5JHGB

Crystal structure of the complex between the human rhoa and the dh/ph domain of human arhgef11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
178
structure length
178
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA bound with its inhibitor and ARHGEF11
rcsb
source organism Homo sapiens
molecule tags Signaling protein/transcription
molecule keywords Rho guanine nucleotide exchange factor 11
total genus 58
structure length 178
sequence length 178
chains with identical sequence F
ec nomenclature
pdb deposition date 2016-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jhgB00
5TDHA 3TAHA 2WJYA 3ETLA 4MUAA 3K1JA 2R6CA 3KFXA 1ZCBA 4TTPA 4RSGA 1M2OB 3DHWC 3RRNA 2GXAA 2GNOA 4A92A 1X8JA 2XB4A 2ZSAA 2P6RA 5FFMA 1E1QA 1KI9A 2BKUA 3SYLA 5AUPB 4M53A 2PZFA 4A36A 2D06A 2ZR0A 3OEED 1L4UA 3NH6A 5AJWA 2ZJ5A 3U3JA 1KMHB 4R7ZA 1A5TA 4JLPA 4E22A 1XEFA 5J4LA 4PSAA 5GVSA 4XSHA 2Z43A 1Y3AA 1UM8A 1COWA 2GESA 3WNCA 4KAXA 2MMCA 1QHYA 2VQSA 4I1UA 1KI7A 2OESA 2O5VA 4C3ZA 1NVWQ 1AA9A 1L7VC 2ZITA 5L3RA 3EARA 1QHXA 3A1TA 4RKFA 1DAIA 2OFXA 5AJVB 5CIQA 3KQNA 1KK0A 1OXTA 1NRJB 1DADA 3EX7C 2A2ZA 2F1RA 4R98A 1W49A 2GCPA 4Q4HA 3MG9A 5JWHA 5TMPA 5G3YA 4QBFA 3MFYA 1N6KA 2ZRJA 2B8WA 1VKJA 2XAUA 3NKVA 4M1KA 1W48A 4IEEA 4FWIB 1AKYA 2PLFA 5JJLA 2NTYC 3OFND 2XGJA 4NL4H 1KSHA 1KJZA 4OI4A 2A30A 2IUTA 2ZRPA 1ZC4A 3CH4B 3QSYA 4QM6A 1U8AA 4RZ3A 1H65A 1G3UA 3K9HA 1HY3A 1TQ6A 1ZD9A 3OZXA 1KAOA 3Q72A 1YZQA 1G64A 3SJBA 3AB3A 3I73A 3X1ZA 3GFPA 1KI4A 4Q1AA 5KPDA 4C7OB 1ZM9A 4DLXA 4KFRA 1T0HB 3KFVA 3KQUA 3TVTA 1UADA 3SU8A 3UG7A 3SBDA 2OLJA 3PR1A 4IDHA 5DH9A 1LS6A 3P4XA 1XX6A 1SKQA 5AJZA 4BQSA 5C1BA 2W6JD 1DAMA 4WVFA 3CW2A 2WKPA 4GSYA 5FR2A 4TQUS 1EK0A 3B9QA 1Z3IX 3BIFA 3A4NA 2VP9A 2D4HA 3ZVRA 4M9QA 2CVHA 1S3SA 2DFNA 2FN4A 3K09C 4RD0A 1SQ5A 1WCV1 1GAJA 4G5GA 4WXRA 3VAAA 2GTPA 5LBIA 2GA8A 4II7A 1GRRA 1IY2A 1YR6A 1WRBA 1E2QA 1GNRA 2JLZA 4PAQA 5AUNB 1RKBA 3SE0A 1JEEA 1VPLA 2GF9A 1R8QA 2XZPA 3FDIA 2P6NA 2ZRMA 3KX2A 4QGGA 1B23P 2CLDX 1RRGA 3PUVA 4Z8XA 5FI0B 4KITB 4DCTA 2ZUBA 1Z63A 1E9RA 1RPZA 1OJLA 3KB2A 2VEDA 3HU1A 3M6AA 4DXAA 3ZDQA 821PA 1S0UA 3AVVA 4A82A 1XPUA 1U94A 1W5TA 4F4IA 4TLAA 1Z6YA 1GL7A 4DDTA 3TSWA 2FZLA 4O2LA 4NE2A 1S4QA 1RVDA 3QVVA 3CBQA 5CK4A 1E2MA 2ANBA 5DE3A 4DEXA 1UDXA 2JJ8A 1MT0A 1Q1QA 4RD6A 2CK3A 1CLUA 1OB5A 1ZC3A 2IYYA 1U0JA 3KQLA 4Q1BA 5CJ2A 1VCIA 2D2FA 3VR4A 1UKZA 5BWMA 3GJ5A 2JIZD 2E1RA 1BYIA 3BJIC 4TZ0A 2ZAMA 3DPUA 4ZDJA 2BKEA 3HPQA 3IQWA 4JBYA 1E9BA 3I4LA 5L3VA 4XWKA 2W58A 2YOGA 3P27A 1XXHB 4IFEA 3A1VA 1S1CA 1NJFA 2J7KA 3K70B 2GDJA 4B73A 1B0UA 1ZINA 3MJHA 2H16A 3UMFA 1F2TB 3CRQA 4M9SA 2J5XA 1K6MA 4HATA 3Q7PA 5DI9A 4O0MA 1R0WA 1U81A 4IOKA 4W5HA 1KSGA 4OHYA 2RB4A 1G8PA 2Z4SA 3L0OA 5CJPA 4CDGA 5JMTA 1Z0AA 2J87A 1Z0JA 4I1VA 1I2MA 1G8GA 1EX7A 2ZIAA 5DYGA 4NU0A 1N6HA 1FW6A 2EU8A 2EFCB 4TN1A 4GI7A 4LRWA 4DLSA 1FP7A 1N6RA 3QKSA 3MGCA 4P32A 5L3SB 1W4BA 1LNZA 4Q9IA 1VCOA 3P4YA 3W34A 2GEVA 3T35A 4ERNA 3W8RA 2VSXA 2CHQA 1ZBDA 2RGBA 3AGQA 2W83A 4AURA 4X8OA 1I2DA 3EWAA 3GFTA 1O3YA 2BJVA 2OV2A 4LV8B 3AEZA 4C30A 4WA7A 4MRSA 4YMTA 5DSZA 5EE3A 1XCMA 4OJQA 1P5ZB 4D0GA 3WHLA 4DLVA 4Q01A 3W5IA 5CDFE 2BC9A 2HLDA 2DWOA 4PQYA 1AQUA 2Z0MA 3KKQA 4B2PA 5FL7D 1UKVY 4LOAA 5SZJA 1HA3A 4JL6A 4X8HA 2ZRHA 3BC1A 1LS1A 2I3BA 4A4DA 2BOVA 4L8GA 1Z28A 2FSFA 4PXAA 4W7SA 1IM2A 3SHFA 4DSUA 1NBMA 3KJIA 4F4JA 3PUZA 3NTUA 2ODWA 3GLGA 2F1HA 1WDTA 2XNSA 3ZIAD 4F7WA 3C41J 3TW8B 2R44A 2Q21A 4BRWA 1G7SA 3QKRA 3WYGA 3FMPB 2R6FA 1GL9B 1YRBA 4QOSA 4CYMA 2GXUA 3T1TA 3V9PA 3IEVA 3QI2A 1CTQA 2FPMA 3DOEA 4BZXA 4MRRA 2CHVA 1BO6A 1GITA 2R6DA 3NBYC 1JQJC 4C0QC 3PUXA 3V4FA 1S2MA 2GBLA 3CZQA 3HPRA 3MWJA 5JBQA 3EPKA 1XFAA 3KQHA 2PCJA 3FWYA 2IF2A 5LD2C 4RD1A 1KKLA 3Q5EA 4H1VA 3WHKA 1N5LA 2OXCA 3SJCA 1XP8A 2PX3A 3RYTC 4US0R 2ZR7A 2AK3A 1G5PA 4KXFB 1N0WA 2C9YA 1TX4B 3FFAA 4D26A 1G3MA 3SQWA 3KTAB 1OHHA 1FTSA 3KJEA 5CYPA 1Q1BA 4B3FX 1XJQA 4ZCIA 2VPPA 2WPDD 3S1AA 1ZD8A 4FN5A 3AVWA 3VU9A 1AZSC 4EPXA 1XWIA 3QEOA 3RHFA 4AI6A 1DG3A 3SDZA 1TUIA 4BFUA 3THXB 1ELOA 2EWVA 2EW1A 1AZTA 3LQQA 4C0SA 2MSDB 1NVVQ 2OXRA 4C4PA 4MITA 2CCGA 3ZD6A 3A4LA 2F3TA 2X8AA 1BS1A 3QKUA 1GTVA 3CUEF 4KLZA 2GK7A 3FPAA 4EQ6A 3I5XA 4MYTA 2P67A 4JLAA 1LF0A 2VHTA 2IUUA 2YHSA 2DFLA 4OHZA 5C4MA 5KPJA 1JAHA 4G5OA 4C0AC 2CXXA 2Q3MA 2H5EA 3QJYA 2FGKA 2ZRFA 1FQKA 1OSNA 2IXEA 2HV8A 4C0HA 1Z6AA 3SOPA 4EIWA 5JHHB 4GDFA 1PJRA 3THOA 2XXAA 4CF7A 3GEHA 3EA5A 4LK2A 2IHYA 5TB5A 2H1LA 4BZQA 3LVQE 4B3XA 4DHEA 2OBMA 3EZ9A 4PAMA 5IDVA 4XWOA 3MWLA 1TMKA 1U0LA 1W36C 4O2RA 5DYIA 1DOAA 1KMQA 5HZHA 3AGPA 3HWSA 2O52A 1X6VA 4LYFA 1NSFA 2CNWA 4DIEA 1FUUA 5JHGB 1AN0A 2OLKA 2WTUA 1E9FA 2REXB 1H8HA 4ZV4A 4NPHA 4ZKEA 3U4QA 2PZEA 4LCBA 1YR9A 4PFSA 3QF4B 4A8JA 3OAAA 3SN6A 1E94E 4GBMA 4NZYA 2ERYA 4G0NA 1DE0A 3OAAD 1QHNA 3LBNA 3IHWA 5JEEA 3RWOA 3VR5A 1NN5A 3G82C 4V0KA 1G6HA 3PVSA 1YHNA 4Z51A 1GVNB 3RANA 1FNNA 2QTHA 1OXSC 4HAVA 4N1AA 3K9LA 1NN0A 3CWQA 2GJ9A 4Q7JB 1GSIA 3DM5A 2X1VA 3PEWA 3HYTA 1KNQA 4PC6A 3VFDA 2E87A 2G3YA 5LD2B 1J8YF 4O25A 4HLQB 4TMTA 4V0ME 4YXWA 4QJ4A 2XNDA 4QFMA 3T12A 