5JHGB

Crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA bound with its inhibitor and ARHGEF11
rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords Rho guanine nucleotide exchange factor 11
total genus 58
structure length 178
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jhgB00
3W6NA 3U2QA 4M53A 3AH8A 3DO6A 3D31A 4BFXA 3ONWA 1COWA 4L8GA 4CEJA 4JLKA 3LNCA 3IEUA 1OLOA 1UKZA 2PT7A 2IUSA 2LCFA 3BBPA 2VA8A 4G5RA 4LX0A 4C3ZA 1R0YA 2R9VA 5KDOA 1E9DA 1FQJA 2XAUA 1FP7A 1CJMA 1E96A 1GP2A 1KYIA 1R7RA 2DFNA 4LV6A 2X77A 4BECA 4HDOB 5HR5A 3ZD7A 3JZAA 1SVOA 1ONBA 3I1FA 1U81A 1COWD 1J99A 2ZUDA 3QF4A 1E2FA 2DCUA 2CNWA 1KKLA 2Z5FA 5K8IA 1N5LA 5HE9A 1UDWA 1Z6XA 2A5GA 2ONJA 2P5TB 5JSZB 4Q1FA 1WB9A 5EP2A 2DWPA 1JR6A 4B3CA 1RJ9A 3BH6A 3CRW1 3VQTA 4Y0AA 1GITA 2OZEA 1XTIA 2G6BA 3G82C 3K9NA 5H70A 3KJEA 3LXRA 2NO0A 3TRFA 2AHOA 1AZSC 3GJXC 2ODEA 2XNDD 2C78A 3SE0A 3DZ8A 4Y0VA 1NN3A 3RS0A 4E5UA 1KI8A 4MGYR 1YZNA 1SKYB 2QTHA 4QBIA 4B2LA 3FMIA 4LJ4A 4ON9A 1FTNA 4FD2A 4EJSC 1TX4B 1M6NA 1F2UB 5K8LA 1XJCA 3MWKA 4PPNA 2F43A 2JLYA 5KPDA 3QUSA 4QNMA 4Q9IA 2V7QA 5KHOC 3VU9A 2X2FA 4TMKA 1CR2A 2BBSA 2FOLA 2MSEB 8OHMA 1S4QA 1Z0AA 3E2IA 3GJ4A 2OAP1 1R0WA 1GSIA 2FV8A 2ZS9A 2ORIA 5H1YA 4B75A 2WWIA 2N42A 2XJ4A 1G3QA 4EPVA 2GILA 4NCJA 4Q4LA 5CIQA 4OK6A 4E09A 4HAXA 2HCJB 2R6DA 4PPQA 2ECKA 3VKWA 3GCGA 2EFHB 2DBYA 2QSYA 2V8OA 2ZI7A 3LBNA 5HPYB 4HLUA 2F1RA 3K0AB 3L8ZA 4G5OA 4TL7A 4EQ6A 2R6FA 5FOUA 1RVDA 1GKIA 1Z5ZA 3QEOA 3K0SA 3GD7A 3LW8A 2OT3B 3F0TA 4TLCA 4EPRA 4QFMA 3NH9A 4JL6A 1IJFA 2H18A 3O8BA 1G5TA 2GVDC 1JBKA 4A36A 3P26A 1KI6B 3LBHA 5TXGA 2IS2A 3B82A 4Z51A 4IHQA 4NCNA 2FPLA 1W44A 2XNSA 4JT2A 5AJXA 5SZHB 4A8JA 3TNFA 1LW7A 5K8UA 1XTKA 1E79D 2R62A 2H57A 3TIFA 1M7BA 3C4JA 3U3KA 4ZKDA 1X8LA 3I3SR 1BMFD 2ZE6A 4HAWA 3T12A 1PZNA 4IXMA 3VTKA 3CIOA 1TADA 1TU4A 4WZ6A 3TMKA 5EUMA 2AFHE 1AM4D 2JLZA 4TLBA 2B8TA 3QVUA 5IDVA 2VRWA 5KNCA 5JSZA 2H16A 2JJ2D 2F9LA 1FFHA 2QE7A 1SKQA 4F4IA 3GPLA 2O8DA 3IIKA 1GZSA 3B78A 1AJEA 1BIFA 1SHKA 2JIZA 1D8TA 1CXZA 1Q44A 4BLOA 2WOJA 1UPTA 2ZJYA 3CZQA 1KSHA 1WQ1R 1XZPA 3CBQA 1D2MA 1N0WA 4FXPA 4LHXA 4OHYA 1JAHA 2Z83A 1FZQA 4RKFA 5G3ZA 2PJZA 3SI7A 4AYXA 2R2AA 4BFTA 3W8RA 1HT1E 1XU4A 1KI4A 2WICA 3IILA 1QHNA 3W5JA 3QSYA 1DVRA 1YZGA 5B2ZA 5J4YA 3ASZA 3LQRA 2AWOA 2JLUA 2GJ9A 2QM8A 2XJ9A 1WDTA 3AVYA 1L2TA 1OIWA 1VCMA 2FWRA 3K1JA 1T9HA 1XRJA 4LBVA 3ADCA 1FMLA 2UVQA 3UWKA 4PQYA 5AJYA 4S2EA 5DN6A 4EFLA 2AKYA 2OBMA 2WKQA 2ZRFA 1Q1BA 3GLIA 2HUPA 5EUQB 1W4BA 2R44A 3BD9A 3FVQA 5G3YA 2JDIA 4IDNA 1Z83A 2FGKA 4RFSB 3ZGXA 5KDLA 2IXEA 3KXKA 3QIAA 4Q03A 2AX4A 1MRNA 2K5UA 3N2EA 1SXJD 1XXHE 1KI2A 3K09C 4JBWA 2ZRAA 3RAPR 1DS6A 1GRRA 4P0TA 2QI9C 3SC3A 5JEDA 1NN5A 1JALA 2ZUCA 1IJEA 2FFAA 3DL0A 5ANRB 2QPTA 1BYUA 1W0KD 1UAAA 4QGFA 2F3TA 4YDSA 4JSTA 3AP1A 3QBTA 2BMFA 3OEEA 1DTSA 5EE1A 1E2QA 2H8KA 4PHFA 1G7SA 4M4SA 1VCOA 4PFSA 1EK0A 2BM0A 4NP6A 121PA 4ZCLA 3CLVA 4I1OA 4F4CA 2IWRA 4JLDA 4B32A 3TGPA 1RFLA 1SXJA 1PUIA 1Q3TA 4UQOA 3GJ3A 4XSGA 1XD9A 3QKSA 1VTKA 3EZFA 4UXIA 4ZO4A 2Z43A 4ASUA 3HR8A 1G5RA 3S1AB 2Y8EA 1KY2A 3LH5A 2ZRCA 2ZRGA 2BJWA 2J0VA 3LX8A 5TB5A 1AS2A 4OQNA 3S1AA 4KFRA 2XX3A 1C9KA 3IDQA 1N6IA 2OBLA 1AA9A 2JDID 2ZR7A 1CEEA 1OV4A 2OXRA 3B1VA 4KFUA 2OFOA 1U8YA 4HLDA 2DR3A 1N0VC 2NZ8A 2RGBA 5KSPA 4XWOA 3BJIC 4PXAA 1Q21A 4Q1DA 2C9YA 2NTYC 4H9GA 1T0JB 2ZIAA 3KQUA 2A5JA 4UXHA 5LB2A 2PCLA 1LS1A 2D06A 4D2IA 2CHVA 5FPYA 2SHKA 4I81A 1EWRA 2W00A 1J8YF 1GKYA 1E9FA 4RFSA 1CR4A 2ONKA 1T3LA 2OO7A 4OHZA 3WNBA 1LTQA 1ZNZA 4JL8A 4II7A 2JATA 721PA 4X8OA 1QHHA 1Z3IX 5LPNA 2PBRA 5FI0B 3P4XA 3SR0A 1DAGA 5A0FA 1XEWX 3SEAA 2JJ2A 1ANKA 4OK3A 1O3YA 1A2KC 2VP9A 2E9SA 5JWHA 4N0DA 4OQLA 1E1RD 4CF7A 1UADA 3GFTA 3J81k 1NNEA 4Q66C 4DCTA 3DVLA 2RCNA 3MWLA 1U9IA 1DG3A 5FR1A 2ZRNA 1KI9A 1M34E 1WCV1 2ZSDA 1S3SA 2BKUA 1NI3A 2IYLD 1NLYA 3O8DA 4OI2A 3C8UA 1AK2A 2HXYA 5DI3B 5EE0A 2VQSA 4S35A 1AKYA 1ZYUA 1TUEA 2QA5A 5JZVA 2AK3A 5EXXA 2JLWA 5J4VA 3BXZA 3MSXA 1IXZA 5KSZA 3EAQA 2QPOA 4D80A 3TUJC 1EWQA 4G01B 4GP6A 1CLUA 3FKQA 2GTPA 3V4RA 3ADBA 4WOPA 3U60B 4GZLA 4TN1A 1HA3A 2RHMA 1XMVA 1FTSA 2BIFA 2G0NA 2EWVA 1FNMA 2HEIA 3HU3A 4HEJA 4L16A 4NYJQ 4R9UC 5AUQA 3ZIAD 2O0KA 3Q9LA 1RYFA 3GJ8A 1CJTC 4IOKA 4M1SA 1S1MA 5LD2B 3P27A 4IDOA 2GESA 4DCVA 2XB4A 3OIWA 4EDHA 3EARA 2IL1A 5HKKD 3SHWA 4OQFA 3X1XA 1CULC 2HYDA 2GVZC 4M9QA 4HLQB 1XXHA 1BH2A 4HYYA 2ZETA 2GWHA 1XD8A 2CMKA 4BRUA 5L8VA 3IPYA 1U8AA 5F3WB 1ZP6A 3KXLA 3SOPA 2ZSEA 4Q1BA 1ZINA 4P4UA 3W5IA 4GFDA 1Z06A 2FFHA 1R8QA 2IYXA 2EFEB 4ILEA 3IBYA 3EZ2A 1FQKA 2GJAA 5DYIA 1YZUA 5AK0A 5JLJA 1XEXA 1XB2A 3GLFE 3I5XA 5FUXA 3SDZA 2ZRKA 1G3RA 2J0SA 1W46A 5AJWA 2CCKA 4HUQB 1E0KA 4QNRA 3P20A 4MYCA 1OH5A 4UNNA 1XPUA 2IF2A 1OT3A 2BM1A 4PR0A 3RYTC 3GLGE 2KJQA 1E4VA 4Q9LA 3VNUA 1Q20A 4JVSB 2YZ2A 1K8RA 1I4LD 3OAAA 4HB3A 3WBKA 3SHFA 3AF3A 2Q9AA 4DDUA 1DAIA 3O8RA 5B64A 2ASEA 3PUZA 4B3GA 1E0AA 3Q3JB 1TQ4A 3KKMA 3OAAD 4D81A 1VPLA 4M9ZA 3R9WA 4TMWA 2OAQ1 3QVVA 1EX7A 4LYJA 1S2MA 2VP5A 1Z2CA 4PC3A 4QOSA 4HB2A 4KITB 3IQWA 4GDFA 1T3SA 4JJKA 4IDQA 1XXHB 