;  2O5L X;  3IC2 B;  3E5O A;  1XQ5 A;  1S0H A;  1DLW A;  1HCO A;  2H35 A;  3A5B A;  3UBV A;  1JDO A;  1MZ0 A;  2MHB A;  1S0H B;  1MLU A;  2C0K A;  2MGC A;  3HHB A;  2FRI X;  1M9P B;  1YE2 A;  5CND A;  1AZI A;  3UHS A;  1XCH A;  3D4X A;  1MLM A;  1BZ1 A;  2PGH A;  3RGK A;  4UIQ A;  5CNG A;  3QM5 A;  4HRT A;  4ROL A;  1QSH B;  1HAB A;  1MOC A;  2Z6N B;  1NS9 A;  2QSP A;  3HXN B;  3WHM A;  2PEG B;  3QQR A;  3FS4 A;  3EDA A;  2NSS A;  2DN1 A;  1J7Y B;  1B86 A;  2EF2 A;  1X3K A;  2D2N C;  1DO1 A;  1J40 A;  2R1H B;  3QM6 A;  1YOI A;  1CBL A;  1F5O A;  3BA2 A;  1V4X B;  3S66 A;  1DKE A;  1HAC B;  5KDQ A;  4O35 A;  3KUO A;  1Y31 A;  1Y4B A;  1DKE B;  2ZFO A;  1YIH B;  5KDQ B;  1MWD A;  1N9X A;  2MGI A;  3ASE A;  3MJP B;  1Y31 B;  3OO5 A;  2V1G A;  3ZJQ A;  1OR4 A;  4ODC A;  2HBG A;  1Y7D A;  5CHQ A;  4NXA A;  2H8F A;  2AV0 A;  5JGG A;  1Y2Z A;  3MN0 A;  1HDS B;  1EMY A;  1HGA B;  3FH9 B;  3RJN B;  2OLP A;  2VYW A;  2ZLU A;  3O89 A;  1Y46 A;  1ASH A;  2MGD A;  3BJ2 B;  1DXU A;  4XS0 A;  1K1K B;  3GYS B;  2QMB A;  1UMO A;  1IT3 A;  1YIE B;  1YG5 B;  1QSI A;  1I3D A;  3ZJO A;  1BBB A;  1RTE A;  1MKO A;  1JF3 A;  1A3N A;  2G10 A;  2LH6 A;  1YIE A;  3AT6 A;  1YHR B;  2DN3 B;  2BLJ M;  1A3O A;  2RAO B;  4HSX A;  5EV5 A;  2ZLT B;  4U8U D;  2G0X A;  1GDI A;  1C7D B;  4HRR A;  1GBV A;  1JP8 A;  3UHQ A;  1MLS A;  2MHB B;  1HHO A;  1YZI B;  1UFJ A;  2FRJ X;  2JHO A;  1YEU B;  3PI8 B;  4MQI B;  2HBE A;  3HHB B;  2WTG A;  1EBT A;  2GDM A;  3VAU A;  1YHE A;  2HBC B;  1OUT B;  3UHH A;  1J3F A;  3NMM B;  1COH A;  5E6E B;  4ESA B;  4WCH D;  1S69 A;  1O1I B;  1HAB B;  3EOK B;  1YOH A;  3WHM B;  1EW6 A;  3QM8 A;  1HBB B;  2Z6T A;  2HBS B;  2AUO A;  3WCU D;  2HHE B;  1G0B B;  1Y0C A;  1AJH A;  1C7C A;  1MTI A;  3DUT A;  5CNE A;  1Y01 B;  3GQG A;  4FH7 A;  1YDZ A;  3AQ5 A;  1BJE A;  1Y7C A;  2R4W A;  1Y0C B;  1RTX A;  1CG5 A;  3HC9 A;  5CN9 A;  1GCV B;  1VWT A;  1K0Y A;  3R5I B;  1CH9 A;  1CP5 A;  3K8B A;  4N7P B;  3BOM A;  1Y7G B;  5C6E B;  1VRF A;  4G1B A;  1BZR A;  2G0V A;  1KR7 A;  4N7N A;  5HY8 A;  1HDA B;  1DO7 A;  2GTL A;  1HV4 B;  1O1O B;  2QU0 B;  1JZM A;  3S65 B;  1CQ2 A;  1CLS