4D4JA 1W0JA 2IEZA 4JLMA 4KSBA 4BFVA 3FE2A 4Z1MD 4RVCA 4MRPA 2B92A 2IWHA 4JLNA 5CLQA 5JWRA 3IPXA 3ZS9A 4OI2A 3ZYCA 3TIFA 5FPSA 5FTJA 2PBRA 3CKLA 2JLXA 4BASA 1N0VC 3B7GA 2GZHA 2KBEA 3EZFA 3N5CA 3K8YA 5JCPA 1GL6A 4ARZA 1MO5A 2VHQA 4Q9LA 5KSOA 3AVXA 5FPTA 1CBUA 4QG7A 3KQKA 1VCNA 2ZI4A 3PEYA 5FTLA 5K8TA 5A0FA 2VHCA 4LJ7A 2NMVA 1HURA 2C96A 1TL7C 2OG2A 2Z5FA 4HB0A 1FP6A 1LTQA 3JVVA 4PPQA 2XSZD 3GPLA 1XF9A 3LH5A 4AIIA 3TK1A 2PMKA 3U7FB 4LJAA 2Q9BA 2P65A 3Q3JB 1BH2A 3GCGA 1XTSA 3D3QA 4ABYA 4PO9A 3QKTA 3BFVA 4A1FA 2RGDA 1GZSA 1QG4A 4B47A 4GOJA 2YOFA 2I1QA 1A1VA 4AKIA 1OF1A 4EPWA 2YC2C 1E4VA 4RKEA 2F7SA 1G7CA 3KL4A 2QPTA 1OIVA 2R8RA 3QNUA 1OB2A 2ZE6A 4XD7A 1LW7A 4KODA 1L2TA 4M0LA 4I4LA 1XJ0A 2V9PA 2DCUA 2DY1A 2D2EA 2RKOA 1KI6B 1UEIA 4CT5A 2QGNA 1E2PA 1G8HA 2BV3A 3L0PA 4D0LB 1K5GA 2WSSA 1GG2A 4IVQA 2BBTA 3K70C 2CL7X 1Z0DA 2ZQ5A 4LV6A 2BBWA 2C77A 3GLIA 1AGRA 5FOWA 2ZI7A 2DHRA 2ZROA 1WQ1R 5G40A 4FMDB 2UZIR 1KI3A 1XDBA 3BD9A 1QHHA 1S1MA 3LV8A 1TF7A 2OBLA 2NPFA 4C2TA 3VNVA 4A0FA 4B32A 2HXYA 1NN3A 6Q21A 2RGNC 4X8LA 1E2NA 2KBFA 3THWA 1VG8A 1Q44A 4M8NE 2W00A 3OF5A 5DN6D 1VMAA 5AK0A 2WIBA 2FH5B 3B2EA 5KDOA 1EESA 5FH9A 1AS2A 1DAHA 2ZJ8A 4LX0A 1DAKA 4KFTA 2FSHA 1M34E 3FKQA 4TQ9A 2J0QA 2NO7A 4KV9A 5JSZB 2BMEA 3THWB 4PPGA 2WWYA 4OYHA 1FMLA 1LVGA 2O8FA 2PCLA 1GDDA 3RRYA 2GKSA 3LX5A 3T1VA 1XJCA 4N0DA 4NMMA 4URVR 1UJ2A 3NIBA 2CCKA 3CRVA 5D3MB 1U2RA 1DPFA 1ZM2A 2J3EA 2N1BA 2CBZA 1VIYA 3B85A 4B75A 2D74A 1YQTA 4HAUA 3KKMA 4BECA 3UMRA 4BZPA 3EPHA 3TKLA 1OH8A 4G3XA 3VR2A 2MSCB 4KFUA 2J41A 1AS0A 2PEZA 3EW9A 3QG5A 3CX6A 5FPYA 5KSYA 2AD5A 1ESMA 3NEJA 2HXSA 5TVKA 4Q7LA 2Y8EA 2R9VA 1N25A 4QXAA 5JLJA 1E2KA 5DN6A 1N5JA 5EP2A 1OH5A 4I99A 1OIXA 1COWD 2RHDA 4G5SA 2FF7A 5FBQB 1KDOA 1G5TA 2PH1A 3K09A 3QF4A 3DM9B 2ZYWX 1RRCA 5E7JA 3MD0A 1KI6A 1R10A 2ZJYA 3C16C 4MGYR 4DDVA 1YE8A 4GMDA 3SZRA 5H68A 1U99A 2X2FA 1F2UA 5EXSA 2BCGY 3GEEA 4HZUB 3I62A 2G6BA 4PZZA 3LBIA 1E1QD 4NP6A 1WMSA 2JLVA 4KBFA 2ZJOA 2CEAA 3ASZA 4HAWA 4DVGA 3L2OB 3WMEA 2F3RA 1J7KA 1RRFA 1NMYA 2VHUA 3ICQB 1II0A 4A0RA 3B6EA 5KSZA 4GRAA 3GD7A 2QL6A 4I1SA 2ORVA 2WJVA 2WZQA 1CR2A 2C03A 1ZAKA 2YWEA 3WMGA 2ZSBA 4XOIA 5CLLA 1KO1A 2FPKA 1G9XA 5JECA 1CXZA 3B5JA 4RZ2A 3DMDA 4UNPA 3GJ0A 2TMKA 4DSNA 1FMJA 2OZEA 1Z8FA 1J2JA 2V7QD 3SJAA 4B2IA 4HUTA 2JDID 3TUIC 2J45A 1OFHA 1G4UR 5B57C 2XTMA 1OFTA 3KKOA 2C5LA 1FUKA 2CE2X 2HF9A 3KDSE 4E03A 2VLIA 2H7VA 1A2BA 4MQBA 1KK2A 4K46A 4GZLA 4JLDA 4KVGA 4Q4LA 1RC8A 2DFKB 1IN7A 3PENA 4OQXA 4URXR 2QP3A 4UNQA 1E99A 4F92B 3K0AB 2QUZA 3T5DA 2W6IA 1QHHB 1E2IA 2FA9A 4AK9A 1OT3A 3EA0A 3LXXA 1N3BA 2EQBA 4B71A 3KKPA 1SXJD 3SHWA 4JSYA 1OYYA 1HTWA 2Q3HA 4JKYA 4PO8A 3U7EB 2IYSA 3F5FA 3QOFA 1W4CA 2QMUA 4AYWA 3GLHB 1MRNA 2EVWX 4ON9A 1IJEA 4XVRA 1H8ED 1M7GA 5FTNA 4M22A 1SXJC 2PLRA 2H17A 3I61A 5EZ5A 4AG5A 2V1UA 4BWYA 3ND8A 4AYXA 3FKSA 1NBMD 4PTLA 4MUBA 1XEXA 3I72A 5JFGA 1SVSA 2QZ4A 2QNRA 2VP6A 5BQ5A 1SKYE 3W9YA 4N3NA 5JS8A 4D25A 3B78A 3FKSD 4TMWA 2OILA 5EE5B 3LLUA 2IYLD 3LW7A 1IN6A 4LSGA 4DLWA 1IOZA 2G9NA 1OXXK 2CL6X 5E4FA 2K5UA 1IJFA 3ND9A 2GXQA 3QIAA 1IN8A 2P5SA 4IDPA 4NDZA 2IW3A 2OT3B 1D9ZA 4UQOA 2QG6A 5H1YA 3IBYA 1OPXA 1W44A 2BEKA 3IQXA 1XTRA 1QF9A 1DG1G 5BXQC 4TYWA 4DRZA 1Z29A 1X3SA 3PG5A 1T91A 2FSGA 3TAUA 1TEXA 4A0GA 5CM8B 3GLGE 2ZJZA 2BMJA 5LPNA 4A9AA 3BB3A 1J99A 2I4IA 1DARA 2JLRA 4BFTA 2JLUA 3HU3A 4MKIA 4DEYA 1CIPA 2PZGA 3IO5A 2ZRIA 4IOJA 1FPMA 1OXVA 3QPUA 2V55B 3J81k 5KHOC 1FFHA 1T3SA 3LD9A 2GETA 2FGJA 3TBKA 3AF4A 3AVOA 3P1JA 2PT5A 2ZSFA 8OHMA 2HEIA 5CK5A 1R2QA 1E96A 4UKDA 2FOLA 4I81A 5FPKA 3U5ZB 4IDNA 4LJ5A 4TMKA 421PA 1G19A 1DAGA 1XCGB 2FFBA 3LFUA 4L4UA 1W4AA 2J0UA 5E3HA 4BLOA 2C78A 3QXJA 1ZP6A 521PA 4IDOA 3OEHA 1MO4A 5KTYA 1GM5A 1NG9A 1YZLA 3A1SA 1ZUIA 2FFQA 5EUQB 5GVRA 1MRSA 2O8DA 4Q02A 3LQRA 1NMZA 4BPBA 4CEHB 5J40A 1AIPA 3ZVNA 4JL5A 4KI0A 5L3SA 1D2NA 1PVOA 2QE7D 1JPNA 3GLHA 2D7DA 2Q6TA 3AVPA 4HAYA 1TU3A 2P5TB 2CE7A 3PITA 4NTZA 1T4GA 3KUCA 4DC9A 4HB2A 4WZBE 2QTVB 2XTZA 3LDAA 1SVWA 4JIMA 4B3CA 1W0JD 2IA5A 1ETUA 2JEOA 3KXIA 4JVSB 4URYR 2HCBA 5EP3A 5ELXA 1Z83A 1J90A 2BJWA 4OQMA 3MUFA 4Y0AA 4KJZA 1BYUA 3TUZC 1CKEA 1VHLA 5K8IA 1U98A 3A6PC 2ZI6A 3WXMA 3MWYW 3L82B 3T1OA 2V8OA 4P4SA 4JLJA 2RGAA 4TLEA 1OLOA 4H9GA 3AH8A 4L15A 1NVUQ 2HJGA 5EE0A 3LNCA 1C9KA 1SVLA 4C0JA 2AR7A 4P31A 1YR8A 2H57A 5IK2D 2AL7A 3D6TB 1G17A 1VG9B 1VYVA 4KLNA 4ITRC 5KDLA 5FUXA 2JCSA 1JPJA 3BS4A 3PUYA 4JJKA 5TARA 3W5JA 3KKNA 1XRJA 4ILEA 1DTSA 2ZR9A 2XITA 2NG1A 3M1IA 2IYQA 1UFQA 1X86B 4B6FA 3P32A 3V4RA 3UG6A 4M21A 1XEXB 4JLBA 2IT1A 4HYYA 1LY1A 4NYMQ 3S1AB 3Q85A 3UKDA 4W5WA 3R9IA 4FCVA 1UPTA 1TU4A 1PLJA 1G8YA 3K70D 3BE4A 1YVDA 3AVTA 1UEJA 2QAJA 4YMSA 2W0SA 3NC1C 3K9NA 1EX6A 3CRMA 1M7HA 5KNDA 3UPUA 2HUPA 2J0VA 3TUJC 2AK2A 4BLQA 4Q21A 4OI1A 3CF0A 4TLDA 4RJLA 4MKHA 3C4JA 1GRNA 1M74A 3VR1A 2J59A 2BMFA 2QBYB 4P4UA 3U3OA 3DVLA 3KTAA 4HLDA 3OEEA 5P21A 3ZQ6A 4BRUA 2GILA 3R7WA 2BEJA 1G1MA 4TSFA 4B33A 2NOAA 2GEUA 5JI3E 4P3YA 3BGWA 3SBEA 2JLYA 4A2PA 1X1RA 1P7CA 3TW4A 2XEXA 2IYTA 1ZM4A 3KJGA 5FBWB 621PA 1IAQA 2RCNA 4ASUA 3IBGA 1OYWA 1KJWA 3QPWA 5KDDA 1P9WA 