1A4RA 1E2EA 4DSUA 4XWKA 2PLFA 2J46A 2QAJA 3KJHA 1P61B 1SULA 4KFTA 3IPXA 4M1WA 2AXPA 2HT6A 1YZTA 3N5CA 4PZZA 4QL3A 4DKXA 1XEXB 1IQPA 1II0A 4QHSA 1Z6YA 3QF4B 4EPTA 1KHTA 3P32A 2P65A 4ZDKA 3ZD6A 2NPIA 4UNSA 2IHBA 4JZKA 1JR3A 2GAOA 2HV8A 3Q7QA 3R8FA 4OHVA 5HE8A 1W0JA 1DAMA 3U3MA 1HH4A 2WV9A 4A2WA 3CW2A 4EAQA 4CZ2A 2GKSA 3VX4A 1P2TA 2NGRA 4OHWA 1I4TD 1VG1A 1W49A 3CRQA 4CEIB 2W6JA 3K0CC 1X1SA 4X8LA 4C2UA 1AIPA 1J7KA 1U99A 2WTUA 3KJIA 1W4AA 4C7OB 1Z2AA 2GXSA 4ZI3A 2JIZD 2WZQA 3MJRA 4C9BA 3CO5A 1CRQA 3QXJA 1ZD1A 3HYRA 2O8FB 3TH5A 1HTWA 4ITRC 1HYQA 4CGZA 3CNOA 3AB3A 1OYWA 3K9GA 4DCNA 4MKHA 1RYHA 3LFUA 4M2LA 2ZAOA 3PIRA 1OB5A 3BFKA 4M1MA 5DIFA 3UK6A 1FL9A 2J7KA 2NQ2C 4BUJA 1GM5A 4URUR 3BC1A 1D6JA 1GL9B 2ERXA 2VP2A 2ZTSA 3O8CA 4LOAA 1XEWY 3HP1A 1CJVC 3VR1A 1TQ6A 2IXFA 4HZUB 3FYHA 3IGFA 4C4PA 3MWYW 1ZVQA 1NJGA 2JLQA 5CK4A 5AUPB 3U7GA 4MYUA 4D4JA 3K0CA 1N3BA 5LBIA 1KJZA 3ZZUA 2ZU0C 4KXFB 5IK2A 3ADDA 1KIMA 3GEHA 1CTQA 1FP6A 2FA9A 4NPHA 4DHEA 1EX6A 1NN1A 2XGJA 5HCIA 2AD5A 3LA6A 1DAEA 1G18A 1T5IA 1GOTA 1XMIA 2D2FA 3BB1A 1EESA 4AWXA 1AN0A 4V0OA 2O8EB 4URWR 4BLPA 4Z54A 4C0LA 3VR4A 1SXJE 5FBQB 2BEKA 3E70C 3KZ1E 4MYTA 3AEZA 3U4QA 4ESVA 3U7EB 2AXNA 1PLKA 1K5GA 2NG1A 4CW7A 3UG6A 1FW6A 1N6NA 2IK8A 2PMKA 2YC4C 2ZJ5A 2OM2A 3HDTA 4EQ6B 2WIAA 3U61B 3FDIA 4RZ3A 5G40A 1SVIA 2NIPA 1CJUC 2OG2A 1T91A 3NH6A 1M7HA 3X1WA 1A82A 4Q7MB 1MV5A 2BVNA 1RRFA 3AVQA 4BFVA 2QN6A 1HY3A 2G9NA 5FPTA 2F1JA 5FL7D 1YZKA 3TQCA 3BRWD 2ZJBA 5BWMA 4ARZA 3THYB 1TUIA 4D25A 4HAVA 1I2DA 3B1ZA 4QHYA 2GZAA 3QKSB 1ZUNB 2OCAA 1YE8A 4DCSA 3X1YA 4M8NE 3TUIC 1W36B 1VHTA 4LK2A 5JECA 2ERYA 3H84A 1UM8A 5B57C 5AUOB 1TEXA 4E22A 5CB6A 4B74A 2N46A 2CK3A 2FSFA 3EW9A 3BGWA 4KVGA 4LHWA 5L3RA 5A4JA 1KNXA 3UIEA 3KTAB 3R7WB 3ZZ0A 3FTQA 3AVPA 4US0R 3GLFB 1F2UA 3K70B 2J45A 3B9QA 2OCYC 2QMEA 3Q5EA 4DIDA 4IW3B 1XTRA 3U3JA 3F8TA 4FWIB 1PJRA 4Q5IA 4A15A 4JVLA 4HZUA 1EFHA 3OEHD 4FW9A 3AGQA 2V6IA 2DFKB 4EUNA 3N2IA 3U7FB 3NG1A 2P0EA 4GSYA 1KAOA 2RH5A 3WHLA 2XTMA 3ICEA 2PJRA 1RJ9B 2AK2A 1XTJA 4KYUA 3VNVA 5KYKA 4K8OA 1ZU4A 2IF0A 1E9BA 2GXUA 4AK9A 4CT5A 2G77B 3FB4A 4EJSA 2QY9A 1P75A 1G8FA 621PA 2JLSA 5FTLA 1J8MF 3SN6A 3PEUA 4R2IA 1IOZA 4B34A 1S96A 5KU1A 1JR3D 1E2NA 5CDFE 1KO8A 4ACBA 3HPRA 2GRJA 1OXXK 2QU8A 5FTKA 3ND8A 4PZLA 3T06B 4KJZA 3ZQJA 1G17A 5TV2A 3FHTA 2IYQA 1A2BA 2PEYA 2XSZA 2ZE8A 4LYHA 4FI3C 1K6MA 2DFTA 5HKKA 1I2MA 2Q3MA 1NKSA 1NVXQ 5SZJA 1ESMA 1GIAA 5J40A 1KK1A 3RS4A 2QP4A 3CNLA 3AKEA 1J90A 1AQYA 4DDWA 3ZVRA 1MABA 2GXAA 2JLVA 3EZ6A 2P6NA 1W48A 2FMXA 4R98A 4Q02A 1YJ5A 5DISB 5C2JB 1M7GA 1YZLA 5JRZA 3TUZC 3K0FA 4G5GA 1JB1A 3SS8A 1KK3A 1XDBA 1XP8A 4QGAA 2FEOA 4Q7LA 2JLRA 2HLDD 3WRYC 3D6TB 2IXGA 4NYMR 5C18A 1KDOA 5EP4A 3THXB 4POAA 4TTQA 4PC6A 1FUUA 3CKLA 2VL7A 4FMDF 4WZAE 2G3YA 2EW1A 1IN4A 1PUJA 2YNMA 1E2MA 3KQHA 2J3EA 3EWAA 1IM2A 2WKPA 1DARA 3DM5A 4TZ6A 2Q9BA 3OEHA 1HQCA 3CWQA 4DRZA 1RE0A 4YXWD 4B2IA 3IEVA 3GLHE 3RRZA 3NBXX 1OFTA 2ZI6A 2VTKA 4MYHA 3WYFA 4A9AA 3L0IB 1G3IA 2VHQA 2WMNB 5CIWA 2Q3HA 2RGCA 3NTUA 2QUZA 1IN6A 4DCUA 2KWIA 1LFDB 4ZDJA 2FN4A 1QRAA 3AV0B 2J5XA 2G88A 3NEJA 1ZM9A 1EFTA 4MRVA 4Q4JA 3ICQB 2C04A 3DMDA 2PEZA 4M9SA 2C99A 2YJTD 2FG5A 2IYRA 1OPXA 3FMPB 1DE0A 3ND9A 4TQAA 4NL4H 5DH9A 2IYSA 4A6PA 2V3CC 3LLUA 3SBEA 3TW4A 1RRCA 1O87A 1MH1A 3BB3A 4LJ8A 1XBTA 3FWYA 1G4UR 3A1WA 1E9AA 2QP9X 1CJKC 3CZPA 3KB2A 3LBIA 1N25A 3ZVLA 4NCIA 4PQFA 4GOXA 1KSGA 4RD1A 2BWJA 4F92B 3PR1A 4M22A 1N5IA 3SJCA 3AVXA 1XTSA 1NJFA 3PVSA 2R6AA 4PSVA 1UKYA 3VMFA 5FBLB 5DGXA 4MQBA 1US8A 5J4KA 2C5LA 2FJUA 2ZE5A 1MOZA 4LC0A 3IUYA 4RFVA 1VCNA 3BIFA 3H1TA 5JWOA 5FBWB 3Q8XB 1IBRA 4C0KA 4A82A 1J2JA 1TF5A 1NVUQ 2ZYTX 5CYPA 2WOOA 3OESA 1L8QA 3ZDQA 1BMFA 4NYIQ 1G19A 1OXVA 3CR8A 4AD8A 3TVTA 5J4HA 3CPEA 1NVWQ 5FOSA 3R8CA 3ZYCA 2J0QA 1H8EA 4RJLA 1L4YA 1NBMA 3KL4A 4B3DA 2GJ8A 3JVUA 2XZLA 5JJKA 1M74A 4Q7JB 1Y63A 2FZ4A 3TSWA 1A1VA 1GFIA 5KNDA 4C30A 1MT0A 4F4JA 1XJ0A 3BAFA 1T5LA 4DLTA 4TTPA 4Q9KA 4HAUA 2ZUBA 1KMHA 3L0PA 2XB2A 3LLMA 3KX2A 1CR1A 1DAHA 3TSZA 2VP4A 2A5FA 2J9RA 1MO4A 5HZHA 3FFBA 4Q00A 3GJ7A 3FHCB 2Z4RA 4XSHA 3OE7D 1G41A 1ZBDA 3V9PA 4AY2A 2I4IA 4GI7A 2QBYB 1UDXA 5FOTA 1AKEA 4MDEA 5AUNB 3G0HA 2W0SA 2YWHA 4NHOA 2D2EA 4IRUB 4WBSA 4TMXA 3DDCA 4FCWA 2QMHA 3MLEA 2KB0A 5DLQC 1CU1A 1EGAA 2C98A 5JJLA 4IEIA 4LDJA 3VR3A 2RGDA 2ZR0A 4B48A 1Z0KA 1X8JA 2EU8A 2QT0A 3NBFA 4QBHA 4C0AC 1E9EA 1Z6TA 1N6LA 1II8A 2YWFA 2IYTA 5F9HA 1OJLA 1R4AA 4K46A 1KOFA 4JLPA 2FE4A 1HT2E 2PT5A 2WIBA 3RABA 4JKYA 5K8TA 1SVLA 4KBFA 4PSAA 2PL3A 2VHUA 4N0EA 4IOMA 2O52A 4LBZA 1UF9A 4NDZA 2BMDA 1Q1EA 1C4OA 2KBEA 3C14C 4MRNA 1KI6A 1MRSA 2G83A 2N1BA 2JA1A 3RDPA 2FX3A 2D74A 2LKCA 3FKSD 5DI9A 4B3BA 1SHZA 4Z8YA 5FOXA 4HDCA 2OILA 1OIXA 3PEVA 2VF7A 5DHFA 3IO3A 5JI2E 3I72A 3M1IA 4V0NA 3TLXA 3VR2A 3MFYA 3OIUA 2XZOA 3HJNA 2KE5A 3FOZA 2ZJ8A 4DSNA 1KSFX 2BC9A 1M1YE 2CJWB 3UPUA 1TEVA 2XTNA 1Z0FA 3AVOA 1R5OA 4IOJA 1EXMA 4YONB 1BKDR 1NBME 3X2SA 3ZIAA 3SQWA 2CNWD 1Z0DA 2ZJOA 1GVNB 3BS4A 4TYQA 4LPSA 4Q9JA 3R9XA 1B23P 2ZRDA 1ZCAA 2XXAA 4H1UA 4HSEA 3KUCA 4F38A 2Q6TA 1SXJB 2X8AA 