A;  1SDK B;  3PI3 A;  1MLK A;  2QU0 A;  2NX0 A;  3WCP B;  1Y4Q A;  2OHA A;  2ZT1 A;  1RQ3 A;  3WFU A;  3LQD A;  1ABY B;  1NQP B;  4H2L A;  2LH1 A;  3UHE A;  3D1A B;  2AA1 A;  1O1M A;  2BW9 M;  1MBI A;  1K1K A;  3MYM A;  3HYU A;  1DTM A;  2M6Z B;  1JF4 A;  4XDI A;  4PQC A;  1Y45 B;  2D5X A;  4MXK A;  3OVU C;  5JDO C;  1A0U A;  1JWN A;  1ABW A;  1H1X A;  1MYF A;  1WVP A;  4F6D A;  1Y4V A;  3ARL A;  1N9H A;  3HEN A;  1PMB A;  1MTK A;  3K3U A;  4MBA A;  2MGH A;  3UHI A;  2HBE B;  1UX9 A;  1WMU A;  1YMA A;  4YU3 B;  1FSL A;  1LUE A;  4JAC A;  2G11 A;  1S5X B;  3UHK A;  1OUT A;  1Y0T B;  5E83 A;  1SHR A;  1J7W B;  1YE2 B;  1G09 B;  3NG6 B;  1HBS A;  2W6V A;  4QAU A;  4PQ6 A;  1MLO A;  2MGG A;  5CNC A;  5KKK A;  1HBI A;  2HCO B;  5JDO E;  1LH7 A;  4F69 A;  1UVX A;  1Y4G B;  2HBS A;  2ZT4 A;  1HGB B;  3UGY A;  1LJW B;  2EVK A;  3DUT B;  3ARK A;  6HBI A;  4ZVB A;  3KMF A;  4VHB A;  3ZJH A;  1L2K A;  1AJ9 A;  2OHB A;  2R1H A;  3ZJN A;  1SDL A;  2R4Z A;  4O4Z A;  1FHJ B;  5AZQ A;  3AQ9 A;  3GQR B;  2DXM B;  1NIH B;  1BAB B;  1Y4B B;  111M A;  2IG3 A;  1Y7Z B;  4IT8 A;  2HZ3 A;  1WLA A;  1TU9 A;  2GTL B;  1DLY A;  3BJ1 B;  3ZJS A;  1NPF A;  4F4O A;  1VXA A;  3OO5 B;  3QZZ A;  2ZT0 A;  4N8T B;  3A0G A;  2MYA A;  3WFW A;  2ZS1 A;  3WCU C;  3A5A A;  1LFL B;  3S1I A;  3ONZ B;  2HHB A;  3QMA A;  3UH6 A;  3IC0 A;  1XYE B;  3IA3 B;  4C44 A;  4NK1 A;  1OR6 A;  4U8U B;  3IC0 B;  2MGJ A;  2LHB A;  1NS6 B;  1Y46 B;  1QPW B;  2HZ2 A;  5HLQ A;  2MGA A;  3GDJ A;  1A4F B;  3VRE B;  1ABW B;  1YGF B;  1A3N B;  1G0A A;  1Y4V B;  1O1L A;  1DXT A;  3VRF B;  3UHZ A;  4F6G A;  5CN6 A;  2QFK A;  1OJ6 A;  1FSX B;  3PI9 B;  1XZ2 A;  1IBE B;  4F6B A;  2EKU A;  2VLY A;  2HBF B;  3ZJM A;  5CN8 A;  4MQC A;  1MNO A;  104M A;  1D8U A;  1OBM A;  5ILP A;  4MQC B;  1LA6 B;  2MGE A;  3UHD A;  3NMM A;  1S6A A;  2ZS1 D;  2ZT3 A;  3V2V A;  4F6F A;  2ZLW B;  2IN4 A;  2ZLV A;  4UUR A;  1KD2 A;  3P5Q B;  2W6Y A;  1QSH A;  2LH5 A;  1A01 A;  1Y8W A;  2NRL A;  2G3H A;  3S1J A;  2GRH A;  3WCW D;  3A59 B;  2CMM A;  3TM9 A;  1B86 B;  5HLU A;  4M4B B;  3D17 A;  5HBI A;  1MBC A;  3PIA B;  1YEO A;  1ECN A;  3SDH A;  1H97 