2BCJQ 2NO1A 2ODEA 4EJSA 1E98A 4JBXA 3RC8A 2QAGA 2AFHE 4F93B 2ZM5A 1SVOA 3W6PA 2ODNA 3EIHA 3RS7A 2OFWA 1BKDR 1VG1A 2ZEJA 1N5IA 4CW7A 2JJ1A 2VA8A 1ZNXA 2B7BA 4GT1A 5B64A 2ZS8A 4JVLA 1XMSA 3C5CA 4V0NA 4B34A 3WNBA 3JZAA 2WWWA 1U90A 3E2IA 4IVRA 2IBMA 3AUYA 3OIUA 5LDDC 4NCKA 4W9MC 4KO8A 2ORIA 3U6KA 5F98A 3GJ4A 4D4MA 3RRMA 3GLIB 1CJMA 5DHFA 1ZD1A 2L0XA 4Q5IA 2AN9A 4Z8YA 3WYFA 2RH5A 4OHWA 3BB4A 3QY0A 1U9IC 5J4YA 1UDWA 5FOXA 2WOOA 1Q20A 2GK6A 3VTKA 1T9HA 1F60A 2FNAA 1GKYA 2YZ2A 2X2EA 4QGHA 1GNPA 2WJJA 2JGNA 1FNMA 1E2GA 2Q9AA 3RS2A 2O8DB 4D4KA 1A82A 5JJIA 1II8A 5LB4A 1IBRA 3A36A 3RRZA 4WZAE 2WIAA 1GFIA 2YV5A 3AP1A 1JR3E 1HEIA 2H92A 1Q21A 1AS3A 3IGFA 4C7OA 3EIQA 3ZH9B 2QU8A 1G21E 1E9EA 2ZE8A 3GJ8A 3GJ6A 4OQLA 1QHGA 1YKSA 2GRJA 1P72A 3L43A 4QKQA 4R2IA 2ZSDA 2ZE7A 4EKDA 1IXSB 3TQCA 5KYKA 1R7RA 3AP3A 2WVJA 1KOFA 3T1QA 4IRUB 1W0KD 4NHOA 1JECA 1WE2A 4ZDWA 4F38A 2YYZA 3MMPA 5C4GB 5AUQA 3JVUA 3CR7A 3NDBB 4CEJA 5JCZA 2AD1A 2ZRBA 4HUQA 4ACBA 4TYPA 1E79D 1KZGB 4AY2A 1CJUC 1J70A 1MOZA 4TWZA 3ZGXA 5GJVC 1UKEA 3HP1A 2WMOB 2IS6A 1DEKA 1G8FA 1E79A 2DYKA 5C2JB 2GJSA 4PX9A 1KO8A 4HDCA 2BMDA 2VO1A 3K0SA 4PPFA 4XSGA 1CR1A 4US2R 4QGFA 2ZUDA 3IHLA 5FUWA 4R2HA 4A6XA 5H70A 4J0QA 4BFSA 2ZJ2A 2A5FA 1T3HA 4LC1A 2XJ9A 3TGPA 2W2XA 4M1YA 2O0JA 2O8FB 2QI9C 4BFWA 4LHVA 5SZIA 2A9KA 3O8BA 1L8QA 3W6OA 4HAXA 3HJNA 3TSOA 2V3CC 4JT4A 3ZVLA 5F3WB 3AP2A 4M4SA 4UXHA 5BN3A 4DWJA 1FX0B 4LBZA 1D8TA 5D3QA 2NO9A 2VP2A 3E70C 5KU1A 1F2UB 5FOSA 2IS2A 1ZNZA 3PCRB 1C4OA 4W5JA 3JZMA 5C18A 5HZKA 2QAGB 1HE8B 2WM9B 4BLPA 3U60B 2NO6A 1TTTA 4QRHA 5FOTA 4BGDA 1Z22A 1Y63A 4XD7D 1XZQA 3GFOA 1H8EA 2IWRA 3I92A 1M1YE 1MABB 4TTQA 1JR3A 4Q00A 3O47A 3RSLA 3DOFA 2ZU6A 1P73A 1VECA 1DO0A 2ZYTX 1IY0A 2AXPA 1KDPA 2GZDA 4LBVA 1KDRA 1XEWY 4B3DA 4U00A 3AQ4A 4CRWB 2BM0A 3WYAA 1VHTA 1FL9A 2GHIA 2VL7A 1P3JA 4FMCB 3TQFA 3IILA 2CJWA 3T61A 2HT1A 1VDZA 4DUGD 2OUKA 3QF7A 2WAYA 1G7RA 4JLOA 4G01B 3I1FA 2PL3A 1Q1ZA 2HF8A 3AKDA 1RZ3A 3RC3A 4YDSA 5JI2E 2G1KA 3CRRA 4DLRA 1KJYA 2I1VB 5EXXA 2YOHA 3K0AA 4CZ2A 1P2UA 1HT2E 4Q47A 3F8TA 4LGMA 5HKKD 3U3KA 4ZPXA 1JNYA 5A4JA 5CIWA 3OE7D 1G3IA 3FMOB 2ZRGA 3IIJA 3DKPA 2IL1A 4LHYA 1SXJE 2DPXA 4AKEA 1ZIOA 2AKAB 2JJ2D 3KZ1E 3ZS8A 1FOEB 4QM7A 2ZXUA 4TYYA 4M1WA 1IONA 4TLCA 3VKWA 4BFYA 3BERA 5FBLB 2Q0HA 3D8BA 4KYIB 4LHZA 1UBCA 1G20E 4FWTA 1JR3D 4Q4HB 1SULA 4LBYA 1II9A 1ZNYA 3CO5A 5HCIA 1I4TD 2R2AA 3AM1A 3QPVA 4URWR 2KSQA 1FZQA 1NL3A 4HZUA 2JATA 2V1XA 1CR4A 2YJTD 3EC1A 4FINA 3BB1A 3B1ZA 1US8A 4M1TA 4U02A 3B1XA 2O8EB 2PJZA 1YU9A 2FE4A 2XOKD 4RD2A 4DSOA 4ZCMA 3G0HA 1YR7A 3EXAA 2XB2A 1XD9A 2LCFA 3T34A 5FOUA 4MGKR 5LB2A 4BEBA 1NKSA 2JAQA 1ESNA 1KNXA 4HDOB 1NIJA 2C9CA 4IOMA 1BMFD 4GP7A 5CB6A 1Z0KA 2FV8A 5DIFA 5HPYB 2ZSEA 4A0HA 3ADCA 3M4YA 1OFUX 3AVQA 1P62B 4FCTA 3LW8A 3NHBA 1RW4A 4C0BA 1JALA 1EXMA 1E0AA 2QEQA 4XVQA 2O0HA 1W36B 5C46F 1QHIA 1S8FA 1XB2A 1OIWA 4TSFD 4L9WA 4GL2A 3ADKA 3LXRA 3F3YA 5EP1A 3U7HB 2WJGA 1XXHE 3NH9A 1DVRA 1XTQA 2D62A 4B43A 4CEHA 1CRPA 2ZRKA 1F2TA 2ORWA 5TXGA 2O8EA 3AF2A 5L3QA 1E32A 1R5NA 4IXNA 4PANA 3CNNA 3U2QA 1OFIA 5FBVB 2WOJA 1TADA 4FIDA 3O8CA 2WV9A 4PQRA 4LJ8A 3EZ6A 4RCZA 4QJ3A 1EFUA 3QKRB 2ZETA 4XWAA 5E95A 4EUNA 2XX3A 4L9SA 3I8SA 5JS7A 1XNJA 4M2LA 5F9HA 1NLYA 3SI7A 1E0KA 2ZREA 1SXJA 3I5YA 2V4ZA 4PC7A 2XJ4A 3B8HA 2EYQA 5SZHB 5DHAA 1US8B 3O8DA 5CM9C 4HI0E 1D9XA 3ZQJA 5EZ6B 4IVPA 3PFIA 3R8CA 1XEWX 4D81A 1Z0IA 1XCPA 1ZIPA 1R4AA 2V7QA 1SXJB 1Z2CA 3AUXA 3H0KA 4BFXA 4BUJA 1Z06A 3BK7A 3NDPA 4HB3A 1Q1EA 1W0KA 2DFTA 4MDEA 3R9XA 2OCYC 1A7JA 3QXHA 5G53C 3IIMA 4KYUA 3NBZC 4V03A 4IEIA 3SS8A 4Q18A 1EWQA 1XD8A 1NKTA 2BBSA 1KO7A 4YC7A 5L3QB 1VYTA 2WAXA 1TPZA 3PEVA 2GVZC 2F55A 2C95A 4JT2A 2XSZA 3NC0C 3RS4A 1CR0A 1RRPA 3KJHA 4UXJA 4EAQA 2F1JA 2VP5A 4G5QA 5HE9A 2FZ4A 4PSKA 4WBSA 1W5SA 3WY9A 3A58B 2RGXA 2VH5R 1ZNWA 1PLKA 1G3QA 3KB1A 1OXUA 4XJXA 1LV7A 4A2QA 3VQTA 4MGZR 2WWHA 4LHWA 5BN5A 4HEJA 4A15A 2IUSA 3L8YA 1VG0B 4PC2A 3V00A 3L8ZA 3EPLA 2NGRA 2RMKA 2VSFA 1D6JA 4EFNA 2P2LA 2ZI3A 3K0FB 3OHMA 4NYIR 3R8FA 4YONB 1XD2A 3GLFA 2PMDA 3HR7A 2OO7A 4Q03A 2CK3D 2CHGA 3HDTA 1XMJA 3WP0A 4TMXA 1CJVC 2UKDA 1DBSA 1N6LA 2J1LA 2G88A 2NIPA 4D0NA 3AVUA 4F4CA 3B13B 4MDFA 4DUGA 5IT5A 5HCNA 4BE7B 2Z6VA 4LPSA 4WZ6A 4P4TA 4EQ6B 1XD2B 2IYRA 2CCJA 2EFGA 5DISB 4AD8A 4Z54A 4D82A 3REGA 3A1WA 3K53A 4UJ5A 4Q48A 2XTNA 5DI3A 2QRZA 2C2HA 1E0JA 2ZANA 4FD2A 2ZRLA 4XVUA 2BM1A 3THYA 1YZTA 1ONBA 3SJZA 1NI3A 3RSOA 1CU1A 5HR5A 2OCBA 4KFSA 3M0EA 2ZI5A 2ZRCA 3CF6R 4TMZA 1ZU4A 4FMBB 1HQYE 1Z0FA 3VKHA 2O0KA 1WA5A 2D7CA 2WMNB 5CB8A 4RD4A 4TYNA 2F1IA 4PZLA 1XTJA 2UZ3A 3VR3A 1AKEA 4CEJB 1YZGA 3SYKA 3UXMA 4JS0A 4TQAA 1QVRA 3MAAC 1S9HA 2DWQA 5AR1A 1W46A 4EPYA 4ZO4A 2GWHA 5J4KA 5CYOA 3GLHE 1OH7A 1M8PA 2REOA 2G0NA 1KKMA 3IUYA 4JMPA 4A8JC 2ZTSA 3U44A 1RYFA 2HT6A 4MKFA 1ZCAA 3C15C 2F6RA 2P6UA 2IYWA 4OK3A 2Q3FA 4Q4AA 2VBCA 1FTNA 1Z6TA 4M1MA 1KI1A 2NQ2C 1AGPA 1SVKA 2QM7A 3C7KA 2EFHB 4P0TA 3X1DA 3SFZA 2AFIE 3WBJA 3K0CC 2QGZA 1KGDA 1JBKA 3ECCA 1SKYB 3H1TA 3L0IB 3A4MA 5DGXA 1RJ9A 2OEPA 2WSSD 3GJXC 4K81B 4US1R 1E2JA 1HT1E 1TF5A 1GOTA 2X19A 2PJRA 3FGNA 2A5YB 