3RSLA 2ZJAA 3LO5A 4KU4A 3ASYA 4LHZA 1MO5A 5GVRA 3F5FA 4EFMA 2CL0X 1IHUA 2I1VB 2WWHA 3CM0A 4PHHA 4W5HA 1NKTA 3CWZA 4JT4A 4IVPA 4YMSA 3THXA 4ARZB 3A1VA 1CP2A 3UXMA 4DXAA 2BOVA 3MUFA 2V54A 4LJ9A 3SU8A 3WMGA 2O8BA 1U0LA 2FFBA 5BQ5A 4LV5B 1OH8A 1XMJA 2XOKA 1E99A 2CK3D 1Z6GA 5FH9A 2OFXA 4DC9A 3CF0A 1XF9A 2VHTA 3SNHA 3NDBB 2OV2A 2HT1A 1MKYA 2WMOB 5FBRB 2QQ0A 4P33A 4E07A 1KDPA 1E1QD 2A30A 3T34A 1II9A 2ZI3A 1OFHA 3PUWA 4O0MA 4NYJR 1P2VA 2NO1A 5LD2C 1QBKC 3QKRB 3CF6R 1OHHA 4JLMA 3LW7A 3X1DA 3C5CA 2OBNA 2ZI5A 5BYJA 2Q3FA 4LGMA 3U6KA 2H5EA 3OFNA 1RPZA 1P4SA 4YC7A 1F60A 1ZMXA 5CM9C 4JLNA 4RZXA 1KI1A 4TL8A 3H2YA 3AP3A 4PZYA 3BE4A 1QHXA 4JLOA 3I5YA 5L3VA 2IT1A 4FWTA 2VIIA 4LBWA 4B33A 2CE2X 3MJHA 1IXRC 4UXJA 2KI5A 4ZIRA 5BN5A 3W90A 1YVDA 4JSYA 3U7HB 1QVRA 4BEJA 2RAPA 3A37A 2CVFA 3B9PA 3DKVA 3AF2A 4PSKA 5F98A 2IS6A 4NKRA 4TMTA 4GMDA 1R5BA 1KI3A 2EFDB 4WXPA 1KI7A 1N0UA 3ZVMA 4LC1A 2X2EA 5C4MA 4XVRA 3M0EA 1JQJC 1ELOA 4JVNA 1W7AA 1E2JA 1ETUA 1OKKD 3TW8B 5J47A 1DBSA 3PXGA 1TPZA 2C03A 2RGNA 2EYQA 3W8NA 3RNLA 3W6PA 4ACAA 4V0LA 3JVVA 2YINC 3WP1B 1ZUIA 2C2HA 4URZR 1FMJA 2QMUA 1YR8A 4JKIA 4DB2A 3U3OA 1AZTA 1NMZA 3DZDA 4DIEA 3ZQ6A 1P62B 3AVTA 4PPFA 1XZQA 1HV8A 2WSSA 3C41J 3CNNA 5JMTA 2A3RA 1VYTA 1VKJA 3MCAA 4LJAA 3SYLA 3KKNA 1PVOA 3SJAA 2IEYA 2ZANA 4PC1A 4FINA 5G41A 4ZKEA 2ORVA 2ZU6A 3A6PC 4CYMA 3RC8A 4LPKA 1NN0A 3CX7A 3GEIA 3B1YA 2VHJA 4P4TA 2OUKA 1VYUA 2IYYA 4PC2A 4B3FX 1W36D 1TMKA 3QXXA 2CDNA 1NLZA 3K0AA 1Z22A 2HLDA 1YHNA 1G21E 5JHHB 1G3MA 2FFQA 3T1OA 1XWIA 4OQXA 2ZM5A 4RD3A 2VO1A 2GNOA 3RRMA 4DDVA 1KGDA 1UKVY 3CF2A 3AKYA 2J7PA 2IWHA 5E3HA 1W0JD 4FCVA 4Q47A 2B92A 4F91B 2A78A 4TTRA 5DN6D 1G7TA 2WAYA 4W5WA 2L0XA 2HXSA 4AG5A 4DUGA 1G8GA 1OXUA 4LHYA 1YRBA 4FN5A 1JAIA 2PZGA 4RSGA 4WAUA 3CH5A 4LJ6A 4L4UA 2UKDA 2ZRBA 4XJXA 4KHZA 4N3NA 1R6BX 1DOAA 1PLJA 5CLQA 3E5HA 2VEDA 3TK1A 3LAWA 2A5YB 3AP2A 3L8YA 1OSNA 5AWFC 4O25A 2FSHA 2OHFA 3DEFA 4AURA 1OH6A 2WVJA 3RS7A 2DWOA 1F2TB 3Q7PA 5L3QB 1KDRA 2QT1A 3U6BA 4G5SA 1N6OA 4TQ9A 4A4DA 2IYWA 2XOKD 1IY2A 3EA5A 1GG2A 3ZLJA 1ZD9A 1CS4C 1IONA 3OE7A 4B3XA 1DADA 2ZPTX 1E2LA 1U90A 4LY6A 4RVCA 1E0SA 3M4YA 1NY6A 2QORA 3PJRA 4JBYA 3PCRB 3VR6A 3WRXC 2UZ3A 3RSOA 4BLSA 2PCJA 4Q1AA 2VBCA 2O8FA 2FSGA 4V0KA 5GADl 3NIBA 1G5PA 4TMZA 3ZVNA 1H8HD 5G53C 2CL7X 4LRWA 2PX0A 1Q22A 1MABB 2O0JA 4IXNA 3NXSA 4US1R 4IEEA 3P4YA 3FHOA 4EPWA 4R7ZA 2LWIA 2XITA 3UMRA 1ZNWA 2OE2A 2CHGA 4PQRA 3W6OA 1QG4A 1QHYA 4NBSA 4QXAA 1S9DA 1NIPA 1BO6A 1BYIA 4TL9A 3PITA 2YWEA 4WIAA 2RGGA 2X19A 2RGEA 2AFIE 1CR0A 3KB1A 4RZ2A 5FFMA 1XCGB 4OJQA 1KO1A 5CM8B 5L3SB 3GFOA 4OBEA 4PHGA 4Q4HA 2OXCA 4URYR 3A4NA 4HB4A 1SVSA 5E95A 1Z0IA 3NDPA 3NVAA 4HATA 3EPLA 1NG1A 4LSGA 4IVQA 1G7RA 3AF1A 5DI3A 3REFA 3GJ0A 4TSFD 3FKSA 2ZXUA 4QJ4A 1UBGA 1RZ3A 4KLNA 3PUVA 1WP9A 1G64A 3BH0A 4DLUA 1FX0A 1T3HA 2NOAA 3LWNA 4M1YA 4LWZA 3MRSA 3T5GA 1KZGB 4JLJA 6Q21A 221PA 1KMQA 2J87A 4O3MA 1TQ2A 5FUYA 4NE2A 1VIYA 1G3UA 1W1WA 2GK7A 1M8PA 1XNJA 3DHWC 421PA 2QROA 2VF8A 5EXPA 1PLLA 2YOHA 4I1SA 5L3QA 3TSOA 1CF4A 5BN4A 1F2TA 1GNQA 2QPAA 2YOFA 3NBZC 4B71A 4CEHB 1HURA 2BBTA 4KV9A 2JJ1D 4FIDA 2W6IA 2F55A 3THWA 4DUGD 1E94E 2ZRMA 2G1JA 2ZSBA 4B47A 2Q0HA 2W6ID 1TF7A 2ANBA 3QQ5A 4BFYA 2C95A 1RRPA 3QG5A 1T4GA 4DLSA 5JWRA 3E1SA 1DG1G 3QKTA 4IVRA 4OKSA 4PO8A 3VFDA 2XXAB 3TAHA 4W7SA 3DOEA 1F3OA 3TKLA 3UMFA 1E6CA 1VCIA 3H4MA 1Z08A 1OXSC 1JQLB 2GZDA 3WXMA 4QKQA 4HB0A 2D7DA 3ETLA 2BMEA 4HUTA 1GRQA 1B0UA 4LZZA 4NU0A 3W3AA 3CPHA 1LS6A 2GCNA 2ZS8A 5DNYB 2EFGA 4V0MA 2GZHA 3F3YA 4CIDA 5IT5A 2H17A 4MGIR 3QPVA 2ZYVX 2YHSA 3QPWA 5GJWC 1QHIA 2CE7A 2ZYUX 1HQYE 4Q4AB 5F9FA 1ZD8A 1YU9A 4IFBA 3AUYA 2IBMA 4HZIA 3RHFA 4C2TA 5FOWA 2ZRLA 1OE0A 4XTCS 4KSCA 3CRMA 2GXQA 4JVMA 1OFIA 2FEMA 1SQ5A 3GP8A 1E9CA 4KLZA 2CCGA 5EE5B 1BS1A 1ZUHA 2WSMA 5HTKA 2PLRA 4RZUA 1WRBA 1P5ZB 2F6RA 2ZEJA 5IF9A 1WXQA 1E2HA 1P73A 5J4LA 5TY0A 3TR5A 1KO7A 3T1QA 2OFWA 2VSFA 3A1UA 4DSTA 1XEFA 4TZ0A 3RRNA 3I8XA 3LXXA 2AD1A 3B8HA 3THOA 3WHKA 3EZ9A 2EFCB 3PUYA 2BJVA 2G0TA 4FMBB 3L82B 5JHGB 3CUEF 3RWOA 4DEYA 3KQNA 5EE9A 2QBYA 3AM1A 1XD2B 1T6NA 5IK2D 4GRAA 2BBOA 4IOLA 3MAAC 3GMTA 5E7IA 4US2R 1F48A 1U98A 4RD0A 4G1UC 4ZPXA 2Z6VA 4WXRA 4TYPA 3IIJA 4DLXA 3QJYA 2WPDA 5H8WA 2NO7A 3H0KA 2QL6A 5KPJA 3PV0A 1N6PA 1KMHB 2REXB 4B6EA 1D2NA 1XD2A 3EXAA 4L9SA 4Q1CA 5EXTA 4LJ7A 1E69A 1K5DA 1TU3A 1S9HA 2CLDX 4TT3D 1XPRA 3G5UA 4A0RA 2F1IA 1G6OA 2GAAA 4K81B 2QGZA 3T1VA 1YKSA 4PO9A 1OH7A 1OYYA 1KSJA 1W0KA 3CRVA 3JZMA 2IS4A 2B21A 2TMKA 4MRSA 4MDFA 4TWZA 3LDAA 5TVKA 3RANA 4TL6A 4MH0R 3SQXA 1KO4A 3BH7A 3AVWA 5GJBA 4AG6A 2ZREA 1G1MA 1ZCBA 1G16A 4D82A 1OIVA 4XTRA 1HEIA 1E32A 1EFRD 2BV3A 4Z1MA 3GLHB 5AR1A 1JXOA 4Q1EA 2ORWA 4O2LA 3DKPA 4WVFA 4TLEA 4ESHA 3RLFA 1NL3A 1XMSA 1HUQA 5DYGA 2QZ4A 3B13B 3I61A 2ZRHA 1E2KA 2MMGA 3OIVA 1R0ZA 3KQKA 3KFVA 4LJYA 5FI1B 2MMCA 3Q85A 5EP1A 2OLJA 5SZKB 1TAGA 5E4FA 2JASA 3KDSE 4V0ME 4DLYA 1X1RA 1CRPA 4J0QA 4P4SA 1X3SA 2V6JA 5SZIA 3TBKA 3BOSA 4U7DA 2OCPA 2GK6A 4KSBA 2I3BA 1RKBA 3U4QB 3R20A 2WSSD 5FTJA 2QENA 5B58C 5BW8A 2G1KA 4QRHA 2BBWA 2J0UB 3NEYA 