5JHDD

Crystal structure of ls10-tcr/m1-hla-a*02 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
206
structure length
201
Chain Sequence
TVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAWGVNAGGTSYGKLTFGQGTILTVHPNIQNPDPAVYQLRDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broad TCR repertoire and diverse structural solutions for recognition of an immunodominant CD8(+) T cell epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 33
structure length 201
sequence length 206
chains with identical sequence I
ec nomenclature
pdb deposition date 2016-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhdD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jhdD01
4YWGH 4JFPB 1IJ9A 3B43A 4FQCH 1IQWH 3OR7A 4U1HB 1HXMB 1MJ8L 1QVOB 1N59B 3ARBC 3H8NA 1KB9J 4M5ZL 5C71A 2X4RA 3BN9C 4PR5A 2AJUL 3FQRB 1L6ZA 2JJTA 3I02B 2EDRA 5JDSA 3D0LA 1NCCL 2GQHA 3FFCB 1U3HD 5FKPA 3U82B 1I3GH 4YGVA 5B22A 3CVIH 1TDQA 3AAZB 3BDBA 4D9LL 5C3LD 4LSVH 1VFBA 4HZLA 1BOGB 3B5HA 1AGFB 3EGSB 1A9EB 1UYWL 1TQCC 3QDMB 3JTTB 3GMNA 4DKDC 1FQ9C 5F72S 4HKJB 3SDCB 2HFEA 5SWSB 4KAQH 2AJ3B 4FFVC 3VRIA 4M3KB 5F7DB 4RGOH 5EOCJ 4ZFZB 3U7AA 1V3MA 4M93C 3BH9B 4LLYA 5KVDH 4TRPL 2Q7NA 4PD4K 4R26H 4XCYB 2ITDB 3ZMRA 5A1AA 3TVMC 3V4PH 1WISA 3ARYA 5FCSH 1J9CT 1JGUH 5CAYB 1TTFA 5FYKH 1A5FL 1C5DB 2O5YL 4JG0H 3NPSB 3MLRL 3K1KC 3L95B 1KIRB 4K3EL 3TO2A 4YHLL 1MWAH 1DEDA 1CD1B 1OY3B 2EDQA 3P4OB 5MI0C 1TZGH 1T22A 4UILL 1R3LB 3UTPE 3OR6B 3VXTA 1LO3H 1MVFA 1MHCA 3D2UA 1YMMB 5BVPH 2Q76B 1INEH 4ZO9A 4LMQE 1VPOL 1WVZA 5CMAB 4PRIB 3B9KA 3CC5B 4FS0A 4NFDA 5IFAH 3AAZA 1OP5H 1ZAGA 2YRLA 4M1DH 4K55A 4U3CA 1AP2B 1MAML 1MH5B 3ARGC 5EU7E 4GH7B 5D7JD 1JN6B 4NRYA 3FTGA 4XPAL 2RFXB 1ZWIB 3ILQC 4BKLB 1UEMA 2ZPKL 3CX2A 3QO0B 4AG4H 4NQVB 2EE3A 3MRHB 2OZ4A 1U8QB 1MLBB 3PWJA 1XGPB 4UI2A 4YXLL 1GC1H 4KZDL 1OGTB 1WBXB 4GG8A 5F6HJ 4D8PA 2BSRA 1NC2B 1I85A 3M17B 4JAMA 1HH9A 4RX4D 3MROB 4PY7A 2APBA 1NBYB 3AS3A 1CDBA 3RY4A 1TQBC 4RAUA 4K07A 4GT7A 1F97A 4WNQB 3RU8L 4NQED 5DGQA 4XCFL 1P4BL 3QXTA 4JFFE 3B5TA 2VZVA 4B7LA 5TH2B 4DKEL 3BP5B 3PDGA 1FHGA 1T5XB 3LH2H 4S10A 4PIRF 1LK3H 2C26A 3BKJL 2QQQA 1A22B 3EOAA 4M6OH 3SCMB 2VITB 4Y16A 2YSSB 3BOVA 5F3BA 5KSAA 3DX7A 3QUML 2EYTB 1TPXC 3EBAA 4PJ7A 5ITFB 3G5XB 3BGFB 3IVKA 3IFLL 3FB5A 1UB5B 5CBAB 5FHBH 2JCCA 2ICWJ 2JJUA 3BN3B 4NYLA 3T0EA 2JK5B 3ZT6A 5D1XA 3WJLA 1MLCA 3MA7B 5JOPE 2JCCF 2R2BA 2J8HA 4TSAH 4K23H 3PWLB 1S5IH 3RWGB 4TUKH 3RVUD 4YR6A 1CDJA 1MUJA 2BRRH 4CADA 3GB7A 5JW3L 1FZJB 4GRWB 3C5ZC 1JWSA 4XP6L 5A3IC 4ZPTB 1FL5B 1D5BA 4M43L 1YQ2A 1IC7H 1EFXB 4F57H 4KVNH 4YBLC 3TT3H 5FB8B 3MUJA 2C7UB 1X9QA 3UO1H 5EN2A 3VFMA 4JQIL 2Y6SD 2QTEA 2R2EB 2A6JB 1DQJB 4P46D 5CMAA 2JB6B 3S7GA 3V4UH 4CN6A 1YNLL 1RIVH 1K4CB 2J3SA 4Y16C 2FX9H 5EG6C 1H5BC 4OB5H 4DQOL 5A2FA 3AM8A 5C0AE 1J5OH 4NO0A 5AAMA 5H35A 2RCSL 2WLZA 2VDOH 4Y8AA 5FYLL 5BVJA 4XPGH 3W9DB 3CDGA 1IARB 3ZDXF 1OP3H 1CFVL 2YOCA 3E3QE 1C16B 4D0DA 1XF2B 3GUTB 4XNXH 4JKWA 4Z0BH 4NM4H 5DD1L 1UCTA 2L7JA 4NFCA 4OCRL 3EO1A 4YPGA 3RZCC 1U6AH 1AO7D 2QJDA 1WWWX 2HTLC 1R3JB 3NCFB 3O4LB 4MX7B 1ZE3C 4PBVC 4O2CB 4YGAB 1QR4A 5I8EA 5K9QI 1A6AB 1BFTA 1OTUD 3QPXL 2BC4B 3KPNB 4U33A 2YN3A 3CLFH 5C0EA 4WHDA 1JZ6A 5HVGB 5EA0L 4FQ1H 2F53D 3P0VH 3HG1A 1KCLA 1RUAL 3HR5B 4KPHL 2G9HB 3F6LA 4JFDD 4P49A 4Z5RA 1CLYL 1HWGB 3D85A 1IM3B 5FKAB 5KW9H 2CKNA 5DK2B 4WWID 3CH1A 4AEHH 3EOAB 3SCMA 1I8KA 3DECA 2YWYA 4J6RH 4UU9A 5DURD 4KROD 5GRJL 2DBJA 2WBJD 4PJCF 1S7XA 3BJLA 3ZKXC 3QRGH 1KCSL 3B5GA 3O8XA 3QHZH 3GKZA 4GG6F 4L5FH 2UVFA 3MJ9L 4QNPF 1FAIH 2CD0A 3VI3F 2A6IA 4H0HB 2XKSA 1CICD 2IQAB 2MJWA 3G9AB 1U8PA 4ZD3H 5FYLD 3HS0B 2ZJSH 3WNKA 3RTQB 1RZ8B 3U0PA 1RZ7H 1F5WA 3PV6B 4HMCA 1HXYA 4I18A 3MRGA 4K94L 4UV7H 2SEBB 2NX5E 5EU5A 1FO0H 1G9NL 5HHXH 4XWGL 3VGAB 5MEND 3HZKA 4HWZA 3BAEH 2UZIH 4PJ7E 4P5KB 3PF2A 2DQUL 2Q8AH 3TBVB 3F5WA 2JJSA 2QHRH 1YNTA 2A74B 4MAYB 3MRMA 1LO0H 1XIWA 1T6WA 5F7FA 1VEMA 5ITBL 4P9MH 1CDGA 3C08L 1S7UA 4RGNE 4BM7A 5CCKH 1BHGA 1INQA 3DRTB 4PRNA 4K71B 4LSSL 2UYLB 1B0GB 4PBXA 1HSAB 1U8JA 5GGRY 5L9DL 4NSKB 4XT1C 5KJRH 1OTSC 4FFYH 4FZ8L 2ICWA 1KN4H 1YEKH 4UU9B 2F58L 4Y2DA 4YFLI 2Y5TB 1NCTA 3PQYB 1M7DA 5HPMA 4NO5A 2YUZA 2IF7A 5DUBB 2R2HB 1YJDC 5C7XH 4U6HB 2X9YA 4J8RA 1S9YA 2X4QB 1OTUC 4KMLB 1T03L 1NEUA 4LVEA 1V7NL 5F44A 2NXZD 5E6YA 4G3YL 1JGVH 4QT5B 3SDXF 1VGKA 4K9EL 4KY1L 5B8CA 2P5WA 2C4XA 1P4LB 1NFDE 3DMMA 2AV7A 3KPOA 1SJHA 2V9RA 1YY9C 2Z92B 2HMID 2XOTA 5IW3A 3OKEA 1BGXL 4M5YL 1A7QH 4OLXH 4U1LB 5B39G 5HXMA 2K7PA 3F65A 2BJML 3TCLA 1FZKA 3DSNA 1NANH 1TMCB 5D96C 1DEEA 1S9VA 1HEZA 2DMBA 4L8SC 2JJWA 3WLBB 2GJ6E 1MFNA 1B6DA 2DJ4A 1R5WB 4EN3B 2EIZA 1AY1L 3RAJH 3MUGA 3RWCB 1J0JA 4NKOA 4XZUB 1RSFA 3A6BL 4QXUH 1S7VA 5GS1C 4O4YL 3V5KB 2EIEA 1IAIM 2GEEA 3U4AA 2HTKC 1A1NB 5D71H 2R0ZH 2HFFB 2JF1A 4FXKB 2B1AH 4LCYB 1UENA 1UM6H 5F7LB 4BJLA 1QR1B 3MRJB 1J8HD 3SOBL 2BY0A 5FIEA 5DDHA 4NRZA 4PP1C 3FQXA 4WI4A 4YIQA 1DFBL 2O26U 1JFQL 3HKFA 3VD7A 1CICB 4HWBH 2RAMA 5GQBA 4IMLB 1GOGA 2JELH 2DLHA 5GGTA 2QSCH 5DJ2A 4R3SB 3ARPA 3RWEB 3K2UH 5BMFL 1JV5A 1EPFA 1T04B 3RQ3A 3OKEB 4N9GA 3C60C 