5JHGB

Crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 11
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA bound with its inhibitor and ARHGEF11
rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 58
structure length 178
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jhgB00
4C2UA 1NSTA 3I1FA 1UM8A 1G16A 2GKSA 3RDPA 4KO8A 1BS1A 1S4QA 4GOXA 5TMPA 2IEYA 5C4GB 1A1VA 4IKEA 4HLDA 4PAQA 4V0LA 4Q7KA 1KMHB 4B43A 2IXEA 2HCJB 4Z54A 5GJBA 2Z83A 1KI4A 3ZYCA 1KZ7B 2AR7A 1VCMA 1Y3AA 4DVGA 3U7FB 5BN4A 4KFUA 4HAVA 2QMEA 4P4UA 2UZIR 3THWB 4DSNA 3Q8XB 2BBWA 3QKRB 1BKDR 1JQJC 2FMXA 4DLWA 2A5FA 3LW7A 2QM8A 4QGFA 2ZJ5A 4JLAA 4D82A 1DEKA 2AXPA 3VFDA 4O3MA 1WXQA 1M8PA 4QHTA 1ZM9A 3WYFA 4DCVA 4P33A 2NO1A 1XX6A 4JYCA 1DAGA 5FR2A 4FMCB 3TNFA 1KKLA 3I5YA 4HZUB 1KI6B 2IYXA 1VMAA 2ZR9A 5FTNA 4OYHA 4HUQB 3WBJA 4GFDA 2JLYA 4AKIA 5B57C 2ZSDA 1XCPA 1J2JA 3RABA 3UKDA 3VHXA 4DDUA 1XFAA 2P6RA 4M0LA 5BW8A 3FMIA 1D6JA 2GBLC 2BVNA 4PC2A 3WYGA 3A37A 2OCPA 3LLUA 4PPNA 2WTUA 1Q3HA 4CT5A 1P75A 1E98A 4RFSB 4Q9LA 1KJYA 3ZGXA 1TU3A 3AUXA 3BH6A 1ANKA 1ZMXA 4IVRA 4M22A 5F98A 2Q3MA 2ZE7A 3U61B 2HJGA 3HPQA 2G3YA 4LBZA 2VBCA 4MYCA 4U02A 2AXNA 4ZO4A 4B74A 2FPMA 5AJXA 5G3ZA 4HATA 2ZJ8A 2VHCA 2ZUDA 3B2EA 2QTVB 2VHUA 4BEBA 4HYYA 4Q1AA 3EXAA 1VDZA 3K9GA 3PUXA 3BBPA 1N5IA 2IYYA 4OQNA 3CX8A 5JWOA 3VU9A 2GILA 2F3RA 1G7SA 3IPYA 3Q85A 1KK2A 4HLUA 4BLRA 1VCOA 1XEXA 1Z8FA 5H70A 2AN9A 2W0SA 3OIYA 5G3YA 5F3WB 3K0AA 4IOJA 2WJYA 3CPHA 3MMPA 3GP8A 1JAIA 4Z8YA 3OEEA 1W5SA 1UEIA 3A1TA 3D6TB 1N5JA 2YOFA 3R7WA 1KI2A 1UJ2A 4BLSA 5FUXA 2JASA 1ZC3A 2GCNA 2OFOA 2WV9A 2GJKA 5AR1A 2GTPA 2ZYWX 3SJCA 1B23P 1XTIA 2CVFA 3IO3A 2ZSBA 4YXWA 4PANA 2A9KA 2R6AA 2GXSA 5F2EA 3L0OA 2W6ID 1GL6A 3DOFA 2QNRA 3IBYA 1CP2A 4PC3A 1EWRA 2Q21A 2ATXA 1FMJA 4IXNA 4UJ5A 1YR7A 2OCBA 4DLZA 1G3RA 4B3XA 4LPSA 2C99A 4MYUA 5BWMA 3KKMA 1QHHA 3W3AA 2W0MA 3UIEA 1AZSC 1V43A 3OAAA 1L7VC 2AWNA 1ZUHA 1R5BA 2H7VA 1HEIA 3BERA 4I1VA 4P32A 1OYWA 3NH6A 4BQSA 3KJEA 1N6IA 4YDHB 1OXSC 2AWOA 3PQCA 3GLFB 2PMDA 1S9DA 2A5GA 2RCNA 2WJJA 4GPTA 3BS4A 1NN0A 4N0DA 1FZQA 3K0CA 1XTQA 4YQFA 3EZ9A 3CX6A 4ZKEA 1J90A 2JJ8A 3C41J 1R0WA 2R9VA 2YINC 4D2IA 1ZM7A 1JR3E 1N0VC 4L8GA 5DE3A 4CYMA 1OW3B 1GRRA 1ZYUA 1OHHD 1NL3A 5KTYA 2XITA 1OF1A 1GL9B 3N2IA 2OT3B 3TR5A 2G0TA 1Z08A 4QXAA 2GWHA 3CRVA 2X19A 3PR1A 1CXZA 1FUUA 1MO3A 5KDDA 2NG1A 1FNNA 3EZ2A 1JXMA 3CUEF 3AP3A 5C4MA 1E79A 1US8A 3QUSA 4PAOA 4NCKA 1G3QA 2VSXA 3AKDA 4Z1MD 1TUEA 3DMDA 2W2XA 5FBLB 1KIMA 2IWRA 5KNCA 4C7OB 2V1UA 3CRQA 1UDXA 4N3NA 2R65A 4A15A 3B13B 5M04A 3PEVA 1W0JA 3EIHA 5EXTA 4HEJA 1KI9A 2J7PA 4HLQB 1KMHA 1RRPA 3AKYA 3WP0A 5UKDA 1R8QA 2JJ2D 3SQXA 2XSZA 3I5XA 5CLLA 2J0QA 1N5LA 4RZUA 4X8OA 5SZKB 2FSIA 4ZDIA 1XD9A 3SBEA 2XZOA 2IYZA 3THWA 1CJUC 4HAZA 2Z4RA 4ASUD 3GJ0A 1Z22A 3QKRA 3W5IA 1Z0AA 4DCUA 1Z2AA 2J0UB 2WJVA 2F55A 3UXMA 2XXAB 1G19A 3E5HA 1K5GA 2IK8A 3U5ZB 2QP4A 1PZNA 2CHGA 2REOA 1VKJA 1JR3D 2KSQA 5IHPA 1CULC 4HZUA 1KI6A 5IK2A 1AN0A 5EE9A 4URXR 4HUQA 1XCGB 2YC2C 4HAXA 2CDNA 2FEOA 1EFHA 3I73A 4ZCIA 1E32A 3S1AA 1MOZA 1E96A 3KKPA 1P62B 4AYXA 3I72A 1P9RA 2NO7A 3CIOA 3M6AA 4AY2A 4Y0VA 2C9OA 4BLOA 4V03A 4ZI2A 4A4DA 5J4YA 4J0QA 4PO8A 4RFSA 4MGIR 4FIDA 2JLUA 3C14C 2GF0A 3CF6R 4WOPA 2BIFA 2KBFA 3OE7D 3THYB 1WBBA 4MA4A 1W46A 5HCNA 4WBSA 3TLXA 1EFUA 4OKSA 1G3IA 1FNMA 1L2TA 3O47A 3Q7QA 2O0KA 1W0KD 2HCBA 3ZLJA 1OKKA 4S2EA 3TVDA 2DWPA 3QBTA 1NN5A 4NONA 5AUNB 1E3MA 2JCSA 1VG8A 1XXHB 4RFVA 1XPOA 4IOMA 1WF3A 1W4AA 3TUZC 5LB2A 2J1LA 2ZTSA 3O8BA 1K8RA 1N5KA 3U3OA 1Z63A 2BC9A 1T8UA 3UMRA 1D9XA 3LBIA 2JLXA 1NN3A 4WAUA 3L0PA 2O8EB 5JZVA 3QKSB 3K0EA 1RFLA 2ZETA 2ZUCA 5GADl 2OG2A 1Q57A 2JLSA 3MWKA 1A82A 4JL8A 2PH1A 5J40A 1RPZA 2LWIA 2D62A 1FFHA 2IW3A 4A8JB 2PZGA 1XZQA 4OL0A 2DCUA 4XH9B 5G41A 4JSYA 2FZLA 3U7HB 3RC8A 4XWOA 3VKGA 3ZS9A 1OXUA 1YU9A 1XD8A 2CE7A 2EU8A 2VEDA 3ASZA 4WIAA 1FW6A 2QTFA 1IHUA 2RHMA 1Z83A 2HEIA 4M53A 5HKKA 4V0MA 3IKJA 4YC7A 1UF9A 4DSOA 2ZR7A 4LV6A 2ZRAA 1A4RA 3KJHA 1SVKA 2FSFA 3DPUA 4M21A 3AF3A 2F1RA 2X2EA 3NBYC 3H0KA 2W6IA 5JRJA 1I2MA 1GOTA 2XTMA 5EXSA 3GLFA 1QHXA 1GNPA 1QHYA 1QVAA 1SVLA 3QXCA 4PPFA 2ORVA 3MWJA 5EXXA 5JJKA 3Q3JB 3QQ5A 1O3YA 3U4QB 2ZROA 1DS6A 1N0WA 4MRNA 4KLZA 2NOAA 1NNEA 3QIAA 5KSPA 5GJWC 1KO5A 5JECA 4A36A 4GL2A 2ONKA 3QSYA 1AA9A 3RYTC 3SYKA 3QBVA 4MITA 3GLGE 2OLJA 4NU0A 3EX7C 1QHNA 1NMXA 4UXJA 5HE9A 5K8TA 4PX9A 1U9IC 1HQYE 3TUJC 2D06A 3CBQA 3ETLA 1NBMA 3BWDD 1LFDB 4G5OA 1H8EA 4TL7A 5BN5A 2BJWA 1RYHA 1DO0A 2GEDA 2RGDA 5AJWA 2C98A 1XDBA 1XMIA 4Q03A 4CF7A 1ZM4A 3A1UA 4Q66C 2YKGA 3AGPA 4C7OA 1MO5A 2CNWA 1D8TA 2MSDB 4DLTA 2Z4SA 4IEEA 1Q22A 3IQXA 1SZPA 4KVAA 3ZVLA 3EPJA 1AJEA 2QPOA 2WWXA 1S2MA 2CL6X 4BECA 1LF5A 2WZQA 3VNUA 4JBXA 1E2KA 3MUFA 3ZJYA 1BMFD 1M34E 1YZLA 2XX3A 2R6FA 4BUJA 2VHJA 1HA3A 2OXRA 3TIFA 1E9DA 3TVTA 1Q0UA 2QM7A 1YVDA 2QTHA 1G4UR 1WCV1 1E1RA 4NZYA 1U8AA 4MH0R 2Z43A 2J0UA 2HF8A 3RWOA 4OHYA 3QY0A 4CW7A 2XXAA 1T0HB 3K8YA 3NBXX 3T5GA 1UADA 3LD9A 5KNDA 3MJRA 5JS8A 2RHDA 5BYJA 2QT1A 2WAYA 4XOIA 3WMEA 2C78A 4DLSA 2ZJOA 1A7JA 2V8OA 