4WW0A 3RS2A 2OEPA 2W0MA 2VSOA 4PTLA 4DB4A 1RC8A 2FGJA 4UKDA 1C1YA 2H1LA 3T61A 3VKHA 3K53A 2O5VA 2WWYA 2ODNA 2ZI4A 3UKDA 5GVSA 1WBDA 4TSFA 2F1HA 2P3SA 2BMJA 4UNPA 2CLSA 5KSOA 3KKOA 1G8PA 4D4KA 1E3MA 3PQCA 1WA5A 1MO3A 3MGCA 4RY2A 3H86A 3QI2A 2GHIA 2ZVQX 3EC1A 2QMOA 3SZRA 1AGRA 1GRNA 1UBEA 3PENA 4FMDB 1Q0UA 1Z07A 2P67A 1H65A 1KY3A 2ANCA 1ZU5A 3WBJA 5FOVA 2V1XA 3Q72A 4KI0A 3CR7A 3FGNA 1U9IC 4DLZA 3QEJA 2ZRJA 3LV8A 1W2HA 3O47A 1RW4A 1WBBA 5HZKA 4M1KA 1U0JA 3A8TA 2ZI9A 1G9XA 3EASA 1GUAA 3HPQA 4MKIA 4LYAA 3C7KA 4KVAA 2QAGC 5FPKA 5L3SA 2WJIA 4BRWA 2YV5A 4NMMA 4PPGA 3NHBA 1UEIA 4QM6A 4PAMA 2ZSFA 2GEVA 1Z8FA 4O2RA 1I4DD 1IY0A 2FSIA 2WJGA 4GMXA 3TR0A 4CEIA 2XTZA 5KUTA 3AF0A 4IDHA 5AJZA 4C0BA 1LVGA 3MD0A 4Q9HA 1FPMA 2JGNA 3GJ5A 4GZMA 4B2PA 4B73A 2KSQA 3IHWA 5KDDA 3V00A 2GJSA 3NBYC 5D3MA 4MKGA 1IN7A 2DY1A 4KO8A 1OHHD 4D6PA 3AVUA 1D9XA 1DO2A 2XSZD 1N2CE 2J59A 2GCPA 3EIQA 4OI1A 1Z47A 5JEEA 4DLVA 2A5DA 3L0SA 1OXTA 4KAXA 3CX8A 4L5BA 2IX3A 4G5QA 4Z8XA 1KDTA 3A58B 4H1VA 3RWMB 3ZS9A 3EZ7A 1E2IA 3GLIE 1X6VA 2PZFA 4LV8B 2BHRA 4QGGA 3GJ6A 1XTQA 3OIYA 2C96A 2R65A 1WE2A 4GPTA 3U3RA 3KQLA 5LB4A 4YMUA 2XNDA 1TF2A 1IY1A 1ZJ6A 5BYKA 4A0FA 2IHYA 2WBLC 2CL6X 3FMOB 2IW3A 3W3ZB 4XD7A 4JBXA 2C9OA 1J70A 4C0SA 3AVVA 1TNDA 4OQMA 2J1LA 5EP3A 1XFAA 3DMNA 2KBFA 4DJTA 2MSCB 4A6XA 4MITA 4DLRA 4EIWA 1XCPA 4U5XA 5CITA 4F7WA 3TE6A 4N1AA 1VECA 1TL7C 2DPXA 1WF3A 1ZC4A 2WJYA 1S8FA 4JLVA 2DFLA 2ZQ5A 4Q19A 3MG9A 4F93B 5JS8A 3U44A 1JPJA 2B6HA 1Q57A 4IFEA 3VHLB 4BQSA 2AR7A 1Q3HA 5A5GA 4TQUS 3UWOA 1EFRA 4LJ5A 3EC2A 5JI3E 2QP3A 1ZM4A 4C0QC 3U44B 1F6BA 1DAFA 5KSYA 4ZDIA 2GBLA 1UKEA 5TDHA 3QE0A 5P21A 2VPPA 1G6HA 1DO0A 5FPHA 2W58A 3QKUA 4RCZA 4NONA 3K8YA 3VAAA 2AKAB 3EIHA 1RRGA 5CDFA 1DAKA 1GDDA 2JJ1A 2R8RA 1NP6A 3DOFA 4Q18A 4BLTA 2YWGA 2EYUA 4TT3A 1SKYE 4B6FA 1TQDA 1XCMA 1MR3F 4XIGS 1JXMA 1L4UA 4B76A 2IYZA 1LV7A 2BCJQ 5IHPA 4M9XA 1NG9A 2WJVA 3AUXA 3RS5A 2HJGA 5F2EA 3PG5A 4MKFA 3VU9B 4BFUA 1Z63A 4CEHA 3GLHA 2F7SA 2D4HA 3AKCA 5CYOA 2JAQA 4R71A 5EZ6B 1Z29A 1XX6A 2D7CA 4TYYA 2DHRA 1E2PA 2RGNC 1JECA 2ZJ2A 4UJ5A 1UBFA 4DWJA 3U5ZB 521PA 2QGNA 4DZZA 1II8B 1Q1QA 1QDEA 2NO9A 3KUDA 3WNDA 1P3JA 1GILA 4NCHA 4NCKA 3T1TA 1T0HB 1NLFA 1G291 4M0LA 2IA5A 4QGHA 2IEZA 2VYFA 2AWNA 4XVQA 2BKEA 2H7VA 3WYAA 1KK0A 1V43A 4RD4A 2ZYWX 3REGA 1E1RA 2WJJA 1CIPA 1W47A 3IKJA 1G8HA 3K70D 3QENA 4JS0A 3A4MA 3GLIB 1ESNA 1D9ZA 1JR3E 3NWJA 4D26A 4RD2A 2A7QA 3L0OA 4KYIB 4Q4HB 2OESA 1ODFA 3FPAA 4A2QA 3I8SA 4B43A 2ZRPA 2PMDA 2ZJZA 2JCSA 2FH5B 3HU2A 3RC3A 4UNRA 5HCNA 1ZIOA 4DT1A 1QHGA 4B44A 2FPMA 1EG7A 4A92A 3CPJB 3D8BA 4HLCA 3SYNA 1NVVR 5CB8A 3QG1A 1OFUX 2VSXA 1E2GA 4B35A 4MUBA 2YYZA 4L9WA 4LHVA 3GLGB 5C46F 1KAGA 2YOGA 3K9HA 2GEUA 4DDTA 2F9MA 1VG0B 4ZCIA 3LD9A 4PAOA 4GOJA 4A2PA 5KNBA 3WMFA 4QBFA 5E7JA 1P6XA 2W83A 1VIAA 4JMPA 5CK5A 2YC2C 2ZITA 4OYHA 4V03A 2GCOA 3QBVA 1IAQA 5D3QA 3EX7C 4C0JA 3BK7A 4JLBA 4DEXA 3LRPA 1VG8A 1W2GA 1GKUB 4URXR 2C8VA 2GETA 2HJVA 1VDZA 3LY5A 5FUWA 5JJIA 4NYMQ 4YMVA 4JYCA 3VR5A 4RCYA 1H8ED 4I4LA 1N6HA 1UJ2A 2P6UA 3NKVA 3KTAA 3R7WA 4PO1A 3ZZTA 4D0NA 3GLFA 1NVVQ 3OF5A 1N6RA 1QVAA 3D7MA 1US8B 1LNZA 1YRAA 2D3WA 3EA0A 4OI0A 4ZCMA 1AQUA 5IRCD 1L7VC 1U8ZA 1X86B 5UKDA 2NZJA 4D0LB 3K70C 3W34A 1IN8A 1SVKA 4BGDA 1DELA 1E98A 2CBZA 3A1SA 4TLAA 4ASUD 1Z28A 1T8TA 1U0HC 1UFQA 2Q21A 4QBGB 1LB1B 4A0HA 3B2EA 1CBUA 3NHAA 4GBMA 3FFAA 4MRRA 2F3RA 4XH9B 2A2ZA 1GNPA 1R10A 2C77A 2FZLA 1Q1ZA 4A0GA 2ZR9A 3RS3A 4I1VA 3T35A 4JL5A 4AKIA 1ZC3A 4D4LA 4G0NA 4Q4JB 5C1BA 3THWB 1R0XA 1E2DA 1XPOA 1YR6A 2CVHA 2J41A 1NRJB 2ZS7A 3HR7A 3MMPA 2CJWA 2QAGB 4HLUC 1KKMA 1R2QA 2W2TA 4BZPA 4AC9A 4GP7A 1YQTA 4M21A 4DVGA 1Z0JA 3CX6A 3QF7A 3ADKA 1U2RA 5FL3A 3A1TA 1ZIPA 2HF8A 1KNQA 1P9RA 4AYTA 3C5HA 4EPXA 5EJEA 2XZPA 2CLCX 1P2UA 3VKGA 1LF5A 1E4YA 4ERNA 4LI0A 2WWWA 4NYIR 2WHXA 5E7MA 3IQXA 2O8EA 3AQ4A 1SZPA 3T5DA 3P1JA 2WM9B 1EFUA 3I4LA 2WWXA 3UG7A 4CT4B 1FUKA 2VP6A 1ZNYA 4D0GA 1V5WA 2QG6A 3EPKA 4QG7A 2QNRA 2X1VA 5DSZA 3DM9B 1YR7A 4W5JA 3N70A 2R6GA 4LCBA 1LF0A 5D3MB 3C15C 1NY5A 1NF3A 1W5SA 3BWDD 5FTMA 2EWWA 1ZW6A 4AKEA 4IKEA 3A4LA 3V4FA 2JLXA 2WWGA 3QXHA 4LYFA 1HE1C 5JCPA 4FCTA 4R2HA 4M1OA 4A1FA 4QJ5A 4BFZA 4URVR 2IYUA 3UMSA 5FTNA 1G20E 4KODA 2Z0MA 5DO9A 3I92A 2DYKA 3UANA 2QE7D 2V55B 1X8KA 5AJVB 4HI0E 4ABYA 3MWJA 1VMAA 5JFGA 3KKQA 3CH4B 3OHMA 3QXCA 4MGZR 3WMEA 1JJ7A 3LQQA 4C7OA 3CRRA 3IIMA 2WWFA 4Q48A 1D2EA 2EQBA 5KO2A 4AYWA 1W36C 1P9WA 4A8JC 1NMYA 1JEEA 4OHXA 3R9IA 3SJBA 1JI0A 1YZQA 3B5JA 4DBLC 1R5NA 2PZEA 1KJYA 1YR9A 2Z4SA 1OW3B 1TTTA 1OKKA 3QKRA 4U00A 1LY1A 1NMXA 1RIFA 1QHSA 1KZ7B 1OF1A 5JS7A 5BN3A 3CONA 3HU1A 4G3XA 3A36A 1E79A 2ZAMA 3KFXA 4GNKA 4Q4AA 1IXSB 3K09A 4PX9A 3PEYA 5B30A 4AKGA 3TVDA 3W9YA 1S3GA 2ATXA 1KO5A 1KTVA 2O8BB 2CXXA 2PX3A 2AN9A 2QRNA 3C16C 3D3QA 4Q21A 1W5TA 1A5TA 3T15A 3WP0A 4BFSA 2NO6A 4ZI2A 2FPKA 3TJZA 1JPNA 1FOEB 5KOYA 4P32A 2REBA 4E03A 4XD7D 2BDTA 1P2SA 1QG2A 3AKDA 4LBYA 4OL0A 2GF9A 2E1RA 3SJZA 5M04A 4P3YA 4MGKR 1GAJA 2BCGY 3EG5A 1NSTA 2JJ8A 4KCGA 4EPYA 5FPSA 2GA8A 3THYA 4NZYA 4TMVA 1R8SA 2R6CA 2VH5R 