3HAEH 4UOJA 5E4EC 4OLEA 4PLOB 2W92A 1PY9A 3PGDB 5I75C 2MKWA 3H42L 4J3TA 3A6OA 1FVEB 1VEPA 4GG6E 1MVUA 4OLYH 1EJ6A 3RWDB 5HY9B 1HCFX 3U7WH 5F7DA 4PJHE 5LBSH 3G5ZB 3NFPB 1JPSH 3F62A 3NN8B 4PJCA 1QHOA 5C08E 4QXGH 4RMRA 1S7VB 2BNQD 1JJUA 4RQQA 1Q0YL 5DA4A 4A2MA 2AJUH 4CVZA 5HGDA 5EZLA 4QO1A 5FA3B 4W6XB 1ZLUH 1W0WA 1A1NA 4Q9QL 4JHWL 5CJ8A 4JFOB 3MLUH 3OKMB 5BS0B 1UYWH 4Z7QF 4BH8B 3VFWA 1AQDB 4N5ED 3STBA 4DGYH 1FVCA 4G8EB 4X6CE 1IC5L 4KK8C 1OAKL 4DUWA 3AC0A 3O3BB 1M05B 4K7PH 3QWRD 2NZ9D 2C5DC 3AGVA 4M1GL 2AVGA 3QCUH 5LAXB 5I8KH 1J1XH 3K2MC 2IBZX 1G6RA 5C0DA 4YDLB 3ZDXE 2D0HA 1T7VA 4MXWH 4RGND 3V4PL 4ODSH 1LO5B 4PJAA 1F6AB 4RNRB 2VXVH 3M07A 4KKLD 4LK4A 4K3DL 4XCCH 4GRLD 4ONFL 2X4SB 2DLIA 5GSRB 1G7QB 3LAFA 2H6PB 1RFDH 1EO8H 2GTWB 2IPKB 1LO3L 2A6KB 2NX5D 3P30L 1DSFL 3PWVA 1KB5H 1MJJB 3SDAA 1RVFH 3IS1X 1W0WB 3FT3A 4LMQI 4NQUA 2G5RA 3ULVD 4C4KT 5IP4A 1N5YL 1YMHB 1VFUA 1P5VA 3S36H 5HHMD 5EBLA 1HSBA 5C0BD 1N6QH 1MHCB 1HILA 1ZVYA 4Z7WA 4FFZL 4MCYA 3KPSB 4MMZC 2GFBB 3JWNC 4QHLA 1BJ8A 1SM3H 2FIKA 3RKDD 2XZZA 5I2IA 2QHLA 1X44A 1YC7A 1I8IA 3IFNL 3S3PA 1DL7H 3CVHB 5T3ZL 1G6RH 2NQCA 3BFOA 1RAMA 4NRYB 5C0CD 2R0WL 5FEBA 2DQHL 5HDQL 5D5MA 4B41A 3BSZH 3UPCA 1DN0B 3KAAA 1L7TH 2R39A 3DXAE 5JR1L 1RZFH 1A3LL 1TJHL 4WI3A 2JK5A 4X6FA 5HGDB 4OKDA 5ISZA 4HUVB 1A3QA 5T33H 4NZDA 1MEXH 3Q0HA 1BMGA 4FQXC 4U1KB 1P4BH 4JRXE 3IDIB 4Y5VC 5EU4A 3KVQA 2IPTL 1F2XK 2ZUVA 5K9OA 2NZ9C 4LCIL 5E5UB 5FECA 5E1HB 2APFA 1DLHA 4ZYKB 4L4TB 4YHKL 1T1XA 2GSGB 3MO1A 4G80A 4JFQA 3QQ9D 3HC3H 2NY6C 1IGFH 1YPZA 1EUTA 3O6LL 3L7FB 2YA1A 1AKJA 3VFRA 1SEQL 3MJ8B 3QEUB 1PD6A 4TSAL 5E8PA 3S88L 5I2IB 5EU3B 3HAEA 3TYFA 3DI2B 1I7RA 1KYOK 1LO5A 2GTZB 3RVVC 2XQBL 25C8H 4LF3B 5C07E 4KGJA 2Y4SA 4MJ6B 6FABL 4X6CA 2DLTA 4AJ0A 3MBXH 5JLZA 1ORQB 5DD3H 3EDJA 5T5FH 4LLYB 3QQ3B 4F57L 3MJ7A 3TT3L 2WK2A 3PWLA 1TZGL 3MA9L 1JP5A 1R5VB 1SMOA 5FAAA 1J1PH 3C6LC 3WFCL 3PWVB 4JEGB 4PRHA 1RMFH 1QLFA 1INEL 4JHAH 1RIHH 1YEFL 1YNLH 2H1PL 4RA0C 5IFHH 1Q9OA 1N0XH 2WP3O 3E2HB 1ZHKA 1CLOH 1FL6B 2N1KA 2VLKB 4P59H 3HMWL 3EYOA 2FDBP 3QUXC 5ID0B 2DYPB 1ZVHA 4L9LC 3DMMD 4BA8A 3H2WA 1H8SA 4IEFB 5BV7L 3ZHDA 1ERNA 1UZ6F 4RGMC 3D85B 1WFNA 5DK2A 4ELMB 5AYQA 1E6OL 5HYIA 5JZ7C 4AL8L 5ID1A 1FBIL 1I7RB 5FUZH 1RD6A 4E5XA 5AG9A 2ICES 3VA2C 3QDGA 1JN6A 1HQRB 5J12B 1CXKA 4PJFE 3LS5H 4JPVH 3BW9B 1QFWM 4JB9L 2Y36L 3GMMA 4MJ5B 5IVXF 4KPHH 3C2AL 3BZFA 4L8SA 4PRDA 3X13B 4M02A 3PWPD 4XPBH 5TE7H 2AJZA 5IWLC 1M7DB 1NBVH 4DKEH 5HPMB 4LDLB 1FPTH 1TVBA 4TUOB 1INDH 2B39A 1D5ZA 3GBMH 4X7CC 2EDDA 4U1JB 3ULUE 1IGTB 5E2UH 4IRJD 3EHBD 3VXTB 2FZ3A 1F11A 2AV1B 3X14B 2MQ3A 4ZUTB 5IVNA 1UACL 1UQSA 1DLFH 4I3GA 5D1ZB 1AGDA 4JJ5B 4XC1L 1QFWI 3DV4B 3WCYA 4OLUL 5C0IA 3I9GL 1JYWA 1XCTB 1YPZF 5CUSL 4XBEH 4U0QB 4RMQA 4OJFL 3TO4A 5GISH 5SWSD 3B8SA 5DYOA 4ZXBD 4HF5H 5CJQL 2CQVA 2IBBA 2Q8AL 3NIGF 5D72H 4LARH 4DTGH 1BEYL 3UTTB 4OV6F 1MLBA 3LZFL 5IBLD 1EZVY 1FC1A 5HYQB 2BDNL 4OZGE 5FO7B 4GQ9L 1RZIB 3EOYG 5SX5H 4TNVK 1JPST 3LEYL 1MCQA 1CL7H 2OL3A 3MRFA 3ZTJG 3QIUC 5DMGD 5BO1H 4X6DE 1EAPB 3JXAA 1GHFH 5DF0A 2RCSH 4NBYB 4QY8B 2IMMA 3VMNA 3MRJA 5IFJB 2Z9TA 4P57A 2FZ3B 5HI5C 2I5YH 3CZJA 2OTWA 4XPGL 1HSAA 4K3GA 3BP5A 3TESA 2HT4D 2BMKB 1E6JH 5L2KA 4XRCB 1N26A 3LKNB 4DFIA 2PTVA 4JN2B 5E5MA 1UZ8A 3P77A 1I7ZB 4Z77A 4Q0XH 1OW0C 1HI6A 3CAFA 4U1MA 5HYSA 4YDLC 1MCCA 4OZFB 3TZVB 3GSRB 5AD0A 4XVUD 5DJXA 5E4EB 1GAFH 2UY7A 1NGYB 3G6JE 4PJIF 5KSBB 2YUVA 3MRRB 1MCKA 1X7QA 4MA8H 2V5YA 2QADC 1Y6MR 2B1HL 2IAMD 2PW2A 3HRZB 1UWXH 3GSVA 3WFHA 1I1AC 1IAOB 4NCC1 4X98B 4QLRA 1I3RB 5FA4A 2M2DA 3WN5C 4N0UA 3WE6B 1BLNB 4GUPB 4HKBA 4H0IA 3VFNB 4P2OB 5F1NB 1B0RA 5EZLB 5FA3A 1MELA 1KCSH 4V2BA 2YUWA 4YUEL 2AI0H 4EOWL 4P4KC 1ZLSH 3T3PE 5C0FB 2OM5A 2FHBA 2R2EA 5CSBA 3D0VB 3DXAD 5D6CB 4KXZI 2NPLX 5I76B 2HT2C 5EU6B 3WFBH 5J56B 1IT9H 3PWUB 5D2LA 3ARUA 3S4SA 2FWOA 5IVZB 3TIEB 4UT9H 3QSKB 4XP4L 3WXWL 5I75B 5F6HI 4UUJA 4ZO6A 3LPWA 4AH2A 4P3DB 5IB2B 3V5HB 4MQTB 1DANU 1DDHB 3H9ZA 4PGBA 3HN3A 2X4OA 4WJ5B 4Y2DD 2BCKA 4XVTL 5ADPL 2GUOA 1KEGL 4JGMA 1QFPA 4BYHA 5B38G 1QZ1A 5I8EB 3IDJA 3P3YA 1UB6B 1MFDH 1IL1A 2VLMD 4GRWH 1NAKH 2WIIA 4P2RB 2R0LH 3O2DL 2ZUQB 3RVTC 4OZHA 4Q6IB 1QQDA 2ZKHL 3GMQA 5J6GA 4DAGL 2PO6C 5SX5K 5E8EA 2PO6A 4I1NB 5AEAA 2X4NA 3MUZ1 2CH8A 4QRUB 2WINA 3ZE2E 3V5DA 3WFDH 5DRXB 5CBEA 3UBXA 2CKBB 3BPCA 3G04B 3VG9B 4K7PX 4JHWH 1TFHA 3IB4A 3DHMA 3FT4A 1V7NH 1N59A 4RNRA 3FQRA 3NN8A 4PJCB 2XWTB 1KPRB 2QADD 4J4PC 2F54E 2EDLA 5T1MA 2LU3A 4UOW0 4LLWA 3CCHA 4ORGA 2VZOA 4X6DA 3G5YA 3WD5L 1X5GA 5C08A 3SEPA 3HE6A 3Q6GL 3KDMB 3MRRA 1XF4B 5HVFB 4OV5B 5KZCD 2BVOB 2EYSB 3JWOC 3GBLA 4S2SB 5DJZB 1LE5B 2DI8A 4M1GH 3CXDH 4KKAC 5I1JL 2X1WL 3GSVB 3TV3H 4IRSA 3L3HA 3HPJA 5I8KL 5TQ2H 5DHVA 5K59F 1CF8H 1WJ3A 5JNYA 5F9OH 5FV1L 1T89A 1I9EA 5IT2L 3FO9A 2V5MA 1QG3A 2D0GA 3MBED 4JM4H 1J05A 2OMNA 1JRHH 4AEIH 4FQLH 4UZGA 4CL7A 5HHNB 2EH7L 2P5WB 1GGIL 1T7ZA 4XX1E 3A0OA 4AENB 4PBWD 3TJHD 5GGQH 1KELH 2DRUA 1IAIH 3PDOA 2ATKB 4MD5A 3MV9B 5F97E 3EGSA 1BF8A 2ADIB 4YDVA 3C6SB 4YHYC 2QQKL 4N0UE 1BZ7A 3INUH 3TA3D 4OGYL 1NL0L 1FG9C 2DAVA 2HT3C 4TVPL 3GI9L 5GS0D 2GTWA 