5JHGB

Crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
b'AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 11
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA bound with its inhibitor and ARHGEF11
rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
total genus 58
structure length 178
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jhgB00
1KDPA 1HT1E 2AKAB 2PH1A 2AKYA 4DB4A 4MUBA 1DE0A 1GUAA 3EZ2A 2ZI7A 1JALA 3MJRA 3TNFA 1E0SA 1P4SA 4CZ2A 1A1VA 3SYLA 2FSHA 4QJ5A 1FMLA 1FZQA 1R5OA 2V1XA 1QZXA 2HT6A 3VR1A 2ORIA 4QKQA 2IF2A 4KSBA 3K0CC 1Z6YA 2PLFA 3VMFA 4NONA 5GJBA 4S2EA 4PPQA 3DM9B 2OM2A 3H86A 1W1WA 5HTKA 3CX6A 1BH2A 4Z54A 1E2IA 2WJVA 4DLVA 4UNPA 5AUPB 5KNDA 3RC8A 2H1LA 1RW4A 3MSXA 4Q47A 4RD2A 2JEOA 1OIVA 2HXSA 2JJ8A 4GRAA 1KKMA 1VG8A 1XFAA 4LJ6A 1GIAA 3T1OA 1YR9A 2HF9A 3T15A 4BEBA 2Y8EA 5FI1B 2ZRDA 1JBKA 3DKPA 3C7KA 4OK6A 4ON9A 4DLWA 4PZLA 1N6KA 1E4VA 2EVWX 2YWFA 5CB8A 2WVJA 2GF9A 1KK1A 1OIWA 4I81A 1Q3HA 2WJHA 5EXXA 4GMXA 4TTRA 4XWKA 2YJTD 3WMGA 1AJEA 4EFMA 4NPHA 2OXCA 3BB1A 2EFGA 1G4AE 2IYVA 1QHIA 1F2UB 1SVLA 1A2BA 2QI9C 3K53A 4IFEA 4YONB 1E2KA 4PC3A 4LZZA 4W5WA 1F48A 2OE2A 3TAHA 1J2JA 5G3YA 1E2JA 1KI1A 2ZR0A 3NG1A 4HAYA 5K8IA 4HLCA 4EIWA 1E9FA 2XZPA 1W47A 4JYBA 4NU0A 4O2LA 4DDUA 1BMFD 2IXFA 2ZTSA 2H16A 5JJLA 4JZKA 1GITA 2GXSA 5J5CA 1E99A 4ITRC 2W0SA 3AKYA 2EFCB 4LC0A 2J3EA 1XBTA 1E94E 3AVPA 5EE3A 4BRUA 5GJWC 1GTVA 4G5RA 5TXGA 2VHQA 2VP0A 1KY3A 2ZRAA 3DKVA 3FVQA 5KPDA 1T3SA 2C03A 1ZD8A 3K0FA 3PG5A 5TY0A 3BB3A 5KHOC 3MWJA 1IN4A 2W6IA 1TU4A 2Z4RA 3LLMA 2R6GA 2ZRIA 3P20A 3QXSA 4MDFA 3LX8A 3WMFA 1VIAA 3QEJA 2O8FB 3NHAA 1W0KA 3BFKA 1GG2A 2ZJBA 4KFSA 2JJ1A 4M1WA 4XSHA 3GLIB 3K0EA 3ZD7A 3ZIAA 1L2TA 1VECA 2ODNA 3HYTA 4ZIRB 3NBYC 1RJ9A 4UXIA 1W36C 2G0TA 1KIMA 3AF1A 4JBYA 4QGFA 5SZJA 3TE6A 1P5ZB 2VSXA 4IDHA 3WP0A 4B73A 4OI4A 2ZRJA 4Q48A 4B6FA 4TMKA 2IBMA 5J40A 2DPXA 4US1R 4LI0A 1A7JA 2P3SA 2GESA 1VPLA 3OESA 3T5DA 3DL0A 2WJYA 3TSOA 3ZQJA 5A4JA 2ZR9A 1Z0AA 2QMEA 3QI2A 4JLNA 4R2HA 1X6VA 3B13B 1ZD9A 2E9SA 1J8YF 1LF5A 3W3ZB 1E9CA 4KHZA 1S3SA 2QTFA 1YU9A 3BD9A 1GWNA 2GBLC 1J99A 2J7PA 2CNWA 3AKEA 1TL7C 2CDNA 3PFIA 4AYTA 4IOLA 4ZI2A 1R6BX 1ZNZA 2WM9B 3IQWA 4KO8A 4HDQB 4JL5A 5G41A 4Q4AA 2ASEA 2VP2A 2X8AA 2JLUA 1QHYA 1N0VC 3OHMA 2FJUA 3SJCA 3SC3A 4A82A 3KB1A 1DVRA 1CJKC 1E9DA 1G1MA 1OPXA 3MJHA 5GJCA 5DISB 4EPTA 3L82B 3CPHA 3U3JA 3QG5A 5LDDC 2IYRA 3LVRE 4DLYA 1E9AA 2ZE5A 2OILA 2E87A 3KJEA 1JR6A 2WSSD 2FE4A 4IFBA 1PUJA 3UWOA 2Q9AA 3B60A 3FFAA 2ZRHA 3ECCA 2P2LA 4C7OA 1DAKA 1ZP6A 3A8TA 2LKDA 2IYYA 2ZI3A 3GJ5A 2YVUA 2ODBA 1KMQA 3OAAA 4UNQA 1P62B 2R2AA 3DDCA 2CMKA 1ZM7A 4DVGA 1VG0B 5J4KA 3ZVLA 1XMJA 2KBEA 5EP3A 4Q4HB 3SFZA 4LY6A 1G8FA 1OKKD 1Z0JA 5FOSA 4BFZA 3EWAA 4GMDA 3CRMA 4A2WA 3NWJA 1OW3B 1PLLA 1QVAA 5L3QA 1TPZA 1LVGA 4MA4A 3RRYA 1NY5A 4Q9HA 3RNLA 2XNDD 3OFND 3BAFA 1JR3E 2QENA 3CNNA 5KDLA 3A1VA 1KSGA 5FH9A 4GBMA 4GSYA 2BHRA 1KJZA 2ZSBA 2HLDA 4EJSA 5IK2A 1P9NA 1WXQA 1XTKA 3CX7A 1JB1A 3R9XA 5EZ5A 1MO5A 2GXQA 5C1BA 5IDVA 3NDBB 2DFNA 4Q1FA 4Q7MB 4Z1MA 1VMAA 2J46A 1TU3A 3AP3A 3VNVA 4BUJA 2OFWA 4Q19A 1GKIA 4OL0A 4YMUA 4KSCA 1WMSA 3BORA 4BLQA 1IXSB 2C77A 5FBWB 3CR7A 3IDQA 3BIFA 3CNLA 3R8FA 621PA 3J81k 2AD5A 5BN5A 2QROA 2VSOA 3SJZA 2CEAA 4X8HA 1AS3A 2OCBA 4X8OA 3WY9A 3EZ7A 1U8YA 2DR3A 3LY5A 2OESA 5CITA 2ZU6A 4EPVA 3EAQA 2NO7A 2F6RA 1U98A 2QSYA 4BZPA 4XD7D 2J0UA 2NPIA 3I8SA 2VHCA 4H1VA 1VIYA 4MQBA 5IHPA 2D74A 4PPNA 3CPJB 3N70A 5KSPA 2RGEA 3HU1A 3TIFA 3PJRA 4TZ6A 1ZVQA 2OEPA 3C15C 1JAHA 2VP5A 3LX5A 3VU9A 4E5UA 4BFXA 3MG9A 4YDSA 3MAAC 5DE3A 5DN6A 1ZNWA 4EUNA 2BCJQ 1P72A 3TQFA 4DLSA 1E79A 4FN5A 5HE8A 3K0CA 1P2UA 3K8YA 1CIPA 3X1XA 2B92A 1KGDA 2C9CA 3PEVA 3SBDA 1E2FA 5EE5B 4TQUS 1MO3A 1GOTA 2C78A 1P3JA 1BMFA 3QKRA 4IXMA 4D80A 821PA 4QBHA 4CEJB 4DEYA 1R0ZA 2F43B 4NCNA 1AK2A 3EZFA 1FX0B 3EZ9A 1UJ2A 4NYJQ 1HV8A 4R2IA 3B1ZA 3KL4A 3QKTA 4G5QA 4CT4B 1MR3F 1Z22A 4F4JA 3WNDA 4RFSA 1XRJA 3D8BA 1JQLB 1UBGA 3IBYA 4HATA 3X1WA 1EFTA 4OHYA 2YKGA 2ZJ2A 1UADA 3MRSA 3MLEA 1NP6A 1NN3A 4YXWA 2W2VA 4L16A 1KY2A 2EYUA 3OEEA 1MABA 5JECA 3DHWC 1JQJC 5HCNA 2H5EA 3ADKA 3FKSA 4Q18A 1WCV1 4QXAA 1OE0A 1VHLA 2VPPA 1A4RA 3GJ8A 3VQTA 3QOFA 1G5PA 1W0JA 4G5GA 3IBGA 3SJBA 3EASA 2BBTA 4FCWA 4D4KA 1DAGA 4LYHA 4LUCA 3O8BA 1UDWA 1UEJA 2JLXA 1PJRA 2NO1A 3QJYA 2MSEB 4Q1CA 3AF3A 4Q00A 1OYWA 3BS4A 5AJZA 1XCPA 3U3KA 1FP7A 1DO2A 1U8AA 2J9RA 2KJQA 4B47A 2CK3D 4OBEA 4PSVA 3KKNA 3EA5A 3WYGA 1OFUX 4I1OA 3FHTA 2FPLA 1S1MA 4LJ5A 4KU4A 4LYFA 1YZTA 1KMHB 1YE8A 4GZMA 5EZ6B 1HYQA 2ZRKA 1YVDA 1NNEA 4II7A 2J0VA 3H84A 4V02A 3L0OA 1UBFA 4UQOA 2C9YA 5EP4A 2WWYA 5FR1A 5FUWA 1XZPA 2PZFA 1NVVR 4QRHA 2OT3B 2QZ4A 1KZ7B 3C4JA 4E22A 3AQ4A 3LW7A 4HB0A 3EC2A 3THXA 4FD2A 2IS2A 5FPSA 3B2EA 3TKLA 1GNQA 1TF5A 2KI5A 3L0IB 3R8CA 4G01B 3DM5A 1E2PA 3GJ4A 1ZJ6A 4XSGA 3REFA 1G18A 2AFHE 4M1KA 1UBCA 3MWLA 2ORWA 5DI3A 2ERYA 4M2LA 5DNYB 2V6JA 2FGJA 5FUYA 2WKQA 2BBOA 4DLTA 4TLEA 5KNBA 4L15A 3NBXX 3QXCA 1NIJA 1OXXK 3LXXA 2BKUA 2ECKA 1E2QA 5DSZA 1Q0UA 4PQRA 1KK3A 5C4GB 1P6XA 2P67A 1QHXA 1R10A 4DBLC 