2QTVB 2WPDD 3L43A 3WYGA 1VG9B 3OFND 2RMKA 3BFXA 4ZDWA 2QM7A 3RVBA 4PANA 4M1TA 3LVRE 3KJGA 3I62A 2P2LA 2ZROA 3B1WA 2REOA 3L2OB 2VP0A 4YMWA 5EZ5A 1BOFA 1ZM7A 2J7PD 2WKRA 4RD6A 3RRYA 4P31A 3HWSA 4CDGA 3EIEA 2JEOA 3NC0C 4BE7B 1S0UA 5H68A 4YLGA 1H8HA 1E9SA 1W4RA 2EVWX 4BASA 1N5KA 2RB4A 2ODWA 1CKEA 4BZXA 3BFVA 3IBGA 4WZBE 2DB3A 1MO6A 1Y3AA 1VYVA 1WMSA 2HDNB 2IC5A 4HDQB 4CVNA 5TMPA 2QEQA 2CEAA 2F43B 3EPJA 2E87A 2VHCA 1ZNXA 3VHXA 4TLDA 3SFVA 2O8CA 4JLAA 5JBQA 5FUVA 4P4SB 4QC2A 4BEBA 5FBVB 3WY9A 2YKGA 2W2XA 1GL7A 2FNAA 3AGPA 5FL7A 1AGPA 3ZH9B 3VX3A 1E0JA 4EFNA 2QTFA 3IHLA 3K0FB 1SXJC 1VHLA 4Q01A 2ATVA 4FMCB 5TARA 2IYVA 4JYBA 5C4GB 2H92A 4ZV4A 2V1UA 2V9PA 5JRJA 1GTVA 3CB4A 4XWAA 1F5NA 4NTZA 3LVQE 1UEJA 2W2VA 2CCJA 2HCBA 4YXWA 1PV4A 1SGWA 3PFIA 3OZXA 4XVUA 3QY0A 5ELXA 3NC1C 2HF9A 3B7GA 4KBGA 3ECCA 5DE3A 1AS3A 3TQFA 2OCBA 1G7CA 5EXSA 4JIMA 1NIJA 2HYIC 1U94A 1Z6AA 3FMFA 5EE3A 1EFCA 2VLIA 4TYNA 1G4AE 2OSBA 2QQEA 4MRPA 1G8YA 2CHQA 1ZAKA 4DSOA 1NSFA 1D5CA 2IS1A 1OB2A 4PHTA 4XOIA 2C9CA 4X8MA 4EJSB 1KJWA 3B85A 1DPFA 2GBLC 4WA7A 1JEDA 3K9LA 3SBDA 3QXSA 5KTYA 5LDDC 4GOKA 2B7CA 1P7CA 4D4MA 4CEJB 1JJVA 4DT1B 3PEWA 4ZIRB 2XEXA 1N6KA 2IUTA 4DLWA 2GF0A 3DPUA 3B1XA 4X8HA 2WAXA 2OLKA 1QHHB 3BB4A 2O8DB 4BPBA 2W6JD 1N5JA 1A7JA 4QHTA 3GFPA 4V02A 5CLLA 4NH0A 2AL7A 5FR2A 4GT1A 3KXIA 1ZRHA 5CJ2A 5BXQC 2ZVPX 2ODBA 2D62A 2DWQA 2UZIR 4A8JB 4UJ3A 5JCZA 2FDCA 1P72A 3KKPA 4EKDA 4Z1MD 4PC7A 2V7QD 2RHDA 1E9RA 3EWSA 4I99A 4L15A 5EQTA 5J5CA 3ZJYA 4I1UA 2O8CB 4AI6A 2GJKA 3GQBA 2J0UA 2FF7A 4HAZA 4U02A 4UNQA 1P9NA 2Q9CA 4JJZA 4QM7A 1ZM2A 3K0EA 1KK2A 2ZSAA 4BLQA 1SVWA 1GNRA 2B7BA 2QAGA 4OJKA 4BZQA 2IUUA 2GEDA 2A9KA 2RGAA 4HAYA 2P5SA 2LKDA 2QSZA 1NBMD 5GJCA 3OEED 4BFWA 3Q5DA 1JNYA 3PUXA 4OK5A 2V4ZA 2YVUA 1Q12A 1QF9A 4AKHA 1GWNA 3SFZA 3WNCA 4C0HA 1AS0A 4HUQA 4MUAA 1ZM3A 4LUCA 2NPFA 3B6EA 4OI4A 4PAQA 4YDHB 3ZS8A 1DEKA 3IO5A 3QOFA 3TAUA 2I1QA 3I73A 2P6RA 4GL2A 2QRZA 4Q7KA 1S1CA 2RKOA 3BORA 3GEEA 4BWYA 4FMCF 3QNUA 3FE2A 4YQFA 3LX5A 1HE8B 1QZXA 1UBCA 3QPUA 3BERA 2ZE7A 1T8UA 3SYKA 1W4CA 4RKEA 2PH1A 3HYTA 4IDPA 1P60A 4KFSA 3AF4A 3M6AA 4AIIA 3B60A 1FX0B 3X1ZA 4YMTA 3GLGA 2FU5C 5DHAA 4BLRA 5CJPA 1FNNA 1IN5A 821PA 3EPHA 2NMVA 4QJ3A 2GDJA 2ZRIA 2MSDB 5GJVC 4CRWB 3UATA 1XJQA 2GCOB 1GL6A 2B8WA 2O0HA 1E1QA 1SVMA 2RGXA 4IJMA 4TYWA 3I32A 2BEJA 1M2OB 4MA4A 4W9MC 2WJHA
chains in the Genus database with same CATH superfamily
2OGZA 2UZAA 3ZV4A 3U2QA 5JNSA 1M8KA 4RVHA 2O2HA 2YZ7A 1B1AA 4O2BB 4PZUA 3R0ZA 4CFSA 2VNHA 1QGZA 4DV2B 1COWA 1G6KA 3FFTA 1QONA 2IEBA 4WHMA 4XWGA 4KAAA 5JQGF 5GV8A 5LMZA 5DCUA 1QBGA 5EIEA 3O1HB 1B74A 1V3UA 2LCFA 3ESXA 3AUUA 1FPQA 1V71A 3C3YA 4LX0A 3TTTA 4WJLA 1E9DA 1FQJA 1V5IA 3FNQA 5I9TA 5ALOA 4FFOA 2ZCJA 1KYIA 1E96A 4Z86A 4CV2A 2JLAA 2O7VA 1YCGA 3STVA 2CDBA 4XB6B 4DGQA 4HDOB 3EVGA 2R7LA 3OZWA 1R4NB 4JI8B 4KOEC 4FFRA 3VHXB 4EHBA 3I1FA 5C0OE 2ZUDA 3IDAA 4FSXA 5CJJA 4GU5A 4TMFA 4MQEB 1LK7A 4UTOA 2QUBA 5K0NA 2PYZA 5L51A 1VSQA 3KXPA 3E05A 4L8VA 5HE9A 4D96A 2O5CA 1H05A 3L1IA 1C9DB 2XV1A 2DWPA 5L8VA 2CZCA 4B3CA 1OZFA 1RJ9A 3CRW1 3VQTA 4RTJA 5I5EA 1MJGA 1I1HA 2G6BA 2JFBA 4QBTA 3DV0B 3Q8MA 5H70A 2QZPA 3KJEA 4GECA 3LXRA 3A6FA 2NO0A 3A26A 2I22A 2AHOA 3FRJA 5TMEA 2C78A 5LQJA 3VR6H 3E4CA 3LUPA 2IKQA 2QTHA 3CXUA 1G66A 3NPAA 3B6IA 4LJ4A 4ON9A 4QBIA 2GX6A 1EK5A 5FYQA 1GADO 3WGTA 2Z2YA 1F2UB 1YI1A 5KPDA 1MAHA 3QUSA 3H17A 3EEYA 2V7QA 4LDAA 4QNMA 1OI2A 2X2FA 2ZBQA 4TMKA 1Q92A 4YIKA 2BBSA 5HF5A 1RKQA 2FOLA 1YCFA 4NZ9A 4EF4A 3LFHA 2ORED 2Z9CA 3GJ4A 2OAP1 5C7OO 2ZWIA 2Q28A 1ZK0A 2ZS9A 2X58A 3MJ4A 2XKBA 2FETA 3V48A 1VI5A 1KVUA 3QFSA 3HDGA 2WQ7A 4QARA 1EAMA 1HYGA 1CF2O 1SBQA 2GILA 2PO5A 4Q4LA 4RS4A 3ADOA 4KE6A 1TOAA 3QRWA 1Y1TA 2JAUA 1OROA 2Y6UA 4E09A 4L72A 1V96A 5ESWA 4LYGA 2AUNA 2ECKA 4CCSA 5LYJF 2DBYA 4MR9A 5EL0A 1NF9A 2GLTA 3I6BA 4AZ3B 8ATCA 3TNYA 5I45A 1U6JA 2GBGA 2PX2A 1NXTA 2F1RA 3OI7A 4PCAA 4EQ6A 4TL7A 1Z8NA 4W4TA 4BO9A 5FOUA 5IFLA 2VPWA 2D59A 1IQRA 1OWLA 1RLIA 4I6EA 2GD1O 4N9WA 4ZOCA 2OORC 2OT3B 2HIHA 3EOBI 1RC0A 2O2CA 2QLTA 3F0TA 3GJYA 1U1FA 4NV1A 3NH9A 4TLCA 5LZ5A 3ZJ5A 3K1TA 5EYPA 1D3AA 3A2LA 3EF0A 3WB2A 3ZCUA 1HNXB 2O9JA 4A36A 2VH1A 1UWLA 1IZ0A 1M2VB 2BF4A 4K6KA 4MAAA 4U63A 4IQ8A 3GFRA 4WZBA 1IB6A 3B82A 1K0FA 4PG8A 3RM3A 7YASA 4IHQA 4MW2A 1N5RA 1W44A 4JT2A 1AKUA 2SKDA 2D1YA 4KE8A 5K8UA 2R62A 1EUDB 1YJ8A 1KZ1A 2I80A 2Y3IA 3C4JA 4I4TB 4P5PA 2R68A 3TIFA 1IUNA 1J42A 1BMFD 1ZD3A 3DXZA 4HAWA 4AULA 5DX8A 1DWUA 1IHOA 3CIOA 1MUUA 2RG7A 2FZ5A 1RWMA 4IUDS 1AM4D 3DJYA 2HJWA 3QVUA 2I6QA 1C29B 1BEEA 1SPXA 5G1PA 1N5DA 4O4JA 5JSZA 2JH3A 3D3KA 2OGWA 3F47A 5MGBA 4KZKA 2P9CA 3PPXA 1SBTA 1V3VA 4F4IA 4G5YA 3F5QA 2UXCB 3ZHZA 3IIKA 2C4KA 2ACVA 2HQOA 2YRWA 3ABRB 4AZWA 3CT6A 3KCQA 4TS9A 5TMDA 1Q44A 3KKKA 4BLOA 2JI9A 5LOVA 1E6UA 1WQ1R 1T2NA 5BR1A 1XZPA 1CQPA 4ND8B 1ZD4A 1VB3A 2RC5A 3DF9A 4Q3CA 1JAHA 2Z83A 3MT0A 5G3ZA 2ZZMA 3JVIA 2BZGA 3PKJA 3AERB 4FE4A 2G8NA 4BFTA 1R4NA 1S5PA 3I0ZA 4K1LA 3ETJA 4E94A 1DIBA 2Q49A 2QN8A 4J0JA 3F3SA 3DE1X 1PEAA 4K3UA 2H7YA 1DIOB 2FMUA 3QSYA 3BHJA 1DVRA 