3MFGB 3LB6D 2H45A 4HWBL 4N5UA 2DMCA 3IDYB 1S3KH 3U0TA 3QDGD 3TGXA 4FFZH 4JRYB 2GUOB 2YBRA 2GTZA 2VXSL 3QFDA 1SM3L 4U6YA 2Z91A 1JPFB 1A7RL 2XZCH 1FFPB 1IKFL 2YKLL 4NRXB 1RULL 1SQ2N 3DGGA 2VDPL 3PWPB 1UEYA 4OCSH 1L0XA 4D2NA 2E9IA 4F37K 3C60B 4MXQD 5CIPH 2BNRE 4PG2A 5JR1H 5JPMA 1LEIB 3MSPA 1JHKH 5DQ9A 2W9EH 2R2BB 2IANE 3L7FA 4X6EA 1U8NA 3GMLB 4WEBL 3KHOA 1UVQB 3QIWC 2PYFA 3P2TA 4PLJC 1IGIH 3QFJA 1IAII 1DBJL 3ZL4H 3IAQA 5DHYB 1B4JL 3EYOB 3FN0L 4LLVB 2R8SH 2EIZB 2BY2A 3EIFA 3TZVD 1SY6L 4EXKA 3RY6A 1D6VL 3RPIA 4NQXA 4ZAKA 2NW2A 3SO5A 4JY5H 2A6JA 4K7PL 4R7NA 4M4RA 1KTLB 4ZOBA 5IB5A 3UZEA 4HGKC 3H3BC 4ZFFA 1Q72L 4LL9A 3FCTB 1NFIB 3PUCA 3VXOB 1CK0H 4ODHL 4ZUWA 1JPFA 4UT7L 5EU6E 1Z5LB 3BPOC 5DMJB 1Q0XH 4ONGL 3Q3GA 1HH9B 4LLUB 1J05B 2XTJD 2QSVA 1A3RL 4M7JL 1Q1JL 5HGHB 5D1XB 4BSWB 2I07B 4PTTB 1I85C 4JKPH 1C16A 4GAGL 3GMPB 3BUTA 4TTGA 4JVPA 4LHUG 5CINL 4JRWA 5TFSH 5DD3L 2MPAH 1J0YA 3BUYA 1NDMB 4NN6C 4TOYH 1BOYA 1RZJL 3ARBB 1J1PL 3P30H 4UIMB 1PYWB 1P1ZB 5KSVA 2J6EH 4IDLA 1RIHL 2A2QT 4EDWL 4XP1H 1YEFH 5KOVC 3KHQA 1RHFA 1N4XL 2QEJA 5KTEH 5E00B 4Q6YA 4ZUSA 2DJSA 1N5YH 1GGYA 2HLAA 4IRSD 3MRQA 4XXCA 2DB8A 2ZCHH 1NBZA 1BZQK 2K1MA 4IIQA 5EBMB 4PRHE 1J0KA 2KZWA 1CFQA 3PL6C 1MUJB 1U3HB 4CJ0A 1MNUL 5B3JE 3P73B 3PDDA 5HGAB 1MIEH 4S1DD 4AIZA 3MV11 3KLHC 4GKSB 3QIWD 5FYLE 3EFFB 2XG5A 4LLAA 1I9JL 2XV6B 1K3IA 1RZJC 1XEDA 5LGHH 4D3CH 1MCPL 2XXMB 1EHNA 3GHBH 4MDJB 3RBSA 5I8CA 3LS5L 2I9LA 4KK5D 4U7MA 5CP3A 3C8KA 4OF3A 4DEPB 1YN6B 1ZS8B 4KJYA 1DBMH 2FIKB 5I1IL 1U8KB 4QRQB 3UTZB 1KJVA 3T04D 1PKOA 4ZTOH 3RY5A 2ARWA 3MV8E 4LVHC 1FV1B 5DLMH 1INDL 5KG9A 1WFTA 4POZD 4JFDE 2FH6A 3JV4A 4YHKH 3QUYB 5FKAA 3H9HB 3MREA 5EORL 2VLME 3CH1B 2VTFA 4L8SB 1VFAA 2VZSA 3VFGH 3FAXA 3QNZA 1HKFA 4NNYA 1LE9B 3FKUS 4Q6IC 1F4YL 1EO5A 5KBNC 3PL6A 2AXHA 3I2CL 3O3UN 2OI9B 5CFHA 4XC1H 2FBJL 3T2NL 5M95B 3BYYA 4MA7H 5J1SC 2BVQA 1PEWA 4ELKA 3MRNA 4Z7VB 4JFDB 3GMPA 3GI8H 3QXAA 3PHSA 1YEEH 3KPSA 5CZVL 32C2A 3MRGB 3T0DA 1CXEA 1UH4A 3KPSE 1MFCH 3DV4A 5AWNL 1T7YA 3U7YL 4KUCF 1MJ7L 2FYYB 1KTDB 5C0AD 1OB1B 1BVZA 4X7TA 3K4ZA 3MODL 4OCXL 3VXMB 2OTUA 5E2WH 2AJXH 1WZKA 4X4YA 3OG4B 2DQDL 4PG9B 3QUYC 4XI5C 1IGCL 1FNSH 3VFUB 1CLCA 1EMTH 1JNNH 5BO1L 4X9GA 4RFEA 4WW1B 1U8JB 4EXPX 5HI4D 5ISZB 4KI5E 4NFBA 2V2TA 4NUJA 1N64L 4EVNB 3GMRB 4NDMB 2XZAL 5ACZA 2NYYC 2DQCH 3GO1L 1NDGA 1WAAE 5FO8A 3IAPA 2Y5TA 5C0AA 4X98A 2V9QA 3HCVA 3NGBB 1D9KC 4KI5D 5E70A 5GRXG 1PKQA 5JPNA 4PJGF 2VLKE 1OARH 4AIZB 1N6UA 3IFPA 5INDA 3F5WB 1BVKB 4RFOH 1BF2A 4C55A 4JREC 4ELKB 2DQIL 3NZ8A 1K8DB 4L8DA 2B4CL 3O3AA 4UNVA 2YD5A 4GKNB 4IOSD 2O93L 2MKLC 4XMLL 5L2KE 3HZYB 3SDCC 5C0CE 4KROB 1HE7A 2ZCKH 3KPOB 2FWOB 2W1NA 1J8HA 5IOPB 3QJHA 3PGFL 5F7KC 5HGBB 5I1EL 4OCYH 2A83A 1M4KA 3QUYA 3G6JA 3QJFB 4F2MA 5J11C 3R8QA 1K4DB 3BGFC 4RCAA 2ILLA 1QFUH 2C4FU 2X4QA 1MCWW 1RJYA 1W72B 3STZB 4P9HC 4X5XA 4HD9A 3UTSB 3KNBA 2V2TB 2F8VA 3BZFB 3GJFH 3KYNA 4GUPA 4HKBB 1H15A 4E41B 3V4VH 3X3FL 4ZO7A 1ADQL 3QEQE 1CDUA 4JFYB 2CGRL 3SGJC 4KTEH 3KPRB 2AXFA 4WTXA 1FZMB 4FZEL 1PSKH 3MV8D 4IRSB 4S1QL 1Q38A 2X10A 1EDQA 3X17A 1M7IB 4M7KH 4Q58C 1T7XA 5JQ6H 3QG7H 2MHAB 1C5BH 2PXYC 3WIHL 4DTGL 3ULSA 5D7JA 2BVPB 1BBDL 1ETZB 1X5YA 3R4DA 1JGDB 4YFLF 5D1ZC 2BDNH 1FLRH 2D31B 3TH4T 4APQB 1SBSL 3QQNA 1YEGH 3CFEA 5I74C 1I4FA 3ULUD 4NYLB 2AQ3A 3OF6A 3O2DH 3T0EB 1DUYA 3BVNB 4QHKJ 4RGNB 5DD0H 3SN6N 2GAZB 2PCPA 3QXVA 1FFNA 4FMKA 3O8XC 4U0RB 1CI5A 1CXFA 1T5WA 1YYMH 3FQNA 4M3JA 4UAOB 2D7MA 3K80A 1KF9B 4I2XA 5FO8B 4I13B 3BQUA 1HOCB 4LCCB 4QTHA 2E9BA 1VGEH 2CDFB 3CXHJ 4JHZA 5F1IA 2R23A 2Y06L 2YXFA 4YK4C 5I9QB 3OAYK 3BZEA 4I18C 2X70A 1U3ZA 3MLXH 3VW3L 4MGXA 3VE0B 1B2WL 3SGJA 1E4WH 5TDNA 4X5WA 2VQ1A 3VFMB 5B8CC 5CSZA 3O2VH 3ARWA 1K8IB 2ZNXA 5IEKB 5HI3D 3UYOD 3HR5A 4YDIH 1M6OB 3EJJX 5JOFA 5JW4R 3ECBB 1UJ3C 2J12B 4YAQB 1HZHL 4KRMB 2WNGA 4EUPG 4XTRD 2AJVH 4HXBL 2WBJC 2FGWL 3CFKA 4QXTB 4OZGA 4A6YA 3KR3H 3DROA 3DETC 5IT2H 2JB5L 4LLWB 4Z77B 4UBDC 3HUJF 1HILB 1UH2A 4NQEB 4ZAKD 4S2SA 2KDGA 2O5YH 5K9JH 3O3DB 2VLRE 3AROA 1OPGH 5F7HA 3MV7B 3HB3D 3OPZL 5IBUB 1CXIA 1YDPB 4YUEH 5IMMA 2H41A 4C54A 4JZJB 4XHQA 4F7PA 5J06A 5T3ZE 2P8LA 4U6VH 3WO4B 5EWIL 2F19L 5DRWA 3ROLA 1F4XL 5F9WC 3T09A 3DI3B 2VXUL 1HOCA 4QTHB 1JNJA 1G7IB 2FJFA 1KSRA 3IU3B 2ITCB 5IM7B 4UT9L 3C9NB 4Z7NE 1XGQB 2EIBA 1HIML 4RISH 3DURB 3PDOB 43C9B 4P2OC 1QKZH 2E7CA 4U4BA 3CDCA 4PGDB 4AT6B 3T3ME 4NO2B 2R2CA 2UWEA 4PRNB 4IRZH 1IGML 4K71C 3ECBA 3KJ4C 4CMHC 4KU1A 3D39A 1UJTA 2F74B 4OGAC 5KAQG 1KEGH 4K2UH 1TETL 4BH7A 2APTA 5JO5A 5AD0B 4YHMH 3HC4H 1MFBH 2NY6B 2IH1A 1X3DA 4G43A 4KZDH 1T1WA 5ETUB 3OB0H 3ZDZE 5DS8A 3B3IB 3RIAF 1QLEL 1BP3B 1AKJB 4QKXB 4U6YB 3VFRB 1U42A 2HFEB 2QBWA 3MOAL 4M62L 1MJ8H 4OF8A 1X5XA 2ADFH 3LMJL 1KBGL 4GXUN 4ZSOB 1NCCH 4N0YH 4PJHA 3ES6A 1B4JH 1XF3B 3Q1SL 1IKNA 4PJDF 1GYAA 4WI6A 4Y5VB 4P5TD 2YRZA 4JR9H 2AK4A 3V79C 3Q6GH 4F15B 1D5MA 4D9RE 4WV1C 4G8FB 1NJ9A 3D5OF 4FABL 5I17A 3TV3L 4F58H 5F88A 4M6AA 1NBYA 2F74A 3HB3C 4P3DA 3K46A 4KH2A 1U8MB 3VFSB 3SKOA 2CLRB 5HHME 5C0BE 4F9PC 4JO3H 4URTB 1G9NC 2ICWI 3S35L 2YD3A 3UC0L 3RZCB 2DI7A 1C12A 35C8L 4UDTB 2X7LB 