4BQSA 4ESVA 1G6OA 2PMDA 4A36A 2O8CA 1KO7A 2J59A 3LVQE 3RRNA 4Q66C 1AZSC 2FNAA 1E1RA 2NZ8A 3X1DA 1UAAA 3BXZA 4LJYA 4M1SA 2NPFA 4C0AC 2QT0A 4A9AA 2JASA 2FGKA 4DDTA 3EX7C 2XX3A 1ZC4A 2R9VA 2GVDC 3IILA 2RGBA 1OKKA 4R71A 1NBMA 3AP2A 3CZPA 3GLGB 5EUQB 3ZLJA 2JIZA 3KXKA 4ZDIA 3AF0A 5LB2A 4TYPA 721PA 4GI7A 1OFIA 2HJGA 1SGWA 4KFRA 1US8A 3U3OA 1KO5A 5KSYA 2V9PA 3OFNA 2FDCA 4O3MA 1P73A 1SKYB 1OXTA 2GRJA 5AUQA 3ETLA 2C99A 4D4LA 1YZGA 4CDGA 4JS0A 5C18A 2BDTA 2BVNA 1YZNA 4JLPA 1MV5A 4LJ9A 3AGQA 1QHNA 1F2UA 3FHCB 3ZQ6A 4DDWA 3B78A 1X8KA 1CLUA 4FMDB 3UMSA 2WIBA 3GMTA 1G41A 3SHWA 4NE2A 1BS1A 1QF9A 4JLJA 4TMXA 1JPNA 2W58A 4EPRA 4A4DA 3L0PA 1FUKA 3E1SA 3IHWA 3OIWA 4HDCA 4QOSA 4IVQA 4S35A 4NL4H 4TYQA 2WJGA 1MO4A 3GLHE 2JJ2D 1CU1A 1UFQA 4TSFD 3RYTC 1FUUA 1JECA 2IXEA 4HAVA 3PUYA 2EWWA 2IHBA 3DZ8A 1IY1A 4RZXA 5FL7D 2QM8A 4PQYA 4PO9A 4C3ZA 5IRCD 4L9SA 4MH0R 1XU4A 1SHKA 1ZCAA 1A82A 3ASYA 3K09C 4KCGA 2CHGA 4MYHA 4OK3A 1J7KA 4Q21A 5C4MA 1AKEA 1U8ZA 3EWSA 4O0MA 4UNRA 3FMFA 4EQ6B 2W0MA 2IS6A 2VF7A 3TW8B 5B64A 2O8FA 4RSGA 2WSMA 2RGAA 4ZDKA 2Z5FA 4NYIQ 3GLIA 4TMTA 2BV3A 4HAXA 4C2TA 1T6NA 3BGWA 5JSZA 5E7JA 2QN6A 2GJKA 3X1YA 3TQCA 4QGAA 3CO5A 3CRVA 5AR1A 1Q12A 4QM7A 1FTSA 2O0JA 2GJAA 2Q21A 4KVAA 3TSWA 2PEZA 1DADA 5F9FA 3FGNA 2J45A 4JT4A 5SZKB 4IXNA 2CL7X 3AKDA 5FPHA 4OHZA 4XTRA 2JAQA 4HB2A 2IEYA 4DDVA 1ESMA 2VEDA 2YYZA 1SVOA 4KJZA 3K0AA 2IYWA 3QF4B 4P33A 4YC7A 4A0HA 3IEVA 1P9WA 5LPNA 1DPFA 1N5KA 1NF3A 3EARA 2I1VB 2ZU0C 2JLYA 2BKEA 1TAGA 3AVWA 4A6XA 2GA8A 3CZQA 2AD1A 5J4LA 4HEJA 2ZRFA 3G5UA 4LGMA 3QBVA 4BFSA 2VP9A 1E0AA 2A7QA 1JEDA 1VCIA 2A5JA 4IVPA 1WQ1R 4P4TA 4B75A 5AJVB 3CM0A 5DHAA 1LNZA 2QSZA 4QGHA 8OHMA 1PZNA 2D3WA 5TVKA 2UVQA 1IXRC 4Z51A 1AQUA 1IBRA 3CNOA 4MGIR 3P27A 4HUQA 1VG9B 3LDAA 1ZRHA 3GLFB 4AD8A 5KOYA 2PZGA 1GKUB 5DYGA 2GJ9A 4QM6A 2IX3A 2J0SA 2EQBA 4LJAA 4E07A 2BMEA 1OFHA 4P4UA 1OIXA 5GADl 4TLCA 1KI3A 3DZDA 1XPRA 2WZQA 4URXR 4Q7KA 1HUQA 4NCJA 4YMVA 4P0TA 1II8B 2WWFA 2XJ9A 1A2KC 2NGRA 1TQ2A 5IF9A 4RD1A 1YRAA 1Z0KA 3S1AB 2ZR7A 3KFVA 3CX8A 3PUVA 3A4NA 1IN8A 4Q4HA 3ZH9B 4D0GA 1RZ3A 2REBA 4NMMA 2J41A 3FDIA 4F7WA 1Z0FA 5JHHB 4N1AA 5FFMA 3Q9LA 4WAUA 3HWSA 2FZLA 4JLVA 3TUZC 2FSGA 1P75A 1CULC 4RD3A 5KSZA 3ZZ0A 1XB2A 2B8TA 4KBGA 4CIDA 1D8TA 1NKTA 3AF2A 3SOPA 3OZXA 4B74A 3W34A 4UXHA 4OQFA 3U4QB 4B3GA 4JSYA 2GAOA 3T1QA 1YQTA 5F3WB 1RFLA 4C0LA 1MRNA 2O5VA 3B1WA 2XAUA 2ZI6A 4RJLA 4AK9A 3FKQA 1C4OA 1N5IA 1XD2A 2ZUDA 3B1XA 3NC1C 1K8RA 3GLGE 1XMSA 4MKIA 3UANA 3VNUA 4OK5A 1WBBA 1QHGA 1YKSA 1W4AA 3H4MA 4A8JB 2XB2A 4OQLA 4LBWA 2CHQA 4BLOA 1U99A 3N2EA 4F4CA 4CEHB 2JDID 2ZJYA 2CBZA 1KDRA 2ERXA 3MMPA 4ILEA 3KQLA 1G8YA 2ZJOA 3I1FA 1GDDA 4LOAA 4UJ5A 3ZZUA 2QQ0A 4TYYA 2FSFA 2FF7A 2XXAA 3WP1B 1C1YA 3NXSA 4M9QA 3TR0A 1HE1C 1Q22A 1ZU5A 3RRMA 1XXHB 1JAIA 4PTLA 4IEIA 2ZITA 3NH9A 5KUTA 2V6IA 1U0LA 3PV0A 4TQ9A 3HP1A 3QPVA 3LLUA 4M1MA 4D4JA 1XJCA 3OIYA 1S9DA 5D3QA 2H57A 1Q1QA 1TEVA 1AIPA 4MKHA 4QG7A 4MKGA 3GLHA 4LJ8A 2AHOA 1AGRA 1J8MF 2FA9A 3F8TA 3GD7A 4JLOA 4UNSA 4C0KA 4OQMA 2GXAA 3SS8A 4KLZA 2QY9A 2AK2A 2RHDA 1N5JA 1X8LA 4HAZA 2DFKB 2ZI5A 2YWHA 1I4TD 1Z0DA 2QNRA 2WKRA 3QXJA 1WE2A 4RZ2A 3X1ZA 1WF3A 3LD9A 3WHLA 2EFHB 1T8TA 1KI9A 1FX0A 3AUXA 3HPRA 3IIMA 5BYJA 1D6JA 1SQ5A 3L0SA 1HQYE 1CJMA 1DAHA 1NMZA 2YZ2A 2R8RA 2QBYA 1YR6A 4MRRA 2ZVPX 3LWNA 2FWRA 1IN6A 3RRZA 2WHXA 3SBEA 4MYTA 4TT3A 1PVOA 1E1QD 3B1YA 1T4GA 4PQFA 2JLZA 4WXPA 2GHIA 2IT1A 2WWIA 2NTYC 5HE9A 4EDHA 1OJLA 1Z2CA 4DLUA 3B85A 4DC9A 1JXOA 5FOTA 1SVWA 2QT1A 3RWMB 4RD6A 5B58C 4PC6A 4DUGA 1FL9A 3SNHA 1KYIA 3RS5A 1X3SA 2RB4A 3BC1A 4US2R 5FTJA 4B2PA 2XOKA 4HZUA 5BN4A 5BQ5A 3UMFA 4DJTA 5JJKA 1EGAA 1IONA 4PANA 1NLYA 3M4YA 4RKEA 2QAGB 1NJFA 2V1UA 3Q5DA 2BMDA 1KAOA 1FNMA 5FUVA 3BBPA 5JBQA 4B34A 3K9LA 2IK8A 2ZRPA 2F1JA 4GP6A 4DEXA 3LBIA 2SHKA 2HV8A 4L5BA 4O25A 1YRBA 4WZ6A 2WJIA 3WHKA 2REOA 4ASUA 1MT0A 2CL0X 2OCYC 2G3YA 1F3OA 4A8JC 3Q5EA 5ELXA 3FMPB 3AP1A 3DOEA 1F5NA 3TR5A 3I3SR 1AZTA 2YV5A 2WWWA 3A58B 1OT3A 4XWAA 3GLFE 1G3IA 4AWXA 1O3YA 3W3AA 1F2TB 4CW7A 3ZS8A 2D7DA 1P9RA 4RKFA 5J4YA 2GEDA 5KTYA 2C04A 3ZJYA 3R7WA 221PA 2ZE8A 4P4SB 3AF4A 1EXMA 4Q9JA 1WBDA 1M6NA 3B5JA 1ETUA 4JL6A 5H68A 3UIEA 3PUZA 1OXSC 1Z06A 1XEXA 2FPKA 4URUR 2VH5R 4U02A 3VR2A 3ZZTA 3KKQA 4WBSA 1WA5A 3KQKA 3KKMA 1VG1A 4ZCLA 2WPDA 4TMZA 2Q6TA 1NIPA 1F60A 4WXRA 4DLRA 1UKEA 4FMBB 4JIMA 4JMPA 4H9GA 2PX0A 2NMVA 2QE7D 5CM8B 1UKVY 2IHYA 1J70A 3GEEA 2WTUA 1T0HB 3R9IA 2RHMA 2GZHA 1EWQA 1KI8A 3EPKA 2P6UA 3C41J 1PLJA 4URZR 2ZRGA 4I1VA 1FW6A 4K8OA 3GLGA 5A0FA 2WV9A 3OE7D 3E70C 1GZSA 3DOFA 3D6TB 1N5LA 3BH6A 3I4LA 1N3BA 2Q9BA 5JCZA 1AGPA 1T8UA 2A30A 2VIIA 1KJYA 3ZGXA 1G3MA 2O8EA 3NH6A 3CWZA 3VX4A 4C0SA 2OSBA 4CF7A 1U81A 3HJNA 3AVQA 3A37A 1FP6A 5AWFC 2OLKA 3U7GA 4QHSA 5BYKA 4BECA 2J87A 3OIUA 2WMNB 1P7CA 4GOKA 2GZDA 2ZJ8A 3JVUA 1W46A 2VP6A 2AWOA 4C30A 2O52A 1UF9A 2O0KA 4MITA 3VR3A 4HI0E 3C8UA 3FFBA 4AI6A 2B6HA 2ZRCA 5CYOA 2BJVA 4I1UA 2QAGC 2ZYVX 4UKDA 2XSZD 1QHHA 3VTKA 4CEIA 1IY0A 1G8GA 2DBYA 3AVXA 4TLBA 3FE2A 1NBME 1VDZA 3CPEA 1T3HA 2B7BA 1DELA 1NVWQ 2VL7A 3I62A 2YOGA 