3F9IA 5KKCA 3FNFA 2REQA 3KSDO 2GH1A 5J4YA 5CT8A 3FN4A 1REQB 3UHJA 1I3OA 1XZFA 3TB4A 3UHAA 2WSLA 2JLUA 2YWDA 1TU0A 1AN9A 1L2TA 1VCMA 3JQ8B 4ONEA 3SKYA 1VL1A 2E89A 5KU7A 4ERXA 2UVQA 4CLOB 1K86A 2PYDA 2EIXA 5JBIA 4NH4A 1GJRA 3ZWPA 4DMCA 1W4BA 2R44A 2QQFA 3EE6A 3K2BA 5G3YA 1KJJA 1RKVA 2JDIA 4E70A 4ZYUA 5JXJA 4IDNA 5AHRA 5FA5A 1KYYA 3GEMA 3QLJA 4MVJG 5KDLA 4RNCA 1NBAA 4HH4A 2H63A 1GAEO 1SBZA 4A8TA 1MRNA 1GYRA 2K5UA 3PR2B 1I24A 1CF9A 3IP1A 3N0RA 4P3PA 1B8PA 1GRRA 3BF8A 2ZYSA 3D6NB 4IIXA 4XDGA 1NN5A 1JLMA 1R5JA 4LHEA 4BAGA 3W9SA 5JYEA 2ZUCA 1IJEA 1I3KA 3JU3A 5ANRB 1BYUA 1PCXA 3C3WA 2UZ1B 3Q7IA 1UOPA 3TDMA 4X90A 2N9UA 4IKOA 4V1CB 1H2EA 3QU4A 3COPA 5EE1A 3OEEA 1DTSA 1PS9A 5H02A 2H8KA 2F2TA 2GEKA 1HL3A 1G7SA 4IDFA 5TNXA 3FCXA 1VCOA 1WW8A 4PFSA 3EMDA 4TXHA 3M1YA 3QPDA 4NP6A 4Q3DA 121PA 4RV9A 4YH1A 3TW0A 4BDSA 4I1OA 5LVAA 1U9JA 1VYHA 1XT6A 2C88A 2WVHA 4B32A 1CX9B 5A5DA 5JOQA 3UUFA 1RFLA 1RI4A 1FFBA 1XLTA 3KVNA 2W93A 4FR2A 1AKNA 2LIVA 3PYXA 4G2TA 4BNNA 1XYVA 1H1DA 1TM2A 3HMQA 4UQOA 3SCZA 2F1KA 1NOJA 4RLFA 5DBOA 4XSGA 5SYAA 3TDNA 4DVJA 2WFLB 2N47A 4KPEC 3ESYA 3PS9A 4ZV7A 1QE5A 4IGAA 4UXIA 4YCMA 1A9PA 2C2OA 3HR8A 2HRZA 4L22A 3S1AB 3HWX1 5AYVA 2XMBA 1SBIA 2QJFA 2Y66A 5BW4A 3D5TA 4MQMA 1ZGCA 2EG5A 2ZRCA 4FSHA 1JWLA 1PWXA 3Q3IA 4BNHA 5DGHA 2X0DA 5TB5A 1W2WB 1AS2A 3QGMA 3S1AA 1VBNA 4OA8A 3RFCA 4BFCA 1Y8CA 3HBMA 4LWQA 1N2OA 2RKBA 3ZNQA 4C7XA 2OBLA 1E1NA 4FFSA 3PZRA 1PVDA 2ZR7A 4HNGA 4ZZ2A 2HN9A 2P2NA 3AY0A 4E5NA 4J0EA 4LE1A 1OV4A 1QG6A 2OXRA 3OQMA 4KFUA 2OFOA 1WCYA 2GMWA 1OXBB 4B5LA 2VBGA 4HLDA 5AHKA 4MHTA 1JW9B 2NZ8A 4NENA 1QSGA 2QV0A 5EWMA 3ZEAA 4JYZA 4JDUA 1PZEA 2C9YA 2I4LA 2F90A 4MV3A 3IS3A 3KQUA 4UXHA 4WADA 5LB2A 3K0BA 4YPOA 1VGQA 4B80A 1R0LA 1Z5NA 2Y1EA 2D06A 3CNQS 4D2IA 3G5AA 4RVSA 1XRLA 5HM8A 4KXVA 4ZFNA 1GY8A 5I9BA 1EWRA 2VRBA 1J0DA 1QX3A 3NWBA 2W00A 1IBMB 3F5SA 4LDZA 1AG9A 3PHLA 1GKYA 2OZKA 5JDIA 1CR4A 3IE1A 3KR0A 1W5FA 3ZCXA 1LTQA 3LECA 4PXSA 1KAQA 5EC8A 4FK8A 4N03A 721PA 4X8OA 1A9YA 4NI5A 4YJ3B 1XSEA 1Q3KA 2PBRA 1QK3A 5T7BA 1OU4A 2G9RA 4HN9A 3T3EA 1J33A 3NHJA 1L8AA 4FJ1A 1XQWA 1U0RA 2J5QA 2UV8A 4GSLA 4OK3A 3DPSA 5DLEA 4CODB 1P4RA 2HC9A 4MCIA 2DX7A 1KEVA 2E9SA 2ZOSA 1XZBA 4N0DA 1EVQA 3B6MA 3RUDA 4G37A 4G26A 1MXFA 4Q66C 1PS0A 1XL1A 2BEUA 4UAUA 3SZOA 3MWLA 1EVKA 1RHUA 3KDAA 4OAPA 5FR1A 4XOUA 4FGZA 3RW9A 6NULA 3SIPA 1JIXA 1IHXA 1A7UA 1KARA 2O59A 3UUWA 3F97A 1QIKA 1J4AA 2VQSA 3KEMA 4NJMA 4FGWA 1J39A 1LTHR 1QQ5A 1TUEA 4RCVA 1H4SA 2AK3A 2JLWA 5HFJA 2Q46A 1V3QE 5J4VA 1G9TA 1N2SA 4XQ0A 5KSZA 2QPOA 4B4OA 4GH5A 4D80A 5CLJA 4H7HA 1ESZA 1CLUA 3ZLUA 2GTPA 4OA5A 1JLKA 4WOPA 3V4RA 3U60B 4ZN6A 5IS2A 4TN1A 4COOA 2VTBA 1XMVA 4P3XA 4CLDA 5AUQA 4YDRA 4R9UC 4Z3DA 2XE7A 3TAXA 5CCXA 4RKWA 1BFKA 1Z4KA 2Q1UA 3Q5GA 4PZCA 5F5LA 4POOA 3ZWVA 3GJ8A 3IA7A 5CAEA 5HJ7A 4IOKA 4M1SA 3OF2A 1EX9A 1GPJA 2D0IA 1W19A 2OR3A 3PDIB 2XB4A 4L0MA 2C2YA 3MA0A 1QF7A 1U2GA 5A1JA 1RE1A 3EARA 1UBNA 2IL1A 3R5XA 2CFIA 4ROTA 4BEVA 2FR0A 3P5BA 2OECA 1SUWA 1NZJA 2GVZC 2VDOB 4M9QA 4HLQB 4UM5A 3STTA 1XXHA 1IYZA 3TPCA 4DV5B 4HYYA 1HT0A 2CMKA 2D3TA 4BRUA 1XAGA 2HADA 1UOOA 2RC6A 1ZP6A 3C5WP 3KXLA 3ODGA 5FO1A 3GOQA 4Q1BA 4I50F 4LYEA 4K9LA 1Z06A 3AI2A 1XALA 3GDGA 3IBYA 1G8AA 3ETHA 4ILEA 4AN4A 3IUNA 4KJXA 3FTEA 2MYPA 4RXTA 2DR0A 4M6WB 3ZCTA 4NBRA 4Y9TA 1XB2A 5F2OA 3FD8A 3JVEA 1LKZA 2ZRKA 3I5XA 4C43A 1O95D 1NW4A 3G2JA 3DAGA 3LCRA 4HUQB 3FSRA 2J0SA 4IMJB 4B7XA 2HKIA 1ATIA 3P20A 3VI3B 5EHZA 4L2IA 4EG8A 1U2QA 3EN0A 5DLPA 3IP8A 4H16A 1KEKA 3ZWKA 2X9QA 2XVAA 2Q2VA 2XQJA 3L7MA 3PDWA 5DP1A 4ZWNA 3L4BA 3UAZA 1O8BA 3Q7SA 1OD6A 4HB3A 2Q9AA 2XYRA 2WA2A 1CHDA 1C3XA 4FS3A 4GMHA 4OBXA 5E4JA 2QRVB 1E0AA 4P7GA 4OEHA 2BGTA 2QLLA 2BM8A 3QBDA 4QWWA 4D81A 1VPLA 5K09A 3R9WA 1DRJA 2OAQ1 4UHDA 3QVVA 1EX7A 5AD1A 4MP8A 2VP5A 3E81A 1D0IA 1Z2CA 2R8YA 3KC2A 4O2BF 4HB2A 4PC3A 3I2GA 1OLXA 2OB2A 2HDWA 1RYBA 2KHZA 5EHIA 4EG6A 1A5ZA 3CKKA 4JJKA 4IDQA 4JBGA 1A4RA 3T7EA 3VOAA 4C07A 1XDUA 1KXZA 3NDIA 4PS1A 4EZEA 4HCJA 3E9MA 3Q11A 1ONOA 1P61B 1SULA 5AK6A 1YFZA 4IZ6A 5CA0A 3ZJTA 2AXPA 1H2YA 4Z4EA 1P1FA 3ELYA 4V38A 1FDWA 2DH5A 4Q05A 2G4LA 2HPAA 5FUQA 1Z5PA 3ES9A 4F2DA 1O6BA 1QGAA 1IQ0A 3DONA 2P65A 1Y7IA 3NNDA 2NPIA 4HT3B 5EFZA 4ZDKA 2XRZA 1ZS9A 3ZD6A 4QXMA 5DBFA 1MNAA 3NKLA 2HV8A 5I7RA 3Q7QA 4S2UA 5HE8A 1OWMA 1W0JA 4LYDA 5BV8A 4M0EA 5FXMA 3RWBA 1H2RS 4A2WA 3CW2A 3PD0A 2WTMA 2P7HA 1QE0A 2A0XA 2GKSA 2WK1A 3LI2A 2PXAA 2XVYA 2IUEA 5HUJA 3B53X 5WRFA 1W49A 3CRQA 3ANYB 2W6JA 3NOVA 2SCUB 1OU0A 3HI6A 4WXHA 5JTUA 2YXEA 5DF1A 3Q15C 3KJIA 1Q95A 4J16A 3AUKA 2H08A 2WAAA 2FI1A 3JTEA 3W1WA 3EFOB 3B1FA 3FTCA 5AW5A 4EW1A 4NG5A 1YDWA 4E3WA 3CISA 2OWEA 2MSNA 1XF1A 3FYUA 3RBXA 3NAMA 5CU7A 1CRQA 1ZD1A 2O8FB 4U7TB 1GPAA 3OZEA 1V26A 5HILA 5HEKA 1VFPA 2FWJA 2I2XB 4QQKA 3PIRA 3OPYB 2WEKA 1F8FA 5DIFA 3WK5A 2GHQA 4KWHA 1X1BA 3QFTA 3O4JA 5LA6A 4ESEA 1HOTA 1QTIA 1LNQA 1NI5A 2BTQA 2I71A 3PE6A 1JKFA 1SEVA 3JD3A 1IG3A 4CQMD 2O7RA 1UEXC 3O8CA 3TFOA 5DDIP 1ODKA 1U3DA 4FYYA 3RTEA 3G59A 4XPIB 4HZUB 4CTJA 3TG8A 1TRKA 3MWYW 5MN4A 4RQTA 1R3UA 2ZYRA 