4TMVA 5JJKA 2R6AA 3DKVA 1CS4C 3GLFE 3CB4A 1UF9A 3ZZTA 5CITA 1W2GA 1UAAA 1MO6A 2VRWA 1Z2AA 1NBME 4F91B 4XIGS 4RFSB 3CR8A 2OBNA 3DEFA 3DO6A 5KO2A 4JLKA 4L16A 1N6OA 5K8LA 3FOZA 2OCAA 3VX3A 1UKYA 1P2SA 4CT4B 3U4QB 1NP6A 1PLLA 2FX3A 2IC5A 4FI3C 4QHSA 5D3MA 3RAPR 4PAOA 3C8UA 3VX4A 4PHHA 4Q4AB 4EPRA 1R0YA 4DDWA 4LZZA 4C0LA 2WKRA 3NBFA 1Q22A 5IK2A 2CL0X 1T8TA 1EFTA 1XMVA 4X8MA 3THXA 4CVNA 1M6NA 2FSIA 3UWKA 4TZ6A 1G7TA 3GEIA 221PA 4D6PA 4MRVA 3OEHD 4RY2A 2WBLC 4BLRA 2R65A 2YNMA 2DB3A 4DKXA 5J4VA 1SGWA 4PHFA 3ZLJA 2BVNA 3UANA 3CRW1 3WRXC 4Q4JA 3CH5A 4XH9B 2YC4C 1GILA 2J7PA 3RS3A 4JLVA 1GP2A 4L5BA 4C0KA 4DT1B 1DS6A 4GOXA 4ZI2A 3GQBA 1EFHA 3EZ2A 3EPJA 3LLMA 3RVBA 4LJYA 3C14C 1CJTC 1OHHD 3AKYA 4TT3A 2BHRA 3QG1A 5F2EA 3OIWA 1JQLB 4U5XA 1P9RA 2CLCX 3IO3A 2R6GA 4MYHA 3WRYC 2JLWA 4ESHA 1S9DA 1T8UA 4EPTA 4ZDIA 4A8JB 2IF0A 4DIDA 3AF1A 2IHBA 3DDCA 1VYUA 4UNRA 1DAFA 2ANCA 4NCHA 3HR8A 5DI3B 1ZUHA 5BW8A 2OSBA 5EE9A 5M04A 4E5UA 1CJKC 1EFCA 3PUWA 4R71A 1U9IA 2OCPA 2OM2A 2DBYA 2JJ1D 4IOLA 1KY2A 2IYZA 3NWJA 1DAEA 2VYFA 1RJ9B 4M9XA 4RD3A 1E9CA 3W90A 3EIEA 1F5NA 4CEIA 3PV0A 1TAGA 2C04A 2VTKA 1E2EA 1E2LA 2O8BB 2QRNA 1P4SA 1Z08A 3LBHA 4PZYA 5FL7A 4EJSB 2RGNA 4EFMA 1T5IA 1E3MA 2H18A 1ZYUA 3BWDD 3QXSA 4C9BA 1T5LA 1NNEA 1G41A 4KCGA 3ZZ0A 1UBGA 4DB4A 1QHSA 3BXZA 1CULC 3DZ8A 3H86A 3RS0A 1PV4A 2EYUA 4B3GA 1WP9A 4TLBA 1E1RD 1W1WA 3PQCA 3A8TA 4QGAA 5AUOB 2J0SA 4Q4JB 2GCNA 1E1RA 2HCJB 3U44B 1KHTA 1KI8A 2HJVA 2W6JA 5G3ZA 1X1SA 2WWIA 5GJBA 2A78A 3B9PA 4HLCA 4S2EA 2RHMA 4B2LA 1E9SA 2A5JA 2QY9A 3W8NA 1LF5A 3PIRA 4JJZA 1T3LA 4OBEA 2B6HA 4PHGA 3SYNA 1W36D 3UMSA 2ZRNA 4AWXA 2FG5A 1G16A 1IY1A 4DT1A 4H1UA 1TNDA 1P61B 2C98A 4TYQA 3I3SR 1O87A 4KBGA 1G4AE 2QMHA 2AXNA 4JSTA 3L0SA 5GADl 3CF2A 2ZJAA 1I4LD 1QBKC 1TEVA 5JRZA 5KNCA 3B82A 1HUQA 1T6NA 3Q7QA 1EFRD 4E09A 1YJ5A 1OKKD 4EPVA 2LKDA 3MRSA 5G41A 4YLGA 3UK6A 1Z47A 4OJKA 5IHPA 2CDNA 1N5KA 1E6CA 2F43B 3EWSA 2EFEB 5E7IA 2WJHA 2D3WA 3FMIA 1HYQA 5TV2A 1CEEA 1NIPA 2BDTA 3VNUA 5B2ZA 5FR1A 4YQFA 4N0EA 3U7GA 4HUQB 3IEUA 5AJYA 4ZKDA 4BLSA 2QP9X 3BFKA 4CIDA 3I32A 1W47A 4D4LA 3BBPA 2YVUA 5AJXA 3F0TA 3QEJA 4FCWA 1MO3A 2OHFA 1WBDA 2QM8A 4DLTA 2FFAA 2RAPA 1HH4A 4NBSA 2ZUCA 5HKKA 1Z6XA 4QBIA 4LY6A 1A2KC 4LV5B 1AJEA 2VP0A 5H8WA 4QHYA 1MABA 1SVIA 2LWIA 3CPHA 4PC1A 3AKEA 4PQFA 3X1XA 3ZZUA 1TQDA 1CF4A 2JLSA 3GP8A 1WBBA 4TL9A 1F6BA 2QQEA 3AF3A 5UKDA 4AC9A 2YWHA 1ZW6A 3GJ7A 2NZJA 4DLUA 4E07A 1QRAA 5DNYB 4AKGA 5EQTA 4OK5A 4WOPA 2FU5C 1Q12A 3KXKA 2ONKA 1SHZA 2FWRA 4B3BA 1HE1C 1P9NA 3MSXA 4NKRA 4Q7MB 2FPLA 2ZPTX 3ZJYA 2OFOA 3Q5DA 4M9ZA 2W2VA 1VCMA 4MKGA 1ANKA 2F9LA 2WPDA 3CIOA 1MR3F 1KAGA 4QBHA 3WP1B 4GFDA 2QN6A 4MYCA 4PC3A 1UBFA 3P26A 3QVUA 1F3OA 4YMUA 1G5RA 4WXPA 4QBGB 4URUR 4V02A 1IN5A 3IKJA 1JXMA 3E1SA 4G1UC 3LWNA 4JBWA 2ATXA 4I1OA 2QQ0A 3CNLA 4LYJA 3AF0A 2FEMA 1U8YA 5CDFA 4NYJR 2P3SA 2Z83A 5F9FA 1P2VA 2IS1A 4A6PA 1OKKA 4TL8A 1EFRA 1T0JB 3EZ7A 2HLDD 1ZM3A 3CPEA 4LC0A 5BN4A 1JR6A 3QBVA 3EG5A 4AG6A 2J46A 1GNQA 4IJMA 3RNLA 1XTKA 2QTFA 5FTKA 4ZIRB 1QVAA 4LPKA 2H8KA 1XPOA 3ZD7A 1KO4A 3TLXA 1QG2A 3ADBA 2REBA 4MRNA 4Q1EA 3VKGA 2CNWD 3ASYA 1K5DA 1SHKA 1XBTA 2LKCA 3GLFB 3PJRA 1Z07A 2HYIC 4HSEA 4JVNA 4B48A 3SR0A 1W4RA 3KUDA 3G5UA 5FPHA 1E69A 2OE2A 4DLYA 1E2DA 1RYHA 4ACAA 2AWNA 2QPAA 2QMOA 3QXCA 1F48A 2PEYA 2YWGA 3EC2A 3VHLB 2DR3A 2JASA 2VIIA 3QXXA 2XZLA 2ZVQX 2O8CB 4HLUC 4V0MA 3TR5A 3UIEA 1V5WA 1XZPA 2BIFA 4GP6A 1II8B 1G291 3WBKA 2FDCA 5EUMA 1XTIA 4NH0A 4DCVA 2KE5A 2QENA 2WHXA 2XOKA 1N6IA 2A7QA 2QA5A 3CPJB 3OIVA 3K0EA 4WW0A 1N6NA 2GAAA 4Q19A 1N0UA 1G3RA 4LYAA 3A37A 2FFHA 3FHCB 4IFBA 4G5RA 2KWIA 4BEJA 3FHOA 1BMFA 3IPYA 5HE8A 2AHOA 4Q7KA 2ECKA 1R0XA 4HDQB 1HV8A 5DLQC 2GBLC 1FX0A 2IXFA 1Q3TA 2AX4A 1P2TA 3NBXX 4QL3A 4UXIA 4DDUA 1VIAA 3TMKA 4URZR 4Q66C 3QQ5A 3BFXA 3LA6A 2WSMA 1QZXA 1RIFA 1IHUA 2QE7A 4B44A 3LY5A 4D80A 4MGIR 4KSCA 1D2MA 4EFLA 2VF8A 3AVYA 4Y0VA 2ZU0C 1YZKA 2E9SA 4O3MA 4EJSC 1NJGA 2QAGC 5FOVA 2IYVA 3CONA 2KB0A 4HAZA 4WIAA 3B1YA 121PA 1JJVA 3FVQA 4LHXA 4P4SB 5KNBA 1KI2A 1P60A 2ASEA 4QHTA 5IRCD 5E7MA 4YXWD 3SQXA 1RE0A 2G0TA 2N46A 4GPTA 1OE0A 3MCAA 4OQFA 3CWZA 2YKGA 4XTRA 2IS4A 1ODFA 3LAWA 4LI0A 3B60A 5JRJA 1KSFX 1KZ7B 2ZVPX 2Z4RA 3W3AA 4IHQA 4UNNA 1AK2A 4Q9JA 3RS5A 1MKYA 4V0LA 1R5BA 1GWNA 2F9MA 4C2UA 1A4RA 1GKUB 3A1UA 4LYHA 2V54A 3QKSB 1SZPA 2O8CA 3N2IA 2DWPA 2J0UB 3IDQA 5EE1A 3TJZA 2XZOA 1I4DD 1PUJA 4DB2A 3GLGB 2B8TA 3B1WA 3LRPA 3WMFA 1ZJ6A 3BAFA 2G77B 2QP4A 4Q9KA 2QPOA 3CM0A 2JA1A 3T5GA 1GUAA 1R5OA 4RZXA 3GJ3A 2G83A 3VMFA 4B6EA 3REFA 1WB9A 4MA4A 3P20A 1IXRC 1MV5A 4ZDKA 2ZYVX 1IQPA 4FW9A 4POAA 1WXQA 1XXHA 4FMDF 1QDEA 1M7BA 2X77A 4RFVA 3K0CA 4KHZA 4LWZA 4GOKA 2ZAOA 2QORA 3RWMB 3FFBA 1KSJA 2GJAA 4QNMA 3N70A 3OFNA 2MMGA 1P75A 2GJ8A 1G18A 4IKEA 3I8XA 5JWOA 2WKQA 3PEUA 3TNFA 3U6BA 1FQJA 1VTKA 1NSTA 3R20A 1EGAA 1W2HA 3BRWD 5B30A 4DSTA 3D31A 1NVVR 1ZRHA 2ONJA 4NCIA 1Z6GA 1G6OA 2QSZA 4UNSA 3DL0A 2HYDA 5EJEA 3OESA 4D2IA 3U61B 1RFLA 1Z5ZA 2AKYA 2IX3A 4Q9HA 1KK3A 2ZRDA 721PA 3CX8A 2QT0A 1E9AA 3RLFA 2EWWA 3QENA 2IYUA 1CRQA 3W3ZB 3LX8A 2NPIA 1BOFA 4IDQA 3VU9B 4A2WA 4ZI3A 5A5GA 