A;  1MLF A;  2ZSZ A;  4ZVA A;  4PNJ A;  3BJ1 A;  1MLJ A;  1CH1 A;  4MQH B;  3GOU A;  4MPM A;  5ILR A;  4N8T A;  1RPS A;  1NPG A;  4B3W A;  5EOH A;  1Z8U B;  2DN2 B;  1YH9 A;  1JZL A;  2ZFO D;  1SPG A;  1Y7D B;  1S5Y A;  2GKN A;  1DUO A;  2MYE A;  3WCP A;  1Y85 B;  2O5O X;  3GQP B;  1BIJ B;  1G9V A;  3GLN A;  4H2L B;  1Y5J B;  4H0B A;  1NS6 A;  1O1M B;  3S66 B;  1HAC A;  3NL7 A;  5D5R A;  4HHB B;  3PEL A;  2ZFB A;  1SI4 A;  1N9I A;  4PQB A;  4HHB A;  5E29 A;  2ZFB B;  3LHB A;  1DXC A;  2VEB A;  4MQG A;  2ZSS A;  5AZR A;  5SW7 B;  1CIO A;  5JGG B;  2O58 X;  1CP0 A;  3G52 A;  4C0N A;  2W72 A;  3HEP A;  1GBV B;  3FH9 A;  3G4U A;  3UHC A;  1URY A;  1UC3 A;  1YCA A;  2GRZ A;  3NFE B;  1NEJ B;  5EYJ A;  4MAX A;  4NI0 A;  4F6J A;  3D7O B;  1UX8 A;  1J7W A;  4MQK B;  1NGK A;  1YG5 A;  1BBB B;  2ZLV B;  2BK9 A;  4NI1 A;  1MLL A;  3A9M A;  3KMF C;  5E6E A;  1JEB A;  3B75 B;  3GKT A;  1JP6 A;  2D60 A;  3QQQ A;  1YGD A;  1VRE A;  3AT5 B;  1Y5F A;  4SDH A;  3QJD A;  2D60 B;  1JY7 A;  1J3Z A;  1LHS A;  1MLQ A;  3D17 B;  3MJU A;  1YEO B;  4FH6 A;  1LFV B;  2E2Y A;  3OO4 A;  1M6M A;  1UVY A;  3PT7 B;  1HBH A;  2GKM A;  1FDH A;  5EUI A;  4YU4 B;  1LFV A;  1ABS A;  1OUU A;  3PT7 A;  3GOU B;  1HDB B;  5EU2 A;  1VXC A;  1A6N A;  4F4O B;  3CY5 A;  3G4Q A;  1SPE A;  3VRG B;  2ZS1 B;  3ECL A;  1MYJ A;  3WR1 B;  1U7S A;  3S65 A;  1CG8 A;  1C7C B;  1CLS B;  1CPW A;  1S56 A;  2D2N D;  3LR7 A;  1XYE A;  3WR1 A;  3QJB B;  1JPB A;  2ZSP A;  1Y09 A;  3NML A;  2MYB A;  1RQ3 B;  3OZV A;  3PI4 A;  1X46 A;  1K0Y B;  4MXL A;  3QJB A;  4NXC A;  1F63 A;  2AA1 B;  1YHU D;  4HSW A;  2ZSX A;  3GDJ B;  1YVT B;  1EBC A;  1HGC B;  1BUW B;  3UHW A;  1NS9 B;  1YE0 B;  1O1O A;  1RQA B;  4G51 A;  2MGF A;  4KMV A;  1BUW A;  4G51 B;  3LB2 A;  1QI8 A;  1IDR A;  1Y4Q B;  3IXF A;  5M3S A;  1QI8 B;  4TYX A;  3WCU B;  1CMY B;  1NEJ A;  4KMW A;  4NI0 B;  1BZZ A;  3QM7 A;  1BVD A;  1GLI B;  3A5G A;  1ITH A;  2LH2 A;  4U8U C;  1LA6 A;  2VEE A;  1XXT A;  2ZFO C;  4NI1 B;  2D5Z A;  1MLN A;  1QSI B;  1LH6 A;  1C40 B;  3OZW A;  1JEB B;  1XXT B;  1EWA A;  3P5Q A;  2D5Z B;  1DO3 A;  2ZLX B;  1Y4G A;  3WCV A;  1FAW A;  1Y8W