1NFIA 2BVOA 3OJ2C 2H26A 5D1QC 3I6LD 5GGQL 3DBXB 4OCWL 2KH2B 1AGCA 4QT5A 4M7ZC 5TE6H 4AY0A 1RZJH 3UO1L 3FTGB 4KMTL 4BSJA 1N3NA 4OFVA 5JA8B 1MREH 4HUKB 3RWHA 4P4KA 4U05A 3DTXA 4XP1L 1MCLA 5IM7A 4XAWH 3GSOB 2ZUYA 3NPSC 4QHKI 3S98A 2EDKA 4UB0L 4MA1B 4TVPH 3EJZD 4MYWB 1GGBL 2G60L 4M6NH 3O2WH 4M48L 3HE7B 3MZGB 1BQLL 1I1YB 4L3EB 3VXSE 4S0SD 4QRRA 2VABB 4YXKH 3IFOA 4RAUB 4Z0BL 2Z93A 1CLZL 1AJ7L 1HCVA 3QXAB 3T1WA 1KCVL 4LIQE 2AJSL 2E27L 3VGDA 4XCNA 1MIEL 4AMKL 1AD0B 4H8WL 4ZTPH 4I9WE 1MCOL 2NNAA 1U58B 1LQSR 1T1ZA 5F8QC 4P2YA 5DO2C 3U9PL 1IVLA 5DD5H 3DX6A 1DN2A 4Z0XA 3IDYC 2YBRB 4H26A 5E1AA 1WICA 5CJ5A 1GGTA 4UMGA 3FMGH 4RRPG 2J5LB 3C6LA 3MBEB 4Z7UF 5C08D 5KW9L 3VFWB 2BOBB 5HHOA 2P44B 3VCLA 3QUMB 4QHNA 3TC9A 5DLML 1XH3A 3HI1A 4L3ED 2VL5B 1DBKH 4NCDA 4ACPA 1DZBA 5ISZE 3KJ6L 2VDKL 1F90H 5IB1A 5IMOA 4QRQA 5HYQA 4NJAL 3M8OH 1Z9OA 1WC7A 1D5ZB 2FYYA 2ARJQ 3RHWK 1R3KB 3F12A 2OL3B 2FATH 3V8CA 3KPNA 2QSQA 4M9PA 2DQEH 2FCBA 2WMPA 4HIHB 4PJXF 4ODTH 2G75A 2A6DB 3AY4C 5IMKB 3SGKC 2VLJE 3D3VE 4OD2B 4XB7A 2VXTH 3U46B 3VXPB 1K5NA 4QTIL 3MRIA 1OAUL 4JLRB 4TNWF 4NC1E 1U58A 1QSFB 2GYSA 3FRUA 5CINH 4M43H 2D7OA 1JYXA 4OFDA 3GSWA 4LEOB 1NMCB 4NQSA 1OT1A 4Y19E 1LDPH 5IW6B 4FQXA 3FB8B 4X4MA 4DW2L 3S4SG 4F15C 1R6VA 5KTEL 3FOLB 4X5XB 3HS0A 4OIIH 3KPPA 2NLJB 4XPTH 5EO1A 3OX8A 3LKQB 1L9MA 2Y23A 3KYNB 5D8JH 4R0LB 4GBXD 1EAJA 3WUWG 4MQXC 4JN1L 3LN9A 2GT9B 3UX9B 3QPQD 4XX1G 1KGCE 5DJYB 1I1FB 2ZUQC 3CFJB 3K4AA 1URLA 1XIWD 2WUBL 4PJDB 1J0IA 5D5MB 1AGEA 4QRPB 4L9LA 1PY4A 1SJXA 1FL3B 2AJYL 3EFDL 4ETQA 2AXJA 4G6KH 5F3HB 3TT1L 3UJIH 2Z0BA 4NO0D 3ZYJA 1PZ5A 3LKOA 5MEPA 2J8UE 4X0KB 3REWB 2OR7A 2P24A 3P9LA 4C58B 1XGYL 1ETZA 5FGCE 3FCTA 5LGHL 3CLFL 3QNXA 3L3OB 4KTYA 1PKQB 4S11A 5JPNB 3GSQA 1BGXH 4MDIB 5ILTH 1GOFA 4PYGA 5IIEB 5A2JH 1GZPB 4KFZC 4OF0A 1MCDA 2IQAA 3O81A 4BFBD 5J1TC 5AUMA 2PYED 3ZKMC 1CLYH 3P73A 3WL9B 4FQHA 4U3HA 4XH2A 1KEMH 3HLAB 1P7QB 4LKCA 4JPIB 3VFOB 1G9MC 3DO3A 1S9WA 1KTRL 3MLZL 2X1OA 1D3CA 5KOMC 4YHPB 2NY7L 3NTCL 1F58H 3BJ91 4QRPD 5D71L 1F4YH 4ZD3L 3RDTC 5IQ9A 3IJHB 2VR9A 4K3JL 5DD6B 1KENH 1ZA3A 4NHCL 4A2LA 4X6CB 2EEBA 1B0GA 2DJUA 5MENE 2HJLB 4JFHD 3D18B 1YEIH 3H9SB 5DJCA 3MJ7B 5CZVH 1KPVB 1CDHA 3JWDL 4L3CA 4XCEB 2A9NH 4U7SA 4WTWA 1MFCL 5AWNH 4WGVB 5HYFA 1OM3L 1EXUB 4GMSL 3VWKC 2PETA 1NAMA 2GKIA 1PX3A 3C08H 4HUXB 5CCKL 4MB3A 3MYJA 1WLHA 4HPYL 1M7IA 2ZOLA 2KKQA 2VLJA 3MA7A 3MV8A 2EYSA 2OK0L 4EI6A 2MQCA 4JFFA 4KQ4H 3D0VA 1ZANL 5D6CA 4BZ2H 1AQKL 4LP5A 2C3GA 5DDHB 5LBSL 2ESVA 3CDFA 3VXQA 2C4FT 4NO3B 1WWBX 2ORBL 3C60D 4O2FA 3UPRB 1B6UA 3V95A 3GJFB 1X5ZA 1PLGH 4G9FD 5FCUL 4NJ9H 4JM2A 2VN7A 3BD5A 5FB8A 1EBPA 3ZSTA 5ADOL 3LV3A 4QRUA 3THML 2DWEA 3EJYC 2F9BT 3DYPA 8CGTA 4G3YH 1NMCC 1FH5H 4DGYL 3TO4C 1J1OL 4OQTL 4K9EH 3L3JA 4KY1H 5I15L 1OAXL 1JPTH 1NMBL 4M7LH 1EVUA 4L4JA 5FDWB 1NC2A 3ISWA 3UJJH 3MXVH 3FO2B 2EC9T 3OJDB 1DQQB 3KS0J 5C08B 4QRTA 4WI7A 2XA3A 1XAUA 4X5WB 1FFQA 3GUTA 2ESVD 1XGQA 5IKCB 5LWYL 1UXWA 3VI4F 5DR5H 5JOFB 1LO2H 3MOBL 2BOCA 15C8L 3RDTD 4JPWL 4L8BB 3EOTL 4NO2A 4CVXB 3RAJL 3GSUA 2Q1EA 4IOFC 4E0RA 2ESVB 2IGFL 3GBNL 4PJ7B 2DIBA 4DN3H 4XNUH 5EWIH 1DSFH 1G1YA 4ZUUA 5H35B 3MLVH 5I1LB 1UM6L 4JVWA 3C5SB 3V9FA 1LNUA 3PP4L 1FORH 3O9WA 4TUJA 3IRPX 5DS8B 5KS9F 4NN6B 1T2JA 3RUGF 4FZEH 1AXTL 1A7PH 3X13A 3L3KB 3I6KA 3BPNB 3BQUD 4JRXD 2Y1VA 1CGSH 1JWUB 4XMKL 4FMFA 1V7ML 3QCVH 5E8OA 2EXWC 3OGCB 3IF1A 3RWFA 4LEXL 3D87B 2OP4H 4P0DA 2R4SL 4JKKA 2QL1A 1XF1A 3KYKH 3TM6A 5DMIL 3EOBA 3BO8A 3N1QC 5GIRA 3T65A 3DOSA 2W59A 4HWEL 1DQTA 1W72L 2M1KA 3HG1E 1NCWL 4UQ2A 1R3IH 1MFBL 3ZKND 4I9WD 3IKKA 4R0LC 1MQ8A 1NSNL 1L7TL 4NWUH 3DVNA 5DD0L 2W0LA 2ZG3A 4NPYA 2E7HA 1AR1C 4NN5B 3SCMC 3P0YH 1WK0A 1YYML 3GJFA 3U1SH 3DSFH 1UZ8B 3P77B 4X4XB 1S7TB 2ADFL 1O0VA 5BVJB 1RURH 4PV9B 4LU5L 3SPVA 4P9HH 4RA3A 4R8WH 3WIHA 4KXZH 5LCVH 2EDTA 1A6WL 3H0TA 3ARRA 4YQXH 1N8ZA 2HVKA 3OAUH 1V3LA 3MRPA 3OKNA 1VHPA 1JYVA 1J10A 1HHIB 1AGCB 5BZDA 3ARFC 4NRXA 4WY7H 2LAGB 5CHNB 3O6LH 4GRLC 3DGGB 5D1QB 4XBGB 2WQRA 1S7RB 4GAJL 1F3JB 3RWFB 3HFMH 2FGWH 3I6LE 3TN0D 1WV7T 3MRCB 2D7QA 2DWDB 5J12C 3B9KD 1WEJH 4OM1H 4KJQC 4AZ8A 4RBPK 1GIGH 3W39B 2OSLB 3UC0H 5AAWA 2CLZA 5CIPA 5I18H 1M6OA 1PDKA 4PG2C 5C0NC 1T2QH 1RFDL 1A8JH 4FQJL 5HYSB 3IFOB 4Z7WB 5E95B 4YFEA 3U4BH 4GXVH 4X4XA 3GHEL 4GFTB 1QYGH 4GAFB 1QSEE 2JTDA 3IJSA 1MCEA 5L8KB 2NTFA 1BOGA 3RKDC 1QSEA 2R2HA 1CZ8H 5IFHL 1EEZA 3ARBA 2FNBA 5IROC 4L29A 5D4QA 5D96B 3SO3B 2NW3B 1Z2KA 4P59L 5KANG 4OF7A 3F8UB 3FZUC 2YPVH 1HYRC 1R5WA 5BV7H 4ZDHA 3VFNA 4ZG1A 3FB7A 3BIKB 3U46A 3VXPA 1FN4A 5HTSA 3SJVA 2CLVA 2QQLH 3QO0A 3KYAA 2AV7B 2AJSH 2E27H 4NZUL 4JPKL 4PJ5D 4A6YL 3HC4L 4HCRL 2HYMA 4QYOB 3MMEB 4H88H 3O0RL 3JWOH 1YY8A 4NZRL 3PP3H 1YMMD 3MLSH 1JRHI 4CMMA 3MLWL 5EZIL 3S4SB 2FD6L 1DE4A 5I8OL 4NGHL 4Y19B 2BVQB 4OT1L 3KXFB 4M6ML 1U93A 3MC0A 4DJMA 1WBYA 4PP2A 2BNRA 1KBGH 3OX8B 5D7IE 5BJTB 4CNIB 2IPTH 5TF1H 2EYRA 5IV2B 2FX7H 1AHWB 3UJTL 3IT8D 4Y19D 1KJVB 5IMMB 4YEFA 2YC1A 2V2XA 4FXKA 1VDGA 1FE8H 3QFJE 2GK0A 5F9WB 1NCUA 3HZMA 5DMKA 4EI5D 1EGJH 4XXCC 1UACH 3B9KC 3HMXH 1CVSC 2GK2A 2BNQA 3LHPH 3BI9X 4G7VH 3DV6B 