4ASUA 2YWEA 2Z5FA 2OXCA 2G6BA 3SYLA 1U90A 1W7AA 3O8CA 3E1SA 1YR9A 4G01B 4KYIB 1DO2A 3B1WA 2O52A 1S1CA 3KX2A 4BLPA 5JBQA 4JSTA 4ZIRB 1TNDA 1FTNA 1XB2A 2ZYUX 2PEZA 3FE2A 1YQTA 2E1RA 2BHRA 1EG7A 1G5TA 1I4TD 1IM2A 2PZFA 3THYA 2HLDD 4I99A 3TMKA 4RCZA 3OHMA 5EJEA 1QHIA 3NDBB 4KHZA 3OFND 4US0R 1R5OA 1YZGA 2VA8A 1N6PA 1HUQA 2BKEA 1XXHA 3U3MA 8OHMA 2OCYC 3LVRE 721PA 2QPAA 3B1XA 4Q4AB 4C0SA 1T4GA 3QG1A 3FMFA 3CH5A 1EXMA 4FMDB 3ZZ0A 2O8EA 3QKSA 4JL5A 4UKDA 5F9HA 3UK6A 3P32A 3EASA 1LF0A 2DWQA 2H17A 5J47A 3LAWA 3TQFA 2ZI9A 4RSGA 4OI4A 1WA5A 1KI3A 1P60A 4IFEA 4TSFA 3FKQA 4A8JA 3MAAC 1WRBA 5FFMA 4AKEA 3MWYW 4PC6A 2F1IA 5FUWA 4HAWA 3K09A 3ZVMA 2ZREA 4C4PA 5IRCD 2AK3A 2GEUA 1C9KA 4XIGS 2KI5A 5FTJA 1BYUA 4B2LA 4IJMA 4GOKA 4L16A 4LI0A 2RGGA 1IJEA 3IUYA 2CMKA 4V02A 2RGAA 3RS0A 3AKCA 3QOFA 3V9PA 2GESA 1N6NA 3C4JA 2FFAA 2C95A 4WZ6A 2WM9B 4WXPA 4A0GA 2GXQA 4BRWA 1G8FA 2QMUA 2DBYA 5KHOC 1YZQA 3AVVA 5E3HA 6Q21A 2B8WA 2C8VA 1Q20A 2WSSD 4P4SB 5IDVA 4KBFA 2ZI5A 3BXZA 4TT3A 1TADA 1T9HA 3U4QA 2MSCB 3RVBA 4D81A 1IONA 1CJKC 1DAEA 4M4SA 3EWAA 1F2UB 3U3KA 2RAPA 1RKBA 3HYTA 1NG9A 4UNRA 3BORA 1NRJB 4ZDJA 2QAGB 4LX0A 2PX0A 3DZDA 4LJ5A 4LJ4A 4DEXA 1KOFA 3IQWA 1YZUA 4ACBA 4EJSB 3LQQA 1G20E 3ZH9B 5B64A 3PEYA 4OQMA 4QNRA 2VHTA 2CHVA 2I4IA 3CZQA 1AQUA 3DZ8A 1X86B 5KOYA 1Z07A 2AKYA 2G1JA 3TE6A 4XVUA 2IYUA 1CU1A 3CB4A 3FHCB 1G7CA 521PA 1IN4A 3K70B 2FV8A 4BFVA 5DIFA 5FBQB 2JATA 3DL0A 5CLQA 4AG5A 3AVPA 1GZSA 5DSZA 1VCIA 5E7MA 2IC5A 3U6KA 5IF9A 4D4JA 1W2HA 3DKVA 2VP6A 4B76A 1GNRA 4KXFB 1R4AA 2VYFA 1Q21A 3AVOA 3DHWC 4JT4A 3E2IA 3BFKA 5FOWA 2C96A 4KFRA 3TR0A 3U44B 3HP1A 3EZFA 3KL4A 1JB1A 2OE2A 3K53A 4IDPA 4QM6A 2ZJYA 1NVUQ 2Q6TA 1DELA 5IT5A 1AKYA 4O0MA 3HU3A 4PQRA 4B48A 2QT0A 5JLJA 3VKWA 4A0RA 1ZRHA 4AI6A 3DO6A 1U8YA 4TQUS 4YMSA 3NBZC 1HYQA 4TLEA 5L3QB 2EFEB 4DBLC 3GLIE 3W6NA 2G1KA 1P2VA 4AK9A 4OQFA 3N5CA 1KI8A 3AUYA 3QKTA 1DAKA 3DDCA 4MGYR 4M8NE 1T6NA 4POAA 3LLMA 1W49A 1U0JA 3FKSA 1L4YA 4KLNA 3LDAA 4EQ6B 2P67A 1TU4A 5CK5A 1NN1A 1ZW6A 5KPJA 4RZXA 5FBWB 3GJ6A 4P0TA 5EP4A 4DKXA 4E5UA 1H8HA 4G5GA 4TLDA 4PHTA 1G6OA 4ZIRA 2ZU0C 3C15C 2OBLA 2HF9A 2LCFA 4MKFA 4RZ2A 1EK0A 1HURA 3A1SA 4M1SA 2XOKA 2EYQA 2ZRLA 421PA 4BLTA 4OK3A 2D3WA 2QAJA 4JBYA 2ZPTX 2P3SA 3LVQE 5HR5A 2FWRA 2F1HA 2P6NA 3T61A 5P21A 1XEFA 1KAOA 1Z6XA 4X8LA 2BEKA 2BBTA 4F4JA 2N1BA 3KQKA 2IYTA 1VHTA 1KSGA 4F4IA 2XB2A 3O8DA 3P26A 1HE8B 3QE0A 4Q4AA 1KSFX 4LHWA 1OV4A 3A4LA 4OBEA 3OIVA 2QRNA 2CXXA 3X1DA 3PEUA 1HT1E 3EZ7A 2YC4C 1ZCBA 1ZCAA 2VH5R 3H86A 4BFZA 2ECKA 1VYVA 1CR2A 4MRSA 2DY1A 4X8MA 3GQBA 3T1OA 1ZU5A 2WIAA 3VR6A 3ZIAD 4CIDA 4LYJA 5C1BA 1OH8A 1N6LA 5FPYA 4LPKA 1E4YA 3FGNA 1ZBDA 3ZVNA 2N42A 3P20A 2ZJ2A 4WZBE 3T12A 4EUNA 2ZSEA 2NPIA 1P2SA 5DO9A 3HPRA 3MLEA 1UKEA 1SKYB 5CIQA 4NBSA 3EA0A 1KO7A 3IHWA 3BB3A 1DE0A 2XNDD 5ANRB 1NMZA 621PA 4EFNA 3T15A 2MMGA 4V0OA 4JLOA 4MYTA 4FMCF 1ZVQA 4Q4HB 1KDOA 4RKEA 4BEJA 1IJFA 5C2JB 1GDDA 4E09A 5DNYB 1D2EA 1AQYA 1XTSA 4D0GA 4YMTA 4BLQA 1W5TA 4G5SA 2Q3FA 4ZV4A 4FMBB 2ODEA 3SBDA 1TPZA 2GDJA 4I4LA 1FTSA 2JIZD 3Q5DA 4P4SA 1ESMA 2R2AA 3I62A 5FI1B 3HU1A 4MUAA 4IEIA 4YDSA 4HSEA 1R2QA 1KY2A 4HDOB 3NKVA 1NIPA 4TMVA 1KSJA 2EFDB 2ZXUA 1F2UA 3CF0A 2ZU6A 4LV8B 2IYSA 4EPWA 2QAGA 2CVHA 4M1TA 1GVNB 1JPJA 2IF0A 2REXB 4PZLA 2DFTA 4EJSA 3X1YA 3S1AB 2C9YA 2JAQA 1SVSA 2WSSA 4HLCA 4BZXA 1E2PA 3TAHA 3AF1A 2PT5A 4MQBA 1U94A 4Q00A 3QF4B 2Q9CA 2W2VA 3IDQA 2DFLA 4Q1DA 3BH0A 5FL7D 2JEOA 4PTLA 2IHYA 4PZZA 3WNDA 2N46A 1Z6TA 1G7TA 4AD8A 1QHSA 5CM8B 4PC7A 2ZJZA 1R10A 2IF2A 2RGNC 4JVNA 4Q1BA 5TVKA 3X1WA 3D8BA 2AL7A 2ZRBA 1YRAA 2QGZA 2WSMA 3U44A 1Z0JA 3OIWA 4XD7D 1KK3A 5KU1A 4JLKA 4D26A 3GFPA 1OLOA 2JGNA 2IL1A 4RVCA 2ZR0A 1XMVA 4OK5A 1BOFA 1S3GA 1G1MA 2QENA 3GLHE 4AKHA 3RSLA 2Q9BA 4D80A 4M1YA 1KNXA 2IBMA 2YZ2A 2CLDX 1QZXA 4MYHA 4UJ3A 4B3DA 3CF2A 1SULA 5L3QA 3DVLA 3K9HA 3L2OB 1JBKA 4JJZA 3KXIA 1QBKC 1G18A 5ELXA 4OJQA 2HXSA 3KJIA 3WNCA 4E22A 2ZE5A 3Q72A 4FCVA 2V7QA 1G3MA 3RC3A 2GNOA 1RRGA 3B6EA 2GXAA 4AG6A 4EQ6A 2HUPA 3HR7A 3O8RA 3CM0A 5FTMA 1FQJA 2AHOA 1KO4A 3Q9LA 3NHBA 5FOTA 1SVWA 1XTJA 2W6JD 3ONWA 1LV7A 1KNQA 4OHXA 4Q4JB 1X8KA 3SZRA 2IA5A 1SVOA 1F60A 2GCPA 5J4HA 2QZ4A 3EC2A 4ZCLA 1JJ7A 2DPXA 4HAYA 4F93B 5K8LA 1E9BA 3SDZA 1HV8A 1EX7A 1P2UA 1P61B 2IS4A 2KJQA 1RE0A 1JEDA 2BM1A 4KJZA 3VR5A 2FFBA 2LKDA 3QNUA 4H9GA 2SHKA 3QPWA 4L15A 1Q44A 1II9A 3BAFA 4URYR 5JWRA 1TL7C 2QN6A 3IGFA 2ZRKA 4MKIA 3R20A 3SN6A 2VIIA 3IEUA 1ZM3A 1GL7A 2GK6A 3OEHA 4LYFA 5JI2E 1W36C 1DVRA 2W00A 1ZNWA 1Z28A 4KI0A 4L9WA 3PJRA 1DG3A 1YZTA 3QPUA 4Z51A 3QF7A 4M2LA 3ICEA 2CCJA 1E0JA 5FL3A 1M7HA 3AVQA 2OCAA 4WW0A 1NG1A 1XP8A 4K81B 2J0SA 5EXPA 1Y63A 1NY6A 2IS2A 2ZYVX 3Q5EA 1N6HA 4B35A 1XPRA 1Z0KA 3WNBA 3RS7A 1A2BA 4NCHA 3W34A 4XWKA 4NYMQ 3GD7A 5H8WA 3AEZA 2FOLA 5FBRB 2YWHA 4XTCS 3PITA 2AD1A 5LD2C 4M9SA 4Z8XA 1M7GA 1GRQA 4Y0AA 2BMFA 4DLXA 2PJRA 4AIIA 1R0ZA 4LJ8A 4LWZA 4UNNA 1Z0FA 2EWVA 1RYFA 4Q4HA 2CK3D 3EW9A 1YRBA 3NG1A 3C7KA 1NMYA 1XMSA 5DGXA 5CB8A 2ZITA 2JLQA 2B8TA 4DJTA 2GEVA 2HT1A 1PJRA 1COWD 2FSGA 2RGCA 2OUKA 2XNSA 1Z6GA 2FH5B 5H68A 