B;  4FC3 B;  1J3Y B;  1DTI A;  3AG0 A;  1RVW A;  112M A;  4TWU A;  1LJW A;  3E55 A;  3BJ2 A;  1Y0D A;  1BVC A;  2VLX A;  3KUN A;  3WCW C;  1CQX A;  1FN3 B;  1SDL B;  1Y8I A;  3ZJP A;  4TWV A;  2GTL D;  1GDK A;  2RAO A;  1COH B;  1YEQ A;  3MKB A;  1BZ6 A;  1IRC A;  1JW8 A;  2ZT2 A;  2B7H A;  2HHD B;  3UHB A;  1V4W B;  1SPG B;  3M3A A;  1HHO B;  3ZJR A;  3PI1 A;  4M4A B;  1LFQ B;  1MLG A;  1BZ0 B;  3HRW B;  1KFR A;  1LH1 A;  1Y4F A;  2DN1 B;  4AVD A;  1LFQ A;  3UH7 A;  1R1X A;  1CH5 A;  1T1N B;  3UHG A;  1YDZ B;  5HLX A;  2EKT A;  1FHJ A;  109M A;  4BJA A;  1Y4P A;  1NIH A;  1R1X B;  1O1P B;  1A9W E;  1V5H A;  3CIU B;  3E5I A;  4ROM B;  3MVC A;  1MYZ A;  1Y0W A;  4O2G A;  1SI4 B;  5C6E A;  1Y8H A;  1MYI A;  1YVQ B;  2HZ1 A;  5E29 B;  4ROL B;  2V1E A;  1LFY A;  103M A;  1MOD A;  2HHE A;  3G46 A;  3MJP A;  2EB8 A;  1Y8H B;  3ZOM A;  5MBA A;  2PEG A;  3BCQ B;  4N7O B;  3H57 A;  1I3E A;  3U3E A;  3UHX A;  1A6G A;  2HHB B;  1O16 A;  2FAL A;  1YHU C;  3M38 A;  1LTW A;  1J40 B;  4DWT A;  1J7S B;  3WCT B;  1IBE A;  1ABY A;  4L7Y B;  3MOU A;  4N7P A;  2AUQ A;  1F5P A;  1XZ5 B;  2MGL A;  3ZOL A;  1F65 A;  1IWH B;  2OH9 A;  1IOP A;  1HBA A;  4B4Y A;  3UHY A;  3WCW B;  1HBR A;  1A00 B;  1MOH A;  3LR9 A;  3PT8 A;  2HBD B;  5EYS A;  1HSY A;  1YEN A;  2ZWJ A;  1A00 A;  5F0B A;  1QXE B;  2HBD A;  5IKS A;  110M A;  1VXB A;  1YMC A;  1QXD A;  3G4R A;  1FSX A;  1NQP A;  1A3O B;  1LFT B;  1QXE A;  1XZ2 B;  3MBA A;  3D1K A;  3QJE B;  1IRD A;  1R1Y B;  1HLB A;  1UT0 A;  2OH8 A;  1C7D A;  1WMU B;  4F6I A;  3WCT C;  1MOB A;  2R80 A;  1XQ5 B;  2M6Z A;  3OO4 B;  4DC7 A;  1LFZ B;  5CN5 A;  4YU4 A;  4NZI A;  2G12 A;  1LH3 A;  1CO9 A;  3QJC B;  1Y35 B;  5KER B;  1BIN A;  3EU1 B;  1VXG A;  2QRW A;  2D2M C;  2D6C A;  3WTG B;  3ECZ A;  2HCO A;  1THB A;  4O4T A;  2B7H B;  3UGZ A;  1XZU B;  1YOG A;  2SPN A;  2MGB A;  3VRG A;  3WTG A;  2QSS B;  4HRR B;  1BZ1 B;  4X0L A;  1GBU B;  2ZS0 D;  3HRW A;  1V75 B;  1Y83 B;  3OGB A;  1HBB A;  1S5Y B;  2EVP A;  3GQP A;  5CNF A;  3UBC A;  1LHT A;  3NG6 A;  2HBC A;  4DC8 A;  1YFF A;  1CG5 B;  3WCV C;  4ROM A;  1NWN A;  2DXM A;  1GCV A;  4WJG A;  1RSE A;  3UH3 