4ZCIA 3WRXC 1CJUC 3T34A 3GPLA 2OV2A 1K5GA 1MKYA 3CF6R 2WICA 3TH5A 5JHGB 2AXNA 4A2QA 2GKSA 3SQXA 4EQ6A 4B33A 3AM1A 2FU5C 3NDPA 4WW0A 4LV6A 2NOAA 3FOZA 2OG2A 4QBFA 3GFTA 1J90A 2D06A 4LJ4A 4RZ3A 1RVDA 2OLJA 3VR5A 2HCJB 1GRQA 4BFUA 3ICEA 1M2OB 2YC4C 3QVVA 5KU1A 2QQEA 4JL8A 3U5ZB 3AGPA 1IHUA 1U0HC 3V4FA 3RDPA 5G40A 4LRWA 1GAJA 4C0JA 2HYDA 2BBWA 4JVSB 4M1YA 4UNNA 3ZS9A 5TV2A 5CLQA 4B3CA 3THYB 3I8XA 1C9KA 3U7EB 4DLXA 2AWNA 2BWJA 1GNRA 3A1SA 3GJXC 5FTNA 4F93B 2C95A 5SZHB 2OFOA 1Z07A 4ZI3A 3TVTA 2LKCA 4IDPA 1UM8A 1E98A 3K9NA 5FOUA 2Q9CA 2HEIA 1CR2A 2GJ8A 3LH5A 1TMKA 4FCTA 1TF2A 2Q3MA 3KQUA 2BCGY 4PZYA 2AK3A 1YR8A 4KBFA 5DH9A 1NN5A 2JLRA 2QP3A 3TUIC 4KAXA 4BFTA 3G0HA 2LCFA 2FFQA 4PC1A 5FTKA 4MGKR 1UEIA 1DG1G 2P5TB 2ZSAA 2CLSA 2OXRA 3I73A 4IRUB 4LHYA 2PJZA 3QPWA 4OI2A 2ZSDA 4V0LA 3GLIE 2V7QD 2YINC 3FMIA 4Z8YA 3GEIA 2JATA 2Q0HA 5FL3A 2WOJA 1AS0A 1S1CA 1COWD 3QVUA 1BYUA 3GLFA 1D9XA 6Q21A 2ZROA 2ZS9A 4DT1B 1W4RA 2GK6A 3TK1A 3RLFA 3SZRA 5B2ZA 1JNYA 4LDJA 1R0YA 3OIVA 2FEOA 1SVMA 4IEEA 2ZI4A 5K8UA 4BZQA 3EPLA 3MD0A 4IHQA 4N0EA 4XJXA 5JS7A 4MRVA 3QF7A 5TARA 2ONKA 4OHWA 1ZC3A 3G82C 3N5CA 2CLCX 3SYKA 3FYHA 2XEXA 1CR4A 3GJ0A 4XTCS 1ZM9A 1GKYA 4QNMA 4DCVA 3GJ3A 2VHUA 1BOFA 3S1AA 4NZYA 2ZRMA 5FOXA 2ZXUA 2F9MA 2I1QA 2FX3A 4QL3A 4TL6A 3FMOB 5SZIA 2A5FA 4POAA 4LBYA 1HY3A 4Q1EA 4LJ7A 2IYXA 4GDFA 1LY1A 4V0MA 4PR0A 1N6RA 2HCBA 4B2LA 1LB1B 3W9YA 5KSOA 1EX6A 3C14C 2EFDB 3NBZC 3ZVMA 4A2PA 2G77B 3U4QA 1X1SA 3K0FB 2Q3FA 4JBWA 4A6PA 4BASA 1S3GA 4B3XA 3ICQB 2JCSA 1EFRD 2RAPA 1YJ5A 3EW9A 2O8BA 2W6JD 2OZEA 4K81B 2G9NA 5HCIA 4RD0A 2FSIA 4Q02A 3LO5A 3U3MA 3O47A 1RC8A 3PQCA 2L0XA 4JKYA 1VTKA 3W6NA 4AKGA 3EPHA 4A8JA 1XF9A 4YDHB 4NTZA 1SXJB 2A5GA 4EPYA 1H8ED 1W4BA 3BFVA 4ARZB 1EFUA 1IOZA 2QE7A 5E4FA 4CEHA 1I4DD 3P32A 1W5TA 1LTQA 2X1VA 4QFMA 1GL7A 2Z43A 3LNCA 5F2EA 5K8LA 2XZOA 1OXUA 1GSIA 2F1HA 3PR1A 1E9SA 3TAUA 1T91A 2HF8A 4WZBE 2WSSA 3EZ6A 4OI0A 4F92B 3PEYA 2IYSA 1NG1A 1OB5A 3MFYA 2ZAMA 2GILA 4LC1A 2ZREA 3NC0C 1XCGB 3IPYA 3LQQA 3SDZA 4B48A 4NYJR 3OF5A 1Z0IA 2BMFA 2QRZA 3TGPA 4TTPA 4R7ZA 1XTRA 2F3TA 2VF8A 1G64A 4P32A 2GBLA 4LK2A 5EJEA 3QQ5A 3TLXA 2H18A 1VHTA 4NYMQ 4PC7A 1BO6A 4AYXA 1GL9B 1KDOA 3LXRA 5H1YA 3RHFA 1KNQA 4LHXA 4MGYR 5UKDA 4HAUA 3QXHA 4PAOA 1HH4A 1U9IC 3F0TA 1ZUIA 4Q4AB 2XNDA 5FOWA 1NMYA 3WBKA 1YZLA 1RYFA 2FFHA 3IO3A 4JLKA 4M0LA 2NO6A 1UKZA 4FXPA 2QP9X 2R6DA 1CJVC 1XX6A 1W49A 2HDNB 3U6BA 3VHLB 1Q3TA 4Q4LA 2IUSA 3Q7QA 1E9BA 4MGZR 4V03A 2J5XA 3HU2A 3QG1A 3SU8A 3E5HA 3A4MA 1IJFA 1OYYA 1KDTA 4ESHA 2QEQA 3ONWA 3MUFA 3MWYW 3TUJC 4TZ0A 4TMWA 1OLOA 3KTAB 4XIGS 4EKDA 2CVHA 1B0UA 1E2GA 3F5FA 4ZKEA 5FTLA 3IEUA 3IIKA 2FPMA 2GNOA 2PZEA 3I92A 4BEJA 2AFIE 3KUDA 5GVSA 5A5GA 521PA 3W6PA 4MKFA 2CJWB 4TWZA 5FOVA 1OXVA 2GETA 2DB3A 2D62A 4OHVA 1EX7A 2QU8A 4LPKA 3W6OA 2IYZA 2CCGA 3BH7A 2A9KA 3WRYC 1RE0A 4Y0VA 3A1UA 2DFLA 3H2YA 4XD7A 3KXIA 1BYIA 4L9WA 2QAGA 2PJRA 4F38A 2WAXA 1SVIA 1RRGA 4PHGA 3D31A 5EE9A 1AN0A 3IKJA 3RS4A 3UWKA 2GK7A 2RGDA 4M22A 5DI9A 4M9SA 2AN9A 3RC3A 1NI3A 3AB3A 3EXAA 3H1TA 3FTQA 3PITA 1ZINA 2B21A 1E96A 2J0QA 2XTZA 3IQXA 5FPTA 1V43A 3V4RA 5G53C 4LV5B 1W4CA 1SXJC 3OEHD 1T3LA 4ZIRA 5M04A 4M9ZA 5TDHA 4W9MC 2W00A 3RWOA 2ZRLA 2ZE7A 2FEMA 4ZDWA 2ZJZA 3DMDA 5HR5A 3EPJA 3ADDA 1XTSA 1XTQA 2EU8A 2H92A 2AX4A 1QG4A 1Z5ZA 2UZ3A 2W83A 3CLVA 2CVFA 2CXXA 1JPJA 2A5YB 4XVRA 2PMKA 4PHTA 2X2FA 1F2TA 5EP1A 4B44A 5EE1A 5AJYA 2OCPA 1N0UA 2XB4A 4PO8A 1HE8B 4E09A 4A15A 1XJ0A 2KBFA 4YMSA 4OYHA 4TL9A 4AKEA 2WWXA 4E03A 1LF0A 2ZETA 4A0RA 3RANA 2V7QA 5D3MB 1N0WA 4IOKA 2ZJAA 1L4YA 4AURA 3PIRA 4BRWA 3PENA 2J0UB 2W6ID 1G21E 3PUXA 5DO9A 1CRPA 2ZJ5A 2RGGA 4YLGA 4PHHA 1S0UA 4QGGA 4Q4JB 5DYIA 2EYQA 2EWVA 4NHOA 4BWYA 1FMJA 1S96A 5L8VA 1Z6TA 4TL7A 2HJVA 4UJ3A 1TADA 1XEWY 1OFTA 1Z6GA 3P4YA 1FQKA 4FI3C 4PHFA 1SXJD 3L8ZA 3I32A 1AM4D 1W0KD 3NEYA 4G5OA 4V0OA 2JJ1D 5JCPA 3UPUA 1UKYA 2R65A 2R6FA 3D3QA 2H17A 4FMCF 2WBLC 3IPXA 3P1JA 1Q1BA 2C96A 3CONA 3ZIAD 3L8YA 4BFVA 2X77A 4KYUA 4Q03A 4XVQA 4DCSA 4B3DA 4QHTA 4BZXA 4D81A 4D0NA 4W5JA 4OJKA 3QKRB 4GOJA 2CK3A 3CKLA 1LS6A 3RSLA 3O8DA 2VSFA 1QVRA 5CLLA 1CR1A 1E2DA 3GQBA 1N25A 1T0JB 2RCNA 3UKDA 1GVNB 3WXMA 4GL2A 1KJWA 1JJ7A 2OO7A 4J0QA 2I4IA 3GCGA 4RY2A 1Y63A 2YHSA 1FQJA 4IKEA 2A78A 3TJZA 1ZD1A 2OFXA 1G3UA 1PV4A 2ANBA 1TNDA 3LRPA 1AA9A 1D2MA 2ZVQX 1MABB 1LV7A 2J7PD 2CNWD 5AJWA 1NSFA 1KI6B 2OUKA 2DY1A 4XWOA 2BOVA 3KUCA 4Q01A 3AVYA 2QPAA 4DCTA 4BE7B 4G1UC 4HLDA 1E0KA 4O2RA 5L3SB 4AKIA 2F7SA 1PLKA 4B76A 2GCOB 4EFNA 1G17A 4NYIR 4WVFA 3QBTA 3C5HA 3QPUA 1NY6A 3HR7A 4OHXA 4KFUA 1XD8A 2GCNA 4MUAA 5FBLB 4N0DA 1W2HA 1DAMA 2JGNA 3BFXA 4MRNA 1W44A 5C46F 1FOEB 4ZPXA 5JEEA 2QGNA 3QKSB 2WMOB 2ZYTX 1U0JA 3CR8A 1SKYE 2C5LA 3SQWA 1E2EA 2RKOA 4KYIB 3OAAD 3FB4A 5CIWA 4DCUA 1N6PA 3C16C 2ZSFA 2P5SA 3KX2A 4LV8B 4Q1BA 4QJ3A 2VTKA 4JVLA 1UPTA 2QG6A 4ERNA 2R6CA 5GJVC 4OQNA 4V0KA 3GEHA 3L43A 5F9HA 4JYCA 4PPFA 4QHYA 3HPQA 2REXB 4YMWA 4NCHA 1ZIPA 4LHVA 1SHZA 3THXB 2MMGA 4IDQA 4X8MA 2GDJA 4NBSA 3CH5A 4JLMA 4M9XA 2YWEA 4A0GA 5DHFA 1LW7A 3W5IA 1W36B 1QDEA 3JZAA 3THYA 1ODFA 