2MMCA 4LHVA 1VG0B 4KBGA 2QSZA 4AC9A 1CEEA 3C8UA 4B2IA 4B3FX 4QJ3A 4BFXA 1EFCA 4Q1EA 1UBCA 2EVWX 4PO9A 1KO8A 4LV5B 1CJVC 2RB4A 1F5NA 1OJLA 2AFIE 2Q3HA 5A4JA 2CLCX 3TW8B 2ZRCA 1OIXA 5C46F 3I61A 1X6VA 1EGAA 1MRSA 3KJGA 2A7QA 4I1OA 4TQAA 3U3RA 2DB3A 1Q1BA 3GEEA 2B21A 5JS7A 1SXJC 2IYVA 4DSTA 1W36D 1W4CA 3TAUA 2L0XA 1Z06A 5FPHA 3SQWA 2JJ1D 3PENA 3QF4A 2J87A 1KSHA 1G17A 4L9SA 4F92B 3KQLA 4IDNA 5CJPA 5CYPA 1SXJE 1NLFA 2ANBA 3KKQA 4RY2A 1CLUA 2GRJA 4NH0A 1CR1A 2QA5A 1XWIA 1WE2A 4P31A 3GMTA 4X8HA 1G21E 3UG7A 4NHOA 2YYZA 4Q18A 3THXB 5JRZA 4DLRA 2GZAA 4XSGA 4PPQA 1QG2A 4CGZA 4ESHA 2DFNA 5BXQC 1WP9A 4EPYA 3PFIA 2VPPA 3C5CA 5CJ2A 4OK6A 1D5CA 3B9PA 1NI3A 4EFLA 3N2EA 3MJHA 5EE3A 4DDTA 2C2HA 4LC1A 3B60A 4IVPA 1G8YA 1P7CA 4UNPA 4HZIA 4LHXA 1P9WA 1RZ3A 1FP6A 2FSHA 3QI2A 1RW4A 1U0LA 3WYAA 1VG1A 1GTVA 5JSZB 2EW1A 3UG6A 1XF9A 3RRYA 1MV5A 2V9PA 4LBWA 4EFMA 2D7CA 2ZE6A 4ZDKA 4NP6A 3AH8A 3PUWA 4PHFA 3CRW1 1E2EA 4QGHA 4B3BA 2WMNB 1MRNA 3OZXA 3EPLA 3VAAA 3RS4A 4JKIA 1PVOA 4EPTA 2WPDD 1AK2A 5DHAA 3L0IB 4UNQA 5CITA 4EKDA 1TQ6A 4M1KA 2J3EA 3MGCA 4F91B 4JLNA 3V00A 5DISB 5F9FA 1NLYA 2Z6VA 4Q4JA 3VR3A 4OI1A 3MRSA 3KKOA 5EP2A 1HQCA 1SXJD 1QDEA 2F9MA 2GCOB 4DLUA 2CJWB 3BH7A 3TSZA 1R8SA 2NGRA 1SVMA 1N6RA 2JDID 2R8RA 1S3SA 4GDFA 3LXXA 4A2WA 3AVUA 2ZS8A 3ADDA 4QKQA 1N3BA 4G5RA 2A5JA 3EWSA 3UMFA 1P4SA 4V0NA 1IN6A 2F43B 1VPLA 1R5NA 2GBLA 3LFUA 3U60B 4DC9A 2XZLA 1E9CA 3KB1A 2BV3A 4YMUA 1KK1A 4GRAA 5CDFE 4D6PA 5LBIA 4B33A 1DAFA 2WJHA 4CT4B 2YOHA 5DN6D 5J4KA 3V4RA 1GSIA 3L43A 1NLZA 1NF3A 1VYTA 2VP2A 1GKUB 3MCAA 3WHKA 3LW8A 4FW9A 1OH7A 1D2MA 2REBA 2ZAOA 4GOJA 1TEXA 5CB6A 4O25A 2GXUA 1MKYA 2BKUA 2OSBA 4EDHA 3K0SA 2ZUBA 1T3LA 2RH5A 3UWKA 3B82A 1OHHA 2VP5A 2QRZA 1Z0IA 3FMOB 4A6PA 2YHSA 4MGKR 3SJAA 5KO2A 3OESA 1WB9A 2HJVA 2C03A 3I8SA 2HV8A 4LY6A 1MO6A 1Q1EA 4DT1B 4HB4A 4M9XA 2OLKA 2WOOA 3HWSA 4B47A 5J4LA 3AF4A 4B32A 2EWWA 3L8YA 4UXIA 3U3JA 2YWFA 3R8CA 1PLKA 4NYMR 4Z1MA 5DYGA 5KSOA 3QEOA 2IS1A 2YWGA 5GJVC 2IUTA 3NC0C 1CF4A 4OHZA 3GPLA 1XJ0A 1G64A 2NTYC 1UBFA 2D74A 2WKPA 4Q02A 1HH4A 4UXHA 2O5VA 4A9AA 3SC3A 1N6OA 2QMHA 3ND8A 2AKAB 2ATVA 1JEEA 2JJ2A 1FUKA 2EFCB 3D7MA 1QF9A 2V4ZA 3B5JA 4Q47A 1E1QD 3BOSA 5TXGA 1ELOA 2ERYA 4C0AC 4U7DA 5KYKA 1XNJA 3SEAA 1VG9B 3LV8A 5KUTA 1GAJA 2BMDA 1XMJA 1KDTA 3CPJB 3IHLA 3JZMA 4AWXA 1JR3A 5FOSA 1TF5A 3KB2A 3NWJA 4JLJA 4LJ9A 2IUUA 1TX4B 3K1JA 4TMZA 4XJXA 4TZ0A 3KXKA 4N0EA 4CDGA 5DLQC 3NVAA 3RANA 4WXRA 2ODNA 4NKRA 1G8PA 3W5JA 4TL8A 5L8VA 4DCSA 4KAXA 2OEPA 3GLGB 2RMKA 3DM9B 3VX4A 4C30A 2ZRMA 3NH9A 4FMDF 4QM7A 2IWHA 4EAQA 3CWQA 3ZVRA 1G4AE 3THXA 2I1QA 4IOKA 1GITA 4KU4A 4DLVA 1Z0DA 1U0HC 1JI0A 1YHNA 1IXZA 1IQPA 1GFIA 2ZRGA 3U6BA 1TQDA 1ZP6A 2PEYA 2RKOA 3RAPR 2YV5A 3W9YA 1E9RA 4DIEA 4XWAA 4GP7A 1E2QA 1TEVA 3OE7A 2HDNB 4LDJA 1T5LA 1X1SA 1JECA 4AKGA 5EUMA 1OXTA 3PV0A 4QL3A 3RS2A 1S1MA 2P65A 4B3CA 4QGAA 2QORA 1SHKA 4GSYA 4EPXA 1QG4A 3P1JA 4O2LA 1W0KA 5BYKA 5JSZA 4URWR 1W48A 1HT2E 2QL6A 3IO5A 1I4DD 2V6JA 4KFSA 4II7A 3K0FB 1AM4D 4BZQA 1D9ZA 1Q3TA 2GK7A 4Q19A 1N0UA 2EYUA 1GWNA 3ZQJA 2O0HA 4JLMA 2XTZA 4B34A 2WIBA 3TKLA 5GVRA 3CLVA 2FN4A 4PC1A 4JLVA 4Q9HA 1CJTC 1JQLB 1PLJA 3B1VA 4HLUC 5A0FA 4CEIB 3R9IA 4PQFA 4DLYA 2B7CA 2LKCA 1N2CE 1E9FA 1RJ9B 1M2OB 2BMEA 4W5HA 3VX3A 1TTTA 1GIAA 3AP2A 1GILA 2GCOA 3NIBA 2CJWA 4JVSB 4PQYA 1N6KA 3ZZTA 3QXHA 3BE4A 3VQTA 1UAAA 1EFRD 4PFSA 4FCTA 4LSGA 4V0KA 4TLCA 4B71A 2HYIC 1D2NA 5H1YA 4YMWA 2PLFA 4HB2A 2ZEJA 2F43A 3RSOA 2JLWA 1WBDA 2DYKA 3NDPA 3B1ZA 4ZI3A 3BD9A 3B78A 1MT0A 5L3RA 4PZYA 3ICQB 5TB5A 4Q01A 1LB1B 1GKYA 2JDIA 4LOAA 5FOVA 1BIFA 2X8AA 2X77A 4ACAA 4Q9JA 1PUJA 4BWYA 1R6BX 2WBLC 5SZIA 5FTLA 3PUZA 5KDOA 1EESA 1KAGA 1IOZA 4D25A 3BB1A 2Q0HA 2P2LA 1T0JB 4TWZA 1VYUA 1AIPA 1CKEA 4RD1A 2PX3A 4RD6A 1U99A 5FPKA 3REFA 3RHFA 2QGNA 5DN6A 4G5QA 4OJKA 3LO5A 5JFGA 1IY1A 4NCNA 4PAMA 3K0CC 1TF7A 3T06B 4L5BA 4TL6A 3F5FA 3ND9A 5TDHA 4DT1A 1CRQA 3JVVA 4YLGA 4WVFA 5G40A 3IILA 4AYWA 2O8FB 2Q9AA 3SU8A 2G0NA 1KGDA 3A4NA 4QBFA 1QHGA 2AX4A 4XSHA 2DR3A 2A78A 1AGPA 2WJGA 1KKMA 2BCJQ 3A58B 3MSXA 5LB4A 4DHEA 5B2ZA 1J8YF 2VF7A 2H1LA 3Q7PA 1QRAA 2ZAMA 4FN5A 1C4OA 2YNMA 5D3MB 2FGKA 5AWFC 3QVUA 3ZS8A 4GP6A 4NDZA 5J5CA 1OYYA 3MG9A 3VKHA 4DZZA 3OEED 2AFHE 2WWIA 3SJZA 1O87A 1BMFA 1CS4C 2WJIA 5JJLA 3MD0A 4TLBA 2GJ8A 4IRUB 3IIJA 2GETA 2GVDC 4KCGA 2BDTA 4PPGA 3W8NA 5FUYA 4JJKA 2VSFA 3LY5A 1IY0A 1G9XA 1ZD1A 1SKQA 4YXWD 5AJZA 3L8ZA 1IXSB 3EA5A 3I4LA 4MDFA 4ESVA 3SR0A 2V6IA 3SJBA 1AZTA 1JAHA 2EFGA 2VLIA 1W2GA 2ZS9A 3KXLA 4TYYA 1CBUA 1EWQA 3KFXA 4Q21A 1E2HA 1YR6A 1X8LA 3HU2A 3LX8A 4QRHA 5HCIA 5D3QA 2NIPA 3LNCA 3OAAD 3RRZA 3GLGA 3FB4A 2E87A 3EAQA 1E0AA 3HDTA 2ZE8A 3A36A 4IFBA 3ADCA 1EX6A 4TMXA 4GZLA 1NIJA 4W5JA 1DTSA 1G5PA 4N1AA 5KDLA 1F3OA 2QY9A 1KI7A 2R6DA 1MABB 3H4MA 2RGBA 1YZNA 3WY9A 3BRWD 3KQNA 1U9IA 1S0UA 3TUIC 2BWJA 2HLDA 2IS6A 1R0YA 1G41A 2FDCA 3B7GA 2WWGA 1EFTA 2IYRA 1SGWA 3A8TA 3VHLB 4BFSA 3F8TA 1X8JA 3THOA 1IBRA 3GJ5A 1TMKA 3FYHA 2ZRPA 1BO6A 1RRCA 3OFNA 1OB5A 3CRMA 1W44A 3CPEA 3SS8A 4TMWA 3W6OA 1OH6A 4DSUA 5AK0A 4NYJQ 1XEWY 3SFVA 