4JZJC 1XR8A 1LP9F 1EEUA 2FATL 5D5ME 5CP3H 5HHOE 3DXAA 1SEQH 5GS0L 4ODTL 1BD2D 3FQWA 5CUSH 5FGBA 2QKIA 3WIIH 2YA2A 5I19H 4Z76B 3TCXA 4JO3L 3S35H 5BW7C 3G5VA 4HF5L 2P1YA 1OWRM 1RJCA 1AQDA 5SX4I 1IEAB 1VKXB 3QI9C 3CLEH 1U2HA 3TVMA 1BEYH 4ENEC 1T0NB 5IMKA 3BEVA 1DBBL 3QUZD 2XTJB 1UC6A 1QRNA 4ORZC 3DLQR 4MAYD 4PS4H 2K9UA 5ICYB 1CQYA 3RY6C 1I7TB 2YZ1A 3JUYA 1LE9A 3MV01 2NY1D 5EO9B 1CLOL 1SYVA 2YC1B 4PG9A 1MFEH 1OVZA 2X41A 2QQNL 3KPRD 3QQ4A 4G6AC 2NMSA 4OZFG 4YDJB 2V7NB 5C07A 3T0EC 4NWTH 3G6AB 3FOLA 4YXKL 2PW1A 3VFPA 1CGYA 4HGMA 1ND0A 4L3CB 4YR6B 3TT1H 4CW1A 5DQ9B 1JK8A 2F54D 4D9QD 1TIUA 3UTQB 3ZDYE 4WW2B 2QV2A 3LSOA 5I16A 1NCDL 2D2OA 1T0PB 3LKRA 3RIFF 4LCWE 3QCTL 4LOUD 1KPUB 2VQUA 4HS6A 3SJVE 4NP4H 1IZKA 3HNVL 3SGEH 4L4VB 3VMPA 2BK8A 4JRYA 2P5EA 3F58H 3ZE1F 3UPRA 3JTTA 1CGVA 5C09B 4Z7OE 4YE4H 4HK3N 4DGVH 3AB0B 4NJAH 5C9KA 4NQTA 3ULUL 1F58L 3NA9L 3ZLQC 4HUMB 1UWGH 4J3UA 3MRBA 4Z7WE 2DBLL 5C0GA 1U0QA 3NFNB 1ED3B 1HNFA 1Q8MA 2DQEL 5EC1B 2VZUA 3VFVB 4NHCH 2EO1A 1V05A 4LGPB 4ZPVB 1YEIL 2BNUB 4HX1A 3MYZA 1UADC 3QIBC 5MHSD 5DRZA 5GISL 4KDTC 4LLDA 3V6FA 1OP5K 3W5MA 4M9OA 1A7OL 3OWEA 4LARL 5DJ0A 4JREB 3W2DH 3SDCA 2X1QA 2DL9A 1BFSA 5HI5D 5JIHA 2FGZA 2HKFL 2Q8BL 4P48A 5D93B 1KJ3L 1DQDH 4G6AD 2YPLD 1GPOH 4GRWF 3EYFB 4PPTA 5HDBE 2R0LL 4JRXA 4CGTA 5IJKA 1EX0A 4WUUB 2HP4A 4JDTH 1SYSB 1H3PH 4RIRB 5T1KA 2J7LA 2FEDC 3QEGH 4JDZB 4L4TE 5E0QA 2FECI 2A0LC 3DX7B 3C6LB 2H8PA 3L6FA 1IGYB 4FHBD 5EUOE 4CDGC 4L4TA 3S37L 3R0MA 3KLHD 1MRFH 1D6EA 1UGNA 4NJ9L 1S9XB 3QUXA 4MB5A 3RNQB 4OIBA 5GRYA 3RX5A 3C5JA 1V3JA 1MAKA 5IKCA 3OKOA 2BSTB 3T0BA 4BZ1L 1CBVH 2AJYH 3F7QA 1A4JA 3JVGC 1TLKA 1QFWL 1AGBB 1FH5L 4R4BB 1YN6A 1ZS8A 4KJYB 1IAKB 1N5AB 2NY0C 2HA1A 5D6DC 1JPTL 2IADB 5J6HB 4JO1L 2FO1A 3G9VA 5HHMB 5C0BB 3T0AA 3NACL 3UJJL 1DUZB 4Z78B 3VGAC 4LLMA 4XP5L 1L7IL 2HJKA 3B4NA 3NCMA 43C9A 5J3HD 3O6FA 5J1AB 7FABH 3D25B 3A6CH 2J88L 3NIFF 3PWUA 4NQVA 5DR5L 4ZUVA 5FYKL 4ZFOB 2ZUTA 1KEML 4TPRH 1OTTD 1Q94A 3FHQA 5IG7A 5CGMA 5IWLA 3RFZC 2BRQA 4AH2B 2VDLL 4NO5B 4OD3H 4WFGE 5ITFA 1TVHB 1XCQB 2EH8H 3RVVD 1KELL 3B9VA 1GGCH 1IC4L 4LIQL 4ODUA 1WF5A 4W68A 5DVKA 3WFBL 3OXRB 4Y2DC 2WSKA 3W0WB 4XC3H 3PP4H 4M7LT 2YD8A 2H32B 2FH8A 4RX4A 5IB4A 4PGEB 1NUDA 3PHOB 4JPIA 2OR8A 3VFOA 1CFTA 3GI9H 4HAFA 1A6UH 2DIJA 1YECL 4JVUA 1OQXA 1X5IA 1GC1C 1MCWM 1S3KL 3QEQB 2VISA 4MQ7B 1RUKL 1BAFL 3RVTD 1L6XA 3AREC 1V7MH 2Z4QB 2VXSH 3OG6B 3X12B 4DVRL 5IESH 4XI5D 2PO6D 4ETQB 4I0PD 1IKFH 3S37X 3QUXD 4YO0B 2YR3A 1LGVA 1BM3L 2UWEB 1EHLL 5A2IH 5DD6A 4R4FH 1JNLL 5D1ZA 3NIDF 1JI1A 1R3IL 1GC1L 3QULB 2BFVL 4KHXH 3ZZ1A 5JW5A 3OGCA 1NJ9B 1NSNH 5EULV 4OUOA 2V7HA 1J7VR 1FCGA 4HQQH 2ZG2A 2VXQL 3L5HA 3ZE0F 5D1XD 2OTPA 3G5YB 4XVJL 4KDVA 5FYKU 3W9DA 3QP3A 1E4KA 4G9DB 4QRSA 2CUIA 5KSBE 3LY6A 4BELD 1PLGL 3SE8L 1EHAA 3AVEA 4LSVL 3BKCL 4NPYB 1AI1H 3QHFH 2J6EA 1QBBA 2D4DA 4MA3B 4YHPA 4NN5C 3QXUA 1YEJH 1JWMA 3IJYB 4G42A 3SDDC 2J5LC 3MBEC 5GGUA 4NM8L 2O5ZL 1OAXH 3L9RA 4U2YA 5C0EB 1DUZA 4EDXB 2W07A 3QJHB 4D0CB 4IRJC 3W9EB 4UTBH 3BW9A 4ODHH 5BW7A 2VMFA 4KKBD 1XIWB 3NCBB 3RWJA 5DZNA 2G5BA 3IRZA 4G8FA 2XACC 4LPTA 1JHTB 4QGYA 1GIGL 1RIUL 5EOCL 4UIKH 4LSRL 4GAGH 2DL2A 1Y6NR 5DK0A 5IK3A 3MLRH 5HVHC 1AH1A 1Z0NA 3GSNB 2MFNA 2DOCA 4OBRA 2C3WA 3GSNL 5FKPB 1QSVA 1FSKC 4ZAKB 1FIGL 1EAPA 3DVGB 5H2BA 4J8RB 1D7FA 1IKNC 4RMTA 4LGSB 4PV8A 1CZ8L 5EIIA 3BDYH 3SDAB 2NY4B 2GIYA 2BOCB 1WUNT 4H26B 3DRQA 2VAJA 5E1AB 2HWZL 3KLAA 4OTXL 3E6FB 5HVWA 4Z7VF 1A7PL 1HDMB 1MAMH 2DLGA 1CU4L 4NKDA 3GIZH 5BOZG 4JFPA 3VFTB 1RUMH 4P2OA 5E9DB 3OR7B 5K33A 1N7ML 1CGSL 3LRGA 1K85A 3KGRA 5EUOB 1MY7A 1G6RB 2OP4L 4OCRH 4JE4B 3N50A 4Z8FH 5K93A 3HHRB 4WHCA 1FGNL 4HJJL 4NZUH 5ANMB 2BNRD 2VN4A 3QEHB 3CU7A 3MACL 3BX7C 4H88L 4PJBF 1JYNA 1ZT1B 3BH8B 3TBSA 4WUUD 4XCNB 4JZNA 3GHBL 3RL2B 2W9EL 1UXSB 3SJVB 2XKNB 3BH9A 4YWGL 3MCLL 3SKJH 1ADQA 4OT1H 4U6XB 1A7NL 4DOHE 3B9KB 2N7AA 3G6DL 4P5TA 1KULA 4FFVD 2VUYA 2DTMH 1CL7I 2OJZH 4Y4KC 3SDDD 4LU5H 1I3GL 3NMEA 3IDIA 1VADB 3OZ9H 2IAMC 5GRJH 1LK3L 4UINL 1S8DA 2J8OA 5JHDB 2AQ1A 4KK5C 4XPHL 3BXNB 4HK0A 3QZWB 2D31A 2ZUUA 5MENB 1O5DT 3OR6A 4JO2H 5J6GB 3IFLH 3PP3K 2GY7B 2CIKA 5EUKA 5E8EB 3I2CH 2Q6WB 3AMKA 1UFUA 2DICA 2AK4E 1T04A 1JGEA 2IANA 3BGMB 5IB3B 1R5IB 4FA8A 3WNNA 3CZFB 1JCKA 5INCB 4JG0L 3ARSA 2UZIL 3W82A 3OJMB 3B8YA 3NGBC 5T1MB 4H25B 3SKNB 3CLEL 2ITDA 3U7YH 2C3XA 1S7RA 1B3JA 4K8RC 3DUUA 2UV3A 1FLTX 4NKQB 2FIRT 4Y4KA 1BBJB 4LCYA 1TZIA 5ALBH 3RVUC 3U4BL 5DUML 2AS5M 5C09A 3WUZA 4CVZB 1F00I 2OJEB 4JFEB 5L9DH 3V6BR 3EDDA 1N4XH 4TVPD 5C09E 1FNEA 4NZTH 1WC7B 4LHUA 3FRPG 1CGTA 2B8OT 4Q7DA 4FQQA 2CUMA 1W2KT 2ZCHL 5HHNA 1J18A 4Q2ZA 2ICCA 3C8DA 2Q76A 3S97C 4LPXA 3V0VB 4UTAH 2DQCL 4HS6B 1UWEL 1M71B 2UZYB 4NKOB 2D03L 4WENB 3HI5H 5D2NC 4LDOB 4GQPH 2VDQH 4HK3J 4AG4L 1JNHA 1U8KA 1MNUH 3STLA 3AY4A 3MRIB 4JCLA 1MPAH 3IXAB 4HIJB 3UDWA 1OARL 1TITA 5F7EH 5HDBF 4HCRH 4YHNA 1OB1A 4GRWE 1BJ1H 2OS7A 1ZT1A 1Z6JT 3IDJB 3AXLB 4W4OC 1I8MA 1I9IH 1CFSA 2RFXA 5JOEA 4OZ4B 4KKNA 5LGJA 2OI9C 4AYFA 1D5XB 1P84K 2GCYB 3JV0A 4GRMA 4EN3D 3DUHA 3C9NA 1JTTA 1L4IA 4NNYB 3RL1A 1TZHA 5IBUG 1I8LA 3H9SA 4MJ2A 