4MRPA 2HLDD 1M7HA 5IK2D 2DFTA 1IN7A 3U7HB 1Z2AA 1MO6A 4GP7A 3VFDA 1IAQA 1TF7A 4PFSA 4QBIA 4EPXA 3O8CA 1DTSA 2TMKA 1KK0A 4Z1MD 5G3ZA 2AL7A 2ZRNA 4YMTA 1HTWA 3N2IA 1Z28A 3AH8A 4WIAA 1G7CA 2O8CB 1K6MA 5HZHA 1QRAA 1OHHD 4KV9A 5CDFA 2IC5A 5JI3E 5FUXA 4CEJA 2F43A 1CBUA 4U5XA 3IHLA 2VYFA 4US0R 4DIDA 5HZKA 2C8VA 4GPTA 4XH9B 3P26A 1TX4B 3BERA 1VCOA 2FN4A 1IN5A 4LWZA 4PX9A 1TQ4A 4KODA 3GFOA 4FMDF 2JJ2A 1U9IA 4AG5A 4ZDJA 1E32A 1XMVA 2BEJA 3KFXA 4TSFA 4DWJA 1FNNA 2UZIR 3R9WA 1P2TA 2XNSA 2KB0A 3SJAA 1YZKA 3LAWA 1TEXA 5FL7A 2AR7A 5JMTA 2WKPA 3U61B 2FFAA 1NG9A 1US8B 4DT1A 1Z47A 1S2MA 4I1SA 421PA 4M8NE 2N42A 1G291 3I5YA 1ZIOA 2OAP1 3RSOA 1EWRA 5BXQC 5DN6D 3M6AA 2R44A 3KKPA 3CW2A 1Q1ZA 2PEYA 1G8PA 4C2UA 1Q1EA 1W7AA 1NRJB 1E79D 4D6PA 2IUUA 1G6HA 2ZYUX 1R5BA 2QA5A 1ANKA 3IGFA 3OEHA 1DOAA 4A92A 3IO5A 2RGNC 3LBNA 1SVSA 3SR0A 3PEWA 3A4LA 1IXZA 1G5TA 2GZAA 4AYWA 2VQSA 5L3VA 3I61A 1LFDB 1Q57A 4AY2A 1KI4A 3QXXA 1UBEA 4Z8XA 2NO0A 2EW1A 2ZS8A 1E4YA 3EIHA 1ZBDA 5L3RA 4D25A 3JZMA 3SEAA 1KMHA 3NKVA 3K70B 1SKQA 3BOSA 3LBHA 5EE0A 4MYCA 3T61A 3K09A 4ACAA 1KHTA 2V4ZA 4FW9A 2QMHA 4HB4A 1CS4C 1AS2A 1NN0A 1W2GA 5DIFA 2B7CA 1SVKA 4GZLA 4RCZA 1JEEA 4YXWD 1G20E 1XWIA 3OEED 4GFDA 2GXUA 2N46A 3V00A 3DEFA 5AUOB 1N6IA 1N6HA 4AKHA 3Q85A 3FKSD 4NDZA 4A1FA 4PSKA 3GJ7A 1FPMA 1E2NA 2CE2X 2Z83A 4JT2A 3LFUA 1SXJA 1W0JD 2QORA 3B6EA 2GCPA 4ARZA 1SULA 1IQPA 2ATVA 5FBVB 3RABA 1VCNA 3U60B 5JSZB 1VYVA 2IS1A 4QBGB 4BGDA 2P6RA 1S9HA 1OH8A 3TRFA 2C9OA 1II9A 3CWQA 1ZAKA 3B1VA 3GFPA 5KDOA 3CRW1 3FWYA 1E9RA 2IYLD 1D2EA 3UXMA 2R6AA 3U2QA 1RIFA 3NBFA 1Z83A 3KJHA 2KE5A 2O8DB 3K9HA 2DWOA 2NQ2C 1TQDA 4N3NA 4LPSA 1KZGB 3PCRB 4V0ME 4HUTA 4F91B 1N6NA 4HYYA 5JJIA 2NZJA 1I4LD 3K0AB 4M4SA 3EA0A 4DSTA 4Y0AA 2F55A 5JI2E 3AUYA 5P21A 3HDTA 1E2LA 1YR7A 2G88A 4Q7JB 1DG3A 1LS1A 4AG6A 3DO6A 2GEUA 2IYTA 1ZNYA 1IM2A 1YZQA 3O8RA 2CL6X 3ZVRA 2VBCA 3EIQA 4RD4A 5TB5A 3ZDQA 2PL3A 5FPYA 3RS7A 2ATXA 1D5CA 4OJQA 1ZUHA 4CYMA 1EG7A 1GRRA 5CJ2A 1G7RA 4HLUC 4C9BA 3NHBA 2BMJA 1W36D 5KPJA 1N2CE 1DEKA 1S8FA 2KSQA 2YC2C 3AVVA 4C4PA 1X8JA 5GVRA 3X2SA 2BEKA 4HUQB 1OB2A 3CH4B 1VKJA 5J4HA 3T1TA 5B57C 3W90A 2QTVB 2UKDA 4IDNA 2A5DA 4CRWB 3KQNA 2J7KA 2PCJA 3NVAA 121PA 4PC2A 3JVVA 1W5SA 1XXHE 2K5UA 2ZS7A 2D2EA 4WA7A 1JR3D 3KTAA 3UG7A 2F1RA 1IY2A 4RVCA 2AXPA 1F6BA 1E1RD 1G5RA 3BE4A 5H8WA 4U7DA 1G4UR 2QMUA 2OAQ1 2JDIA 2VLIA 4PPGA 1YZUA 1II0A 4CT5A 2XJ4A 4I4LA 3FHOA 1WDTA 2IF0A 4DCNA 4ABYA 1NBMD 3ZYCA 2CJWA 1T5LA 2CE7A 2JIZD 3U44B 3QNUA 2OBLA 4MDEA 3ND9A 2IWRA 3K70C 4XVUA 1CXZA 3B7GA 2DHRA 1CTQA 1OV4A 3DMNA 4IDOA 3PVSA 3K1JA 1E69A 1X86B 2GF0A 5CYPA 1I2MA 4JKIA 3SN6A 3NEJA 2JLVA 5BWMA 4KFTA 3CF2A 1G3QA 4JVMA 2ZANA 2ZRBA 2IYUA 4UXJA 1DAFA 5AK0A 1XD2B 4HLQB 4MRSA 5EXTA 2ZYWX 4DSOA 2NIPA 4JLDA 3Q8XB 5F98A 3NTUA 2WWGA 4LBVA 1OHHA 4EFLA 2CLDX 3K9GA 4V0NA 3THWB 1KSJA 1KSFX 2FG5A 1XZQA 3I5XA 1QHSA 3T5GA 2XTMA 2NO9A 2HUPA 3QKUA 4W5HA 3K70D 5HKKD 2XTNA 1XNJA 4Q9LA 1Z63A 3MGCA 2XXAB 1NVVQ 4TN1A 3QF4A 4YQFA 5D3MA 3RVBA 1WRBA 3L2OB 3V9PA 5JEDA 1GFIA 3U7FB 1W48A 4DRZA 1E1QA 1E2MA 1KK2A 4HSEA 4Q4JA 1HEIA 4BLPA 3AV0B 2QUZA 4RFVA 4HAWA 4PAMA 4U00A 1G7TA 1P60A 2JLSA 3BWDD 2QPOA 2PLRA 3GLHB 4C0BA 2WOOA 2QP4A 5BW8A 5FBQB 1N6LA 2Z6VA 2H7VA 4TMVA 3QUSA 2G6BA 1XEFA 2WJJA 4K46A 5EXPA 3WNCA 3CIOA 4BLSA 4DHEA 4B43A 4KXFB 2ZUBA 1KO4A 1H8HD 4WOPA 3LQRA 3THOA 2ZIAA 3WBJA 3WYFA 3VR6A 3TSZA 1UDXA 1E3MA 2QAJA 1XP8A 2FH5B 4MYUA 1II8A 4IOMA 1NJGA 2ODEA 1M7BA 2QBYB 1ZMXA 3A6PC 5EQTA 2GVZC 5E3HA 1TUIA 4FMCB 4B2IA 3Q3JB 4NH0A 3SI7A 4PXAA 2DWQA 4B35A 5KO2A 1KO1A 2YNMA 4URYR 1BKDR 1EK0A 2IEZA 2D2FA 1RYHA 1P2SA 4EAQA 1OSNA 1GL6A 3SYNA 4C0HA 4PAQA 1V5WA 2N1BA 3AKCA 1Q21A 1OF1A 2VRWA 1KI6A 2F1IA 2JLQA 4IJMA 2D4HA 1ZU4A 1Z6XA 2R62A 4IVRA 4B3FX 5BN3A 1KOFA 2ZAOA 3VAAA 4B6EA 2ZM5A 4D4MA 4DKXA 3C5CA 2WWHA 3UMRA 1EESA 2RGNA 1AKYA 3KJGA 2WIAA 3PUWA 5L3SA 3UK6A 2XITA 4HZUB 4RZUA 4EPWA 2C98A 2EFEB 2GCOA 4GT1A 1TUEA 1XTJA 1HA3A 3GJ6A 1M8PA 1GNPA 2MSDB 1WP9A 3HU3A 4AIIA 3A1TA 3RS0A 3HR8A 1MRSA 4I99A 5CIQA 4TYNA 4CGZA 2RGXA 2G1JA 4NKRA 1L4UA 3LW8A 3QKSA 4ZO4A 4ZV4A 2QTHA 3AVTA 5JWRA 4BPBA 5JFGA 1H65A 2ZSEA 4G3XA 3NIBA 1RJ9B 1G7SA 4HB3A 4AC9A 1CP2A 3D7MA 3GP8A 2F9LA 5H70A 2HT1A 4R9UC 1KI7A 2BC9A 1JXMA 2QGZA 3U3RA 2DWPA 3QENA 5K8TA 4D26A 2GAAA 2XGJA 5E7MA 1T5IA 5CB6A 1X1RA 1GRNA 1VYUA 1BIFA 2A2ZA 4L8GA 4DIEA 3OE7A 2A3RA 3B9QA 4G0NA 5EXSA 4NP6A 5DLQC 1XXHA 3R7WB 1RRCA 1SZPA 1R4AA 2RGCA 2ZI9A 5FI0B 1GP2A 2CHVA 5FTMA 2ONJA 3VKHA 1XDBA 1D9ZA 3WNBA 2FFBA 4KVGA 2KWIA 1DAIA 1XEXB 2I3BA 2PT7A 3A1WA 4JJZA 4Q9KA 3SE0A 2YOHA 1QBKC 4D82A 1G16A 4C0QC 1E9EA 2ZE6A 2QL6A 3CF0A 4Q7LA 1CKEA 1HQCA 1M74A 4ACBA 1M1YE 2V55B 1DARA 2V54A 2ZPTX 1XPOA 1R7RA 2PT5A 2QMOA 3QSYA 1JR3A 1XCMA 2IXGA 3BK7A 3FPAA 1R8QA 2MMCA 1R5NA 1U94A 2ODWA 2CCKA 5AUNB 1JJVA 4D0LB 1OH7A 3W5JA 2XSZA 3P4XA 4Q5IA 4JBXA 5FBRB 2E1RA 2GJSA 3DVLA 4B71A 4URWR 2GWHA 1XEWX 3VKWA 5KNCA 2VO1A 1Z29A 1NL3A 4HLUA 1KI2A 2PBRA 4OI1A 5LD2B 3RAPR 1DBSA 2RH5A 2ORVA 2P0EA 1AQYA 2GTPA 2VA8A 1MH1A 2VP4A 3LV8A 4TTQA 1Z6AA 3TMKA 2FOLA 3PEUA 4C7OB 