A;  1GZX B;  3G4Y A;  4FWY A;  1DXV B;  1RQA A;  1MWB A;  3DR9 A;  5MBN A;  4O1T A;  2ZFO B;  1NXF A;  2MB5 A;  5HY8 B;  1Y22 A;  4N7N B;  2QSP B;  3HXN A;  1JL6 A;  3M39 A;  1BIJ A;  1G9V B;  1CH7 A;  1S61 A;  3WCT A;  5CNB A;  5HU6 B;  1HJT A;  2ZSO A;  1Y5J A;  2BNL A;  1XY0 A;  1VWT B;  2WTH A;  3UHV A;  5HU6 A;  2GLN A;  1Y2Z B;  3NFE A;  3LB1 A;  3PEL B;  1Q1F A;  1HDS A;  1V9Q A;  1HBR B;  2G0Z A;  3ECX A;  3QM9 A;  2O5M X;  1HDA A;  1O1N A;  107M A;  1JL7 A;  1V07 A;  1VXE A;  3HF4 B;  4JYQ A;  3D1K B;  3B75 A;  1A0Z A;  1V4U A;  1M6C A;  5ILE A;  3W4U A;  1Y5F B;  3UHU A;  1A0Z B;  3O7N A;  2NRM A;  1YMB A;  1YHU B;  3MJU B;  1FN3 A;  1G08 B;  1YZI A;  1DWR A;  1MCY A;  2DHB A;  5EUI B;  1YHU A;  3OK5 A;  1Y35 A;  2D5X B;  1G08 A;  3UH5 A;  3DHR A;  3ZJI A;  2XKG A;  1THB B;  3ARJ A;  4F68 A;  101M A;  1YHR A;  2EB9 A;  2D2N A;  3LB4 A;  2V1F A;  3PI9 A;  3CY5 B;  1Y4R B;  2VM0 A;  2VYY A;  1IT2 A;  3QJD B;  4M4A A;  1J3Z B;  1BZ0 A;  1CG8 B;  2O5S X;  1Y4F B;  1C7B B;  1T1N A;  4M4B A;  1YEU A;  3PI8 A;  4MQI A;  1NWI A;  1Y09 B;  7HBI A;  1YFF B;  2V1J A;  3DHT A;  1MWC A;  1MBS A;  1C7B A;  1YHE B;  1O1P A;  2BWH A;  3AQ8 A;  2QFN A;  1M9P A;  2MYC A;  3ED9 A;  1HRM A;  3GQR A;  1BAB A;  1J52 A;  3LB3 A;  4ESA A;  3SZK B;  1YVQ A;  1MNK A;  2V1H A;  5CMV A;  4MU5 A;  2FRF A;  3EOK A;  3BOM B;  1O1K A;  2W31 A;  1Y0A A;  4HRT B;  2ZS0 C;  1PBX B;  4UZV A;  2KSC A;  1BZP A;  1AJG A;  2H35 B;  1LFL A;  3FS4 B;  1MYT A;  3V2Z A;  2Z6S A;  1DWT A;  1RQ4 B;  1PBX A;  1DM1 A;  2R4Y A;  1CMY A;  2G14 A;  1J41 A;  3G4W A;  3BJ3 B;  3LQD B;  2O5Q X;  3A2G A;  3BJ3 A;  2ZSY A;  1MYG A;  1DWS A;  1YH9 B;  2PGH B;  3PT8 B;  2ZS0 A;  3G4V A;  3A0G B;  2QLS A;  2SPO A;  2ZS0 B;  3ONZ A;  1OFJ A;  3WFT A;  3E4N A;  2QLS B;  1MYM A;  1MGN A;  2O5B X;  4OF9 A;  5JDO D;  5EE4 C;  2D2M D;  2AUP A;  1RVW B;  3D1A A;  1MBA A;  1NZ3 A;  3H58 A;  2R80 B;  1Y0D B;  1FCS A;  1QPW A;  5CN7 A;  2DHB B;  1MTJ A;  1UIW A;  3HYU B;  1GJN A;  4YU3 A;  1Y8I B;  1VHB A;  1NZ4 A;  4XS0 B;  3HEO A;  106M A;  1XZ7 A;  2QMB B;  1LH2 A;  2XYK A;  105M A;  2W6V B;  1XZV A;  2D2N B;  1MNH