2C04A 1P2TA 3K0FA 4HB3A 1KY3A 3FDIA 2JLVA 5FPTA 2OHFA 4JT2A 1NVVQ 3CNNA 4F4CA 3HR8A 2QQEA 1OIVA 3AQ4A 3FFBA 3WMFA 3CONA 3CRRA 3GLIB 1FPMA 4LHZA 4QFMA 2CCKA 4QBGB 1W0JD 1J8MF 4TYQA 4BFYA 2D2FA 4CEIA 4TTRA 2J7PD 2ZM5A 2BCGY 2GJAA 4KYUA 4C9BA 1RJ9A 2XSZD 4B2PA 4US2R 2C77A 1DOAA 2DWOA 1ZC4A 4XVQA 4D4LA 2OAP1 2P6UA 4IVQA 1XRJA 2K5UA 4C0HA 4TMKA 3CNLA 4CZ2A 2TMKA 1PV4A 2ZIAA 2ZQ5A 4BFWA 4TQ9A 1OFTA 3CH4B 3GJ8A 4DDWA 1E6CA 3EG5A 2WWWA 5IK2D 3C5HA 1K5DA 4LHYA 4Q4LA 1EFRA 3PVSA 1ZUNB 3VR2A 3VNVA 2WWFA 1ONBA 2HXYA 3M4YA 1E9EA 1KYIA 3KTAB 1L8QA 1TQ4A 4IXMA 4US1R 4DUGD 3JZAA 2AK2A 3B9QA 3X1XA 4QG7A 4V0ME 5JJIA 3A1WA 1W4BA 2GJSA 1NKTA 4M1OA 2FNAA 3LRPA 4URVR 2KE5A 5B58C 4TYNA 1AS0A 1KDRA 2CEAA 2ZRNA 4ZKDA 1ZNYA 3AM1A 3MWLA 4Q48A 2ODWA 1E2IA 5EE1A 2GA8A 4A6XA 2O8FA 3GLFE 2UVQA 1E2JA 5DI9A 3P27A 1VCNA 3M1IA 1ESNA 1ZU4A 1Z47A 4TTPA 2PJZA 4HUTA 1E99A 1OE0A 1A2KC 2F9LA 1N25A 1UEJA 2ZI3A 5HZHA 1OKKD 3FHOA 3TJZA 4CEHB 5J4VA 4LCBA 1Q1ZA 1UKYA 2ZRIA 3IBGA 2QI9C 4GMDA 2IYQA 2HT6A 4Q7MB 5D3MA 1IN5A 1GG2A 5AUPB 5KPDA 3HYRA 4IW3B 1Q1QA 3PCRB 5TV2A 5L3SB 4DWJA 1YR8A 1E2NA 3CR8A 1GNQA 1SVIA 2J46A 3RS3A 1NBME 1F48A 2R6GA 3F0TA 1DARA 3RRMA 5DHFA 2VHQA 3U7EB 2ZSFA 2FA9A 1Q12A 4OHVA 3LQRA 2V3CC 4PO1A 1T8TA 4ZCMA 2IT1A 3SFZA 4IDOA 2QE7D 4Q9IA 4FWIB 2ZRJA 4GI7A 4NYIQ 1W4RA 3LA6A 2VF8A 1JALA 5HKKD 5FTKA 2QPTA 2D2EA 3CR7A 3LXRA 3G5UA 1RIFA 4JBWA 1FMLA 4RD4A 3GEIA 4OQXA 1VECA 2FEMA 2PCLA 3KKNA 1MR3F 4FD2A 2P5SA 1XU4A 3LBHA 1UBEA 2JLZA 3R8FA 2ORWA 4OHWA 1E2MA 1MABA 1IY2A 2FG5A 1S96A 2WVJA 221PA 2XGJA 1NVXQ 4ITRC 4DB2A 3BC1A 4MRPA 3X2SA 3ZDQA 3BIFA 4LJ7A 3A1VA 2J5XA 4GZMA 4RKFA 2PT7A 3G0HA 1OB2A 4MDEA 5HPYB 1G8HA 3ZQ6A 4QBIA 4W7SA 2BMJA 2FX3A 3SYNA 1PLLA 1ETUA 1P9NA 4KITB 1NBMD 3LX5A 4O2RA 4Q5IA 4YONB 4TL9A 3GLHB 4FI3C 1H8ED 2ANCA 2H18A 4JKYA 3DKPA 5FOXA 4A1FA 1F6BA 4TYPA 1I4LD 1NVWQ 3R9XA 1VHLA 4CEJB 3GLIA 2CNWD 4NYJR 5FI0B 3ZIAA 4AURA 2VP9A 2WWYA 3I92A 1IN7A 3FMPB 1NY5A 3MFYA 1W47A 2QUZA 5G53C 5GVSA 5SZHB 3PEWA 1CTQA 5EZ6B 3QEJA 1NVVR 2ZVQX 4Q9KA 4Q1CA 2O8DB 4JVMA 1XXHE 4DEYA 3EZ6A 3IEVA 2ZVPX 1E2LA 2W83A 2XNDA 3PG5A 3QXXA 5GJCA 3RLFA 2A5DA 1DAMA 3AKEA 1GUAA 4W9MC 3EC1A 1E1RD 4EPRA 3AGQA 2QROA 3SOPA 1B0UA 5LPNA 4DDVA 4A8JC 5EE5B 1ZIOA 4NL4H 2B92A 3WRXC 1R0XA 1ODFA 4OI2A 3K09C 2RGEA 4K8OA 3A6PC 2BJVA 4IHQA 3AVTA 3TH5A 1KK0A 3QVVA 3ECCA 2XAUA 2JIZA 5EP1A 4TZ6A 3NC1C 1XTRA 821PA 2FU5C 5TARA 1OPXA 1YKSA 5FUVA 3KTAA 4MKGA 4E03A 1VTKA 2KWIA 3CNOA 3PUVA 2NO6A 2NMVA 4RZ3A 1KJWA 4DCNA 4I81A 4D4KA 3EARA 1Z5ZA 4LJYA 1L4UA 2G88A 4LK2A 4JMPA 2F6RA 1LS6A 3EIQA 2DHRA 2JA1A 1W36B 3LH5A 2ZS7A 4LJ6A 1JPNA 1BH2A 2ZRDA 2QG6A 4DUGA 4JYBA 5EQTA 3T5DA 3ADBA 5FL7A 5EE0A 4U00A 2ODBA 3UANA 3FOZA 3QXSA 2F1JA 4CEHA 2KBEA 1A5TA 4QHSA 3EPHA 1J7KA 1CR0A 2IHBA 4PSKA 3ADKA 1FL9A 3V4FA 4F38A 4OQLA 4P4TA 3J81k 2J9RA 1OSNA 3KUDA 2OFXA 1CRPA 1DG1G 4A2QA 1XJCA 1AS3A 3IIKA 4XD7A 5L3SA 4QC2A 4U5XA 2X2FA 5LD2B 2ASEA 4NPHA 5B30A 4QJ5A 3GJ3A 3WHLA 4H1UA 2GAAA 1M6NA 3PXGA 3OF5A 1T91A 4H1VA 2XJ4A 4RCYA 2FF7A 4URZR 1YJ5A 4TSFD 3SHWA 5HE8A 1SHZA 121PA 4IDQA 1LVGA 2CHQA 1ZNXA 2VRWA 3NBFA 1I2DA 4BGDA 3QXJA 1KMQA 2J0VA 1UKZA 1ZJ6A 3SE0A 3LBNA 1HTWA 3KDSE 3RRNA 1E4VA 2ZRFA 4ILEA 5E7JA 1NSFA 1KZGB 2WWHA 4TYWA 2IYWA 3BGWA 3WRYC 3BK7A 3IIMA 1QVRA 3ZD7A 1E2FA 2VQSA 3BFXA 3I3SR 2BOVA 3X1ZA 1H65A 2FPKA 2C9CA 4NYIR 4IOLA 4P3YA 3H1TA 4ZDWA 2QE7A 3HJNA 5DYIA 2W6JA 4UNSA 3AVXA 1RC8A 2A2ZA 4NCJA 1C1YA 4TT3D 2I1VB 4R9UC 1SXJB 4PHGA 4XVRA 4TLAA 4EIWA 1GP2A 1TF2A 3VR4A 4B6EA 4W5WA 1XD2B 1XJQA 2PL3A 1FX0B 3W90A 5JCPA 4MGZR 4Q7LA 5DI3B 3UMSA 5JI3E 2UKDA 5BN3A 2NO0A 2ORIA 2XZPA 1NJGA 1UBGA 2QP3A 1FP7A 2WAXA 2J7KA 2MSEB 3CWZA 1IXRC 5FH9A 4BPBA 2ONJA 1OXVA 2QBYB 1ZD9A 3BFVA 3L82B 2RGNA 3T34A 4KODA 3TSOA 4C0JA 3CKLA 3GFTA 4TN1A 3GFOA 3DEFA 3PIRA 3GLHA 4PR0A 4RD3A 5FBVB 1OFIA 5E95A 4DIDA 5E7IA 1U98A 2E9SA 1Z6AA 2PBRA 2R6CA 1Z6YA 1KDPA 1LTQA 1ZNZA 1NP6A 3AVWA 2J59A 4CEJA 2V55B 2QU8A 1NJFA 2OBMA 2ZANA 3NEJA 4FWTA 3T1TA 4E07A 2OBNA 2CCGA 3ASYA 4DCTA 3TK1A 2FJUA 4NMMA 3A4MA 2W2TA 1JJVA 4BASA 4B6FA 4ERNA 2O8DA 5CYOA 4EPVA 2H92A 2FZ4A 4NCIA 4F7WA 4D0LB 1CIPA 4TMTA 1RRFA 4PXAA 1HE1C 5JHHB 3WMGA 4KFTA 2CL7X 1G5RA 1X1RA 2CK3A 2OILA 3GJ7A 4A82A 2R62A 3OIUA 4K46A 3AB3A 1KI1A 2YJTD 2HYDA 1M74A 2F3TA 4JLDA 5SZJA 1COWA 5AUOB 1LS1A 4QBHA 3UPUA 4XTRA 4LBVA 4C0LA 1II8B 3WBKA 4UQOA 4B73A 2FFQA 2QQ0A 2O8BB 1SQ5A 2H5EA 3FKSD 5JWHA 1DPFA 1OH5A 5A5GA 2WICA 3QPVA 5AJVB 3TW4A 5JEEA 2XB4A 3E70C 5EUQB 3F3YA 4DRZA 1T3HA 1GKIA 1H8HD 4JLBA 3KUCA 2ZI7A 3EPKA 2UZ3A 3NTUA 2IXGA 1XPUA 4DXAA 2GF9A 2BBSA 2PLRA 3QKUA 4GNKA 4ARZB 3CO5A 1AKEA 3H84A 3WXMA 1DAIA 4G1UC 3ZD6A 4BFTA 5HZKA 2G83A 1OFUX 2XOKD 1J70A 1T5IA 2JJ1A 1RVDA 4M1MA 2X1VA 1E69A 1VIAA 4MRRA 2QAGC 3BB4A 1WDTA 3GEHA 3AV0B 1MH1A 2ZI6A 3KQUA 3W8RA 4EJSC 4I1UA 4PHHA 3K9LA 5C18A 1OFHA 1CJMA 2I3BA 2WKRA 2ZI4A 2GZHA 1HY3A 3M0EA 4L4UA 3DM5A 4BRUA 2CE2X 2NZJA 1FQKA 1TAGA 1E94E 2CL0X 2GJ9A 2WOJA 3FVQA 2GVZC 2J45A 3K70C 1KJZA 2H16A 1WMSA 2KB0A 2XTNA 3JVUA 1G8GA 2DFKB 4ZPXA 3KZ1E 3P4YA 4A2PA 