3KJIA 2ZEJA 2IW3A 2W2TA 1MOZA 2O8EB 3RS2A 4W7SA 3SFVA 2QM7A 3HYRA 3RS3A 3ADBA 1O87A 1G19A 2B8WA 1G3RA 1CR0A 3WMEA 4F4IA 1Z3IX 3M0EA 5JLJA 3ASZA 1A5TA 5JWHA 2Z0MA 3ADCA 1HT2E 1T9HA 1NKSA 5L3QB 1XPUA 1KAGA 1NMXA 3DPUA 3VKGA 5KYKA 5B30A 2YOFA 1ZM4A 3KZ1E 5CDFE 1EFCA 5J47A 3CRRA 3UG6A 2O0HA 4P3YA 1XTIA 4IOJA 2F3RA 2RMKA 1E2HA 1D2NA 4EJSB 4QC2A 1QHHB 4HDOB 4ZKDA 3F3YA 5JWOA 3KQHA 3W8RA 2FMXA 5JRJA 4CEIB 2BM0A 5E95A 3CBQA 5HKKA 5TMPA 2IUTA 1CEEA 2G0NA 4JLBA 1GILA 1CF4A 3EIEA 3IIJA 1CRQA 1L8QA 2OBMA 1HURA 1TQ6A 4TT3D 4PSAA 4QJ4A 4LYJA 3CRQA 4LHWA 4D2IA 5LB4A 1M34E 5JS8A 5JRZA 3LA6A 5CJPA 2YWGA 2XZLA 3MWKA 2Q3HA 2ZQ5A 2JA1A 3R20A 4DUGD 1CJTC 4URVR 3EG5A 2BM1A 4OQXA 3T35A 3W8NA 1Z08A 4P4SA 1GM5A 2D7CA 3Q7PA 2J1LA 2IYQA 1RRFA 2XOKD 3CB4A 1JI0A 4M1TA 5JZVA 2QPTA 1COWA 1R0XA 3B8HA 1M7GA 4NYMR 1NVXQ 2V3CC 1P2VA 2ANCA 4RCYA 1Z8FA 1E0JA 4FINA 4GOXA 4BLRA 5ANRB 1KTVA 4LCBA 3VU9B 3BRWD 1H8HA 4JSTA 2O8DA 2HXYA 4LHZA 1KO8A 2V8OA 2DCUA 2FZ4A 4L4UA 4TL8A 3T12A 4DSNA 2IS4A 1VCMA 3I72A 3PXGA 2IWHA 1FFHA 1ZUNB 2BBSA 1P61B 4ASUD 1OH5A 1G8HA 1DAEA 1ZM2A 2WAYA 3VR4A 1Q20A 4DB2A 3REGA 4LX0A 5E7IA 4A0FA 3QY0A 1NSTA 2DYKA 5IT5A 1I2DA 2HYIC 1XMIA 3IUYA 3T1VA 5C2JB 1ELOA 5EP2A 1R8SA 1KNXA 4TLDA 1ZW6A 2FV8A 4DLZA 3TBKA 4M21A 4NCIA 4ZCMA 3BJIC 5CK5A 1ESNA 3QE0A 4G5SA 2OBNA 4HZIA 1EFHA 4DXAA 2OCAA 3BB4A 1SXJE 4Q1DA 4KI0A 4LYAA 4LBZA 5KDDA 5LD2C 1RKBA 5FPKA 3H0KA 1S4QA 1NLZA 2OHFA 4NCKA 4RFSB 4B3BA 4TYWA 3QEOA 4JVNA 4M1OA 2CCJA 4TQAA 1QG2A 3QIAA 2GEVA 5CK4A 5EUMA 4IW3B 2PCLA 1VYTA 1FTNA 2X19A 4WZAE 1KKLA 4KLNA 2JLWA 2PX3A 4JJKA 4PZZA 1EFRA 4R98A 2Z4SA 4KITB 4PO1A 3ZD6A 2W6JA 4X8LA 2WPDD 4Q9IA 1TTTA 4DZZA 2W2XA 1RRPA 1DO0A 2H8KA 5AJXA 2P65A 1YHNA 4LSGA 1L7VC 2VHJA 4FWTA 1RPZA 5CM9C 1H8EA 2G83A 3A36A 3K0SA 4CVNA 1R0WA 1NLFA 4B32A 1WB9A 3B9PA 1ZNXA 3CUEF 3KKOA 3SHFA 3E2IA 3KDSE 1XJQA 3KXLA 1Y3AA 1DS6A 2C2HA 3M1IA 3ND8A 5LBIA 4BLTA 2QRNA 3VX3A 1NN1A 3AEZA 1N6OA 4FIDA 3ZVNA 1PUIA 4Q1AA 1E6CA 1KSHA 4EJSC 5J4VA 3U6KA 3U44A 1ZYUA 3TVDA 2VHTA 4TLAA 4BFWA 1ZM3A 1NVUQ 3TW4A 3AVUA 1U2RA 1IJEA 3WYAA 3KB2A 3AVOA 3EC1A 5DGXA 2BJWA 5HPYB 3UATA 4QNRA 3T06B 4OKSA 2ZUCA 5FR2A 4BFYA 4P31A 2IA5A 1OH6A 3VHXA 3BH0A 1B23P 1R2QA 4FCVA 2O8BB 4FWIB 4JLAA 2IL1A 3B82A 2BIFA 2P6NA 1U90A 4DSUA 2X2EA 1K5DA 1ONBA 4H1UA 1ZCBA 4M53A 1XD9A 2G1KA 3Q72A 5DI3B 2LWIA 2NG1A 3THWA 4XOIA 3MCAA 1G9XA 1Q44A 2MSCB 4GNKA
chains in the Genus database with same CATH superfamily
1CQPA 2HMUA 1HT1E 1PJZA 5KZMB 2AKAB 1SVUA 3LHFA 1EHIA 5B58T 2A6PA 3M83A 3EZ2A 4IDGA 4MLDA 4R81A 4IZHA 3A3OA 3PDJA 3TNFA 1WUHS 1A1VA 1XN4A 3OH8A 1P1RA 3S5UA 4AJEA 2X23A 1LLFA 4HN4B 3QPDA 4MV4A 3KCNA 4QJ5A 5CW2A 4EQZA 2C4VA 3WTCA 1HE5A 2V1XA 3Q40A 5EJ2A 5A9TA 1U1EA 4X6LA 3QLJA 1A1SA 1RPTA 5CT5A 4O2AA 4H77A 1BMQA 3F74A 4PZAA 3G7NA 3DLAA 4MIOA 3GLRA 1EGVB 3VBCA 4NONA 1I1NA 5F35A 1BXRB 5H16A 2LRHA 4PNZA 1QO7A 2AOVA 1J5PA 1QF7A 3FSGD 3HKCB 3CCFA 4BIMA 4RA9A 3JZIA 2ZUUA 4YBZA 3WB9A 2H1LA 1NXOA 2H00A 4YQYA 4YPVA 4NOMA 4XA8A 2FSPA 4WY2A 2QN9A 4ZZIA 1QO9A 3Q3CA 4GRAA 2Q6VA 3HLYA 5BNWA 1GNLA 3WSTA 3HN6A 2CN1A 1H0HA 1UANA 2HF9A 4M60A 3T15A 3T1OA 4YACA 3T7KA 4EYOA 5A05A 1JBKA 4RLSA 1E1MA 2B61A 1K6IA 1YUBA 3LXUX 1UXIA 1JWAB 4LMRA 4D8VA 2GUGA 2BPOA 2JBAB 2YWFA 3GEBA 4NPCA 1DIAA 5AOBA 5LCXA 4GKJB 1R4MA 3IMGA 1OIWA 2QLBA 4I81A 2E55A 1UBMS 1C5KA 4E0BA 2HW8A 2B3TA 4TTRA 1UWCA 1IQUA 4BL5A 2VWGA 2VYQA 2BAGA 1MG5A 1SURA 3WHIA 4KWHA 5A4FS 1NXPA 3K53A 4IFEA 3VC1A 1DJLA 3BQNB 2H63A 2GD2A 2IKSA 4W5WA 2JAPA 1J2JA 3OCYA 3AWDA 5AVOA 5G3YA 1CZRA 4FE7A 2ZR0A 1APBA 1OBFO 1W47A 4GD3Q 2JARA 4O2LA 4XFDA 1V47A 2IXFA 2ZJ0A 1E3DA 5JJLA 2MIIA 4HH4A 3TQFA 2AN1A 1E99A 4G6ZA 3EEFA 3MB5A 1GGVA 1M6VA 2JKVA 5AOVA 3WLPA 4CLRB 4F04A 2EW2A 1SXIA 1V1JA 1E4EA 4BRUA 5GJWC 2I3AA 3WGQA 5TXGA 2W43A 1XMXA 3QLUC 2VHQA 4RPLA 2BRUC 1V48A 3FVQA 1T1RA 1D1QA 3K0FA 4RK4A 1T8RA 2DY0A 3LK7A 3BB3A 2JZOA 4MVJI 3CEMA 4BX9A 5C1OA 1TZKA 4I7EA 2Z4RA 3P20A 2P1ZA 1MFPA 3OPQA 4X20A 3FGOA 1G6KA 2W6MA 4QBKA 1QCZA 3LX8A 3SR4A 3WMFA 5ALRA 1T5OA 4BKMA 5HW0A 4YJ3A 3UMGA 4BNKA 4RY9A 2AUMA 2DKOA 3UMCA 3I2YX 3ZDRA 5BSFA 3BHIA 1RZRA 4KFSA 3GT7A 4RIEA 3K0EA 4L6IA 3WG9A 3GLIB 1FZTA 5C4IA 4EA7A 4WFIA 3IIEA 5WRFA 2YCBA 2C94A 4C78A 5BVHA 4LF4B 3NBYC 1QU3A 1IG0A 1W36C 4DMHA 3SZ3A 4Q6WA 3HRIA 4QGFA 2NU6B 3BWMA 2C42A 2W4MA 5C52B 4PX2A 4LEIA 4IDHA 3WP0A 3A6FA 3LT4A 2F64A 4R1SA 1BS2A 3MRXA 3T8YA 1RJEA 3DF9A 4MWTA 4G0UA 1P19A 3RJ5A 2IBMA 5J40A 3NOQA 1I7SB 2DPXA 5LIRA 4X6XA 1M6YA 5BRNA 4BGEA 3NLLA 1FYDA 4OHPA 1VPLA 2BUAA 2FUEA 3I5UA 3KZVA 1OQAA 4JLNA 1SBZA 3SDBA 2B30A 4NFLA 2JAWA 3B5EA 3HYNA 1X6VA 5ECGC 3B13B 5HDBB 4AZ0A 4OBWA 1J9ZA 1ZD9A 1BX1A 1X7YA 3FNQA 4MJLA 2VTBB 3W3ZB 2F2TA 2R8ZA 1LSUA 1E9CA 1H9AA 3RKUA 2TMGA 3CIFA 1IRXA 1YVPA 3H9UA 5AYVA 4LS3A 2A0WA 1Y48E 4TV8A 2R8PA 3AKEA 3PFIA 4AYTA 2CNWA 1TL7C 1I3CA 4IOLA 5GY7A 3EVBA 4QVIA 3QKWA 3IQWA 4KO8A 1R0KA 1SPBS 5K6TA 2VP2A 4J3NA 2FJUA 3SJCA 4OQEA 4EHKA 4EHAA 4F2WA 1KFCB 4EPTA 3SK0A 3HKDA 1Z82A 3L82B 4F8YA 4JI4B 1NVDA 4ENSA 1J9EA 1NQUA 1VL0A 2C1ZA 3E0XA 3N2NA 