2C8VA 1NG1A 2AWOA 1J8MF 1GRQA 2C99A 2VHJA 3SC3A 4EDHA 4B35A 1L4YA 2W6ID 4P33A 2V6JA 1P6XA 2ZS9A 4JYBA 3THYB 4NYIQ 2GXSA 1ZM7A 3W6NA 2P0EA 5J47A 2PT7A 1ZMXA 2A5DA 1JEDA 2FJUA 2VSOA 3K0FA 3ADDA 3X2SA 2PX0A 1MH1A 5J5CA 3TSZA 1DELA 1NF3A 1E9DA 2OAP1 3KXLA 2RGEA 4PO1A 5AWFC 5SZKB 1NVXQ 4HLUA 4WAUA 1JI0A 4YDHB 3AV0B 3OIYA 2J7PD 4LDJA 2JIZA 3TE6A 2QBYA 4OL0A 1E0SA 1Q57A 1TQ4A 4OK6A 4NYMR 3T06B 4CEIB 1AQYA 4GMXA 5ANRB 3X1YA 4FMCF 3CLVA 1WF3A 3TVDA 1CP2A 1X8LA 3NG1A 3SFVA 4ASUD 1JXOA 2ATVA 2QT1A 1LFDB 2IEYA 2ZE5A 5JSZA 2WICA 3CX7A 2C9OA 4OQNA 2CMKA 2VF7A 2IK8A 2KI5A 2JJ2A 4QC2A 2W0MA 4DCUA 3IIKA 1OH6A 1IXZA 3N2EA 5KSPA 2B7CA 4QJ5A 4JYCA 1U0HC 4K8OA 1R8SA 4YMVA 2XNDD 3EAQA 3H4MA 1JJ7A 4JZKA 3X1WA 4B74A 3FYHA 4IXMA 1SVMA 1PUIA 2G1JA 4LUCA 4OHXA 4V0OA 3T15A 1YZUA 1D2EA 3CNOA 2IXGA 3NXSA 4DCNA 1NLFA 1JB1A 1NMXA 4YMWA 5K8UA 4LBWA 4KVAA 4DCSA 2GVDC 1KDTA 4XTCS 4NONA 4QNRA 3FHTA 1UBEA 2R62A 5JEDA 1D5CA 2ZS7A 5FI1B 3NVAA 3QUSA 5GJWC 5L8VA 3TR0A 3D7MA 4TL7A 3BH0A 4RCYA 3R7WB 4MH0R 4S35A 4OI0A 1PZNA 1NLZA 2CLSA 2RGGA 2NO0A 3BH6A 2BBOA 2RGCA 2W2TA 3H84A 1C1YA 4HB4A 3CZPA 4TTRA 2IYXA 1TUEA 1GKIA 4DJTA 3O8RA 3GLIE 1KIMA 3C5HA 2KJQA 1DO2A 2WWFA 1LB1B 3HYRA 4CGZA 3VR6A 1R6BX 2NZ8A 3LO5A 3MJRA 4B76A 4RFSA 3TH5A 3UATA 3ZIAA 2WJIA 3PXGA 2EFDB 1S96A 2ZYUX 2UVQA 3ZVMA 1S3GA 3VHXA 5KUTA 3Q8XB 4Q1CA 1Q3HA 4NYJQ 2Q9CA 4AYTA 4U7DA 4NCNA 1GIAA 2BWJA 2F43A 2GCOA 3BOSA 4PPNA 1YRAA 4ARZB 3MWKA 2V6IA 3ONWA 2XXAB 1YZNA 2N42A 1XMIA 1E4YA 3E5HA 3H2YA 3SNHA 4OHVA 4AKHA 3QE0A 4DLZA 3Q9LA 1XU4A 3AKCA 2QROA 1AM4D 5EP4A 1KO5A 2JLQA 3BORA 4OKSA 3ICEA 1V43A 1KTVA 2ODBA 2YINC 3NHAA 1U8ZA 3HU2A 3SEAA 1NN1A 3FTQA 1KMHA 3FB4A 1TQ2A 2GJKA 1K8RA 5FUYA 1NY5A 1H8HD 2WWGA 4Q1DA 5EXTA 3B1VA 4JVMA 2ZI9A 2QMEA 4LJ9A 1JAIA 1NY6A 2VP4A 5B58C 3EASA 2OAQ1 2A5GA 2GAOA 4ESVA 5IF9A 2A3RA 5KOYA 4BLTA 1EG7A 4NCJA 3GMTA 4TL6A 4GNKA 4R9UC 4DZZA 2SHKA 4TT3D 2GZAA 3RABA 2GF0A 5FUVA 3TRFA 5HTKA 4KU4A 3DMNA 2WWXA 5FBRB 1E2FA 2ZJBA 4UJ3A 5FL3A 5EXPA 1HQCA 3WNDA 2B21A 3OE7A 2FMXA 1R0ZA 4LJ4A 5BYJA 2QSYA 3MLEA 1IN4A 1BIFA 1Q0UA 4M1OA 3U3MA 3K9GA 4DBLC 5JZVA 2MSEB 1XPRA 3U3RA 3R9WA 1N2CE 4IW3B 2GCOB 4FXPA 1TF2A 1KYIA 1ZVQA 4HZIA 1EWRA 4PR0A 5FTMA 1OV4A 1N6PA 2YWFA 2JDIA 2CVFA 4ZCLA 4JKIA 4JL8A 5BYKA 4Z1MA 1ZU5A 4MYUA 3LVRE 3QBTA 1X8KA 1ZUNB 2FEOA 2O8BA 2GEDA 1KY3A 2ZRAA 3NEYA 4LJ6A 1OW3B 1E2HA 2CJWB 4BFZA 4GZMA 5DO9A 5GJCA 1KK1A 3UWOA 4M1SA 4RZUA 4ZIRA 3FMFA 3DZDA 4Q1FA 3BH7A 4PHTA 5J4HA 3RDPA 5TY0A 1W7AA 4PSVA 2J9RA 2HDNB 2ERXA
chains in the Genus database with same CATH superfamily
1G8SA 1PJLA 3C6ZA 3IQDB 5LR6A 4K0RA 1AU9A 1TB4A 2R6CA 3KFXA 2X1HA 1ZCBA 4HX9A 5JMPA 1E62A 2E85A 2OQRA 3LRTA 3L7AA 4JC4A 5FBZA 5F9MA 3RRNA 9GPBA 1XL1A 4ALIA 4W1QA 4J90A 5DHTA 2JZCA 1KI9A 4UCXA 4BQIA 3SF8A 2BKUA 1I7QB 1PYOA 3L06A 4WGGA 1XDZA 1OX5A 2H4YA 2VNKA 3O4JA 5TGZA 2PZFA 4X54A 4EGAA 2D06A 2ZR0A 3TYXA 2I6QA 1L4UA 3EDMA 5AJWA 2Q41A 2ZJ5A 3U3JA 4E22A 5J4LA 1QH9A 4ZALA 5GVSA 4AWAA 2MYTA 2Z43A 3MXTA 3BTOA 1OREA 3GVHA 1FFBA 1LU9A 4DXDA 5FWDA 1UM8A 5EWLA 1COWA 3U4CA 3WNCA 1EHIA 4OLHA 4UARA 3ZY2A 4IG4A 5BR7A 2IEGA 5F35A 3TSYA 2O5VA 3VTFA 3UT5A 5IBCA 4B3MB 3EC7A 3HB7A 4M9UA 5B6IA 3MJ4A 1OFGA 1QHXA 1RKVA 1O57A 4JR2A 1BROA 1DAIA 2OFXA 2QJTA 4YJHB 1EM8B 1BGVA 5CIQA 5B3LA 3IFSA 5TT0A 1NRJB 2VJDA 1LBHA 1FXSA 1K88A 1DADA 2WF9A 3RG2A 4AKTA 2BISA 2F1RA 4AP5A 2GCPA 4Q4HA 1GA1A 3ZHRA 2QRGA 4YAIA 4QBFA 1AO0A 1N6KA 4YP9A 5I9IA 5K4GA 1QYCA 4K26A 4RKWA 3HL4A 3ROPA 1DBWA 3P9NA 2NUPB 3G0BA 5K3BA 3WGJA 4EHBA 5JJLA 1UPXA 1J8DA 4NABA 4TV9B 3UUWA 4FB5A 4YT8A 4OKIA 5AJHA 3HG7A 3VR5D 4HVCA 3C1TA 2UUCB 4D98A 2A88A 1M5UA 4OI4A 1QIMA 2A30A 5IVDA 4EVRA 3F5SA 4LZAA 4LWQA 4QM6A 2FRDC 2J31A 2Z1MA 4NDNE 3K9HA 3PGKA 5AKYA 1WXIA 2E4AA 3KB6A 3OZXA 1YZQA 3X1ZA 1ZOLA 2XWPA 3I73A 4PGGA 4TS1A 5KPDA 3ZTWA 5C8YB 3NIFB 2C4KA 2VHXA 3F47A 3TVTA 1VDMA 1N2CB 1UADA 1L7DA 3UG7A 4F8YA 2HJ9A 2R8XA 4RA9A 3P4XA 1VL2A 1SKQA 4JB2A 5DJ5A 4BQSA 1Y98A 4D57A 2IHNA 3GAMA 4BRZA 5T3YA 1UP7A 2WKPA 5D6OA 1CY1A 4NH4A 3O2SB 3B9QA 1Z3IX 3B1JA 3K7EA 2RG7A 1ACMA 2DT5A 5FPQA 5DGTA 4GWLA 5FLYA 5C5DA 2D4HA 2O6HA 4M9QA 2H9AA 5AMXA 5WRFA 1S3SA 2NM0A 3CKYA 4RD0A 3IQZA 1PGJA 3ZVKA 1X14A 1JFSA 2VBIA 2FVYA 4WXRA 3VAAA 2EX1A 4A23A 4XJVA 2DUNA 3PDIA 1LBEA 1YUNA 1GRRA 1VLLA 1JE1A 1VJTA 2ACVA 2CWDA 4EHIA 1E2QA 3HI6A 3ZN2A 5IC5A 5AUNB 1XNQB 4CV0A 2Q4OA 1WZIA 4EZBA 1ND6A 2X5XA 4JB8A 1EE1A 5ICGA 3I0ZA 2CLDX 4DR6B 3R74A 1F0NA 4Z8XA 1T9DA 4EW6A 1ZL0A 2QSUA 1CJSA 1RPZA 5H59A 2P9YA 3ZDQA 2YQZA 4NBKA 4QTTB 4BNVA 4X6YA 5JW6A 4F4IA 5A71A 1GL7A 2AG0A 4DDTA 3FA2A 5K3SA 1Z5UA 4O4JB 5EKTA 4S05A 4BNFA 3BMCA 1VM6A 1Z5VA 2VATA 1Z17A 3VPSA 2XQGA 1E2MA 2ANBA 3IE1A 2JJ8A 4JA0A 1Q1QA 1FDIA 1PFUA 1CLUA 2CK3A 2GVNA 4KMRA 5ER9A 1ZC3A 2R1VB 1X1DA 1OX4B 1U0JA 3AIOA 4QX6A 1VCIA 4WZAA 3UHJA 4GPIB 1K08A 1XLTC 1UBUS 1XTBA 2H1HA 2OV4A 4LXYA 3ASUA 3N74A 5FWXB 2XGOA 2B5VA 4IJ6A 1B2LA 1RBZA 2ZAMA 2WM8A 1ZVJA 2RDMA 3HPQA 3Q15C 1Y80A 2ZT7A 3VC2A 3Q1KA 4RMNA 4UBMA 5CB4B 5THXA 2NSYA 3I4LA 3KQSA 5L3VA 2NN3C 2RARA 4FFWA 3ZK7A 4Z5XA 2O0MA 4D4HA 4DY4A 3RROA 