4C3ZA 2O8CB 4TTQA 2QMOA 1YZKA 1FOEB 1E0KA 4GMXA 4PSAA 4QNMA 5CK4A 3CZPA 3GJ4A 2CBZA 2EFHB 4NTZA 2VL7A 4NE2A 1T3SA 2ZJBA 5FR1A 3U2QA 3DOEA 1U8ZA 2F7SA 3N70A 3SNHA 3G82C 1MO4A 1TUIA 2OAQ1 4LGMA 4R2IA 3FPAA 5JEDA 1Z3IX 4YMVA 1P73A 4JZKA 1G7RA 4MKHA 1F2TB 2CLSA 2OESA 3UWOA 1IN8A 4A92A 2FPLA 1JNYA 2H57A 1ZIPA 1NKSA 1P6XA 2RGXA 2WPDA 5KSYA 4CVNA 3P4XA 3CX7A 4B3GA 3D31A 4KVGA 5KNBA 4IDHA 3SI7A 3AP1A 4R7ZA 4AYTA 4FCWA 4HDQB 4LBYA 1OT3A 1X3SA 4B75A 4LZZA 2OM2A 2ZJAA 4WA7A 2JLRA 2OV2A 4LJAA 1SXJA 2H8KA 1UKVY 3TRFA 3NXSA 1XBTA 3RS5A 1DBSA 5K8IA 1XD2A 1FX0A 3GCGA 3QENA 5EZ5A 5DI3A 5JHGB 1DAHA 3B1YA 1GM5A 5DH9A 1G6HA 3CW2A 4MUBA 4PSVA 3KQHA 4M9QA 2NPFA 2C5LA 3K9NA 2XEXA 3H2YA 1S9HA 4CRWB 4QOSA 2QBYA 4RD2A 4A0HA 2EQBA 3EIEA 5CM9C 2VTKA 1GRNA 4WZAE 4BZPA 4I1SA 1KO1A 1XTKA 3GJXC 3LWNA 3FWYA 1JR6A 2VO1A 4KV9A 1ZUIA 4M9ZA 4A0FA 4RD0A 4BFUA 2FGJA 3UATA 2V1XA 3K70D 1ZAKA 1KHTA 2R44A 4KSCA 4DB4A 2IYLD 4MRVA 3BJIC 4JIMA 1AGRA 4OI0A 1E9AA 1YE8A 3AF2A 1ZINA 4JLPA 4R98A 4JS0A 2ZYTX 3ZZUA 1Z2CA 4ABYA 1VIYA 2G77B 2A30A 4ON9A 1OXXK 3T1VA 2BEJA 1U81A 4D0NA 1BYIA 1XEWX 1M7BA 2G9NA 5AUQA 5K8UA 1LNZA 2B7BA 2J41A 1UFQA 2GZDA 2PCJA 1WQ1R 4KSBA 4D4MA 4QGGA 1KTVA 3PUYA 4FINA 2OFWA 4S35A 3W3ZB 1Z29A 1CR4A 2NO9A 2B6HA 3TSWA 1P3JA 2IXFA 1ZD8A 4B44A 1IAQA 3VU9B 3B85A 4RJLA 1G3UA 2BM0A 2NQ2C 5CIWA 1XEXB 4Q7JB 5AJYA 3AVYA 4HI0E 1II8A 2VSOA 5FPSA 3K0AB 2V7QD 4M1WA 3T1QA 2O8BA 2NZ8A 2V54A 1V5WA 3RWMB 3B8HA 5L3VA 1SKYE 2Y8EA 3REGA 3DMNA 1XZPA 2VP0A 3FFAA 3T35A 2FE4A 3TBKA 3R7WB 1E1QA 5EP3A 1DADA 5CDFA 5TY0A 3WP1B 2WKQA 3SHFA 4LRWA 3C16C 4FXPA 5HTKA 3RNLA 1E0SA 4ARZA 2ZSAA 3AF0A 2IUSA 2P5TB 4GT1A 1S8FA 1II0A 4QJ4A 2XJ9A 1E9SA 1M1YE 3IPXA 4G0NA 3I32A 4GBMA 1J99A 3TQCA 4JL6A 1W1WA 3R9WA 1QHHB 3W6PA 5LDDC 1U2RA 2PMKA 2QEQA 4BE7B 4URUR 3KFVA 2YOGA 3OEHD 4JVLA 3FTQA 2QP9X 1UPTA 1LW7A 1P5ZB 2FFHA 4HAUA 2GHIA 3VR1A 4R2HA 1JXOA 4G3XA 5E4FA 3VTKA 2D7DA 1G291 1TQ2A 2GAOA 2ZRHA 3TGPA 2IX3A 3NHAA 4LUCA 5JCZA 5JMTA 3D3QA 3QG5A 4LYAA 3I8XA 5FOUA 1E79D 4C0KA 2AD5A 4LC0A 2BBOA 3U7GA 4HB0A 2O8CA 2PZEA 4C0QC 2ERXA 4R71A 1ZM2A 4HDCA 2QSYA 1R7RA 1OIWA 1PUIA 2OO7A 1P72A 2D4HA 2YVUA 2VP4A 4LYHA 2WMOB 1UDWA 5BQ5A 1LY1A 1AS2A 1XCMA 3QJYA 2W58A 4C2TA 1US8B 4Q1FA 2P0EA 1K6MA 4QHYA 2A3RA 3VMFA 2Z0MA 2O0JA 3FHTA 1F2TA 1E2DA 2A5YB 3L0SA 2WHXA 4C0BA 2IEZA 2OZEA 5KSZA 3NEYA 1E2GA
chains in the Genus database with same CATH superfamily
1XNRB 1BCSA 3I1FA 1IZZA 3HUDA 3RDPA 3C3YA 3AEUA 4RETA 4ML3A 5TMPA 4PLYA 1OTXA 3R7NA 3RU2A 4IKEA 4PAQA 4CKWA 4B3SB 3IXQA 1K97A 2XCTB 1QRSA 3QFTA 4B43A 2FSSA 3H2ZA 2HCJB 4CG2A 2Z83A 4TUYF 2K2WA 3ZYCA 2PKCA 1T5TA 2B78A 2OCXA 3RG8A 3ZWYA 1EX9A 3E0XA 4CHGA 5BN4A 4UCFA 4UDYX 1O6CA 3ANSA 3Q8XB 1H4TA 4MPPA 4N8DA 1JQJC 3FCUB 1A7KA 2FMXA 3RF7A 3RUIA 2DBZA 1Z6QA 2HHCA 2Y1OA 2QM8A 3D9QX 3LW7A 4H6PA 3UMGA 3VFDA 4GSKA 1GTJ1 3I05A 4QHTA 2VG8A 3V1NA 2F4NA 2UUAB 3NWPA 2FSPA 4JYCA 2VHYA 4E4RA 1W35A 4FMCB 4F86A 5AD1A 3L6BA 3I5YA 2C9DA 3EE6A 3EGVA 3I4CA 4HZUB 2QUAA 3FX2A 3D6UA 3HUEA 4IXDA 4OYHA 3PQ8A 3FYUB 3JARA 1GGKA 2JLYA 1VKZA 2C29D 5B57C 1XCPA 3RABA 1YJCA 1TVEA 1XFAA 4TZTA 4RZIA 4JA0A 4M0LA 5BW8A 2OQIA 3FMIA 3AFIA 3WKCA 3ROKA 3KSMA 2GBLC 3FPSA 1J07A 4PC2A 1B93A 4P53A 3C4QA 3ZWQA 5E8RA 2WTUA 2B35A 1O6ZA 4TT8A 3I2KA 1PZMA 5A02A 3Q41A 5JMPA 5EJ4A 3UJ7A 4RAQA 1H6AA 3AUXA 3PFKA 3ZU2A 1EP2B 4BE4A 3NBMA 1I33A 5H7XA 3N2GA 2Q3JA 4QDUA 2H1RA 2ZE7A 1C81A 4K1LA 5EPUA 3HUTA 3U61B 3T3NA 2H0AA 2G3YA 4PRKA 2R48A 4MYCA 4U02A 2ZUTA 2AB0A 2FPMA 4B74A 2ZP1A 1WB4A 2V5AA 4HATA 4J2HA 4E09A 3OQMA 5LQDA 2YFYA 3B2EA 7MHTA 2VHUA 3QM1A 3R5HA 5TJ9A 1WTCA 4I1IA 1K63A 3EXAA 1N2CA 2P75A 3H19A 3QE3A 3MRXA 3QNMA 4IHAA 5IKEA 3K6SB 1VBFA 1J5PA 3JD3A 2PMEA 1Z6PA 3FZEA 3ZCQA 1N2OA 1NXQA 5CBPA 2GILA 2F3RA 3GAFA 5C1IA 1KK2A 1KVTA 1VCOA 1XEXA 1JLKA 4WT7A 1QH0A 2X0KA 3A7DA 4P5DA 4BPRA 1ADFA 3K1YA 2LD4A 1JEOA 2AN1A 1JEJA 3CPHA 1VRVA 3JQ7A 4R83A 1GZ4A 4L74A 5HRUA 1I8TA 2YFHA 4WQMA 4C22A 1K75A 1ULTA 1W5SA 2PJUA 2V6GA 3OEEA 3SVTA 2XCUA 3QK7A 3ZDEA 1CQJA 1A8PA 4E2FA 1ZUWA 1NW4A 1UL1X 4UAUA 2JASA 1ZC3A 1PWYE 3VZPA 1AKRA 1NOKA 1QONA 2OFOA 2VDWB 3N59A 3EGIA 3IX7A 4MVCA 1N7GA 1LSJA 1B23P 3IO3A 4YXWA 2ZSBA 4QXOA 2WD7B 4F5YA 3QEAZ 5CNJA 5H81A 3VKUA 2JAXA 3OJFA 1AN9A 3GJTA 3L0OA 3WNVA 3GCDA 2W6ID 1GL6A 4RPKA 4WEQA 5H80A 4PC3A 5KB3A 3ISTA 4FFLA 2Q46A 2W43A 3Q2OA 3HKBA 2OCBA 1G3RA 1QPBA 4Q3AA 3VR5H 1Z4OA 2C99A 2BTQB 5BWMA 3KKMA 1QHHA 2H1CA 3W3AA 4XFJA 5FRDA 4A8PA 5KYTA 2W4QA 3UIEA 1AZSC 1V43A 2QTRA 3C3KA 4I46A 2AWNA 4HS4A 3NHUA 4M76B 2HY7A 2J32A 2C59A 1I2ZA 4RHYA 1JILA 1N6IA 4YDHB 4LWQA 3EQZA 5B4TA 1B14A 3HY6A 5G1OA 4DMFA 4P83A 2RCNA 2PRJA 2WJJA 4GOOD 2GF2A 2KQUA 5L3ZA 3EGXA 3W8FA 4N0DA 4YQFA 4MS1B 1CZRA 4M88A 3GLRA 4LXTA 4ZKEA 1X7YB 4JAVC 5A3JA 5KKNB 2JJ8A 4ND3A 1I5RA 4J3NA 2R9VA 1NV8A 4OX9B 3SPXA 5DE3A 4L8GA 2X5XA 4R9SA 3KEQA 5T41A 2DM6A 2SKDA 3JZDA 3H2KA 3S2IA 3UNXA 4K28A 4H4DA 1RWMA 5EIAA 1OWNA 1OHHD 3ANTA 2XITA 4CUKA 3L1HA 1J1IA 2CJXA 2G0TA 4ZPJA 2DETA 3ZV4A 1GQOA 3V32A 4QXAA 4TLLB 3CRVA 2XUPA 1FUUA 4DLLA 1MO3A 