1VBNA 1ZGCA 3FTNA 3LVRE 4DLYA 4CCYA 2OORA 3FPFA 4ROTA 2TRSB 1RBMA 3KETA 2Q9AA 1N8KA 1O89A 3NEAA 3WJAA 1FFXA 5FOQA 4H7PA 3HGTA 3VHRA 4YV1A 4ZC8A 2AFHB 3A8TA 3OY7A 4JI6B 4C7BA 2IYYA 3QU5A 4RHXA 5JNVA 5D3MB 3QVTA 4EEZA 2ODBA 2I91A 4H16A 1Q74A 4U7TB 2BEVA 3ILHA 2UXDB 4CM4A 4FEGA 3MQ4A 3OCUA 4RVGA 3L1IA 2ZYHA 3ZE1B 2HSGA 4KMRA 2VSYA 3SFZA 4LY6A 1G8FA 1ADFA 1MOQA 1T5BA 4NI5A 3UUEA 3DHYA 3TRKA 4ENUA 3AI7A 1OW3B 5EJFA 5MN4A 2D0DA 5BRJA 1YE3A 4QICA 3NU1A 4N8SA 2ECFA 4FEAA 3H6GA 5JCJA 5IANA 4R9NA 4OXXA 2C9MA 2CUNA 4KAJA 3OFND 1Z5NA 4CCWA 4E08A 3Q0EA 3KPVA 5FJJA 2XW6A 1XKLA 1YCFA 4GICA 1J0DA 5FH9A 4MV0A 3SF0A 1Q92A 3PA6A 2WM8A 3KPJA 1KJZA 3GK3A 5ECYA 3VC3A 4CIAA 4C5BA 4YEDA 1JX6A 2QU7A 2O48X 1L7XA 4BTLA 2OZLB 4TRRA 5F52A 3R9XA 1L1RA 5C1BA 3IMKA 4HQKA 4N0QA 2DFNA 1GAWA 1JDVA 5HIAA 1TTHA 1TU3A 3ZJVA 5AW5A 5FNVF 2OFWA 4Q19A 1X8XA 1ULAA 1EG2A 3JQ9A 3I6ZA 3QLVA 3E4DA 3V2UA 1IXSB 2Q2WA 2C77A 2QUJA 4AY5A 5FBWB 1M8FA 3CR7A 1O6FA 1Y4AE 5CB4B 1KJ9A 1T5DX 4DW8A 621PA 1BROA 1VXRA 3BE8A 1L8LA 4FOOA 4CIXA 4HNVA 4XPIB 1UFKA 4XIIA 1B43A 1I0IA 4ZGWA 4PSCA 3SX0A 4MI9A 1Y3DE 2Q1TA 3ELYA 4X8OA 3EZ7A 1Y9EA 3E5MA 4FU0A 1P0FA 5AVRA 2G1PA 3U4GA 4MWBA 5CITA 2X4IA 3NIFB 2ZU6A 4QQKA 4EPVA 1XPJA 1WHTA 3BXGA 3V4ZA 4CL0A 2CZCA 3I2HA 4ISCA 4K9DA 2RHOA 3RLIA 3PIDA 4XD7D 4TTJA 1UMDA 2IJGX 1RWNA 2V58A 3P0FA 4ZYTA 4H1VA 4G97A 4MQBA 3PVZA 4TZ6A 5JRDS 2B0JA 3GCZA 1GT6A 2GEFA 2I8LA 5TT1A 3ZHCA 4BFXA 1K9SA 2EJCA 3VPGA 1H3NA 3PKJA 3RYFA 4B6PA 1IZ9A 3NB0A 5ERYA 4V0SA 2JIOA 5CIYA 4QJBA 1H1LA 5DTJA 4EG4A 1HBJA 4L2IB 3NTRA 2O5CA 1NMEA 1YHYA 3KS9A 1WHSA 4O4JA 3BCRA 1IU9A 4WJZA 4OMCA 4E6EA 5IAAA 5ICEA 3BL8A 4L3WA 2HNAA 4TTAA 3SBDA 1ZK3A 2C9CA 1VPEA 5EE5B 3RGGA 4FX2A 3KWFA 4K9PA 2C78A 1YE5A 5EJAA 1BMFA 4BO5A 2OM6A 1KPIA 2F43B 3GFQA 4DEYA 1EKXA 3DNMA 4QG3A 4NYJQ 2AOTB 4GAEA 4W8GA 4RTLA 3AXTA 3ZY6A 3B1ZA 3ANSA 3QKTA 2F48A 4M1EA 4MPDA 1L3CA 2Y6UA 3JS5A 3P5BA 4HXYA 3JZFA 1CRLA 3RK1A 1VLHA 4P2BA 5GZ6A 4HATA 3NHSA 3SC4A 2X5OA 3SXUB 5JASA 3PR3A 4EA9A 4WT7A 3VNQA 3C8MA 1UIMA 4YXWA 1NN3A 5K51A 4C5CA 3OEEA 3G6WA 2Q6IA 4ZQGA 4BVKA 2PPVA 2H5EA 3FKSA 3IJ5A 4U7WA 4UDOA 1N1EA 3COPA 4QXAA 1OE0A 1V8FA 3L7YA 3GJ8A 4JFRA 4DCOA 3V42A 4B0PA 4ED9A 1YUNA 3IBGA 2BBTA 3CX4A 1JDSA 4FCWA 4CETA 4D4KA 1NI5A 2FWBA 4FFWA 1UBHS 1ZZEA 5E6UA 5DM60 3HO8A 1EZ4A 1GG9A 3O8BA 2JLXA 2AN4A 2I4OA 2QLFA 3ZKAA 1PJRA 2OK7A 4R8MA 4E2YA 1XN1A 2IE8A 3EF1A 4Q00A 1XCPA 3EMVA 1FP7A 1P39A 1U8AA 2KJQA 3RO7A 4F3NA 1ZJJA 2BFEA 4OBEA 4PSVA 1E7QA 1WABA 3EA5A 1ECFA 1EJ0A 5JC1A 3E22A 1S1MA 3D2LA 2EKDA 4M8IA 3RIHA 1AK1A 1MB2A 1POWA 2G9RA 1VLLA 2X7JA 1OT5A 1YZTA 1KMHB 1YE8A 2H4YA 4M38A 1HYQA 1ZW1A 3DFUA 1YVDA 4C4XA 1NNEA 2J0VA 4ZOCA 2GZ3A 4FC6A 4IXDA 4V02A 3SLKA 4UQOA 1QYWA 2FUG1 3QEMB 5EP4A 1NC3A 4WGFA 3VTZA 5K0ZA 3TZCA 5CXXA 2W6NA 2HRRA 3H4MA 4QRHA 5EWMB 4CQJA 3C4JA 3HXQA 4WJKB 1BG6A 1D5WA 2XYGA 2P8JA 2ZULA 3QIVA 4LC9A 1Z4NA 1W9HA 4OJNA 5ABPA 2ONYA 1WXGA 3B7PA 3RAGA 1G5IA 3PTAA 2WR8A 4OXRA 1ZJ6A 4LNAA 1JFRA 1FDIA 2I54A 4OB7A 3QYPA 1E60A 2ERYA 3PA8A 2V6JA 4KDFA 4RTOA 3T9DA 4NEQA 1SOAA 1DKNA 4F5YA 2WKQA 2WU4A 2I76A 3DKRA 5LC1A 1VI2A 2OCKA 1N1MA 1NYRA 2OP1A 1G63A 2Y0CA 3B1KA 1NZJA 4YUAA 1S2NA 1MVLA 1IL0A 3JQQA 4K9MA 3ZX5A 3M1YA 1C0KA 5B3AA 1RM5A 1FFGA 3P9SA 5IJAA 4A91A 3V8MA 1E20A 3EXHC 5BSKA 4P1ZA 4I4CA 4HDRA 4KR0A 1KEUA 4DHWA 2BFMA 1BW9A 3QA3E 1JNXX 2MOKA 4CODB 1MHTA 1CDZA 4XM1A 1FK8A 2FJPA 2QQGA 3I0ZA 3R5JA 3AFNA 2RH4A 3GFFA 4M1SA 4A9AA 1G9SA 2JASA 2VAVA 4DDTA 1ZC4A 3B53X 3OLCX 3TOCA 4RA6B 3R3YA 1IOVA 4DV2B 3IUNA 3IILA 4WNAA 4BNNA 4R1QA 4BB5A 1OKKA 4R71A 2YJ3A 1PVVA 3AP2A 3V4PB 3ZLJA 3T9CA 4E88A 1U1DA 5E6SB 1RKUA 3D8UA 4N39A 2EQ5A 721PA 4CGYA 2GBGA 1OVMA 4WACA 1JSCA 3OWHA 4Z9BA 1AF4A 4KFRA 4Q7EA 1PT8A 2QTTA 2D1TA 1XZBA 4RWZA 3U3OA 1SIWA 4L8VA 5KSYA 3H18A 1P73A 2QTLA 1OXTA 2AF3C 3O4FA 5TPWB 4O3MA 4JJGA 4HNSA 1XYYA 4FDUA 2PLAA 3CNHA 3GLQA 3UPDA 3SQDA 3TFWA 1YZGA 2R1ZA 5FTWA 4YV0A 3PQDA 4HT3B 4LGVA 2BDTA 3ELUA 3EH1A 1YZNA 2GX6A 1MV5A 3NOOA 4WK4B 1QHNA 1F2UA 3GVXA 2OFFA 1N8NA 4CCSA 4MCIA 5DWDA 1MQAA 2GN0A 3URKA 2BGNA 5IHXA 3IR5A 1OC2A 2ID9A 2P9HA 1WD5A 2PTGA 4NNJA 4TMXA 3RRBA 2XZTA 3IFSA 3ED5A 1NGSA 4LECA 5C0OE 4EPRA 5KX5A 1SG6A 3L0PA 4RYDA 5ENVA 3GG2A 2Q50A 1RXWA 3IHWA 1PFGA 3OIWA 3VVMA 1Q1AA 4HDKA 4QOSA 2X14A 4ZO6A 4LDRA 2XVYA 3CZ5A 3PNMA 3P2YA 4UPDA 4IVQA 4UNIA 3IULA 1QFMA 3GLHE 1MO4A 1NHWA 1BQEA 2OO5C 2PIDA 4QUJA 5DTEA 4TSFD 4A23A 1K75A 4ZV9A 5BSWA 2FZGA 1EWKA 1NBHA 2IXEA 3DXXA 4MI6A 1LEHA 4JBHA 3IEMA 1T2UA 2L82A 1IY1A 2C4MA 4QOHA 1UC4B 4INPA 2QM8A 5FL7D 4PQYA 5IAKA 5CFOA 1VYHA 3G17A 1JE1A 4C3ZA 3KALA 3KTFA 4L9SA 4MH0R 4CM6A 3PHHA 1WAMA 5I9IA 1KZHA 4M7PA 3QHAA 1V1RA 1JIIA 1D2CA 1WX1A 1TW3A 4EQ6B 5DRTA 4GYWA 3EVFA 3LPLA 5B64A 4KPUA 4QOJA 4RSGA 3LDGA 4ZDKA 3C7AA 1G5QA 2BT4A 3CGWA 4XGNA 4L75A 4Z1OA 1QDUA 4NYIQ 3UB2A 4J0CA 4HAXA 1CYEA 3BGWA 1YFLA 2IHJA 1CJSA 1YQDA 2QN6A 1TAHA 4MV7A 5C8YA 2AUNA 4AJOA 3PNKA 1X15A 1X92A 1WKCA 1Q12A 5FT9A 2X5XA 4QFDA 1GYRA 5BQPA 1J6UA 3DC2A 3I53A 5LMZA 3LSTA 3PWZA 3FZGA 4NX2A 4IXNA 4Z4CA 2BZGA 2VJQA 