3KKKA 1JQDA 3P9QA 3RVRA 2BGNA 1NJFA 2C9ZA 2NVOA 3HVIA 4B73A 1U1DA 4R83A 4DIKA 5AW8A 3L8EA 3PB3A 4MV4A 4E5YA 1ZINA 2PL9A 1F2TB 2OBBA 3CRQA 4XCQA 1P44A 3I5UA 1V9SA 1R0WA 1U81A 1XZHA 1XZMA 4IZHA 4O0MA 4W5HA 1UQUA 4B4VA 4BUZA 4OHYA 1G8PA 1ZWLA 3BSWA 2PD4A 2XGGA 4BO7A 4B9EA 1JSLA 3ZDCA 1D5WA 1X7WA 4H4EA 4R0VA 3BXFA 4I1VA 1ZQ1A 4O4HF 4OUDB 4U0KA 2O2CA 3ZY5A 3GNTA 2WU0A 1T43A 3BX1A 2WYVA 4NU0A 4EW2A 1N6HA 1OWPA 1DC6A 1FW6A 2PUBA 3DNMA 5FBKA 3OH8A 3AJAA 4LVNA 3IOYA 4A03A 3RJ5A 1KORA 4P7KA 1Q0SA 3BSYA 3KQMA 3QKSA 2A9RA 3GDHA 3O94A 3VDMA 3WGKA 4GOND 2ENUA 4FFBA 1KFCB 1W2WB 1OYVA 4UUNA 5E8RA 5BV1A 3AYZB 4G5YA 3FHLA 3SQDA 5INTA 1H2WA 2ZDQA 1LNZA 4OJMX 4Q0MA 3RQIA 5C8ZA 2BRUC 2O3QA 4PO3X 1LA2A 2H0RA 2VSXA 2XNCA 3QLEA 3E0XA 4ERNA 2OHXA 2E4XA 3AGQA 1N2ZA 4K6KA 1TI7A 4DSUA 4X8OA 1I2DA 3GFTA 5A5VA 4Z9FA 3V8EA 1D7OA 1O3YA 4PYLA 3JVEA 2F1OA 1NV9A 4XGRA 4ZU1X 4KUHA 1CZLA 4F6CA 5H9WA 1DWQA 2O3SA 4I5FA 4WA7A 2I2XB 2O1SA 4YMTA 1KOGA 1XCMA 4EG1A 3HNOA 3T52A 4WUVA 1N4DA 4Q01A 4INOA 2J4DA 1A9OA 2BC9A 3JQAB 4L28A 1QB7A 1XZJA 1QMPA 3GFBA 3KU1A 5BSGA 2Z09A 4P38A 2Z0MA 4ROTA 4QDKA 3U13A 4B2PA 4UEKA 3OA0A 1H6DA 4OXYA 4I36A 5JASA 5HVNA 4OQEA 3CX3A 3ODGA 3A6JA 3MLBA 1MC8A 4A4DA 4Z4QA 3ZS8A 4JJIA 4L8GA 3SHFA 2VAMA 4AUNA 5K3OA 1IM2A 4HYQA 1W1UA 1F7VA 1SEVA 1KA9H 1EP2B 5KVSA 3KJIA 3PL5A 5LKAA 5IAGA 2Q62A 3P0IA 5DLPA 4J4TA 3R6TA 1N9ZA 4UATA 3STHA 4GXNA 5BW4A 2R8EA 3HBLA 3ZIAD 4NE9A 4OIFA 3TW8B 1BWSA 2Q21A 4KIWA 4BRWA 3WYGA 2Q29A 3RT1A 3NHYA 4G89A 3V8NA 4DSAA 1DQRA 1GL9B 1RACA 3O3CA 4QOSA 1M1NA 1A4XA 4YBRA 3IEVA 3L7BA 1AKMA 1U3TA 2YXEA 3QI2A 2RH9B 4MW1A 2Y1KA 2FR1A 4NAVA 1MLDA 2R4UA 3B6JA 1UBMS 1CNEA 4MRRA 1KVSA 4NK4A 2IEDA 3C3MA 3NBYC 4NFLA 4DA0A 2W6PA 3PUXA 1BX3A 3EXFA 3ZCTA 2PSEA 3EEIA 1RWPA 5D5QA 1FDWA 4GGMX 4MA5A 1XRSB 1ZY2A 1V7CA 4YJ2F 1AG9A 1LJLA 4DMHA 1YFKA 1XHFA 2ZYGA 3R5XA 1ZSYA 3Q6NA 2OKGA 4IEFB 1CRZA 1NF2A 4QWWA 3BHMA 1M6EX 3BD7A 3W5AA 1MAWA 2PX3A 2WYHA 2W5UA 4HRAA 2HU8A 1HZJA 3RYTC 1QIIA 4PNPA 1XRNA 4LDAA 3S70A 3I2HA 3OZ7A 4WKOA 4KXFB 4U2DA 4ZI7F 3PFNA 1TX4B 2HLHA 1K89A 3QZUA 1JAYA 1I30A 5LYJB 3UJ3X 1R4MA 3A28A 2VPPA 4IPTA 1NW4A 3V8MA 2VXCA 5IF3A 3WLNA 1PR4A 1WXGA 4PZCA 3KOUA 3PHIA 4DJEC 3QEOA 1ZLYA 3UGQA 1NZDA 4CLRB 1VSTA 4J16C 2QUAA 3SDZA 3I05A 4MV3A 5TT1A 4BFUA 4DV2B 2L82A 3T3IA 1ELOA 1T4CB 1FNSA 2EW1A 1AZTA 4UEOA 4WERA 3C3KA 2MSDB 3S8EA 5EVCA 4M87A 4MITA 3U40A 3F67A 2IYPA 1C9EA 1GZVA 3E9QA 4I4IA 3GEDA 2X8AA 5K20A 1BS1A 1TVEA 3GEMA 1XDWA 1ZRSA 2AZDA 1GL3A 4M7WA 4EQ6A 3LXUX 3D6MA 5EIBD 3GFSA 4HQFA 5KYVA 3U80A 1C30B 2A35A 3LLSA 4H31A 2R1TB 4Q24A 1TK9A 3I9NA 1LF0A 4ZQGA 2IUUA 5JS2A 3U3XA 1MZPA 4OHZA 3AO0B 1T5OA 4G5OA 3HDQA 2GCIA 4KXXA 1Q77A 2O54A 4HAIA 2IXEA 2HV8A 3KT3A 4GDFA 4EIWA 3FF4A 1XSEA 3NJRA 4HX2A 1EQAA 1FEZA 4RTPA 3DE4X 4F04A 2ORED 1XKXA 3KELA 2DKFA 2H1LA 1D4OA 1MIOB 4RSMA 3UMCA 3D3EA 3PNOA 3EZ9A 4XWOA 2PUWA 1JIJA 2X4IA 1TMKA 2FEXA 3DT8A 1WPXA 3MWDA 3R7DA 3WMRA 1HM5A 1ZMOA 5HZHA 4ZI7A 5EJ6A 2O2DA 2EL9A 2XMZA 2E48A 1O1YA 2O52A 3NHWA 4R4JA 4U00A 5HP4A 3OZVA 3ORRA 2X7JA 4MEAA 1TTHA 3PTZA 4MV7A 4FYXA 4EOGA 1RYEA 2IYNA 1WF6A 2H6EA 2ESRA 3CNBA 1K7SN 3PRJA 3S8MA 3TS1A 4ZV4A 2VK4A 2YZNA 4L9AA 1KFJB 2CMDA 2IZOA 3BIWA 3JAWA 3PFWO 4ZK2A 2PY6A 3AUFA 2OBXA 4R69A 3HVRA 4A8JA 1E94E 4GBMA 1JQEA 5MFZA 3TWOA 5I9LA 1Z6ZA 3QGMA 4G0NA 2OHHA 3VV2A 1V71A 3OJEA 3PUJA 3LBNA 2DUMA 3P97A 5JEEA 3A06A 3NBUA 3ER9A 2RAUA 4BMXA 3I01A 5DEIA 2V4UA 3PVSA 3KZKA 1YHNA 4Z51A 2JI7A 4Y1FA 4IGEA 5KTKA 4J75A 4MQ4A 2BKXA 4FX2A 1MZVA 1XDDA 4MWTA 4DEVA 1OXSC 1W88A 4EKYA 1T4DA 1UP4A 1U8TA 1NN0A 4NS1A 4P1ZA 1N75A 3BL6A 2VPYA 4UM5A 2IUFA 2P30A 3MLAA 1B8OA 3TMYA 2X1VA 5D6NA 4EO7A 3SJ7A 3QPBA 4OAPA 1XMQB 3VFDA 2AN1A 3QWIA 2E87A 4EGSA 4L57A 4YXWA 3ZLTA 4QJ4A 3IP6A 3T0GA 3ZU2A 1ZJJA 2A67A 3IA2A 4JR1A 2BUBA 3ROTA 3JSAA 1RLIA 4C29A 4WFJA 3EEYA 3IPAA 4JLNA 2QHXA 4XR9A 5CGZA 1KQFA 2WKWA 3PXAA 3EFOB 5JWRA 2JVKA 3IPXA 1O9BA 3K94A 3OMXA 4EA9A 3VJRA 1JLSA 2XUGA 3TIFA 1CRWG 5FPSA 2VHVA 1JDZA 2PBRA 1LLUA 1XZDA 3FPBA 3O38A 4K9NA 4L0QA 1EBUA 5JH7A 3RKRA 4ESEA 5KSOA 4Q9LA 2H3HA 1LBSA 3I6ZA 4QG7A 1VCNA 1Z74A 4AO7A 4L7QA 4BJ3A 4BVBA 4XJTA 4F3YA 3ERCA 3O3NB 4YQZA 2VHCA 4U8HA 4LJ7A 3MT7A 1HURA 1DFHA 1O95A 4FNOA 2Z5FA 4GM4A 2CJPA 4OQYA 4ZAVA 1FP6A 3G6WA 1NQXA 3JVVA 3B8EA 3IR5A 3OZEA 1EK1A 4FHZA 1IPEA 2JCVA 4AIIA 4DR7B 4CN8A 3U7FB 2Q9BA 3RBAA 2GZ3A 4JEHA 4NZOA 1GSOA 1I80A 1K5HA 3GCGA 3V2GA 4LF7B 3JALB 1AZWA 4ER7A 5LNK6 4UNIA 4ABYA 5IUNC 2XUDA 1XHEA 1IG0A 2BGKA 3QKTA 1RJGA 1GA4A 2I1QA 1A1VA 1G38A 4RVFA 2YC2C 1E4VA 3M6IA 4CNQA 1HC7A 4RAOA 2F7SA 1ZGHA 3EEFA 1QC5A 2QPTA 4RZSA 1OIVA 2R8RA 3QNUA 4S12A 4TX1A 4XRRA 1UKCA 3TDKA 3O4IA 4H08A 4O8CA 1OB2A 1XAIA 2HPZA 2ZE6A 3AJ9A 3ES9A 1LW7A 3LJKA 4KODA 3B9RA 3ZIUA 2R5NA 1KEWA 5T7BA 2I71A 1JWBB 4TLLB 1XJ0A 3ZCXA 4JQYA 5LN1A 4DV3B 5I7WA 3GRCA 1GNTA 2WVAA 4HGQA 2QGNA 5FV7A 3OM1A 2VK8A 5DB4A 3RIHA 4D0LB 2WSSA 4MW7A 2BBTA 3I9V1 2CL7X 3EULA 4MLPA 3OTOB 2WG1A 1ADJA 1QH1A 3HCWA 3QX9A 4ID3A 2ZUFA 5AKZA 5L95A 4G09A 5KU7A 5FOWA 2HAEA 5DW0A 3K4QA 3TCNA 3TNJA 2R87A 5G40A 1I6MA 4C5BA 4FMDB 4XUGB 4YJFA 