2AFHA 3FZGA 2YS7A 4R7GA 4E08A 3EZ2A 5D01A 1X0VA 3ROFA 1JXMA 3VU1A 2XUJA 3AP3A 1GLGA 2I76A 5C4MA 2PZJA 3WYBA 2O4CA 4PAOA 1J8FA 4NCKA 3SIWA 5CDGA 2NV0A 3PD0A 5BN5B 2VSXA 3AKDA 4EYKA 4YV0A 4PQGA 3UWDA 1PJBA 1B74A 4E5MA 5JG7A 1C2TA 1SB8A 1KIMA 4HQLA 2I6UA 1NAHA 2ZWIA 3Q5GA 4B0PA 2I6QA 3CRQA 4N3NA 2PKQP 2JGDB 4QTTB 4NQZA 5LNK6 5BT8A 5M04A 3DW3X 2Q5FA 1W0JA 1FXWF 2VK4A 3AI7A 3MJTA 3I04A 1USUA 3AY7A 1SKMA 4EL5A 3SOZA 3NJRA 3PA6A 4RZUA 3JYOA 4F5EA 5DHPA 5K6TA 4TRNA 1Q2XA 3S8MA 2PSHA 3KV1A 1SWWA 4KOEC 3P19A 3GFVA 1I1OA 2RHBA 3GJ0A 2XMBA 1MA3A 2HQOA 2JAPA 3ILYA 3EAFA 3SZ3A 1DIAA 2J0UB 5FIUA 1LPOA 2B6NA 3LT5A 2JVKA 3V7NA 1M0EA 2IW1A 1G19A 1XSEA 4QREA 3OU7A 2XXAB 1DQYA 3OURA 2IK8A 4LJKA 2QP4A 5IDXA 1I24A 1U2EA 4GEKA 4Y2TA 4TKMA 2WLTA 4HZUA 1NX6A 2Q1SA 2BHLA 3FPLA 2V6BA 1AN0A 3FYUA 1PZGA 2YC2C 4IGAA 5EWMB 5H3LA 1TLTA 1KZ9A 4HAXA 4L72A 4YP0A 5FPPA 2FEOA 3KRTA 1J4AA 4ZCIA 2PK3A 3S1AA 4ZK6A 1E96A 3AFGA 1O9HA 1PJ3A 3I45A 3KKPA 2GBPA 4UZEA 1O96B 5CHEA 5TMDA 4DA9A 3WLKX 5IXYA 3FSJX 4XCQA 1RNLA 2FF5A 1GYRA 1DQRA 2RHCA 3MJ4A 5G1NA 4R05A 4AUEA 4ZI2A 4PG4A 2H4JA 1ILWA 1TT7A 4Y9UA 4A4DA 1E3SA 3L46A 2J3IA 3ML1A 5DLEA 3C14C 2M6LA 2GF0A 3CF6R 1MEOA 1N5RA 2WSLA 3JYQA 4OO3A 3THYB 5ICEA 3L5OA 4REQA 1HNZB 4MA4A 1W46A 3TLXA 4LYEA 3CLKA 2YXDA 2ENUA 2FUCA 1EFUA 1NW6A 2HHHB 2YWCA 4J7UA 4S0ZA 1KZ1A 4OKSA 3O47A 5BWLA 2V0GA 1M2KA 1T9CA 4R41A 2D0IA 2HCBA 3RYHB 3K6SA 1E3MA 1NN5A 3MT7A 2JFOA 4YAIA 2JCSA 1XXHB 1XPOA 2XXBA 1M2HA 4GLOA 2JHFA 1WF3A 4IOMA 1NLMA 5LB2A 5DNCA 2UUBB 1U7DA 2Z3VA 4D8UA 1N5KA 5C32A 4ZMSA 3EGDB 2QUBA 4NESA 1WXFA 4HTFB 4NZOA 3E4DA 2R1TB 1Z9BA 3UJAA 2JLXA 1NN3A 1VHDA 5DGDA 3BAZA 3GT4A 4A16A 3QKSB 3K0EA 1APBA 3AKZA 4WLOA 2IEAA 2HJHA 1FVOA 2ZUCA 5HS4A 1FP1D 2OG2A 2XB8A 4CUZA 3MWKA 2B30A 3AESB 1XZGA 4JL8A 4RV5A 4ZTZB 3U49A 1RPZA 2VDWA 2WTNA 2LWIA 5KYUB 1G66A 4CKYA 2D62A 1FFHA 2F2TA 2XUOA 2PZGA 3LL4A 1XZQA 5DNVA 4A8JB 4AUNA 2RCYA 2ZRQA 1Y6ZA 4JSYA 2O19A 2WD7A 2ARKA 3U7HB 5K3CA 1GPAA 2H54A 3DLCA 3FLMA 4H0NA 5F23A 1UOPA 2I99A 1ZRMA 4IIUA 1YU9A 3ASZA 5DBGA 1D4OA 2EU8A 2P2ZA 2VEDA 5DEIA 4D3YA 1N3YA 2YWJA 3EODA 4K9PA 1IHUA 4E4YA 3BXXA 5ARDA 2HEIA 4EG6A 1NPYA 1GTRA 3OT4A 5BY2A 4YC7A 2VT3A 2WJZB 2BTQA 2X5JO 1S6YA 2ZRAA 4L8FA 3V46A 4DLAA 1EB8A 1DAOA 3AUFA 2ZIGA 4PS0A 3TLBA 2OV8A 1WSDA 3NBYC 3H0KA 2W6IA 3S55A 5C5DA 5EXSA 1FP2A 3ET5A 1B16A 3ONDA 1QVAA 1QHYA 3FOCA 1P3DA 5EIBC 4CODB 5AHOA 3ABOB 4MS1A 5EXXA 1HM5A 3NR2A 3TW0A 4H16A 1CR6A 1X7YA 3C6KA 3U4QB 3C3XA 3VJRA 1QFSA 4KX5A 2YZMA 4G97A 4H4EA 1FJ2A 2EEPA 1RPNA 3FRHA 3KLBA 3TWOA 2IU6A 2LIVA 3QIAA 3FYSA 3QYJA 2PBFA 5DTEA 5GJWC 4BNKA 3KETA 2V9ZA 5JECA 3G2LA 3WYDA 4A36A 1RWWA 2QN3A 5BP7A 1J9EA 3ESAA 1OBHA 4BVGA 4BUZA 1BN6A 1U9YA 2PS3A 4F6LA 1GPYA 4EKNB 1ADCA 4MITA 1XEAA 3JV7A 4IH9A 4BKMA 1I2CA 3EX7C 1NMXA 1JQKA 3K1ZA 1ZL0A 3I5MA 2OKGA 2HJSA 2D06A 2IIPA 3BPSA 2LE0A 2HHLA 1IATA 1JBQA 3ETLA 3KWJA 4ZAGA 4E5PA 5J1SB 1LFDB 4OFZA 4LXYA 4RF5A 5JS1A 5T8KC 5BN5A 2PUJA 5LIPA 3C8ZA 1T36B 2CFRA 1XMIA 3ORHA 4HR7A 3QBDA 4RK6A 1CJSA 5KWVA 3AG5A 3A1UA 4W5TA 5C8YF 2YKGA 3AGPA 3D7SA 3HI4A 5CW2A 2XBUA 1D8TA 2B4KA 1IRIA 2C31A 2JGDA 1BOOA 3G9UA 2JI8A 1QKJA 1YE5A 4BVKA 3HN2A 1VJ1A 1AJEA 1JDPA 3MWEB 3WGKA 4KV7A 1NMSA 3BJEA 5LLDA 2Z98A 4DR4B 5EN4A 2D5IA 5CX4A 2WTAA 4R40A 4UHJA 1FNBA 3ZJYA 3IR5A 2E7ZA 3ID6C 1GKLA 1YQGA 1QIKA 2W93A 2XX3A 4BUJA 1C7EA 1FQOA 4YJ2F 1HA3A 4JQYA 3WVNA 1MDFA 1L7QA 4HNTA 3NV7A 1CF9A 1Q0UA 3K35A 1DI0A 5F9MA 4DCGA 5ALDA 5BWOA 4NZYA 4WJLA 1Y4SA 3IV6A 4MH0R 2J0UA 1UC5B 2P4HX 3JQRA 4OHYA 3QY0A 2XXAA 1HZJA 3K8YA 3NHWA 3CJTA 4J6EA 5K01A 1UADA 5IYZF 3LD9A 4I0WB 4M1EA 2G36A 1FEZA 5ALLA 5EIBD 4P35A 3MWFA 2AG1A 2FKAA 4PXYA 1G5HA 5DX8A 3MJRA 3AMVA 5JS8A 2XVAA 2H48A 1JQDA 2FUNB 2WAYA 3N2YA 3NTXA 4XOIA 2C78A 4RMNA 3P0JA 5EWMA 4DLSA 4QYSA 2YWEA 3BK1A 4R68A 4N76A 1JJAA 2ZAIA 3K8ZA 3LO8A 3RWBA 1SXPA 1W7AA 2YZNA 5EHIA 1ZJ4A 1O96A 3ZDDA 4KQ2A 3TS1A 1DJPA 5CDYA 4C6RA 5JBQA 1Q7EA 3D54D 1Z15A 3W5BA 2EKZA 3A4TA 4ZIRB 5F2NA 2CF5A 4JLSA 5ALIA 1JKJB 5KIAA 1HSOA 5EJGA 2E1RA 4JP5A 4LF8B 2ZIEA 3V8QA 1TCBA 3KAPA 3V4OA 1IM2A 1EGVB 1PR6A 3THYA 1MC4A 2HUNA 4P93A 1HLFA 1ZCFA 5AK5A 1QYDA 4DUPA 5J23A 4YAEA 5BRJA 3WIBA 3ZWXA 2HU8A 5C53B 3D7LA 2HPZA 3IB3A 4QODA 1ABBA 1QHIA 1FJHA 5IMSA 4K9OA 4LJSA 3RYHA 2CUKA 5EPOA 5I01A 4YRGA 4G81A 2VA8A 1N6PA 2BKEA 4D44A 1N2ZA 1XXHA 2OCYC 1NFFA 3KALA 2QPAA 3PGMA 3PR2B 4Q4AB 1H4VB 3KAKA 5CJJA 1QC5B 2G6TA 1ULHA 4LVUA 2YQ5A 3EGDA 1BA2A 4DNOA 4HTFA 3FMFA 5I5EA 1XA4A 2R1TA 1C9EA 3ONFA 2VHXA 4PYKA 3QKSA 5F9HA 1JE0A 2I1WA 2FZVA 1LF0A 3IA2A 4QXPA 5DM60 5J47A 2A0XA 3HBJA 1WB5A 4KTTE 3LPCA 2X5KO 4K9LA 4BU0A 4RSGA 3RLIA 3AEQB 3AESA 3OSUA 1DJLA 1WDWB 4UVHA 3MSCA 1WA5A 4QNNA 4MSUA 3F6RA 3NGLA 5FB3A 4QG3A 4U9IS 5ITWA 4A8JA 2RK3A 3F98A 4QX6A 2ZT5A 3N3AC 3KDAA 2TRSB 2OXIA 4DC0A 4QYWA 1SXIA 4B5LA 3K09A 5TPWB 1XQ6A 1SBTA 5CEFA 3WJ7A 3O4IA 1M5TA 3WFZA 3FTEA 2Y1LA 5EEGA 2GEUA 3Q87B 4Z4HA 2IUEA 2PIDA 2DH5A 1C9KA 3H1EA 3A25A 4XIGS 2L18A 4IXWA 4IJUA 1BRMA 1BYUA 3UQYS 4CMIB 5LUBA 4QDXA 1KQOA 4GOKA 2B1RA 4LI0A 2B2NA 