3CN7A 3MAJA 3U7GA 1JWBB 1C7QA 1RMTA 1CEQA 3ZZUA 3NIDB 4F72A 3H2KA 4KXFB 4R81A 2XODA 3HB9A 3OCUA 4LF4B 5AJUA 4PN7A 1NN1A 2QBYA 5HCIA 3LVFO 3I01M 2B98A 2Q5HA 2AD5A 3CJQA 1DAEA 1NXQA 1RQ7A 3LL4A 1XMIA 3OPMA 3N87A 5EKDA 4AWXA 2BAGA 1Z36A 4LDQA 4QUDA 1C8KA 4CTNA 1A71A 4JUAA 1EFDN 4DTIA 2O8EB 1X1DA 4BLPA 1BJTA 4Z54A 2NNLD 3GFFA 1MLDA 4G8BA 1ZIDA 4BNTA 4PPYA 1D07A 2BEKA 3E70C 3KOXA 1SELA 2Y76A 5ARBA 2BEVA 3RVKA 1K5GA 1SC6A 1SIOA 2XCOA 1FW6A 3EY9A 1YZFA 3SXUB 2YC4C 5AI9A 2OM2A 2WIAA 4IIFA 4RZ3A 5SV2A 2QD4A 1IATA 3JQ9A 1J23A 1NUUA 1V9CA 2WJAA 3NH6A 3X1WA 3U1VA 4IZHA 2WU4A 3WFIA 4Q7MB 2DJIA 4EO7A 1MV5A 3NQ41 2BVNA 1E92A 4X1OA 2FPUA 1HY3A 2PXCA 2QN6A 2W5UA 4MYDA 5HRUA 3TQCA 3RB8A 3H11A 4URHA 1U65A 5C80A 3RJZA 3K7EA 2C3YA 2CSXA 2D5LA 2CNNA 1CVLA 3G7UA 5D2CA 4ARZA 5J1SB 3THYB 2PUTA 4HAVA 2YHUA 4EHIA 3N2GA 4IILA 4S1NA 2GPSA 3BJRA 3SSNA 4BQNA 1YE8A 1S4MA 4FYXA 4M8NE 3TUIC 5ICGA 1VHTA 1Z25A 4FVTA 1CUAA 1NATA 2OC4A 4LK2A 2HEGA 3EGXB 1O4WA 4B74A 1Z6PA 3H19A 4PWZA 1NWHA 2X13A 1SCAA 1DEOA 1R6AA 4KVGA 4TROA 4U3JB 2QW1A 2VRCD 3Q7TA 4XFKA 4WWHA 4G9BA 4AJ9A 2AOWA 2F48A 1KNXA 1F9EA 3FTQA 1CS0A 1EA7A 2HOQA 1XA3A 2O2YA 3CZCA 3IAM1 4MCAA 2V5VA 5LZ8A 5BR8B 4C1NA 3AEQB 3U3JA 2LUOA 1PJRA 5AM3A 4JVLA 1RLMA 4HZUA 1EFHA 3TJMA 2CHEA 2G8LA 4FW9A 2DFKB 3G8CA 4LDRA 1MP0A 2YIJA 3ICEA 3HC7A 2FCAA 2VTBB 3AY3A 3FGZA 3ORYA 4JUFA 1VKNA 1CNEA 4EKGA 3VNVA 3LRTA 4K8OA 1G21A 4DG8A 2PMFA 3H0EA 3EJ6A 1X1EA 1ES9A 1O54A 4ZODA 4G1VA 1OLSB 4AK9A 2O57A 1N3LA 4CT5A 4EJSA 1WCWA 4NMHA 1SUBA 1QRSA 3QPAA 4Z7QB 3TD2A 1XDSA 2A1IA 5FTLA 2O2DA 2CJFA 2B82A 3SN6A 2IIVA 4R2IA 4B34A 4WCFC 3LX4A 3NX4A 9ATCA 4MP3A 2Z1NA 1S96A 5EGNA 5KU1A 4MQ6A 5CMLA 2Z8YM 3A9SA 1GFSA 3H2IA 2GRJA 2XDWA 4XPIA 1OXXK 1V37A 1GGJA 3EXHA 5FTKA 3EQ7A 4GX1A 1G17A 4MYSA 5CT6A 3TRJA 2WMDA 3X2EA 3WQSB 2PEYA 1C1HA 1FYWA 2BFCB 3FNHA 4FI3C 4A6DA 4H7KA 1T4CA 1NKSA 4ZVQA 2JBAB 1ESMA 1GIAA 1QH8A 4OVKA 3W5CA 4G81A 5ALDA 2QG4A 3WG9A 2HV9A 3CNLA 3A6DA 3AKEA 4DDWA 2GKOA 3JD4A 3D6UA 4W9NA 1QCDA 3LLSA 3PEEA 2D0PB 4MVWA 4AF6A 2FMXA 4FNOA 2B37A 3BE8A 4QFBA 2DFVA 3VV3A 1M7GA 3IVGA 5JRDS 5DKFA 2CDRA 3WK7A 3DEKA 4PG7A 1IOLA 1B43A 2MR6A 2X4GA 3GARA 3R3HA 1PWEA 3SS8A 3WLKX 2EQ5A 3VZBA 1XDBA 1OLSA 2YXNA 1IPFA 2HHLA 2HLDD 2JLRA 1MC5A 1Q0HA 3JQGA 4WOJA 4NBNA 3TLEA 4ZAWA 1Q15A 1FE8A 1WKVA 3THXB 3DAFA 4POAA 1KGSA 1O5IA 2AEMA 3FIJA 4PSUA 4D8YA 4PC6A 3WO0A 1U4NA 3CKLA 4FMDF 4GQBA 4WZAE 2G3YA 3KHSA 1IN4A 3D02A 1V6AA 3G9TA 4K6HA 5IJAA 3TQTA 4YV7A 4TZ6A 3OEHA 1G38A 5CGQB 4ZQHA 4DRZA 4YXWD 4B2IA 1UT5A 3GLHE 4ZCPA 1OFTA 2ZI6A 4QYWA 4BGIA 1E6WA 1RQRA 4LCJA 1G8MA 1I9GA 2VTKA 2YIDA 3E3MA 4MYHA 4UHFA 1DFIA 4IWYA 4I9UA 1QQTA 4RYLA 4KQKA 5CG2A 5GZ1A 3VPCA 1QO9A 1CRZA 2RGCA 2VWQA 3BDAA 3OZGA 5JZ9A 1ISIA 2N0SA 5LSAA 1V25A 2O19A 1GN9A 4YT5A 3VNQA 4ZDJA 2QL7A 2BMVA 1J06A 2FN4A 2MSLA 3LHSA 1QRAA 3LO8A 4R40A 3G6WA 1ZM9A 4O29A 4Q4JA 2C04A 2V59A 1D1QA 1G2IA 1PJ4A 3CFYA 4MRMA 2YJTD 2WV7A 3I2IA 1UCFA 5HRCA 3FMPB 1DE0A 4D9EA 1Y5NA 1KZ6A 1ORRA 2IUYA 3KYDA 4QVKA 2IBTA 1IY8A 5JNVA 4PYNA 4A6PA 2V3CC 4MV8A 1RRCA 3D43A 3GZNB 2OV8A 2XQVA 3VH1A 4H3HB 2R85A 1XBTA 3OJWA 3PYLA 4MI1A 1QO7A 2WZCA 1CJKC 4NIMA 4WV3A 4DR4B 4G2NA 3ZCRA 1MX3A 1JIIA 2IEDA 4PQFA 2VUSA 4A03A 1ICIA 2WVAA 2Z08A 4Q7QA 1LPNA 1N78A 3PR1A 3I9V6 3IUSA 1XTSA 3E9QA 5EZYF 3KOYA 1ZBQA 2XCQA 3RG2A 4MQBA 4RTPA 1FTYA 2C5LA 4LC0A 1OX4B 1MOZA 2ZE5A 3CXRA 3EGDB 1GNTA 1V47A 1VCNA 1JTEA 3BIFA 1M34A 3FRHA 4LFCB 3SM9A 1AKTA 3ZI4A 5FBWB 2W6CX 3NHZA 4U9UA 4C0KA 3U09A 2RDMA 1BMTA 3VNAA 2ZYTX 2CVOA 2RIRA 4EYSA 4YX9A 3H9QA 3OESA 3ZDQA 4E5YA 1TZJA 1CRLA 1UT8A 1OXVA 4M0CA 3HR4A 4MW7A 4B83A 3IMGA 1JLLA 3VDXA 1NVWQ 1E7MA 3O8NA 4TN5A 3LDFA 3TZCA 3GVXA 5KOJA 1H8EA 3RU9A 3EGVA 1L4YA 2FFJA 1TCVA 3DE5X 1T2CA 3JVUA 5CVEA 3REQA 2GAFA 4RA9B 2DLNA 3F3KA 3QWBA 1A1VA 4C30A 1MT0A 1PRYA 2FUNB 5K03A 1P6QA 1T5LA 4N49A 4WEQA 4CV3A 2R6HA 4Q9KA 2FSSA 3UB4A 3B3AA 3L0PA 2VR1A 4AICA 1WVGA 1J0CA 2GAIA 5L7YA 4DCGA 4HVLA 3QFCA 5U1PA 1ZOSA 2PV0A 1RRMA 4MV9A 3FSJX 2J9RA 1DB3A 2NWQA 5HRAA 5HZHA 4EGJA 4Q00A 3U39A 5HIJA 3JWPA 1R4ZA 4PY2A 5IKEA 2TS1A 1QOZA 3LG2A 3WI7A 1PWYE 5DGIA 5CEJA 2FRVA 3EUFA 4RLQA 5ALRA 4BMVA 4JYAB 2IVZA 5I7WA 4OMFG 3VU3A 4BBAA 2QBYB 1N2CB 1O1YA 5AUNB 4YQZA 1VLLA 2WD9A 4CIWA 1K75A 5IVKA 2QMHA 3ZU2A 1UUFA 1T2UA 2GYWA 2KB0A 1KP3A 4G56A 1YGPA 2HDHA 3LKBA 1QTQA 1NJ6A 1KY5A 4JYMA 2R4QA 3FYUB 4LDJA 5KSOA 2NU8B 4B48A 1R50A 4H4CA 3PFKA 1Z0KA 4C4OA 1L4NA 4IXWA 1X8JA 2R60A 4QT0A 2QT0A 3KK0A 3NBFA 3O8OB 1F2DA 1WHSB 4QBHA 3W4KA 2CWWA 1E9EA 1Z6TA 5KOHA 4MWOA 4RK7A 4W5TA 4JSRA 2IYTA 3DMYA 5F9HA 5K6TA 1AC5A 1OJLA 2PM8A 4G8CA 4WK4B 3RABA 2FE4A 1HT2E 4DGSA 3KKLA 4JKYA 1FFGA 4YDQA 4IOMA 1Z6QA 1XQ9A 2VPIA 1Q0QA 3TLKA 4X61A 2BMDA 1RWPA 2GDZA 5BMOA 3H1BA 5JD6A 1URPA 1T9AA 1W85B 3VPGA 2ZBVA 3ZKWB 4QRIA 4KR6A 2N1BA 3RDPA 1X70A 2FX3A 5GY7A 2LKCA 3FKSD 5DI9A 4B3BA 1KVTA 5AW1A 5FOXA 1EXDA 4HDCA 1P2GA 4DKJA 2VF7A 1SEPA 3AEXA 5AKEA 1NW8A 3KLOA 3M1IA 4V0NA 3MFYA 2XZOA 3HNPA 1SUFA 1FVXA 2BGIA 2KE5A 2W8ZA 3PC3A 3KUUA 1GCUA 1Z4NA 3UC9A 1M1YE 3RFVA 1DKRA 