4XCFH 5JW4M 2AK4D 2YPKA 5L0QC 5BCAA 5C0AB 5I9QC 5F6IC 3O6KH 1FFOB 2P46B 1K3ZA 4PB0H 3QHZL 4LCWA 2W0PA 5GS3A 5EFIB 1KLUA 3KXFA 1BD2B 2VLJB 1NQBA 2OL3L 4G7VL 2X4RB 1T1WB 1S9WB 4M00A 1BREA 2BNRB 4U0RC 1QLRB 4JRYE 1OWWA 3T2NH 1QD0A 1UVQA 1RZ7L 3T77B 1MCSA 2CGRH 1U92B 2HJFA 3DO7A 2A1WL 5HVHB 1G0DA 2Z91B 4K8RD 2VH5L 3GI8L 3BAEL 1ZEAH 5F7WC 4GRLB 5FFLA 3BIKA 4B50A 4GBXA 3FO0L 2QHRL 3DV6A 2YEZA 4G8EA 1CD9B 2YD4A 3MUHL 4GMTH 5CGYD 3VFVA 4KVNL 2COQA 2J4WL 1QPXA 4TSBL 1P84J 5EZJA 3S36X 1JVKA 3ZDYF 3TNMB 4JQIH 3AS2A 4N0CC 5LAXA 5E2WL 4OD1H 5A16B 1CDCA 5FM4A 2R29H 3HNSL 5F96L 1GPOL 4YDVB 4OLYL 5CS7A 5KJRL 4U1JA 5I6XB 1KN4L 4BFIA 4OUUB 4PY8I 4JDTL 1HSBB 4RDQF 2N56A 1EUUA 1KCUL 1T1XB 1E4XH 2CPCA 5E2VH 1R3LA 1JF5A 2I27N 1YMME 1MCJA 3N1GC 4YGVB 2G9HA 2DD8H 4MXQC 4Z5RB 1YMMA 2X7LA 4FFWD 1T03H 1MJUL 1KN2L 4R2GC 5FF6A 5CD3A 3ULSB 5T3XH 3GRWH 5IG7B 4JY6B 2XZQL 5HGBA 3OKKA 3SDAD 1B2WH 4OFYD 3VGEA 2JIXD 3NCCB 4MD0A 3TWCH 4HIIB 3JWDC 1LMKA 5E6IB 3TYGH 4XNYL 4FXGA 3UTTA 4Y4FB 3K4DA 5BRZD 4YPGB 1S7WA 2I07A 1R3JA 4O02L 1E0OB 1KLFA 5FV2A 4Z76A 1OF2A 1H8NA 3CSGA 5I73C 4LCCC 1SMAA 1YUHB 2VRAA 1CDYA 5IB1B 1S7QA 1UM4H 5D7SH 3BMVA 4Y4FD 5BRZB 2X09A 3QG6A 3LEVL 1X6NA 4U6HA 4QY8A 5BV7B 5F6IB 3BZEB 1GJIA 4ZXBA 4HUWB 2EH8L 3RX8A 1BQHG 3PXJA 5GSVB 1G9ML 1ZVSA 2VLKA 3WDJA 2DYPA 4APQC 3S6CA 3CC5A 3H9SE 1OAZL 2IALA 3UYRH 3SE4C 4JDVA 5C8JB 5I1HH 5DEFA 3MLPA 5C3TA 4MJ6A 3VRLE 1I4FB 4WW2F 3REVA 2BVUA 3T4AB 1LEGA 1RJLA 4HH9A 3C87A 3QQ3A 3MLYH 3MRHA 5CEZE 1FZKB 2DIAA 3QDMD 3HRZA 1HQRA 2HN7B 5GHWH 1LO0L 2EXYD 3WIFB 3MFFB 4U1NA 1U91B 1MLCB 2LQRA 3IDXL 1K6QH 1IMHC 1ZGLP 4LHUD 1BWMA 1Q9KA 4QHMA 3MX0A 4HMEA 5D7LB 3MRKA 1DVFA 4WI9A 2OX5A 3PL6D 3ZHKA 2BNUA 1A4KB 2LE9A 4HWUA 1DQLH 3X11A 1EV2E 4F7TA 3U7WL 3V0WH 1FL6A 2F58H 1A64A 1T21B 5ESAA 3QEGL 4NUGL 1TJHH 2IPUK 3M1BB 5TDOB 1QO3A 4GJTB 4YBQD 5C7XL 2WZPD 2IAMA 5T33L 4XGZA 3H9HA 4NSKA 4X8XA 4AM0B 4WO4B 3UBXB 5CBEB 4LCIH 1R5VA 4S1SH 4X7TB 2E8ZA 1P5UA 1FZOB 1AI1L 2H2PD 1OW0A 3OXSA 3SQOL 1U3YA 1QFWH 4NQCA 4Q9CA 1HHGA 4M8QB 2R4RH 4WWKD 2X6MA 3SKMB 4GS7C 4HULB 4KJPD 2IFFL 1EZVX 3NCYS 1HZHH 5DJZA 4Z7VA 4F80A 3C5ZA 1A6ZA 4F58L 4LPYA 2I9LB 4OAWB 5DJ6B 3TBSB 3O4LA 3GB7B 3BKYH 3MV9D 1XGRA 1KJMA 3U83A 1NEZG 3UPAA 4ZUTA 1T7WA 3JV4B 4RWHA 4HXAH 4FRWA 2WINB 1TNNA 2F53B 1NFKA 1T1YA 2CJUH 2H9GA 4UOW1 3OAZH 5DRXA 1CWVA 3UZQA 4N68A 4JHAL 2AEPH 3FT4B 4N1EA 2GJZA 4LRNH 4WUUA 1WAAA 4WO4A 5CD5D 3C6SA 3GMRA 4GAYB 4M8VA 3SDXB 4WUUE 3FT2A 4HPOL 1G7JB 2HWZH 3RL2A 4U1HA 5T1KD 4P46C 1TVHA 1XCQA 1PW3A 4P46A 3TNNB 3AS1A 2AAVA 2EKSB 2VDNH 1RUKH 3CNKA 3W0WE 5KVGL 4ZS6C 1I3VA 4H8WC 3BGMA 5IB3A 4LNRA 4KVCL 1NC4B 1AIFB 1F6AA 1G6VK 3NZ8B 3IFNH 1T89C 2OSLA 1HXYB 3E1F1 4OCLC 3EW3B 4R7DA 4ZTPL 2BC4A 1MHEB 2YD6A 4KK6C 4HWZB 1QBLH 4ODWA 2CIIA 3BE1H 4C4KO 2EDFA 5IBTH 1LK2A 1BPVA 1Q0YH 4DZ8A 3SE8H 4OSUH 1TNMA 2FJGB 3RUGE 1KCRL 4XP9H 3NPZB 5LXGH 5C0JB 5KS9E 1U93B 4IMKA 3O8XB 5E2UL 1YEJL 3FFCA 3O11A 4HJ0D 4Y2DB 4WUKL 2R1WA 2EYRB 5IV2A 4ODVL 2Q87A 4S0TD 3RZCA 2O5ZH 4NKIH 3CFIC 1JBJA 2PCPB 4IOIA 4OLZH 1NPUA 4P5MA 4NT6B 2X4TA 4QYOA 3ARZA 5D6DA 5J4MA 4OLUH 3L5XH 1CFSB 3FQTA 2WBKA 4ZUWB 2EC9U 4G7YL 3VI4E 4NQCE 4P5KA 4LCWD 1I7ZA 1CFBA 1VACB 1OAUH 5EUKB 5BOPA 2PW1B 1T83A 3QWOB 3EYQD 5KSUB 1ND0B 4OCWH 5CKGA 1C08A 1JNHB 3HE7C 1LDPL 5IMOB 5FUOL 2NR6D 1WWAX 2CR3A 4C56E 1MY5A 3V5DB 5D2LB 3ZKXB 1T5WB 3FQNB 2DKSA 3ZYIA 1H15B 5EH1A 4NZTL 2IG2H 1KLUB 4JGJA 2BHUA 4ZS6D 4LPWA 4XPTL 1FNHA 3WLBA 1WBZA 2D7NA 4OBSA 5JUEL 5A40E 4KV5F 5D8JL 5HD8C 1CU4H 4XZUA 2ZUWA 3RJQB 3V5KA 1SHMA 3DX6B 5DO2D 4ELME 4UTAL 4OZHE 3PABB 4JFEA 5TH2A 1YDPA 1UM5L 3VMOA 2KUTA 2VDQL 2Y7QA 1E6OH 1MHHB 1MPAL 3AREA 1G6RL 3MNZA 4MXVE 5EBWA 1IL1B 4H5SA 5B8CB 2PXYA 1FBIH 1ULVA 5FUZL 5GGRA 1GRWA 4WFFD 1I9IL 4HV8B 4FN0A 4EDXA 4QXTA 3U9PH 5C92A 3QPQC 4IMLA 3QUKA 5FUCE 1PGRB 2B2XL 4JFZH 3DURA 4HKXB 2FBOJ 2LABA 5FM8A 1RU9L 4X7EC 4TUJB 3WS3B 3HC0A 4NOBA 3L3DA 5GGSB 3RZWA 4HWBA 4PGBB 1NEZB 4TN9A 3G6DH 2EIDA 5JZ7D 3K7UA 3I6KB 5HI3C 2W0FA 5ACMA 5IF0A 3WNLA 3T8XA 1EA9C 5DJAA 4ZUSB 2ADIA 3OZ9L 3P4MB 1KPRA 1DBKL 3GBML 5CGTA 2R1WB 2F5AL 3MPCA 4I77H 4X6FB 1F90L 4UBDD 4Z18A 4OZIF 3ARGA 2XKNA 4HLZH 4OI7A 3RIFK 1ZT7B 5H2BB 3RJDA 2NTSP 4MNQD 3WSQH 5I66A 2NCMA 3GSWB 4PRHB 3UXFA 5L88H 3RGVA 1OAYL 2DMKA 3D3VD 1OGTA 5HYEA 3S88H 5FGBC 5M94B 4JY4B 5JDJA 4LSTL 3RNKB 4FXGB 3V7AG 25C8L 2C1PB 2AK1H 4KKCC 5F89A 4ZOCA 4NQEA 3TEUA 3CFBA 3WO3B 4MDJA 5I1GL 3IDMA 3KJ4B 3QUKB 4ZS7H 3EO1B 2CIKB 1WGOA 2AK4B 5T5FL 1OM3H 3HR6A 3L7EA 3O9WD 4LRIA 4O2CA 4L3EE 3VXSB 5ALBL 5DUMH 4PJ5E 2Q20A 4YC2C 1YN7A 2J8UF 4K7FB 5B39B 2ZNWA 4L9LB 1ZVSB 4OIIL 5MP6L 4BZ2L 3P4MA 3VFUA 1QRNE 1J87A 1HINH 1T20A 3RPIB 1E4XL 5CEYA 2IALB 2H6PA 1RHHA 4DN4H 3EYFA 2V5SA 3MGTA 2EE9A 3ULVF 5T1LA 3GJEA 3NCEB 3VD9A 5KSAC 2LU4A 2FHFA 1FCCA 2D7TL 2OJEA 3EZ8A 4Q0XL 5BS0E 3UTSD 3PWPA 4HV8A 3ZKMD 5MHSE 1GCFA 3Q3GB 3QXWA 4LLUA 4EKXA 4Y19A 3VXRE 3D2UD 3TYGL 4O9HL 5F89B 1P7KA 4PJEE 2PR4L 4ELMA 4R4BA 1ITCA 2B1HH 5ILTL 1NGQL 1AGDB 4JJ5A 4N5EC 4PRBB 5LJYH 1BFVH 1CFTB 4YXHL 3GRWA 1I8IB 4KK8D 3ULVE 1TCRA 4MD0B 3IXAA 3U0WH 2X9XA 3S9DB 