3AKDA 4OHZA 3DXZA 1TZ2A 1VE7A 4HB2A 2AI3A 4ZJZA 4M9CA 3VO8A 5JY1A 3PDWA 3CF4G 3FN4A 4KJZA 2R7AA 1JP7A 2CNDA 5LBUA 1QQAA 4P33A 1ZSVA 2CGEA 1USIA 1P9WA 5C37A 1DPFA 2NSDA 3L7JA 5IVKA 3EARA 2ZU0C 4P7BA 4E5KA 2JLYA 1H4QA 1TAGA 1CUYA 2HO4A 2JGDA 2J3HA 1DC3A 2AD1A 5KB3A 2ZRFA 5THXA 7ABPA 2Y1LA 4LXXA 4XJSA 2FCAA 1JHRA 5C53B 2R87A 2JGAA 3HWWA 2JAHA 2RG7A 1E0AA 4ROSA 4JR1A 1VCIA 3ECSA 3RUFA 1VGQA 3RIGA 2A5JA 2ARKA 5HVNA 3SF8A 1UJCA 4DJFC 3MJVA 3JVDA 4B75A 1UC9A 3CM0A 5AJVB 4UDXX 4ZZ2A 5MF6A 4LTNA 4ND6A 2EBWA 2VPQA 8OHMA 3ROEA 3ZZMA 1PF7E 1AQUA 3IMCA 5AVYA 1HPLA 4MGIR 3P27A 4HUQA 1VG9B 1QZZA 1J49A 1IEQA 1AO0A 1OGIA 2H9IA 4MHSA 4L78A 3GLFB 2UVPA 4I2VA 4RGVA 2ACKA 4JWKA 5CRIA 3KSBC 4BDSA 2GJ9A 2WDZA 3EGIA 1E1DA 3IJEB 1CLEA 3FSEA 4JXJA 2EQBA 4WCFA 4RVDA 1PR2A 2IY9A 4Z7NB 1OC4A 1RWBA 1W2WB 1P7VA 1OIXA 1C7EA 1IM8A 1KI3A 4X1OA 2WZQA 2B7LA 3UAZA 1PZHA 1HUQA 3IAHA 2COEA 4RVFA 4YMVA 5C1DA 4XGRA 1WUKS 2E4YA 1PEAA 1Y9DA 2NGRA 2QMZA 3KVOA 4NNOA 2WYVA 2GQ0A 2RJ3A 1FSFA 1YRAA 3S1AB 1CX9B 1HKUA 4DYDA 3FOAA 2VSNA 4D57A 2JLVA 1KYZA 3P9RA 3P9PA 3M6VA 3I1YA 2HA2A 4Q4HA 4YJGA 5LWHA 4OUDB 3DF7A 4FHZA 2REBA 4WKBA 4WZBA 4HWGA 3WNZA 2V7UA 4TKLA 3TNDA 1MAUA 3OWXA 3RFFA 3UAYA 2IEIA 3AW9A 3D8SA 4WAUA 2FZLA 3K32A 1OZFA 3KWMA 3TSAA 3IAM6 2DC1A 1QS0A 1VIMA 4PYLA 5LMNB 1O6BA 4ND2A 4G24A 2P9GA 1XB2A 3DOUA 1GZDA 4R8SA 3VI4B 1EX9A 4F86A 2BISA 3Q9SA 3TNJA 4CIDA 4EL5A 1OX4A 3QFHA 5EFZA 3IAAA 2PX4A 5J2TF 1CG6A 2C97A 5D5HA 4OQFA 3WSVA 5C7LO 4HEA1 3W9UA 4FJ1A 1PSWA 3UAGA 2BJHA 1QR2A 5AW8A 7MHTA 4MX8A 1ISFA 3B1WA 4RJLA 4Y7DA 3FIUA 3FKQA 4AK9A 4CKEB 3HABA 2EP5A 3UGQA 4O29A 2X8LA 4J4BA 3SQOA 3B2QA 1XMSA 2QVGA 3HDQA 2JGMA 2O0LA 4MKIA 4P3NA 3VYRB 4K1XA 4CG3A 4CMGA 2F3UA 1MRZA 2NVWA 3ZY3A 5JNSA 2X2PA 1YKSA 1HDOA 1C1XB 2O2ZA 1QJCA 2VT7A 4C08A 1VGRA 4F2PA 3EVNA 4KH0A 5SYNA 4BAUA 3ULKA 5FWXB 5J9FA 1FNCA 4BMZA 4BKOA 4F4CA 1T35A 4CEHB 4WUVA 4EITA 3MMPA 2AZXA 5FAKA 4AXBA 1G8YA 2OHGA 3I1FA 2WWRA 4UJ5A 3FM9A 3HDJA 3EQZA 1MV8A 2Z04A 1VHDA 1D04A 2B4KA 3G0IA 3GDWA 4ID3A 5EQJB 2UXBB 2LV8A 3TTWA 1C1YA 3L1JA 2JS7A 1ODKA 1HE1C 5ALVA 3HY4A 4C4SA 3VO1A 1C8VB 1DUVG 4RDXA 4DIKA 4I50F 1P2DA 3GELA 3KEFA 2RHBA 4PTLA 3JU3A 1U8UA 4U2DA 1JVNA 2ZITA 3TRIA 4UUOA 2FMUA 4KI7A 3A28A 2ZBQA 5LJLA 4PYJA 5I7VA 3I83A 2D00A 3PUHA 3PXEA 5JD3A 3QPVA 2WSLA 2R6ZA 3IOCA 4M1MA 3V97A 4DIFA 4Z7QB 4D45A 1M76A 3IA7A 3LUGA 5EKSA 2H57A 4QG7A 3DXFA 1U6IA 1LKZA 4KE6A 4B6OA 1PDVA 1YS2X 4YRKA 2CXOA 3F8TA 2NXNA 3AIIA 2Z9CA 1DFHA 1EB8A 4NMXB 3SS8A 4PLZA 2GXAA 4M37A 4XX0B 4CT0A 3T4PA 2LPMA 3PNQA 4OLAA 2ZI5A 4II3A 1T1EA 1YA8A 3DG9A 4Y30A 4KGZA 1Z0DA 2E4UA 3GUVA 3LWZA 3S2EA 1K86A 3SCZA 3VKFA 3HJRA 4W7IA 3ZE7A 3BGIA 1W75A 1T8TA 3Q2KA 3PK0A 4CFYA 3Q7RA 1KU0A 3AUXA 5CVJA 3PB3A 2PZLA 2ZR8A 1NAIA 1RDFA 2F8LA 2ZB8A 3IIMA 5BYJA 1Z56C 4LISA 3BHJA 3LWDA 4CKWB 2KLBA 4ZEMA 1FJHA 5DRYA 1XJ5A 3LT2A 3PYXA 2UUPA 3LOQA 2R8RA 4MRRA 1K7SN 2FWRA 3IOBA 1M2VA 3PBKA 3TPFA 4P2GA 3ML1A 3GVPA 3COZA 1PVOA 1U3UA 1LXCA 4WXPA 1XL0A 2WFLB 1FB5A 2YHIA 3AOGA 1SELA 3N86A 4QTZA 4UU8A 2CY0A 5DX8A 1QMPA 2AR0A 4R2JA 5E0KB 4DLUA 5HE9A 3B85A 1WXFA 3EHDA 3TTXA 4AN1A 5FOTA 1SVWA 3SX4A 5CFRA 3DTTA 1Q0HA 4EI7A 4RD6A 4EKYA 5IVHA 1YS7A 1FL9A 1E6UA 1QP8A 2BFDA 4H3HB 1Y37A 2FQXA 2J5KA 3RS5A 3SNHA 4CDMA 4ER3A 3JQBA 3ET4A 5LNK1 1SFRA 2JIRA 3BC1A 2DFDA 3HO1A 1T26A 2LR0A 1FEZA 3IQDB 4B2PA 2ZB7A 4RSMA 4JYAB 5HGJA 4CKCA 1Z5UA 1IONA 4KNWA 1RHQA 4V3BA 5IKPA 1RBYA 4DV6B 4Y2UA 4JOBA 4EGCB 1LTHR 1N75A 2IW1A 3R5KA 2FLKA 1DLIA 3DDZX 5HNKA 5BSMA 1NJFA 1J09A 4AM8A 4BE9A 1UK9A 3NBAA 1KAOA 2JZCA 2HPAA 3PF8A 4DR7B 4GP6A 2IK8A 4JBGA 2HCFA 1HDIA 4LNUA 4DEXA 5LP6F 2EJVA 2HV8A 5FBKA 1YRBA 4HZGA 3RREA 3R40A 1T8SA 5E6RA 1TUGA 1F3OA 3MHPA 3GIDA 1DGQA 1GSHA 3LRTA 1C3OA 1XROA 1WMAA 2YRWA 1TIPA 3AP1A 3HCCA 3KELA 1B7GO 2FJ0A 2AFVA 2YNMD 4M1ZA 4UE6A 4MGHA 1L5OA 1UXJA 2VHZA 4WEOA 3ROGA 5C5CA 4L4YA 4AWXA 3LDFA 4EY4A 3QE9Y 1O3YA 2QTZA 3E05A 4L0QA 1VKOA 4X3CA 5F7OA 1XHLA 3OZBA 4TXLA 2D7DA 4BV3A 4CN9A 3BIWA 4HRXA 2C04A 2ECQA 3RYHB 3R7WA 2HIGA 4D3FA 3KWJA 2GUWA 3P2JA 4M1QA 2ZE8A 3F7OA 4P4SB 3ZV4A 3U4HA 1NXTA 3EW7A 3CVYA 1QIHA 2Z56A 3KK0A 4J0KA 1KWGA 2R8EA 3C3CA 1GPYA 1H94A 2EX1A 4FHGA 4AQYB 3NTOA 4CU2A 1CUFA 2GFIA 3PUZA 1C8LA 2ZZKA 3UIEA 3D3JA 2C5AA 1XEXA 2HSDA 4DQKA 3WO1A 2VH5R 4HP8A 1ES9A 1P17A 1XCLA 1IBSA 1DMRA 1XR3A 3QM1A 4OA5A 4U02A 5MGNA 2ZJ4A 2JAUA 3KKQA 1KZ6A 1WETA 1AF7A 3KQKA 2XIQA 5EHGA 2PMFA 1UPAA 2E4WA 5HJ2A 3A7DA 2WPDA 4WJLA 4TMZA 2ECPA 2HZ7A 2OVBA 3KOUA 4OBXA 4WXRA 4LF8B 1GFZA 1UKEA 3RI3A 2R6R1 4H9GA 1L5RA 2FCRA 4P5DA 3JATB 2PX0A 1IEWA 2B5WA 1QIKA 1U3DA 1WIWA 2UXCB 4ESEA 1LPOA 2IHYA 1DCTA 2XNHA 1C1DB 2WTUA 1KQPA 1RYMA 4XW2A 1F6WA 2IDKA 2NUAA 5H3LA 2D5IA 1FTQA 2I5PO 1ENOA 2P6UA 2WM2A 4YH1A 3C41J 2PL9A 4RLFA 1KS9A 2A4MA 3FJ1A 4MPTA 4I1VA 1USVA 3SVLA 3GT3A 3R5SA 4GSKA 1CJBA 1Q14A 2EX0A 1ONNA 4FFOA 1QTIA 4PRYA 1DC7A 1IH8A 5CJJA 3GJSA 5GIPE 4XKJA 3D6TB 4WDRA 2J6HA 1GPMA 1MJ5A 1YXMA 3KYBA 1NJSA 3AJ9A 4J7XA 1N3BA 2Q9BA 2A30A 1OU4A 3FCCA 3ZGXA 3DBIA 1JYFA 2BMAA 3AI1A 1C41A 3HKEB 4QGSA 5JSHA 