A;  1A6K A;  1YEQ B;  3MKB B;  1XZ4 B;  2R4X A;  2ZLW A;  2VHB A;  1CIK A;  2H8F B;  4FC3 A;  1X9F D;  1ECA A;  4HBI A;  3UHR A;  1Y8K A;  2Z85 A;  1MDN A;  1X9F B;  4MQK A;  3A59 A;  1UFP A;  1S5X A;  1DXU B;  1Y8K B;  3PIA A;  1G09 A;  1B0B A;  1OUU B;  3SZK A;  3ZH0 A;  1GDJ A;  1O1J B;  2W6X A;  2BKM A;  3GKV A;  1Y0W B;  1W92 A;  1YGD B;  2DN3 A;  1DXV A;  2W72 C;  3TM3 A;  1O1I A;  1VXH A;  2MGK A;  1MOA A;  2ZLT A;  1LFY B;  2HHD A;  2GTL C;  2V1K A;  1JY7 B;  5C6Y A;  1HGB A;  1MNJ A;  4N7O A;  5JDO F;  4GZG A;  3IC2 A;  2GNW A;  2FRK X;  2SPM A;  1J41 B;  1J7S A;  1Y4P B;  1VXF A;  5HAV A;  4OOD A;  102M A;  3R5I A;  4U8U A;  1MBD A;  2WY4 A;  1IWH A;  3WCW A;  1GDL A;  2VYZ A;  1YE0 A;  2FAM A;  1SWM A;  1YEN B;  2GL3 A;  5EE4 D;  1MYH A;  2Z6N A;  1GCW B;  1G0B A;  1V4U B;  2XKI A;  1QXD B;  1J7Y A;  2VLZ A;  4IRO A;  1MBN A;  1GCW A;  2H8D A;  5D1V A;  1YEV B;  4IRO B;  3K8B B;  1UIW B;  2ZST A;  1V4X A;  1YVT A;  2MBW A;  1YEV A;  1HBA B;  1FLP A;  2W6W A;  1XZ7 B;  1LFZ A;  5CHR A;  3VHB A;  1VXD A;  3QJC A;  1LH5 A;  2LH7 A;  1JZK A;  1C40 A;  3UHT A;  1TES A;  5ILM A;  1G0A B;  2MGM A;  2O5T X;  2XKH A;  1CH2 A;  1ECD A;  4ODC B;  1A0U B;  2DC3 A;  1SDK A;  4MBN A;  1LFT A;  2BMM A;  2ZS1 C;  3WCU A;  3WCV B;  2W72 B;  4FWX A;  3M3B A;  1R1Y A;  1GBU A;  1BZZ B;  3AT5 A;  2Z8A A;  1N9F A;  4MQJ B;  3SDN A;  4AVE A;  1JP9 A;  3DHT B;  2ZSQ A;  4L2M A;  5E83 B;  1Y0T A;  1HBH B;  1SHR B;  1Y45 A;  1NAZ A;  1O1J A;  3GYS A;  1HBS B;  2BLI A;  3EU1 A;  1Y5K B;  4FWZ A;  1CH3 A;  3AQ7 A;  3GK9 A;  1CH4 A;  1FAW B;  1HDB A;  1KD2 B;  1DO4 A;  2SPL A;  1O1K B;  1Y5K A;  3AT6 B;  3QZX A;  1J3Y A;  1U7R A;  2QSS A;  4X0L B;  1DUK A;  1Y83 A;  4NK2 A;  4KJT A;  2DN2 A;  2GNV A;  3UI0 A;  5B84 A;  1A9W A;  2ZSN A;  1RQ4 A;  2RI4 A;  1AJ9 B;  3RJ6 A;  3ORD A;  3CIU A;  2RI4 B;  3MYN A;  3TLD A;  1CBM A;  4DWU A;  1YCB A;  108M A;  3ZJJ A;  1CO8 A;  1HLM A;  4MQH A;  1GZX A;  4ILZ A;  5B85 A;  3NL7 B;  4LPI A;  2R50 A;  3WCV D;  3UHN A;  3OJ1 A;  3D4X B;  3K9Z A;  1RPS B;  5EET A;  1Y22 B;  1O1N B;  3WFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...