4Z0NA 3IUYA 2CMKA 3DFIA 4E46A 2GD6A 2PRSA 4KWHA 3V9PA 3FFXA 4M0FA 4BRWA 2VH2A 4WZ6A 4A0GA 1YWGO 2ABWA 5M3BA 5CCEA 1FQWA 2JFXA 5I7OA 1ZK2A 2G4CA 3O7WA 5KJ6A 4RW0A 3NVMB 1YZQA 2AR9A 3DMYA 4L6AA 2ZBEA 5G02A 1H2EA 4B7UA 5DNEA 3I9KA 3KZOA 3C2QA 3I0NA 1R15A 1Q20A 1H4SA 1MOQA 3TF5A 3RM3A 1DX9A 4LRYA 2I2AA 4LYYA 1NW9B 1T9HA 2WZDA 3ZCSA 1BS9A 1OLXB 3OF2A 3QTLA 1U7HA 5CB0A 1M3SA 3U4QA 3RVBA 4ENQA 5B6IA 3A9CA 1KJQA 2ZYAA 4HY3A 1RI4A 2K6GA 1YDEA 3HYTA 2FWJA 4UNRA 3F1KA 1NRJB 1X1TA 2PX0A 4MUKA 3DZDA 1SN7A 3KC2A 3PS9A 4OAPA 3NUZA 2DCMA 4CE6A 3T0FA 1QQBA 3LQQA 5JAIA 1A9ZA 1V5GA 3R0VA 5C31A 2CWDA 3ZH9B 4F85A 2C57A 2IQIA 2CHVA 3T7RA 3DULA 4RKQA 1YR2A 1AQUA 1GCGA 3M2TA 5BPHA 2BKLA 3H3XA 2WQ7A 1WO8A 2AKYA 1V8PA 4H7FA 3QXGA 2GJ4A 4CCWA 2JCGA 4R1PA 4UPVA 1G7CA 3HABA 4H27A 521PA 2ZWOA 3SC4A 4DUZB 3BDAA 1IN4A 3K70B 1T36A 2NTVA 3AUKA 4WUTA 5FQOA 4F2PA 5FBQB 4C0WA 2JATA 3DVQX 2JJQA 2YMPA 3FMVA 2XUZA 2R8PA 3EIOA 3F9CA 4ZOQI 2IZ1A 3O1HB 2COUA 3OECA 4PR3A 3V8PA 3WL8A 5IF9A 1GNRA 2QTTA 2V7PA 2H7XA 2VYFA 3C39A 5AKKA 4DANA 1Y81A 1D5WA 1XTTA 1TOAA 2IZZA 3IB6A 3MWEA 1K6JA 4PQEA 4IAOA 3M3DA 3HM2A 4FFVA 4G5FA 4UNIA 4DV7B 3KL4A 1N9GB 1V16B 5F5LA 3K53A 1Z0ZA 3HVHA 3NEAA 4IDPA 4YP6A 2QTLA 1XDZA 2GERA 3IAXA 3T3GA 1BXZA 2EHJA 4PZDA 3QUCA 4ZI7B 5AXBA 1EQUA 4PQRA 4B6RA 4AY4A 1VJTA 1KEPA 5EGNA 4OFWA 3TZCA 2UXBB 1H69A 1U8YA 4KPGA 4TQUS 2IVFA 1SC3A 2H9YA 4LY3A 3UGQA 3RUAA 5L3QB 1GU0A 1XVLA 1M33A 4OXKA 4UTRA 4D3XA 3GLIE 4GKBA 4JT9A 2E5LB 2BDEA 1P2VA 4LNUB 1Y1SA 3L7YA 4UFNA 4ZC1A 1KI8A 1IPFA 5NULA 1D4ZA 1DAKA 3IT3A 3INGA 3JQ8B 4M8NE 4MROA 5EVJA 1TKCA 3LC0A 3LLMA 4KRXA 1U0OC 5DHUA 2IPOA 2H00A 1BE0A 2VRCA 3FCCA 3GRAA 3N58A 4E3ZA 3VZBA 5F3DA 2P4QA 4JXXA 4MVYA 1ZW6A 1H4QA 1HKUA 2QLLA 3DYVA 1FXSA 4I66A 1C41A 5AMXA 3UUEA 1ENZA 4DNPA 2ZDHA 4E5UA 1H8HA 3SE7A 1DWQA 1RDFA 5SICE 1GT6A 1ZHHA 3IAM1 2G04A 4OGFA 3G88A 5BNFA 4ZIRA 2ZU0C 1RM5A 1SIWA 4XLLA 3JW8A 3VA7A 1JKJA 3UMVA 4P0PB 3DPIA 5DX0A 5KJFA 3B7WA 4AG3A 4QATA 4UAVA 4M1SA 2XOKA 4RV4A 5K0ZA 421PA 1XYVA 2C5HA 4BLTA 4M86A 1UT5A 4HGQA 4MPDA 1QS0B 2VPTA 3PQ5A 2IHUA 2OO3A 3CUUA 1H2RS 3TQOA 2AUMA 2P6NA 3CLUC 5EY5B 5ILQA 3T61A 1EFKA 3PNSA 4Y18A 4GR9A 4X8LA 4BNHA 1A9PA 3FCOA 5JT1A 3KQKA 1VHTA 3A2NA 2BMWA 3O8DA 1AB5A 3P26A 4QBKA 3ROGA 4Q4AA 1QC5A 1PU2A 3GJSA 1S2IA 1TYAE 3OIVA 4JLUA 3U56A 2O5EA 3EZ7A 5SV2A 5CLHA 1ZCBA 4U2DA 3H86A 1ADJA 4IQ8A 3ETJA 4BFZA 3LGXA 3NP9A 3QWIA 4DMKA 5IC4A 2YHUA 2JH9A 3OOSA 3IUMA 4DM3A 2ZB8A 3GK3A 4CIDA 5C1BA 3LY8A 3I9V1 3RIHA 2XLBA 4RIGA 4D6YA 3L5KA 3H1AA 1LLFA 1FYVA 3AEQA 2I29A 5HMLA 1ZBDA 5ALZA 4QFBA 4YDQA 3NT4A 2GLTA 4U6SA 1B73A 1W75A 4XIYA 4RVGA 3HZOA 1TRKA 1ECFA 3MLEA 3IV7A 2ZCJA 5TPWA 5K4GA 2H5LA 4M83A 3BB3A 2RHOA 4NBLA 2XNDD 3FUVA 1GGEA 2I4OA 2BD0A 1ZICA 1NMZA 3O0DA 2R97A 2MMGA 3HL4A 4MOWA 4CMIA 3LTNC 4MYTA 2YDYA 4FMCF 4Q4HB 4RKEA 1KDOA 1P7WA 1UKAA 4BEJA 1IJFA 2WVAA 1BE6A 2PL5A 1HEYA 1ZQ1A 3HKEB 4BLQA 3N8NA 3O3NB 4G5SA 1M1YB 2C3YA 2XWSA 3SBDA 2Y9MB 4O0LA 2WAMA 3RRBA 1T9GR 5IN5A 2C5SA 1S8NA 4TN5A 4Y2JA 3W7BA 4JDPA 1DCMA 1XALA 5B1SA 2JIZD 1CZHA 2WDPA 1QE5A 4M1QA 4RK1A 4DQKA 2OB2A 2J8ZA 3HU1A 1NDHA 1P2DA 1YS6A 2UYYA 3N0TA 4YDSA 3U1VA 1OLXA 4MQFB 1TZ2A 4QPJC 4MWTA 3QW4B 2QZJA 4N40A 3NKVA 1WMFA 3PYLA 1RWPA 3TOZA 3JTEA 4UHCA 4ZZIA 4FJ0A 2E5FA 3QUAA 3EEFA 5JBIA 5KVCA 3ZU4A 4A3SA 4B4OA 4ISCA 3EXFB 3GYBA 2IYPA 1DIHA 4PZLA 1GFZA 1QE0A 4RC9A 3X1YA 1B8UA 4JUIA 4NS1A 4ROTA 2OGZA 4FP9A 1YFJA 1BFUA 5JO9A 2PT5A 4D74A 4QEDA 4MQBA 3ZYZA 5AI4A 3JWGA 1U94A 1QUFA 2COKA 2Q4EA 4UCWA 3KOYA 4NU8X 2HDHA 4Q1DA 1RABA 5AK3A 3HFGA 2QRQA 2E4YA 4JI7B 2G71A 5EQDA 1GPJA 1Z6TA 3B8EA 4BB0A 2C4WA 2ZWPA 2PUWA 3U7QB 2QX9A 3USZA 4PLTA 3C87A 3LKVA 2AL7A 4KTVE 4IINA 4L6CA 1Q83A 2DRIA 2IRWA 4BOYA 1YRAA 2SKCA 2QGZA 3K2QA 1Y80A 3UV6A 5IULC 1PX0A 2XGSA 3S6JA 1N9GA 1V16A 1XVIA 2DGDA 1G4HA 1JG7A 1NXXA 4D26A 4RV9A 3GFPA 3ONVA 2B1GA 1OLOA 5DTJA 3RVJA 4ZI7A 4ZJUA 4RACA 4BLUA 3KLOA 1URPA 4HWGA 4IPTA 5EMKA 4XD2A 1G1MA 2TECE 4C2AA 4P4LA 2YZ2A 1RMYA 1PL7A 1QF7A 1QZXA 3P9CA 3CF2A 4UJ3A 2HW8A 5L3QA 3DVLA 1R88A 3C3EA 5A4FS 3L2OB 4X0EA 1ZJ5A 2OTCA 5H83A 2NU9B 1YFLA 2HMYB 3EC7A 4FYJA 3IDOA 4LNUA 2R1VB 2Z9CA 1WVMA 1W96A 1Y48E 2HXSA 1PV1A 2VNJA 3C97A 3JQ8A 3OLZA 4G1MB 4E22A 2QLTA 2V7QA 1G3MA 1RRGA 3SHOA 5A4DA 1QQTA 2PSSA 4V2UA 4OOEA 1SA0B 5EJ5A 2Q1YA 5I7VA 1FSGA 2ECOA 2FQXA 4O02B 3U81A 1S2NA 2R6ZA 5FTWA 1PG2A 3O8RA 4BGEA 1FU7A 4G86A 4X6XA 3L7JA 5MDHA 3SC6A 3ONWA 4NENB 2GBCA 3ZEIA 1KNQA 1Y6RA 3FD8A 3W2TA 1OWMA 1E1KA 2GDZA 3PQ4A 1KXZA 2X3YA 3SSOA 3ZCRA 4XXHA 1YC5A 2IA5A 3E9CA 1N3IA 5SYNA 3UFXB 1QB8A 4ZYTA 4I1PA 1QGUB 2QZ4A 2Y67A 3N86A 4M6WB 3ZY2A 3EC2A 2FVYA 1GUBA 1OCEA 4G41A 4HAYA 4LDRA 5GV7A 4F93B 5K8LA 1E9BA 1YIOA 4HX9A 2Q2WA 1ZS9A 1HV8A 1QS0A 5I8ZA 3OBIA 3O90A 2YIVX 2GO7A 4PAWA 1GA4A 3O4VA 1RE0A 2MYTA 4KUHA 4QJIA 1JEDA 4RX1A 4BAZA 2FFBA 2KHZA 1MV8A 2QB5A 5D85A 4L15A 5HFNA 1QP4A 4URYR 4E6PA 4UM9B 1PNOA 4LFAB 2QN6A 3IGFA 2A92A 3OZEA 1D2RA 3EQ9A 3FTCA 4MKIA 4ZU6X 3W4IA 3TFWA 3NU1A 4LRUA 5JI2E 4KI7A 2PX8A 3RHZA 2PTGA 3ENNA 1DVRA 3FVRA 5F5XA 