4XDYA 1S1MA 1SUPA 2FLWA 2RIPA 4TSKA 4WZBB 4C2TA 1NN3A 2P5YA 5DTJA 6Q21A 5FWYA 3CKKA 4X8LA 5AKXA 1J5PA 3O6VA 2NU8B 3DB1A 2Q4EA 2KBFA 4CM5A 1IWOA 3PNPA 4KDFA 3IUNA 4M8NE 2I33A 1T8WA 4GLBA 3PTLA 1VMAA 1KE2A 4CM9A 2G25A 1GZ6A 4K0KB 1BCRB 1K06A 2FH5B 1ECJA 3DBLA 4XUCA 2IE8A 4QGBA 5CNJA 2CV1A 5AVJA 1IOVA 2J5RA 2HWKA 4QOHA 2H2DA 5TE9A 2WHQA 2C5GA 3PNBA 4RENA 2FK8A 2EAUA 2JGDA 4MI1A 1GTL1 4DWWA 2J0QA 3P2IA 4O59O 1LCIA 3THWB 1T15A 2Q4RA 2C20A 4KXVA 4PPGA 3O2QB 4DHWA 2WWYA 2BW0A 3HCPA 3GQBB 4EYSA 1LVGA 3PF9A 2PCLA 5A4FS 3NWBA 5CVUA 3OMWA 3LSTA 3O8QB 5B7GA 5K0BA 1PIWA 1A8QA 1XJCA 2CXSA 4H6VA 4P5PA 3WNQA 1UJ2A 4ZZ1A 1J20A 2QE6A 4DC0A 1GZ7A 1DPFA 1U2RA 2J67A 3I30X 2J3EA 4NZMA 4E1VA 4XLLA 3STWA 5ADWA 3TFWA 5GV7A 2D74A 1ODSA 1GQRA 3LKDA 1JEAA 4HAUA 1GGVA 3JV7A 2VQDA 3EGXB 3TLZA 1VP3A 3DMHA 4BU0A 2DMRA 4HAOA 1L7EA 4L7VA 3WGTA 1ZXLA 1TIPA 3PVCA 4OJNA 3ZZNA 2J41A 1AS0A 2JKVA 4I50A 3ZHTA 3ENNA 3LVBA 1ESMA 2ONZA 3FCCA 3NEJA 3VJMA 2VZ9A 1UR5A 3NAMA 3O9VA 2Q07A 4B85A 2P4QA 1S3IA 4HYTA 5IMSA 3PT9A 3EJ6A 3H5OA 5FDFA 1SHJA 3UWSA 1N5JA 4RY0A 3NOVA 3WKDA 4I99A 2P6OA 1COWD 2HSWA 2CD9A 1TJYA 3H1GA 4HXYA 2W42A 4KR3A 3JASB 2PH1A 3DM9B 4QEDA 3KRTA 4YUAA 3MD0A 1KI6A 4R1PA 4DDVA 5D1HA 4L22A 4MWBA 4D3XA 4LN1A 5DNAA 5I01A 1M54A 4QUEA 3H5TA 1JV2B 3FNBA 3I1YA 4KBFA 2CEAA 1PJAA 1NMQA 3CVJA 4J4BA 4UTOA 2JIMA 3SKVA 2Y1FA 2WNHA 4LVCA 3WMEA 1J7KA 1RRFA 1USGA 4U0JA 3L6OO 3Q11A 2ECFA 4DQLA 5KSZA 3DTVB 3B6EA 2PS3A 3FMGA 5DXAA 1UBSB 2FR8C 2WUEA 3BF7A 3I0NA 4GRAA 1Y4DE 2GPYA 2QL6A 2E6KA 4I1SA 2ORVA 2WZQA 3RIGA 3TXYA 1PUXA 1CR2A 2C03A 1E7YA 2NV2B 2W22A 1E8NA 1ST2A 2QRJA 4YV0A 1RCUA 1FTYA 1N8TA 3AU8A 5FYQA 5IWCA 1KO1A 2FPKA 2XOXA 3VDXA 3B5JA 4RZ2A 4G97A 5J3JA 3UK1A 3GJ0A 1A7UA 3VC7A 1XDUA 3G2JA 3TLCA 1J24A 1M0WA 4MAFA 4ERXA 7AT1A 1FYFA 4IO1A 4QEKA 4AFNA 1EUYA 3WSVA 4LF4B 1KAMA 1OX4A 2JIQA 3CU5A 4J1TC 1CDOA 2V7QD 4CU5A 1HSOA 2PKQP 1ISRA 1KVUA 3MRVA 3G3EA 4BBJA 2O2EA 1OFHA 3P0RA 3VR4D 3KKOA 2H54A 2HF9A 4UHCA 1L9KA 1LNSA 4P22A 4Z0NA 5SYAA 4NJEA 3HKDB 3UBTA 5EJMA 3UMMA 4KN5A 5KVQA 1WMBA 2QP3A 4JCOA 4EEZA 3PIDA 4JI8B 3BG5A 2XMGA 1QHHB 1AHPA 1OT3A 3CSDA 3QX8A 3EA0A 4ZQIA 2NACA 3WI7A 1QUFA 3MAJA 3ZCSA 4WPGA 4B71A 1V4BA 2UUBB 3KKPA 3V8PA 1PKEA 1V5IA 3SNKA 2MYPA 2WD9A 3SHWA 4BO3A 5A4IS 1OYYA 1PWHA 1F4VA 1LDNA 2M9MA 2Q3HA 2QVGA 3LUKA 4QIHA 5CXSA 4FJ1A 1MUUA 2IYSA 4BGVA 2IHUA 4ZMBA 4PLVA 4AYWA 4IDEA 1MRNA 4ON9A 2QT9A 1FBNA 3BJZA 1EWKA 1H8ED 2B35A 2D5BA 4FFLA 5DBHX 4WN3A 3BE6A 1OFVA 3D6FA 3LCMA 1U0EA 2H17A 4GZ3A 4X45A 2F8TA 1G8JA 2F4VB 2PVCA 2VSYA 1O7JA 4IMJB 4AG5A 4GLJA 3G2PA 3ICWA 4JBIA 3Q10A 2QVLA 2PR7A 5H5JA 5CGQB 1I3OA 5K3DA 5JFGA 1SVSA 5JS8A 4GPZA 4TM8A 3IURA 4BNMA 3QRWA 3FKSD 2OILA 2VEOA 3MS2A 3S27A 3UENA 3PFFA 2XDYA 3LW7A 3PWSA 1IN6A 4BMYA 1BQEA 2VHWA 5DCWA 2HDWA 3NPMA 1IOZA 1SHLA 2EF1A 4N8EA 5E4FA 2CL6X 2WFLB 5A4AA 5ABPA 4U2EA 2GXQA 1I1QB 4NULA 2P5SA 3SQNA 4KQXA 2OT3B 2QX6A 3A2LA 2ROQA 2ENWA 3RT9A 4B8YA 5DNUA 1W44A 2E2WA 3BCSA 2J6HA 3IQXA 3WIVA 1QF9A 3NANA 4O4JA 5F2NA 3C8MA 1MF7A 1DG1G 3E82A 3SZUA 3WGIA 2AA3A 3KVRA 5KIAA 3TD6A 3PC8A 3SHQA 4DMMA 3P2MA 1TEXA 4RABA 1J33A 1USWA 3GLGE 1ORTA 2BGLA 1AB6A 3JQAA 2G5TA 2D13A 3E22A 3AI1A 4JKOA 5DVZA 3W3AD 2WZBA 2X15A 3FCEA 3UFBA 3E05A 3KOYA 2ET6A 2ZRIA 3MINB 4IOJA 1OXVA 2JAXA 3DV9A 4B4UA 2JCYA 1YCHA 2ZYRA 5KHOC 3AF4A 3AVOA 1PU2A 2ZSFA 1MG5A 3HHEA 1CE8A 1EDBA 4TRRA 1UBTS 1R4MB 3EGIA 4LDQA 5FPKA 1O4WA 4LJ5A 2XGSA 1REQA 4BVKA 2DERA 1S3FA 1O5TA 421PA 4Z4HA 3OOJA 2Y0PA 3DE3X 3IT1A 3EF3A 1KU6A 4C6TB 2GLTA 2ZWVA 1W4AA 2C78A 6CHYA 4QG3A 1Y1RA 3MF4A 3PZRA 3PC4A 2AMJA 1YONA 3LIPA 3OEHA 4IDOA 1U5BB 1P1RA 1YZLA 1M0TA 4UUMA 1P8AA 2BI7A 5KJ6A 3LX4A 3C97A 3HFJA 4HGOA 1R9JA 3H8VA 3AW8A 4D8VA 4E6PA 2O8DA 4LXQA 1FPQA 4IIGA 4RZIA 5J40A 1D7AA 1MH9A 3I6BA 3E18A 3G9QA 1A98A 2X9LA 3ZG6A 1FTGA 2LNDA 1D2NA 5DWDA 2QE7D 3JQ8B 1U9YA 3ZWMA 4E12A 2NTJA 3ND5A 2Q6TA 5HXAA 5TLSA 2Y4OA 4IDCA 1TU3A 2BCEA 3I01M 5ALRA 1PEDA 2ID9A 2H8GA 2X1LA 5L7WA 3KJNA 4MVJF 1IVYA 3U0VA 3RRXA 5DRTA 4AROA 1T9GR 1UDCA 3U1BA 1YZYA 2PBFA 1GZHB 4UVHA 2XTZA 3CLRC 5TQVA 2VZ0A 2A1TS 1U7HA 3TL3A 1CB7A 1DX6A 4JVSB 4QQNA 4YAFA 1NX9A 5ELXA 3HEBA 1Z83A 2BJWA 4H1WA 4OQMA 3K72B 5HWSA 4G23A 3X44A 4MROA 1CKEA 3A6PC 1U98A 5FHQA 2W70A 3H0CA 3MWYW 3NB0A 1ZD4A 1DIOB 2V8OA 2NUAA 1B4DA 1DC8A 1QTNA 4JLJA 1B16A 3HCCA 1U0NA 4TLEA 3UNXA 1MX9A 2GSDA 4CL3A 3OJOA 2HMUA 2EHDA 1XDGA 2GEJA 2PYDA 4K9KA 1PBNA 4QT0A 4C0JA 1T8PA 1YR8A 3ZGOA 4RPJA 2H57A 2VHZA 3C8ZA 3K8QA 3D6TB 3WTCA 1RRKA 4WCDA 3ZWXA 4BXOB 1DEHA 2EP8A 3L18A 1M0EA 1SBQA 1OBHA 1U2GA 3C3PA 3OQIB 4NATA 3ANSA 1P77A 5FUXA 2IDZA 1D2RA 2FP4A 4RL6A 5TARA 4HVLA 1UANA 3KKNA 3RFXA 1MX1A 4ILEA 2ZR9A 1JG7A 3WOHA 3AM4A 4N7MA 4B6FA 2IYQA 1UFQA 2YCBA 1C1HA 2OZVA 3DDNA 2EFYA 3OCVA 2IOQA 3RASA 1NURA 1GCAA 4YCJA 5DULA 5JATA 5JCOA 1E4EA 1FDUA 2WTAA 2IT1A 3WQRA 2FG6C 2D59A 3ORHA 1E3DA 4NYMQ 3Q85A 3S1AB 2V6MA 4W1SA 5DBEX 2H65A 4F2WA 1CNFA 5BOSB 5CAEA 3R9IA 4FCVA 1TU4A 2C3YA 2FZ5A 3ZWWA 3P0FA 4RC9A 3O4VA 1YFJA 4G67A 1P29A 4MVWA 3BE4A 1YVDA 4PLHA 2AS0A 1UEJA 2W0SA 4S1TA 3NC1C 4HX5A 4UQPA 3UGKA 