2DQFA 2V9TA 3HZMB 3IDGA 5E4IA 4P57B 15C8H 1GGIH 4JPWH 1XF2A 1K4DA 5I1DB 3DTXB 2B5IC 1ZLSL 5ACZB 1I1AD 2NY7H 3SJVD 4W81A 2R0KL 5HYJA 1DLFL 3SKUD 4ZFOL 1EJOL 4KKLC 3IXTA 5FK9B 3KNBB 4LASH 5BRZA 1ZK9A 3VRJA 4R90L 3BESR 5D7LA 1I7UA 5E94B 1TJIH 1XGTA 5IBLC 5I1HL 1H3VA 1NGWB 1F45A 3LVEA 3MRFB 4NQDB 4ENED 2BOBA 3JZ7A 4PTTA 2NY3B 1A14L 4EZMA 3HNTL 4Z7UE 5IHLB 3WBDA 1PFCA 3BMWA 3PNWA 2IJ0C 3O6ML 4Z9KB 5TGBA 1AFVH 3TBTA 1C12B 1KB9K 4W4OA 2FSEB 1XCTA 5GHWL 2R4SH 3LZFH 4GW4B 4TSBH 4JN2A 4MNQA 1ZTXL 5CJOL 2LVCA 4OCMC 2Z31C 3FO1B 2R69H 3X12A 1QOKA 1JIBA 3P40A 4HPYH 5IR1B 2VLLA 2DM7A 5MEOA 1HHKA 1JUFA 2CK0H 1LEGB 1RJLB 3VU2A 3GSRA 2G75B 4OLVH 1DQLL 5GGVL 3SGEI 4FTVD 4PJ9D 3EJYD 3G6AA 3STZA 1KIQB 1XFPA 4JKMA 1MQKL 4IIQB 5EBMA 4YH6A 5GS2D 2KBGA 3OKDB 1S9VB 3BQUB 5E56A 4OGXH 1QNZL 3GSNA 1XGRB 4YQXL 3E2HC 1D6VH 4JAMB 3M1BA 5E8NB 3OB8A 1I1AB 5I16B 8FABB 4GW1A 3QIBA 1BIIB 3LKRB 1J1OH 3B2UD 3SQBA 5ESVA 5FHAL 3H7LA 1X4YA 2NY4D 4WI5A 1GAFL 4JFDA 1BD2E 4HFWA 4MXVF 3DRTA 3SHSA 2XY2A 4GAJH 4L4VD 4MLSA 5E2TH 3QYCA 3DO7B 5E99L 2XPGA 2ESVE 1QSFA 3O6FC 2XICA 4OZHF 4ELMF 4NC0B 3UYPA 2ERJB 3K3QA 2VZTA 4K7PY 3VFTA 2MNUA 2JJSC 3OQ3B 1F13A 3QFJD 4FP8H 5DJ2B 4E5XB 3ARFD 3HAEG 1FYTD 1I8LC 3V5HA 3DX9B 5F3HA 1RK1A 3HZVA 1CIDA 2EKSA 3B6SB 5CLWA 1P53A 5TFSL 5HHQB 2CKBA 4G6ML 4HXAL 1C5CH 2ATPA 3PL6B 2YS4A 1S9KC 4MA3A 4F7PB 2A73A 3EYSL 3O41A 4S1RH 4X7DC 3D9AH 2W65B 5F1NA 3V7AE 1VPOH 1Q9OB 4X80L 1JPGA 3O45B 5J13C 4HPOH 4PJDE 1D5BB 3RKPA 1MFAL 4XH2B 1XZ0B 4C57C 2PO6B 2YPVL 3BPOB 3H7BA 4JFFD 4RMVA 2MCPL 1QFHA 3UTTE 1Z9SA 4JLRA 1K8DA 1TQBB 4L8DB 4KRPD 4F7EA 3VD4A 1NAMH 3LKPA 4X0KA 5FGCB 3N9GH 4EI5B 1A7RH 4LSQH 4HAGA 3IYLW 4MQXD 1BFOA 3QNXB 2FEDD 5GS0C 3DMMC 4NKMB 1MI5E 4PJBE 3IVKB 3FZUD 1JV5B 4WJ5A 1MRDL 4V1DB 3E3QC 4R97B 5F1SA 2BCKB 3EO0A 3MLSL 4D3CL 2RBLA 3T4AA 2Q86B 1TJGH 2HJLA 3T0WA 3QA3B 4MSWB 3U30B 3QWRA 3BE1L 4NUGH 4FQCL 4NDMA 3DSFL 3F7YA 3VH8G 3T3MF 4YIQB 3H6JA 1TVBB 2NY0D 2O61A 3CVIL 4S1SL 4JG1L 5DHXB 2CIIB 4CKVX 2C1OB 5H94A 2P42B 4KJQD 4BQCA 1EGJL 4DZ8B 3MMEA 4GG6B 1YY8B 4M1CC 1IM3A 2CO7B 4HSQA 5GGRB 3UTPD 1CE1L 1BVLA 5TDPB 3L5WA 2EECA 2VSCA 4I4WA 4UQ3A 4TUKL 4KK9D 3WIIL 2PTTA 3BRGC 1MCHA 1Q1JH 1HHHB 1EXUA 5I0DA 3VXNA 4Y0GA 3SKOB 3HUJE 1M71A 1MI5D 3DVIA 4RGMB 5IHBA 5E08H 3LS4H 3OKOB 2IEPA 3D69B 4YHYB 1AGFA 4FQJH 4X99A 2V2XB 4JFOA 4OCXH 5DTFA 5HPOA 5C0CB 1S8DB 3NZHH 4ZXBC 3G08A 1QEWB 2AEPL 5CSGA 4LRNL 1S78D 1ZT7A 4KRPC 5IFAL 4ONHA 1DP0A 5T1DH 1X5KA 3RDTA 2EEDA 1KXVC 2A83B 2H2SD 1H3TA 2P49B 3SDYL 3MV9A 2WWKT 3D25A 3HG1D 1FNEB 4U1KA 4HZAA 1MIML 5LKNA 1ZLVK 5KSBF 3H3PL 2LV4A 4MAYC 1UM5H 2WUCH 4CMHB 1PJ9A 2W60A 1VCAA 5HGHA 3ZE0E 3IU4L 2VLKD 2YKLH 3L1OH 2QADB 1AO7E 2ADGA 3Q48A 4PLJD 3SKNA 3ILPA 4G8IA 2VNCA 2DQIH 5D7IB 3JWOL 3STLB 4KI1A 1X7QB 4I3RH 4JFEE 4R7NB 3PV6A 4N9OB 2DQTH 5I8OH 3DJ9A 5EA0H 1HKLL 1QBML 5IB4B 2OQJA 3FFDA 3HAEB 3TYFB 5TPWH 5SWZB 5IBTL 5C6PB 4JM2D 1H3GA 2I60H 5H8DA 2CDFA 5F1IB 3HNVH 4QEGA 4LHUB 2GHWB 4ZTOL 4WRLA 4AEHL 2P8PB 2VAAA 1T20B 3UAJD 1QEWA 2RQ8A 3FN0H 4MNGE 3C2SA 2X4UB 5L2JA 1B0RB 4Q2ZB 1NBZB 2RGSA 4HUVA 2JIXA 4F3FB 3MGTB 3ARXA 3GMQB 3RDTB 3R1GL 4L5FL 4WU7A 5FECB 5I1AA 3ULUH 2MSPA 3DIFB 4NKIL 2CXKA 2Q3AA 1LILA 2VLRA 4Y88A 4NHUA 4JHBA 3T8XB 3TVMB 4HHAA 4GG8B 4WW2A 1JHTA 4YBHA 5FYJL 5GS1B 1CK0L 1CCZA 1CR9H 2VYRE 4K23L 3SGKA 3VGGA 4G6FD 3ROOA 4HLJA 5IK3B 4WV1A 3ZTJH 3IF1B 2YPLE 3WHXA 2IH1B 4FTVA 4JKPL 5SWZD 5D7IA 2YPLA 5JQ6L 4RFNB 1ZHLA 5E6IC 3SE9L 1KC5L 1ZLVH 5CD3B 1DBBH 4YHOL 2NXYC 1MCFA 3KPMA 2UUDK 4LSSH 2FJFB 3VXUA 2C9AA 12E8L 4PRAB 1FNSL 1IFHL 1JTPA 2H3NA 2YUXA 4OB5L 3VXSD 2A38A 1KOAA 2BY3A 5L0QB 4RAHA 4DN4L 3CPLB 2VDOL 2WIMA 3CU1A 4Z95L 5CIPB 3KYOB 4Y5XB 5EUOF 2FJGA 4CAGA 1MRFL 4PJ5A 4F7MA 4TUOA 3W81A 3QUYD 5ICZA 4ZPTA 1AR1D 4WEUD 3SCMD 4PJ9A 5DFVD 4GRLA 1H3XA 4UDUB 3BO8B 1KJ2A 5GIRB 1QA9B 5JIKA 1ORQA 3CUPA 4F7CB 1F3JA 4DGIL 2RIKA 3B3IA 4PRHD 4YDIL 4O51A 3VA6A 2X4TB 3QDJE 5AYUH 4BQ8A 3BP6A 2PR4H 3OKKB 3NACH 1RU9H 1WZ1L 1S5HB 1A7QL 3QDJA 4P23C 3V52H 3MGOB 1MRCL 4YXHH 1ZT4B 5BS0A 1G7MB 3AREB 3CH8A 3FB7B 2J88H 2ZSVB 1KXTB 5GGSY 1FN4B 2XQYG 4TVSa 2IBZY 3SPVB 3VXRA 4XNMB 3PG2A 3GM0A 1H3WM 1ZHBA 2JE8A 4L8CA 3OKDA 3C5JB 1EFXD 3S5LB 4Y1AD 4C59B 3QRGL 1AKJD 4YE4L 2IQ9L 4I48B 5J3HC 3LD8B 5BZWB 2GW5A 5EO0A 3NA9H 4P3CL 1A4KA 1SBBA 1WCQA 4PB9H 4JO4H 4YC2B 4Z7OF 4MA7L 4LBEB 4MAUL 1WBYB 3KXFE 3LRSA 2VDMH 4J2XA 4P5TB 1AE6L 5DJ8A 1A14H 1HQ4A 1QKZL 1S7WB 2VKWA 3KS0H 3LEXA 4M7KL 1RZKH 3W39A 4HUNB 1RY7B 3U9UB 4ZS7L 1D5IH 2NXYB 1Z9MA 3CMGA 2HT3D 1NFDB 1U8HB 4CU6A 5BMFH 1MJ7H 1RZGB 1YEHH 2AJ3A 3VRIB 3DX8A 3CDGB 4XBPA 5EPMB 4YHIB 4QRRE 4ZODA 4QHUB 2XN9E 1EMTL 1RZ8A 2WV3A 5LQBH 4X8JB 2V6HA 2LAAA 3D0LB 4HQQL 4XNQA 5HBBA 1EO7A 3RTQC 4BFGA 1WZLA 2YN5A 4MS8D 4PGEA 2IAND 2NW3A 1ACYH 4OZFH 4MNQE 3WV0A 3TO2B 1LVEA 5HJ3A 3DBXA 2Y06H 1FYTA 4I5BB 4OGXL 3MLUL 5E8DL 4W6YB 4BK5A 1NKOA 3KYMA 2A74A 2WANA 4PRPD 1UA6L 2W9LA 3CVHL 4F2MB 2IPKA 2MCG1 1T1YB 2NNAB 1QSFD 3CSBA 1BBJA 2MHAA 3BZDA 4WDIA 3O2VL 5CZXC 3BP6B 1R0AL 1V8HA 4F33B 5FO7A 4LAJH 2HAZA 1Q9KB 4QHMB 3FRUB 3I6GB 1L7IH 1NLDH 4RWYL 4QRRD 