4DIOA 1KYVA 2YYAA 3U37A 3VX4A 1TT5B 3TB4A 3H7IA 1EM8B 3OIDA 2SCUA 5AJUA 3A37A 3FCXA 2XYPA 2E37A 3BILA 2OLKA 5AWFC 4MTLA 4P81A 3VPHA 2HTEA 4NXNB 2IDZA 4ZK6A 1CB0A 3OIUA 2WMNB 1Y9JA 3RT9A 4E30A 1TIKA 4EW2A 1P7CA 4UVDA 4GOKA 4P7GA 2VP6A 3X3HA 4ZGGA 3KOOA 4KUGA 2O0KA 3WJ2A 1V6AA 3BZWA 3HCWA 4QTTB 4P0QB 4Y6QA 2JD1A 4AI6A 2ZRCA 3UFXB 4U9IS 1A5SB 3KNZA 4FLMA 2CB9A 2BFAA 2VSQA 1XDSA 5EXEA 4I3HA 1OWPA 1KMCA 2CUKA 2GSDA 4I1UA 4K26A 4W5OA 1Z25A 3S40A 1KQ3A 3SSOA 1AE1A 1JIQA 3UA3A 1RHKA 3MERA 2H3EA 4DVJA 3D0RA 1G8GA 2QDXA 3RYIA 2HAEA 2Q5LA 4D02A 3IRVA 1VDZA 3CPEA 1R0LA 1NVWQ 5JAIA 3I62A 1MNAA 5CLHA 4BB9A 3NT4A 4F5ZA 2ECOA 3BGSA 2OV2A 4BOYA 4J91A 1W8DA 1K5GA 2V6BA 2Q45A 3Q6NA 1Q15A 3JYPA 3D3KA 3QWBA 1YZFA 1Y3HA 1PT6A 2HIAA 5JW6A 4GWLA 2FZWA 3FRJA 2PU5A 3B7WA 4L8WB 4U7HA 3WZMA 4ZZ1A 4LZAA 2FU5C 2YMPA 3DE5X 3EDMA 3HJTA 1FA9A 4JROA 4LV6A 4WW0A 1QIFA 3GLSA 2CL5A 4RZ3A 1RVDA 3MVEA 2HCJB 1GRQA 2PRKA 4PFKA 1ML4A 4JJAA 3HXPA 5DLDA 5IDQA 4GMGA 2QQEA 1AMUA 3SEFA 3U5ZB 2OKGA 5CNMA 1TFRA 3HXTA 3SFTA 1U0HC 3ILVA 3TS1A 1TQHA 4LRWA 5G40A 1L4GA 3OETA 4PBTA 3UCXA 3GHHA 4EO7A 4GXTA 3M6LA 2ZIXA 2ENUA 3SHOA 4UNNA 3N05A 3ZS9A 1XZHA 5REQA 3H1BA 5TV2A 4B46A 1Y5RA 2Q5QA 2E7ZA 2P4SA 4PLYA 2AWNA 3ENKA 1GNRA 3QBDA 5FTNA 2FMFA 5FYDA 3V7YA 1OPRA 4OX9B 1FP2A 3AETA 3AM4A 2LKCA 5CB0A 1GUBA 3G02A 4IDPA 1UM8A 1ZUNA 4MWCA 1D4AA 3H2IA 5DF1A 1V35A 1CR2A 2P27A 3GJYA 4K6HA 4TV9F 4WQMA 4ZCQA 1M0SA 2P9FA 1I0ZA 4X6YA 3KQUA 2YY5A 5D6OA 3A9UA 4PZYA 3QVMA 4KQ1A 1YR8A 4QO7A 2GNAA 1QH8B 1MHPA 4KBFA 4YAOA 1KDZA 2QP3A 3TUIC 3G59A 3R1IA 3TQOA 2LCFA 3OEWA 3GROA 2QX9A 5FTKA 4MGKR 4C07A 1RHUA 1DG1G 4O1IA 2QRJA 5DGDA 2ZSAA 1L4FA 3DUFA 3GGJA 5SY9A 4NBUA 1EFLA 4LHYA 3EWIA 2PJZA 1N9ZA 1H93A 4R3NA 5IC6A 4AJNA 1RQGA 3C3AA 1M5TA 2BI4A 5FL3A 4GKBA 1X7ZA 2WOJA 3UUGA 1S1CA 3QVUA 1RBZA 3NYWA 4R2WA 4RTQA 1LDBA 5K3DA 4OAQA 6Q21A 2QPLA 1NDQA 1U7WA 2OHXA 1GTZA 4A5OA 1JNYA 1M3SA 1JDPA 1Q95A 2VAWA 4IEEA 7ADHA 4EVSA 4N0EA 5IBPA 1HZJA 2Y71A 3HBMA 1C4KA 5T4FA 3W1VA 2OWEA 3N5CA 5A6SA 2CXUA 3BJRA 8AT1A 2I2FA 2XEXA 1CR4A 3LU1A 4EGJA 3CH7A 3KU1A 4F9GA 5CA1F 3WGYA 2VHUA 2OGZA 4PEVA 2I8AA 3OIGA 5AHOA 3ZBQA 4IFTA 2IELA 3L7CA 4ZP1A 5J43A 5FOXA 5BOVA 2LW7A 3SIPA 4RK7A 5KAMA 1ZR2A 2UUCB 2FX3A 5HSGA 5G0VA 4PZ0A 1SQ0A 3A14A 3QNMA 5TNXA 1L5WA 1ULTA 1FS6A 2A88A 5SZIA 3QJGA 2A5FA 4HDAA 4GBGA 4F5DA 4POAA 4D44A 4LBYA 3E3MA 5TJ9A 4PIMA 3RT1A 3VM6A 4GDFA 4AMGA 2IYXA 4UU7A 2P3QA 3DAYA 4GL4A 1NKVA 1F4PA 1Z34A 1KBQA 3LQYA 1LB1B 1G6Q1 1H1TA 3OE1A 3NBZC 5AOAA 4EKNB 3U4QA 3HUFA 5FX2A 4YLYA 3DOHA 1M2HA 3I4CA 3TG2A 5EPOA 3ICQB 2OECA 2P11A 3HVIA 4D9KA 2R1TB 4R2XA 3KZOA 1B74A 1YJ5A 4NK5A 2W6JD 1R12A 4IIJB 4Q1VA 2QVYX 3OOHA 4A16A 3LO5A 3U3MA 3O47A 5I45A 5FTLA 3W6NA 4AKGA 4MUEA 1JRLA 2FN3A 2C2WA 3OA2A 4L4SA 4KO2S 3DV0A 1EA7A 4WLNA 4DQDA 3KXDA 4D9FA 4EPYA 1W4BA 2PYZA 2X0NA 3E7DA 3NUGA 1IYZA 1EFUA 4ARZB 1VP9A 4OP3A 1SC6A 4HNAB 3PCXA 5E4FA 3UA4A 2BN4A 2W90A 1QO0A 4X00A 4NE7A 5I4CA 1XLWA 1WKVA 2HRQA 1SO8A 4DEVA 1WPQA 4QT0A 2NTNA 2X1VA 4QFMA 4WL0A 4LVOA 1SG9A 5E2AA 1OLUB 2AMLA 3LC2O 2JEZA 2IPLA 2JFOA 1NQXA 3AEKB 1OXUA 1GSIA 1ENYA 3ZU4A 2I2CA 3OCCA 4WZBE 4YUYA 2HK9A 3FDZA 1THGA 1T3TA 1VMKA 2ERCA 2J30A 3EZ6A 4JK3A 4AMBA 4F92B 4OI0A 2XXJA 2XT6A 1NG1A 5I7RA 1LBQA 3QGMA 5AFSA 3G8CA 2C2YA 4Y18A 1CUXA 2O1WA 2ZREA 1L0BA 1XCGB 2BUCA 3LQQA 4FD3A 5BPFA 2G72A 3QTLA 1QV6A 2X9VA 4NYJR 5HS4A 1JKIA 1EU1A 1Z0IA 2BMFA 1XQ6A 4LOLA 5IM5A 1QAOA 1TRKA 1KJIA 1Y82A 2ACWA 1K8XB 3L7BA 1D09A 4P32A 2I2BA 3INGA 3P9ZA 4JEUA 4LK2A 2H18A 2UAGA 1NBWB 2GERA 4NYMQ 2V8BA 1ULZA 1BC5A 1GGJA 2VRNA 2YWXA 3AY7A 1T9GR 3EMDA 3P97A 5B5SA 1AB5A 3INTA 4J0HA 5UKDA 4BWGA 4HMQA 3ESAA 2C4HA 4PGHA 4OD0A 3WK5A 3ERCA 3WLTA 1RYFA 2V98A 1Z5GA 3IO3A 2HPZA 3FYDA 2NO6A 2PXCA 3HL4A 4JLKA 4KO1S 3Q9NA 4F3RA 5CXUA 4X5OA 2WD8A 2HPVA 1PHRA 5IZCC 3D6VA 2ZUWA 4DMKA 3U6BA 4Q4LA 3Q7QA 1TO1E 2R86A 1E9BA 1ZI8A 2B8NA 2JL1A 3LTEA 2VUUA 2Z2ZA 4V03A 2F62A 3DWIA 3E5HA 4NBLA 4BNUA 1VSTA 2DOKA 1EFVA 4RV9A 1KDTA 5A3RA 4EVRA 1XLVA 1YB5A 1U3FA 1QGDA 4G1BA 4IGAA 5IMBA 1H66A 3MUFA 3ZDFA 4EM6A 5LZ2A 3PFBA 3PGMA 3PC7A 4TMWA 3KTAB 4M7WA 2Y0BA 2X4GA 2PS1A 3FG9A 4AO6A 4EKDA 1VE9A 1E2GA 1ZH8A 4DKJA 3Q3HA 4S1PA 3F9CA 3WAGA 1WULS 3IEUA 3OQBA 1FFSA 2JGJA 3K96A 2IZ7A 1Z6PA 3I92A 4NCBA 4HEQA 3E9ZA 2DBZA 3QVWA 5DBFA 1CK4A 2EEPA 1E1YA 4N9WA 4P7FA 2MHCA 5LYYA 1OXVA 3RFXA 4J43A 1LZKA 2D62A 1J1ZA 4OHVA 4DQUA 3JPWA 5DHPA 4XD7A 1PIWA 4WLUA 1NQWA 1B41A 2B37A 1BYIA 2YWRA 2C2MA 2QAGA 3KXIA 3KYCA 1YIDA 1H23A 3EPPA 4L9WA 4P3XA 4PBSA 3WGMA 3X44A 2QMYA 2WAXA 4BDTA 4XDGA 1QH0A 4KTVE 1T6XA 2EZUA 2RGDA 4D9BA 2XCOA 1GKLA 1OROA 3PPIA 4M9SA 2AN9A 4CDRA 4ZO8A 2FE1A 1U6JA 5J4LA 1ZWKA 2XNKA 3WRXA 1T4DA 5BMOA 1ISSA 3FPHA 5I3ZA 3A04A 1H2ZA 3W2TA 3A6ZA 4EY5A 3Q11A 1EXDA 5AVQA 2OV3A 2NT4A 3MWDA 3DLPX 3FFXA 4LFAB 4BV9A 1R74A 3SZGA 1DDGA 2WD7B 5M04A 1JGTA 1LWOA 2YMLA 3STVA 2C88A 1VJ0A 4ZDWA 2ZE7A 2FEMA 1MA3A 3GHYA 4MMXB 2YRFA 2W83A 2PKRA 4MUGA 1QG4A 5DLEA 5A06A 5K8JB 2CVFA 2CXXA 1CQXA 3M70A 4PHTA 2X2FA 1F2TA 2HHHB 3HSSA 1JHOA 2OCPA 4PO8A 3MT9A 2OCDA