2G6TA 3HJGA 2A14A 1P1CA 3FYDA 4MVJE 1IG3A 5JAUA 1M6WA 3UB3A 2QN7A 2MINB 1P1IA 4OFXA 1J07A 4IYRA 3AEKA 2BGRA 4R1QA 5IBQA 1GLVA 1C0IA 3NM4A 4TLDA 5HBGA 5JDCC 3F8SA 1J25A 4FYKA 1ZRNA 3OZSA 1WB5A 3IAUA 4OM7A 3HB0A 3NGXA 2W2LA 4X64B 1CY4A 2WINI 4HBZA 1XJ5A 1GFWA 3K1TA 3DVLA 1Z0ZA 4RH0A 4XUDA 2GK4A 2ZT8A 3U3OA 4C5CA 1G2IA 5B4UA 3LT1A 3H7IA 3CZMA 5P21A 3IT0A 5CLGA 1DKNA 2X2PA 1WMEA 3LDUA 3MD9A 2BEJA 1QGAA 4TSFA 4EHDA 2YHIB 1S4MA 4KMSA 3QY9A 5JI3E 3AWIA 5LWQA 1HNZB 2ZG6A 3KOWA 4JT8A 1TVKB 3SBEA 4EA6A 4OG2A 1X1RA 4ZT4A 1Z35A 3TW4A 3VUEA 4ZYVA 1ZM4A 1THGA 1K7YA 1S2NA 1SB8A 3O1LA 2ICAA 2RCNA 1Y1TA 4YN3A 3UTDA 2ZUEA 1XNHA 2W48A 3V55A 1I2BA 1TM7E 2ZWPA 1TXGA 2LTAA 1PDWA 3DOOA 4X1IB 3L93A 2XUZA 1CIJA 2NO1A 1E98A 1OA0A 5F5LA 3URKA 3PNYA 3EXIA 2DETA 4F2HA 3RC8A 1V5GA 4Y6RA 3IPLA 3JALA 2G4LA 1SUDA 4F3NA 3QUBA 3RVOA 2GARA 3HI4A 3KE9A 3U4MA 3FJ1A 2OFWA 3O8OB 4R2MA 3WIOA 3L1KA 1N5IA 3CXRA 2VQEB 2QN2A 2JJ1A 3LUDA 1Q7BA 4FT4A 4PG5A 1QSGA 5F78A 4BS9A 2ZS8A 1IDN1 1XMSA 3OP4A 4Q3BA 4V0NA 1ZK0A 4AZ0A 3DZFA 3ZXYA 1EHCA 3DXFA 1NI5A 1AV7A 2IOFA 2EOAA 4ZHQF 4M0UA 5JR3A 1N8SA 2IBMA 3AUYA 1CZHA 2PIAA 3FCUB 3MWEB 3A26A 3WOVA 1RT9A 5LDDC 2O5CA 4NOKA 2C84A 4FK8A 4W9MC 4KO8A 3ZJ4A 3SSAA 2HLNA 2I3AA 4D4MA 4R9NA 1C7RA 1OR8A 5BV8A 3L46A 3DOHA 1RZUA 2WZDA 4GICA 3C8HA 4LX8A 3EA4A 4Q5IA 2AN9A 5CH5A 3GLUA 1C3LA 5BSTA 1Y9ZA 3E8XA 2FMUA 1CX9B 1GUBA 2HI0A 5JCJD 1JHZA 3FWPA 4HSGA 4F6RA 1U9IC 1T5DX 1VJGA 2Y3IA 1KAQA 3CNHA 4MR9B 3V6MA 1MB2A 2H1OA 4I50F 4JEMA 2JD1A 2WFMA 1ZEMA 3D59A 1N3LA 3I04A 1F60A 1E3WA 2YZ2A 3QWFA 4A5SA 4F5WA 3C39A 1J1UA 4QGHA 4JX8A 1GNPA 3PGVA 3FTFA 3KXDA 1Y3DE 3FMVA 1FNMA 2HM7A 5KC8A 4IX9A 2Q9AA 3RS2A 2O8DB 5FA5A 5SYNA 3CZ9A 1II8A 3WQSB 1FZTA 3EBLA 3PD1A 3JPYA 3RRZA 3MIZA 2WIAA 1GFIA 2DPMA 5D85A 2OPBA 1DC4A 4OA5A 4FGUA 4KIGA 3IGFA 1UJ4A 2JFPA 5HKBA 2PUDA 4HNRA 1E9EA 4CETA 2WDPA 3NAZA 5B7QA 1D1PA 3K4PA 1E4OA 1KQ3A 4DDKA 1VI6A 4EQZA 4EF6A 3HCBA 4YFVA 3GARA 1IXSB 4HWSA 1RQGA 4X1KB 2C61A 4W6ZA 3H8WA 1GPAA 4BMZA 1E4EB 4LFAB 2IU4A 4GZ6A 1H05A 1MW8X 4IRUB 1I4WA 4YRRA 1T1SA 1JECA 2WF7A 4QAJA 5DM70 2VQFB 1YZVA 3KYDB 2BDUA 1TZCA 5ELMA 3VU3A 2FSVC 2P75A 4BZZA 1C7JA 2JGDB 2VNJA 2E37A 3GF4A 5EERA 3HH8A 3HSYA 3H3FA 3IQHX 3JWHA 3DMPA 4D8WA 5DSTA 4UM9B 2BEVA 5B1SA 3QLTA 4JNKA 2DX7A 3M49A 1J70A 4OQPA 4AMBA 1H69A 4BX3A 4N3GA 4J9UE 3HP1A 2WMOB 3BFJA 2QJOA 1DEKA 1G8FA 3DWFA 2PO5A 4EJ2A 3PE6A 1KO8A 2NU8A 1PD0A 2Q1WA 5E2BA 3ZGLA 1KR5A 2VDVE 5IN4A 3GG9A 4RLSA 4PPFA 2X7HA 4QGFA 4A6XA 2ZTVA 3IHLA 4R2HA 4UHEA 2YUIA 2YIDA 4J0QA 4O1MA 5BV7A 1T3HA 1PT8A 2I0FA 2NUBA 3A9TA 4GP9A 3B20A 2O8FB 2QI9C 1P4GA 1FFWA 1ONPA 4NQRA 5ALZA 1L8QA 1L4FA 2CLLB 1FDVA 4MQEA 4ZVPA 3RPEA 2ZIGA 3HJNA 4R9RA 5TR9A 1YC5A 2VDLB 3D4IA 4IHJB 3ZVLA 3AP2A 4UXHA 5TPZD 5BN3A 1D4FA 1FX0B 1OLSB 3IYLW 2Z6AA 1JH9A 5KU1A 2JF0A 5DYTA 2IS2A 4MW9A 1E1CA 2JVJA 4OFZA 4W5JA 5DLDA 2V7PA 5BW6B 3FW1A 4AF6A 5HZKA 3GPCA 4UEQA 1HE8B 3WGHA 5A4KA 2PUJA 1RXIA 4NAHA 4QRHA 1Z22A 2EF0A 4KYTA 3UV7A 5B4TA 3LQKA 2IWRA 3I92A 1M1YE 4DSZA 4ICIA 3BSFA 5A9RA 3ENZA 1E1LA 5LQAA 3EGXA 1Z68A 1EXVA 2BHLA 4Q00A 1LLDA 4HL6A 5KKNB 1E6KA 3DOFA 1OZAA 3K30A 3UWPA 1DO0A 1RTTA 4DTCA 4ZHQA 4IHJF 1SUWA 3Q3CA 1KDPA 4WJKB 3RVSA 4LBVA 2QG4A 2VYCA 3LCJA 3R3VA 2O06A 4XVCA 2BM0A 2MYUA 3WYAA 1U0FA 3DWGA 2AX3A 1NXVA 1ZMTA 1DDIA 1P3JA 4AZWA 3H5IA 2HT1A 1VDZA 5G4KB 3LY9A 1X1AA 4FHFA 3QF7A 4DUGD 2WAYA 1NW8A 5FA6A 3DFZA 4I4NA 3E35A 3I1FA 3G2OA 4JLOA 1SNYA 4Z9BA 1RZ3A 2VT3A 2PGXA 3ILHA 4FFRA 1FP4B 2WUVA 4Y2RA 1FVFA 5E1MA 4DLRA 3W04A 1KJYA 1CUGA 4CZ2A 2YOHA 1H2ZA 4MWGA 4LE2A 2ZWAA 1SQGA 5DV9A 2QVZX 4ZPXA 3VR6H 5A4DA 4BVFA 5LQKA 2C7GA 2IBSA 1XR3A 3FMOB 1JDBB 4PF1A 2ZRGA 4WOKA 1THTA 1M2VB 2XB6A 4EUFA 4G2NA 3DKPA 4AKEA 1SXJE 3G0OA 3DBLB 3OLWA 4QM7A 2DY0A 5DBGA 3T4PA 5FHRA 4F12A 1TD1A 4Y9TA 1IONA 1UMKA 3HYNA 2E4YA 2RI1A 2A0FA 3TFOA 1I5EA 4D0RA 2H9IA 1DJMA 1L5HB 4M38A 4PCLA 1JR3D 2F3PA 2ACKA 2QJWA 3D2AA 1II9A 5I7HA 3SSOA 1L8XA 2JS7A 3WNZA 2IZ6A 1AK9A 2Y66A 1I4TD 3IDSA 2YXBA 1RKUA 3GJZA 5HCIA 2R2AA 2ERCA 5AOAA 1ZAYA 3T7DA 1SURA 2KHZA 4HXFB 5A1TA 3C2QA 3SE7A 2ALJA 4FINA 4M1TA 3B1ZA 1FX1A 1XRPA 4J6EA 2Q8NA 4CMJA 5AVZA 5D86A 3G9UA 4C3VA 4MW5A 3QBJA 4NC9A 4RD2A 5IM5A 4KAAA 4YHBA 4Z9AA 3ZHYA 4ZCMA 3G9XA 1XD9A 1U5AA 3LUBA 3L02A 4MGKR 4HJXA 5JBIA 2R0QC 4F5YA 3VVCA 4R7TA 1DJNA 2P69A 2AW5A 1NKSA 1HT0A 4KTVE 1QLJA 4TTAA 1U1EA 3EDYA 4HDOB 2QV7A 3R5JA 4I50B 4GP7A 3OUUA 5EIFA 5HMMA 1AQIA 2FV8A 1KU0A 3WGGA 3IV6A 3TECE 3T0IA 4A0HA 3M4YA 2OVBA 4AJJA 2QZ9A 3LW8A 1WSWA 5IJ0A 1NOJA 1JALA 1IM8A 1KPGA 3RJ9A 1ICEA 1YZHA 2O0HA 1W36B 3BQMB 4H7EA 1JLMA 5C46F 1QHIA 5HGXA 3TQIA 5C7OO 1KDZA 2YUTA 4R3UC 4WX2B 5DTEA 3MYYA 3OP1A 3CCCA 3F3YA 4B8ZA 2OCDA 4K6CA 2TECE 1C9YA 2BFBA 1OQAA 2AG5A 3QPAA 1OJ7A 3BICA 1JIVA 2C54A 2UU9B 3P2KA 1YQ9A 2C5FA 3C1OA 1JA9A 3MUEA 1CRPA 1VPEA 2BKLA 3HXKA 1R5NA 4X3PA 3ACBA 1TADA 3Q8LA 4B7UA 2PQMA 2P4HX 3RRBA 2FQQA 2XVAA 3F5QA 3QKRB 1T6XA 4YO7A 3UICA 1NBIA 2EXXA 3LS2A 3NZEA 4L9SA 3TL2A 3LKZA 4KH1A 4MTLA 2X0EA 3LM8A 1XNJA 3PXDA 2IH4A 1NLYA 2XGMA 1HNWB 1PR9A 1SXJA 4BJ5A 1QQ6A 3DL7A 4AP6A 3I5YA 1ISPA<