3I2FA 3EYAA 4ER3A 2XTNA 3E8MA 3QYAA 5J43A 5K8JB 1Z0FA 3LDGA 1QX4A 1R5OA 3EGWA 3ZWDA 4QDZA 3Q0IA 3X2SA 1NBME 3SQWA 2ZP1A 4PLFA 3VSAA 1CVIA 2ZJOA 2DTDA 4A26A 1YVRA 4Z49A 1TB4A 4LSMA 3V7NA 5IDWA 1IOWA 1QYDA 2P79A 1NBOA 5KNCD 4IMRA 3OU2A 3PT5A 4DMGA 4GRIA 3A1FA 3X43A 5C7YA 2OVFA 3D3JA 4Y1GA 3EJWA 4C0WA 3FOAA 3T5CA 2ZJ0A 4CU5A 3TQRA 2I1VB 3NIGB 2CJPA 1A0OA 2K7ZA 4H3KB 1L3IA 4MWZA 4YMSA 4HDKA 1OI4A 4BC1A 3QMPA 5AW7A 1CP2A 1B14A 1G6Q1 1KF0A 1UC5B 3UXMA 4DXAA 5KEIA 4BNMA 2BOVA 3D0QA 3E2MA 4G1CA 2C7PA 2UZ1A 4LJ9A 2AYZA 3E8XA 3PPIA 1IPHA 1RI1A 1DWOA 4HAOA 4F96A 4LV5B 1WMFA 1SU6A 1QGOA 3B20A 1XMJA 3SXJA 1XAIA 2XOKA 3T9EA 1DBRA 1PW7A 3IQZA 1E99A 4CDMA 2OMEA 4P3OA 1W59A 2OFXA 3V2UA 5AM4A 3W5VA 2VT3A 3WK6A 3I6IA 1ZLYA 1XF9A 1UPFA 3ESAA 3JRWA 3SNHA 5B3JC 5LKRA 3NDBB 2IZOA 2WUDA 1L5NA 1V1MB 2RE8A 5FB3A 2ODAA 2QQ0A 4RM3A 2V7PA 4NV0A 1KDPA 4E33A 1WCXA 3G0IA 4JJFA 1LDBA 4NG4A 4PFJA 2HQSA 3OQBA 4L4ZA 1LDMA 4NOMA 5EIWA 3PUWA 1XVAA 4O0MA 3N7TA 4DEVA 3TEFA 1PL7A 1EINA 3C3EA 3KZMA 1GD1O 3CMMA 3MN1A 2XA2A 5FADA 3R7FA 1W94A 2OBNA 1PQUA 2ZI5A 2BCEA 1BGWA 3G8BA 4GKAA 5BYJA 3TSCA 4PX2A 2H5EA 1JLSA 1A8QA 2F3QA 1J9GA 3DTNA 5DHSA 2GN6A 3F6PA 3GEPA 1KI1A 1ZLXA 2JLCA 2OWDA 4PZYA 2XF8A 3RVNA 4CQMB 3M5CA 2A9VA 3BE4A 3LTEA 4OU5A 2QKYA 3N74A 1QHXA 3S4YA 1SZJG 4OBWA 3HYSA 4YAKA 4RQBA 3SOZA 2YFHA 4JITA 4AS2A 2YTZA 4E30A 2CE2X 1PSWA 2GN1A 1NW5A 3C3AA 5C8ZA 4ER0A 3W90A 1YVDA 3H9JA 3UT6A 4BPRA 3PIIA 4OPMA 2WWRA 4CKEB 3OP1A 4BEJA 5JH7A 2XCLA 2CVFA 2HMTA 3DKVA 3AF2A 3P2JA 4PSKA 1K9SA 1HO3A 4HF7A 1H42A 1I3LA 4I9NA 1EVLA 1R5BA 1P44A 1ARZA 2YMLA 4M7PA 3V8NA 5BPHA 3C6BA 1KRHA 1WPGA 2G70A 3ZIDA 2PFKA 2G67A 1X7WB 4MUMA 5ALNA 3HVUA 4K1XA 4D43A 4HWPA 1SUIA 3TXYA 4BB9A 1ELOA 3AM4A 1FSSA 1E2JA 2HRDA 5ALXA 4E88A 4S0ZA 1DBSA 3PXGA 1TPZA 2JB9A 2C03A 1PFQA 2IV2X 5EIXA 1FRQA 1L5HA 1W52X 1WV0A 2BE9A 2WLSA 1NV9A 3WA7A 3OSUA 1ML3A 4ATNA 2C2HA 3FLBA 1P1RA 1K4YA 3E0QA 3FPJA 4FYKA 2FWNA 4KO1S 4JKIA 1ZA1A 3A4TA 1NMZA 3I8OA 2M6RA 3GJTA 1KAEA 1EDZA 4PPFA 4FBGA 5EKXA 3RJMA 1BQ3A 2WSSA 1MC1A 1ZJJA 4G0ZA 2GSDA 4LJAA 4WN3A 5E9QA 1QNLA 2UVPA 2XI4A 1F8UA 2ILVA 4BMPB 2MSWA 2ZANA 1FBNA 4G8DA 2FUG6 4FINA 4PC1A 2JBWA 4CQLA 2EEZA 3RHZA 4OQQA 3FVRA 3UB2A 5F1OA 2QXYA 2AV6A 4LDNA 3UHFA 5JAMA 1UWKA 5F1PA 2VHJA 2TSYB 1K6IA 2OUKA 3KEGA 4KLAA 4P4TA 2Z6AA 3LCMA 2WJ6A 3PGLA 2C9ZA 3PNQA 4D9NA 1SZCA 3QXXA 5BP7A 4X24A 1NLZA 1PBTA 3K0AA 1RVV1 2JPDA 4QUJA 3VR2D 4H08A 1YHNA 2NADA 1L7EA 4IO0A 2O1EA 2BSAA 5D51S 1MHPA 2H11A 4OQXA 4RD3A 3U48A 4WLVA 4U7WA 2ESRA 4XR9A 1TAUA 1UKVY 3IOBA 3ZHBA 5LZ4A 2NUPB 4PNHA 5IDXA 1WB5A 4HGNA 5A3VA 3PF8A 1WZIA 3B89A 4GICA 3NCHA 4Q47A 3DBRB 3U40A 4C4ZA 2A78A 4TTRA 5SYMA 3VVCA 3GAZA 1SKBA 3L7BA 3AYXB 5K4HA 2V8BA 1SXPA 2I4MA 2Q4BA 2HXSA 1QYWA 3BMQB 1YRBA 2PBFA 1JAIA 4RSGA 4P92A 4LJ6A 1J0AA 3OX1A 3NGMA 4XJXA 6YASA 7MDHA 4R01A 3RNOA 4MR9B 4K9PA 3WLOA 3TK1A 1JBEA 3E5HA 4BKUA 5KAMA 3R5TA 3LAWA 5HKOA 1K27A 3ENQA 3U16A 4WBNB 2JGEA 3DEFA 1P8AA 3SY8A 1OH6A 1NA5A 1XN1A 2CBGA 3EMKA 2F17A 1I3NA 2QT1A 3AL3A 1I1QB 1WUJS 2JBHA 13PKA 5IAJA 3DWGA 3ZQKA 2ZB2A 1XFDA 1JWAB 3H5TA 3HTXA 4K9MA 4R4JA 1LQTA 3KT6A 4DLBA 2B8EA 4ZRDA 5FJJA 1GG2A 1OWNA 3CBGA 1ZD9A 5JO9A 2ZYAA 4W7IA 4WN9A 1JA1A 2PWYA 3LUHA 5JARA 5K8CA 4RVCA 3UM9A 5DM2A 3A9RA 1U4SA 1D2HA 3C1OA 3PCRB 5LQAA 4MPPA 3CINA 1U02A 2FE1A 2VBCA 2F3UA 4UOQA 1KFCB 1SK9A 3NIBA 1G5PA 2AYYA 4TMZA 4HV4A 3R7NA 4BTLA 1TYCA 1XROA 5D5PA 3G2OA 3L8EA 2FWPA 1M54A 4ZYWA 3RO7A 2UUCB 1MABB 1RS0A 2BRUA 1UDRA 4G4GA 3AI3A 3IQHX 3K5PA 3NGLA 4BO8A 5J2UA 4R7ZA 1RHKA 2Z8YA 4M0DA 3HJGA 1N2CA 5JDCC 4QXAA 1YRYE 1I2CA 4UOZA 2IP2A 4Q1VA 2YXDA 2J0EA 2A0YA 4EB6B 4ALKA 2RGEA 3BKWA 3E58A 4RZ2A 4TWIA 3UT5B 4F4DA 1WQ4A 2E18A 3WWOA 2XYPA 5AQEA 5EXDA 1BCSA 3DKKA 2NN3C 5E95A 5EZYB 1Z0IA 1Y9JA 4HATA 3R3ZA 3T7CA 2XUQA 4F4HA 4IVQA 1G7RA 3EIWA 2WINI 5DI3A 3DVAB 1MIHA 1PDWA 1CZNA 2DT8A 4L8YA 4QELA 2ZXUA 5JSKA 2WUEA 1RZ3A 3V1TC 3PUVA 4EF5A 1WP9A 1Q91A 1SC9A 4GLBA 4I4TA 1MPTA 4XJVA 2HWKA 4YUZA 4DLUA 2CW5A 1TCUA 5FULA 1ULUA 1UZLA 2ZDHA 3MGGA 2HK6A 3ABQB 2JJQA 3GJZA 3QA9A 4BJ5A 1F8GA 3VUEA 1ZFNA 3DV9A 3CVOA 1AA6A 5TJ9A 4ZT7A 3C1UA 3GL9A 1RHQA 3GGSA 2C3UA 4OMDA 4DYVA 3LLCA 3F46A 4N5IX 1C3JA 3SSAA 1RT9A 4R2XA 3D4BA 2QROA 3ONNA 4DFDA 1RWOA 5BN3A 5L3QA 1L5LA 5D7BA 1IZ8A 1K7FB 2XCTB 3OT1A 2IYAA 3R8XA 4QPNA 3TZQA 4B71A 3UJPA 4EL5A 5IYZF 2XUAA 4G8JA 4DUGD 5MN5A 2ZRMA 5LP6A 2XMDA 3U7IA 2NM0A 3W1VA 2Q5JA 2ZSBA 5PNTA 4WOCA 2ANBA 2NZXA 3W77A 3GIDA 7REQA 5HUQA 1WSWA 4OOFA 3ZQUA 1FXWA 4MLZA 3QKTA 4IVRA 4PO8A 2PUHA 1AURA 3K5IA 3SIXA 4EI7A 5LM3A 3LKZA 2W48A 4BRSA 3PI7A 4RGYA 1SQGA 4I4NA 4UEWA 3TKLA 4UUAA 1U11A 1CQIA 1Z08A 1JQLB 2SBTA 2VK2A 2EXXA 4ZQEA 5GAJA 3ETLA 3WXMA 3CTPA 4QKQA 1Z74A 2CC2A 2P1RA 5DN9A 2Q4TA 4HUTA 2ZDQA 4NU0A 1H0KA 3CPHA 2FCRA 1S01A 4R69A 4ZVRA 2FKAA 2ZS8A 4LA4A 1T2EA 3EIFA 1N92A 3F3YA 3IPAA 4CIDA 3NFYA 1PDOA 1W25A 5IT5A 5C3UA 3MWEB 4MGIR 3SP1A 2ZYVX 1QK4A 5GJWC 5IUKC 4E31A 1VE6A 2CE7A 3AJ9A 2A7XA 4GOLD 2OPHA 1BXGB 1ZD8A 1ZNQO 4K6OA 3AUYA 1U9ZA 2O1SA 3H2SA 3MIZA 3NI2A 4YK7A 3V4PB<