5F73A 3DOJA 2G08A 2P4SA 1GPKA 3CKMA 1G6KA 3M6LA 3PLAE 3O8QB 4Z51A 3B6JA 3QF7A 3BEOA 4FGUA 4QVKA 5ESRA 2EDAA 1XTZA 1XKTA 4QQ8A 1JQBA 1O58A 5I9NA 3CC8A 3RK1A 2OCAA 2EKBA 2V7TA 3AFHA 3AM5A 1RC1A 1XP8A 2VSNA 2BTOA 2RHTA 4XPZA 4P5EA 5EXPA 1DFGA 2IS2A 2ZYVX 3GXBA 4B35A 4EO9A 3AX6A 2XE6A 4NYMQ 4ARSA 1GGMA 2R8OA 3K15A 4Y6LA 1JHYA 3O1LA 5FBRB 3TXAA 1YCFA 2W70A 1PR2A 4JMLA 1XWFA 4M9SA 1HDGO 3VDXA 2H2DA 1M7GA 1GRQA 1KDVA 3KJNA 4GE3A 1A96A 4ITVA 4LWZA 5LVAA 1JHZA 1Z0FA 3K4PA 4PSCA 3NNNA 1PR9A 2H65A 4Q4HA 4QUBA 4DKJA 2CK3D 3GHYA 1QZUA 4G2NA 3S1SA 1NJ8A 5JIBA 1MC1A 3HKEA 1WD5A 3PB3A 2JLQA 4ZV7A 1M1YA 2WYUA 3QYAA 4JGGA 4WGFA 3HUFA 3VRHA 4M0CA 5GTDA 4MNTA 1RD4A 2RGCA 4P92A 1P33A 2Y1GA 3G5TA 3HZRA 1EPUA 3SGLA 4KBGA 4DG5A 4NNJA 2YZKA 3IEXA 3TG8A 2EOAA 4OEHA 1U3DA 3FZYA 2CXOA 3C8UA 1QX4A 1Z5WA 3V3KA 3ZHCA 3OE4A 2IDJA 5H3HA 4IG4A 4HS9A 1CRLA 4MQFA 3WKAA 1FFWA 5BMOA 2EVWX 4E11A 1KO8A 2YJ6A 5K0TA 2J5KA 4F11A 3W78A 1DFHA 2I2FA 3C1AA 3MERA 4NCXA 4AJ1A 1JHDA 2Q3HA 3KQQA 3EXFA 2CLCX 3TW8B 4BTLA 2VDMB 4C29A 3BJZA 3DDUA 3HBNA 1TVKB 2A7QA 4I1OA 4ND5A 1QGED 3ABZA 4OQEA 1Q1BA 4RXTA 3GEEA 4LXIA 4E13A 1XMOB 2DB3A 4CV2A 1W4CA 1L5YA 2L0XA 3NCHA 1BS2A 1OZ0A 1ADBA 3E5NA 5IARA 3GWGA 5A9TA 1M6HA 3QEMB 4RBNA 1KSHA 3QWHA 4JQZA 4L9SA 1B0ZA 4QICA 5EEHA 1N2BA 5CJPA 1Q11A 2Q5EA 3I9NA 1ECGA 3GJYA 1VKNA 4F3KA 2BDUA 3HP7A 2O7QA 4RY2A 5EWJB 1ST3A 2GRJA 1ZH0A 1KQNA 1IXYA 2QA5A 3U7QA 1T0PA 1J06A 2R8XA 3THXB 5JRZA 3KXDA 2XMPA 3FCSB 5EA2A 3T3MB 3U3XA 2GZAA 3WWCA 3HO1A 1BGXT 1L5MA 1FS4A 1OGYA 3VPCA 4CGZA 4M54A 2DFNA 4DA7A 4J0GA 5BXQC 2VPPA 1FU8A 1V96A 2HAEA 3C5CA 3EVEA 4RADA 2L42A 5CJ2A 3QGMA 1R9GA 3AW8A 4JGIA 1D5CA 3VTAA 1KBOA 1NI3A 4EFLA 4ZICA 3LCRA 3N2EA 2F8SA 2P2GA 4UU0A 3OCZA 3Q9NA 2C2HA 3BT7A 1M8GA 3DXXA 4HWRA 4I9NA 4G8CA 1T25A 4HZIA 4UNPA 1RZ3A 3WYAA 1VPTA 4UEQA 5K4HA 1BW9B 2G06A 2DPHA 4B31A 4HYTA 3PA8A 5G4KB 3S8YA 2RGYA 2NU9A 2VVTA 4RH3A 3V8BA 3CLHA 4EFMA 2BFOA 2QV0A 3PEFA 4G6ZA 2ZE6A 1ZR2A 4NP6A 3COPA 2R1VA 4GL4A 4PHFA 3TPCA 1LSSA 1V3QE 2R751 2RE8A 1Z39A 1E7YA 4HUJA 5FUQA 3RS4A 1SA0A 3KTFA 3IUPA 2VTBB 1M75A 1K3UB 2QG4A 1SBIA 2HK8A 2EHDA 5CFQA 3ZN2A 4EKDA 3RAFC 1TQ6A 4J7AA 4M1KA 2F48A 2HREA 4NENA 2ZUSA 3O1JC 1NLYA 2BN4A 3U4DA 1CZNA 5L7WA 2Q6LA 1GSAA 5EP2A 1HQCA 3UFXA 5GQSA 1QGUA 2F9MA 4FFPA 4M6WA 2CJWB 3TSZA 2DBRA 1F4VA 1WSAA 1L4MA 3LKZA 4OVKA 2Y2UA 2C1ZA 4INZA 3UZUA 1TM2A 1JL3A 5B6JA 3NBQA 5L51A 3BCRA 4ZP1A 1S3SA 3P9YA 3LXXA 1ZRNA 4BKOA 4YRBA 4GDFA 3IMFA 3TRHA 4GR5A 2QSUA 4G5RA 4QT4A 1NATA 1A5AB 3EWSA 1P4SA 2C4KA 4IRXA 4V0NA 3UT6A 1J97A 1R5NA 2KW5A 3TI7A 5KI6A 2VHEA 2BGUA 4NZ9A 3KB1A 2BV3A 3OCVA 5JASA 1WSWA 2DLNA 3CEAA 2OR3A 3HVIA 3LP5A 1PG5A 4RYDA 4B33A 2WJHA 1MHTA 5MN4A 1IC6A 1Y82A 5ALWA 2FQQA 4RWZA 1T15A 4YPVA 1JG6A 3GN1A 1NF3A 1YRHA 1WSBA 3O8QA 3MCAA 1YAHA 4TV9B 5CHYA 5G0UA 1RXWA 1D2MA 4BNYA 3DAYA 2REBA 2ZAOA 5DCUA 5MFPA 3WQQA 1CF2O 2ZG6A 4O25A 1VE1A 2OSBA 4RNDB 4YUVA 1YOVB 4A26A 3K0SA 2ZUBA 4DV3B 1JDZA 2RH5A 3P9NA 2YHBA 4M0PA 2PS0A 3UAXA 1LBSA 3ZZMA 2HU7A 3B82A 3EZGA 3IEKA 2QRZA 3LFHA 4A6PA 1M1XB 3NCTA 3V1KA 4D96A 1AQLA 3SJAA 1PT8A 3OESA 1WL8A 4YIKA 2WFZA 3AK4A 4JJ4A 1A2OA 1HZZA 4JYMA 3KPUA 2FG6C 2PUVA 1Q1EA 4UAJA 3ME5A 3IOCA 4HB4A 3GT0A 4WKPA 1M8FA 2UYGA 4FGSA 2E4ZA 3DKRA 5BSUA 3T7TA 4B47A 1BQ3A 5J4LA 5KTRA 1C3EA 2WUGA 4U2FA 4B32A 2EWWA 2EZUA 3L8YA 3UWSA 5IM4A 3HNPA 3U3JA 5ADHA 3JVEA 4Z1MA 1T9BA 4NYMR 4DR7B 1OREA 2WILA 3PTZA 1SXQA 2IS1A 2YWGA 1UMKA 3ESYA 3DEIA 4MWDA 1CF4A 4RK4A 2GYWA 1XJ0A 1ZK1A 3S2ZA 1CG6A 3DJFA 2D74A 4OKNA 4Q02A 1SEVA 3SC3A 4B81A 5F4ZA 4KR7A 1N6OA 3F47A 2YMMA 4RVUA 2QMHA 5HF5A 2JJ2A 2ATVA 1JEEA 1FUKA 2H2IA 4EKGA 4MUJA 1QF9A 2ZQYA 1NNSA 4J90A 1YQDA 3B5JA 3VAZA 1XJWA 2ZIWB 2XYHA 3DOOA 4C0AC 1DXOA 2VZ9A 3TW8A 4KQXA 4L76A 1VG9B 4X7BA 2EZ4A 3N7UA 1KPIA 5ECWA 1TVKA 2HIGA 1NBWB 2UAGA 5KUTA 2YV3A 1EBUA 3UK0A 4Z4FA 3MMSA 1KDTA 5CDTA 4RK5A 5CVJA 4RJKA 1ZKMA 3OM1A 1ZK3A 1JR3A 5FOSA 3OA0A 3NDIA 3KB2A 4LJ9A 4CKEB 1JFVA 3QEMA 1OILA 3IT1A 5C9ZA 1J5XA 1FYDA 2JG3A 3NVAA 4Z3OA 1NOJA 4WXRA 2ODNA 1CIJA 4TL8A 6NULA 5JR3A 2WQZA 4IH4A 4PEVA 3GLGB 3DM9B 3VX4A 4C30A 1WY7A 5EWJA 2DPYA 5EZQA 1KEUA 1MPXA 2BL4A 2F62A 2ZT7A 3H1FA 4X1OA 3ZVRA 3BEDA 3THXA 1V26A 1PV2A 3LL7A 3GGSA 5FTMA 4RPGA 1IQPA 3M9LA 5ELLA 3U6BA 1HEUA 2RKOA 4X60A 4C3UA 1OPRA 4IZ6A 4XWAA 4HGOA 4AJLA 5B6PA 1F9AA 3EQ6A 5DDIP 1IHYA 4PZPA 4RE5A 5K3OA 1KKUA 2G1PA 1HX7A 5KVSA 1GNVA 3RS2A 3HEAA 1RXUA 1L3BA 1S1MA 2P65A 3GG2A 4QGAA 2DFDA 1ZI9A 1E7SA 4IYJA 1SHKA 3DEAA 3RKUA 1J0CA 1BW9A 1J25A 1JIUA 1W0KA 2XQKA 3AIMA 3P1JA 3Q6NA 4LWPA 4U7HA 5G4KA 3TEMA 3BULA 4Q16A 1HT2E 4MQEB 4I8IA 1I4DD 2CMFA 2V6JA 4GGOA 2B0JA 2P78A 3H97A 4II7A 3V7FA 3K0FB 2H3HA 4YRNA 3PDWA 4BZQA 1D9ZA 4GG1A 1X39A 1WV0A 5A4AA 1F8FA 1W6RA 2G9VA 3K9CA 3MCZA 5AW5A 4ZMBA 3CWCA 3DZJA 3ZQJA 1RYYA 1DWPA 3KU4A 2O0HA 4B34A 3WK5A 2VTBA 2WIBA 3H9QA 4EKIA 2BTEA 2FN4A 4PC1A 3KZCA 1GXSB 2QU7A 4Q9HA 1U8FO 1IN1A 3TTYA 1JZTA 2BFNA 5D5QA 5A0FA 2FEAA 1HPLA 4JI1B 3R9IA 1NJ5A 5YASA 2HH9A 2H0RA 2PZMA 4W5HA 3VX3A 3SKXA 1TTTA 5ECDA 1LPSA 2GB4A 3AP2A