1I1YA 2B20A 1RZGA 2X1PA 4L3EA 5C70A 4ERSL 4WU5A 3MV7E 3C5ZB 1JZ4A 2X4OB 4Q9RH 2X9WA 5EFIA 3I3EA 2J2ZA 1BD2A 3D3VA 2KZ1B 2DDQH 1ITBB 3O3EB 4LCCA 4LAQL 5J13B 4PJ8C 4XMPL 4PREB 3A6BH 4QXUL 2O61B 1G84A 2BXYA 4XRCA 4R6UA 3DETD 1PYWA 1FZOA 1MF2L 1G7HB 3MR9A 2AKRB 1FIGH 3OXSB 1R3HB 5J0BA 2GT9A 3ME0A 3I50L 1LWRA 4JCMA 5IQ7H 5L6YL 3E8UL 2VXUH 1KB5L 3T2OA 1CT8A 3DX9A 3QR2A 4G6FB 1KG0A 3RBGA 5I1LA 3SE4A 2E8YA 1FV1A 1RJYB 1G1CA 4X4ME 2FJHB 1YECH 1OHQA 3PGCA 2P5EB 4MLIA 3GIZL 2IH3B 4S1QH 5D7IF 5JORA 4PJEA 1U8QA 3PWJB 3ULUC 2BHZA 3ARDA 3QG7L 4O2EB 5FA4B 4NQSB 4G5ZH 5DEGB 4LSQL 4Z8FL 1BBDH 1F3DJ 1KCVH 4CU7A 7CGTA 1ZGLB 4GKSA 4QF1B 3T2QA 3T65B 1YYLL 1CGWA 3EFFA 4H8WH 2QR0A 1AIFA 1X5AA 3OKLB 4Y4HC 1QLEH 3OAZK 2P5EE 5I76A 2J8UA 4R2GD 4S1DC 5DUPH 4MCZA 5F9DC 1I1FA 1MH5A 4HIEA 3FJTA 1WIPA 4X7SL 4MVBD 1VGEL 1OCWH 4Q9QH 2EYTA 1DUYB 3BVNA 4X4YB 3IGAB 4B53A 1MCIA 1J86A 5IGXL 2VB5A 1I9RH 1R24A 4UINH 4LOUC 1I1CA 3WHE0 3MUY1 1E4WL 3BWAB 3M8OL 4HS8H 5FHAH 4NM8H 4EJ1C 3GNMH 3RVWD 4FOMA 4Y4KD 5JO5B 1J8KA 3GSQB 5DTFB 3BZ4A 1FC2D 3ARDC 1YUHA 2FB4H 2Y07H 4Y4FC 5AZEL 1WIOA 4CADB 3MROA 4PY7B 1J1XL 2WIIB 3OL2A 4UTBL 3CFDA 4PTUB 3ULVH 2ID5A 4MXWL 2X2YA 5C2BH 4N8CL 1CYGA 1HYSC 3HPJB 4Z7VE 1AGEB 5EOTB 5JNYB 5CLTA 1LO4H 1REIA 5FO9A 3KLAB 3O4LE 1FNLA 5SWZE 5K59E 5HGGS 3L5WB 2VITA 3HA0A 4Y16B 5E9DA 4H20L 4HWNA 1FVCB 5T1KB 3EYSH 2X42A 4R96A 4S1RL 5HDOA 3IJHA 2EDWA 2BX5A 1CXLA 2V17L 4Y5YC 3H0TB 4JM2B 3MV7A 4Y5YA 4K94C 3BDYL 3Q5YA 3LIZH 5FOBA 4KTDH 4WHTA 4FQHB 5D1QD 4U6TA 3S36L 5GGVY 4ZUVB 5HHVH 2BHYA 1OGAA 3O2WL 4M48H 5JIPA 3UEZA 1KJ2H 2AEQL 2LFGA 2MCPH 4PJAB 4UAOC 5K9KA 3G5ZA 3NFPA 3P4LA 3QG6B 4MJIB 4IRZL 4DCQA 5BQ7B 2X4SA 3MRKB 1NGPH 2E5EA 3WN5B 2FX8L 1EFXA 1JZ7A 4HG4K 1DL7L 3MYJB 3EFDH 5T3ZH 4BFEA 3QBTB 4J12A 2FR4B 1FO0A 3BKMH 3ARBD 5E9DD 2IMNA 4P23A 4YHZH 4ZFFB 2Z31A 3PHOA 2APVA 4MNHB 1P9MA 5C8JA 3MNVB 2PXYB 2VR5A 3QHTC 3NABH 3LKPB 1MAJA 2PTUA 4G9FA 4FQQB 1V3KA 3HMXA 2OXHA 2Q6WA 2VDRH 1HHGB 2NTFB 3BRFA 4PR5B 3Q1SH 4WO4C 5I30L 5FYKE 5EDXA 5BJTA 5EC2A 4Y5XC 5JXAH 4Y5XA 1VFBB 4HZLB 2R15A 3R1GH 1RK0B 3RUGA 2A73B 5D7KE 4ZSOA 5K9QG 5KSVB 2CKBH 2VAAB 2EICA 5J9PB 3T3PF 4BK4A 3T08A 2CMRL 3WDIA 1W8NA 2YXMA 1AD0A 3QIUB 3DUUB 1ONQA 1T1ZB 1NH6A 5DT1L 1KENL 1SY6A 1UXWB 2YD2A 2XQBH 3VXUD 4TNWK 1EHXA 3MRMB 4OJFH 3QDJB 4QTIH 5IJVA 4OM0L 2HG5A 4JY4A 5EZOH 3DUSA 4Q74A 3SE9H 1KC5H 4G42B 2ZG1A 4GMTL 2PUQT 5FM5M 5HGAA 3Q2CA 1U2CA 3O4OC 3MO1B 3PHQB 4G80B 4POYA 3N1FC 3IDNB 1AXSA 4LKXA 5B4MD 1CGUA 2A6IB 4QWWC 3O9WB 1CL7L 2R56L 3LQAH 4FG6D 2NW2B 3ILQD 3QDMA 1ZANH 1N0XL 1XMWA 3UBXI 1PG7L 1P1ZA 5CGYC 1GHFL 5D1ZD 1QSZA 3L3IA 4G6JH 3V0AC 4K7FA 1X5HA 1H5BB 3WE6A 2DQFB 3RA7H 1ZT4A 1ZGLM 1KJMB 3WFEL 1E6JL 4PRAA 5KG9B 1OSPL 3MBEA 1W0VB 4E0RB 1FSKB 3VXUE 1MJUH 4ISVA 1KN2H 3MCKB 1YNTB 4WVRA 4JM2F 5HHOB 3B9DA 4OZHB 4AEEA 1SJHB 5H37H 3GK8L 2ZSWA 1DVFD 1C5DA 3LDBC 3TNMA 4CW1B 3QULA 1RJZB 1DBAH 1VKXA 3O4OB 2F8XC 1YQVL 2NY5C 3U36A 1G9EA 2NY5H 1UJ3A 1BJ1J 1B90A 3L3KA 3N85H 1PG7W 4I4WB 2WBJA 5F7YC 3NIGE 3LD8C 2XT1B 1DDHA 3QI9A 5LWYH 4ZQKB 4WFGD 4YEEA 5EC2B 3CCHB 4ORGB 3TPKA 1FPTL 3T77A 3MOBH 4MZ2A 1UG9A 3LEVH 1U95B 3GIVA 2MOVA 1N0LA 4X83A 3MRPB 3KJ6H 2HKHL 5DMYA 1RK0A 5ANME 5CILH 4NC2B 4L29B 4HBQA 4WTZG 4TSCL 1FYTB 5ECJE 1KNOA 1T3FA 3L3IB 5KSAB 4KJWD 5EIIB 2P8MA 3GBNH 5DRWB 1KYOJ 3ROLB 3DVNB 3W11D 5C2UB 2OCFD 4KRPB 4I8DA 2VLLB 5MEOB 2OL3H 1A1OA 1UXSA 4P2RA 4PB9L 3Q5TA 4ZOAA 3VH8A 5A3ID 2LTQB 3HI6L 4L8CB 5EZJB 4P2RE 3ULUF 3B83A 5B3NA 4MWFB 5T3XE 4EUPH 1KUMA 3MQIA 5CEXA 3QWOA 3M17A 2RR3A 1ZXQA 1Y6KR 3K8MA 3ETBF 5FYJU 1KFAH 1X4ZA 5CJQH 2DLFL 3A67H 2UZXB 2GI7A 1HHIA 1M05A 2E7MA 1FDLL 3M45A 4OLWH 2FL5B 3EDEA 5E8NA 5E6ZA 3FONB 4HWEH 1K5NB 1RUPH 5D1QA 3MJGX 4OV5A 3LEXB 5A2LH 2CRIA 2OR9H 2YRPA 4HFWB 5KVFH 4PGJA 2E6PA 4OGAD 4KQ4L 2WWMD 1G7HA 3MR9B 5LQBL 3ALWA 1UKTA 1JTOA 1SYSA 4YDKH 5SV3A 2HTLD 3E6FA 2GK0B 4Y7MA 1A6TB 5E2VL 3TJEL 3WFDL 1XF3A 1G7QA 3FHAA 2XYCA 3OHXA 1MWAA 4XNZB 1KIQA 2D9QB 2NLJA 2W38A 3JVGA 1Q9LB 5T3XL 4PJEF 3KLSA 1QFOA 3MFFA 4U1NB 2GJJA 2FSEA 4NBZB 3V6FB 4HUUB 2CDGB 1R0AH 2W0KA 4HJGA 2IADA 2DKMA 4JKLA 5J6HA 3IFPB 4CN4A 5INDB 1JZ2A 2P4AB 2X5PA 4JFXA 4MA8L 1FL3A 5DHVH 4LRIC 3JTSA 4WWKA 4GKNA 1YNKH 4UT6H 5C6WH 1X5FA 4EIGB 2Z8RA 3UZVB 4F7CA 1LO2L 4PJXA 1BQHA 3QFDB 5I1CL 2IPUG 4TULL 3EOTH 4PJXE 4LDEB 4K3EH 4YHLH 5C9JA 5D7LD 1NCNA 2B5IB 4EOWH 1ODAA 4BQ9A 1G9MH 5DFWH 1IAIL 2WM0A 1G0XA 2IGFH 1LD9B 1MF2H 2YD1A 4GXVL 5GRUL 1QYGL 4IJ3C 3HLAA 2VO5A 1IT9L 2ZOLB 4Z7UB 2Q86A 5TQ0H 4QHNB 4U1IA 3HC0B 5HYJE 4PREA 4H1LB 4CNIA 3B9AA 3WLWC 3QO1B 4LQFH 2W0FB 3K0WA 1IILE 1TENA 3FQUB 5D7LE 5IF0B 3L95A 4WI8A 1BLNA 4XPAH 3X3GH 1AD9A 4LEXH 2LVEA 1RV6X 3ZKQD 3HG1B 3WMSA 2HFTA 4G5ZL 4DZBB 4M4PA 1LP9E 1QA9A 5D5MF 3IDXH 1YPZB 4K3HA 5TDNB 2GSIA 1XR8B 4YXLH 1YYLH 1BWWA 1LP9A 3LPGA 1JHLH 2CDEB 4ONOA 4EI5A 1U3HC 4XCEA 4OZIE 5D7JC 1NGZB 4NZRH 4O2EA 4YAQA 1U92A 2HJFB 4E41E 43CAA 1SYVB 4OZIA 4MD4B 3TIDB 3TZVA 4U7KA 3P0YL 1WZMA 5TE4L 2NXZC 3FB6B 5DUPL 2LTQC 3CJJA 1KT2B 1U8PB 3EO9L 1OLZA 2VC2H 3OHXB 4G9DA 4QRSB 4XNMA 1J12A 3TPUA 1OCWL 2AEWA 3O3DA 5LCVL