5JI7A

The crystal structure of ius-spry domain from ranbpm/9
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
199
structure length
199
Chain Sequence
LQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ran-binding protein 9
publication title Structural Basis for the Interaction between the IUS-SPRY Domain of RanBPM and DDX-4 in Germ Cell Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ran-binding protein
total genus 55
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ji7A00
5JI7A 4XW3A 4X8NA 2LM3A 3KB5A 4N7IA 3UV9A 4B3NA 4WVMB 2WL1A 4WVMA 5JIUA 4N7UA 4QT6A 5JI9A 4KG0A 5F6LB 4P9LA 3ZO0B 2VOKA 5JIAA 2YYOA 2YUEA 4P9JA 2E63A 5F6KA 4X8PA 3TOJA 4B8EA 4V1PA 5C33A 4P9IA 2IWGB 2FBEA
chains in the Genus database with same CATH superfamily
3OSDA 4FI9A 1PX3A 2D3SA 2GU9A 5DDJ3 1GQHA 4COVA 4WVMB 4G9SB 1OH3A 4XJZA 1JU4A 3ZSMA 2EVXA 2R042 4CU7A 3IT8A 3WQBA 4PBPA 4COYA 2DCYA 4WM8C 1ND2B 3ZKUA 5BNOB 3MV11 3CJIB 1YIFA 2WWJA 1H1IA 3AB0A 4MX3A 3L2HA 2WUHA 2MEV1 2AGSA 3H8RA 3O12A 1AYN2 1Z78A 3MICA 2Y6KA 4OHYA 1YQCA 3AVRA 4C91A 2WFF3 3VBHA 3CHXA 5GALA 3MGUA 2ZGRA 3JB8A 3AYDA 1VIWB 1RUE1 1S0JA 2PHUA 5F2WA 4QDQA 4XFIA 2C6SA 4FFFA 3OYWB 4GZ9A 2W46A 1R1A2 3ZYGA 3RZHA 1FXZA 4MGIE 1UX6A 2VUJA 3H9AA 4RFT0 2A6XA 4J6GA 5FPBA 1DLCA 2PHFA 3ST7A 2ZMLA 3N9OA 3T1MA 2PFWA 1JOBA 2RDRA 3ZR6A 1HJFA 1HRV1 3PUIA 3N9MA 3TEZA 4XQ4A 4IV3A 1UQXA 4DNYA 2VC9A 4HN0A 3RJRA 3VHRA 2DVFA 5IWFA 3PUQA 2C9KA 3I3BA 1UXXX 1S0DA 4UFHA 4HPKB 4XF4A 4YVSB 2XLAA 3WDYA 4YZ4A 1UOFA 4XUTA 4BISA 2ETEA 3OBZA 5G04L 1QJY3 1VAVA 4DIQA 4TXWA 5IK7A 3N9NA 1LGBA 3EXUA 2WYFA 4JCKA 4AAPA 4NN0A 4XMIA 4AGGA 1HN1A 1VMJA 5DZFA 2X05A 3ZFFC 5JZGB 4E2SA 3HD8B 4YGCA 1UKGA 1TMF3 1RC6A 3INAA 2WO2A 1OA4A 2J22A 5AFEA 2P2KA 2ATFA 3OJBA 1R082 4NHXA 4IGOA 1UAIA 3CNAA 5D8AA 3AC0A 3VBSB 4CUCA 1S4CA 4IE4A 3DXTA 3AJYA 4LBQA 2BNMA 4QQHA 5C9AA 1TEIA 3B94A 3ETPA 3POFA 3BALA 1RUH2 2VBDA 3IN9A 4HXCA 3VBRA 3BI3A 2DFBA 1COV2 4HK9A 1CAXA 3NAPB 4QQPA 1C1FA 1GZ9A 4S2GA 1NLRA 4Q1RA 3WNOA 2QVSB 3H8UA 2HWF2 5I0UA 3ZN6A 3O1MA 4OHVA 1YI9A 4KWUA 2DTWA 2O1QA 4QDRA 1SPPB 1MS4A 3NW4A 3MFAA 4GJYA 2JE7A 1DGWA 3ACFA 3KQ4B 3WEZA 3M3QA 1JW6A 1Z7S2 4URAA 1VBC1 1O8SA 4NOTA 4OI1A 3WSOA 2ZMKA 5CKQA 1JU3A 1LOGA 3M3EA 3UKVA 2VZOA 2BNOA 2Y0OA 1GOFA 1OKOA 4WVWA 4IGPA 1YUDA 4AHXA 3L2YA 5F1RA 4Y1YA 2D5FA 2ZGMA 1O4ZA 1EUTA 3AM2A 4FT8A 4OMCA 4YW4A 4BLIA 4E9KA 2R1DA 4Q4W1 3IM0A 1PK6B 1VAKA 2LTNA 4IEQA 3W21A 1WCSA 3BYWA 2GP3A 1W8NA 3ILNA 4RS5A 4ZZ5A 3HAGA 4L9BA 2UYAA 1H8TC 4UFMA 2E7TA 5CVRA 1QNYA 2RJ2A 4B4QA 4MHRA 4CDUC 1NQJA 4IEXA 4PLOA 2RM23 2K46A 3M3CA 1TME1 4NIIA 2QQUA 4P5YA 4Q5OA 4AQTA 1UY0A 2ZGQA 2A3XA 2JWPA 1V6KA 4PI0A 4Q0UA 3ZN5A 2BVVA 2HWE1 3QCWA 2FCVA 4QDSA 4XTMA 5AC92 4AHZA 3AZVA 1OI6A 1KRIA 1MS0A 2CU5A 5FYUA 1HXS2 4XW3A 4AQ2A 1AR82 2QQPA 3SHRA 3WW1A 4ZPIA 3B00A 4MHUA 4RHV2 5K0UB 1Q56A 1BBT2 3NKGA 4Y22A 3ZN4A 3IIAA 2WWUA 3ELNA 4GAZA 2W5FA 5FYBA 3RZJA 1HDKA 1OSGA 2JDAA 5FZFA 1DZTA 2DDUA 3PVNA 1FOD1 3H50A 1W0PA 2B7YA 2IZWA 1V6IA 2G4IA 1V6OA 3LA3A 4LNVA 2JEMA 4Q4V1 1AR72 1LGCA 3HQRA 1C28A 2W47A 4HFSA 2NZ9A 4KL1A 3RGBA 1G9FA 1SLTA 1KEXA 5FYHA 1IGOA 1ZZ7A 2RR12 2Q1FA 3ZPYA 3CZUA 2O0OA 2Z5WA 2WWSA 2UWCA 3KHBA 3KT1A 2TEPA 4RQPB 3WUDA 2RMU3 3IDCB 4AYUA 2XWJB 2ZBJA 2VECA 4AI3A 4B7KA 1QGLA 3JD71 3S30A 4LBJA 1FT9A 2JDNA 2SBAA 1JYWA 1DGRA 2YC0A 1O3QA 3PMSA 2EXJA 1GZWB 4E2GA 4H7LA 2NMOA 3IIIA 5DN2A 5C5TA 3RZZA 1ODNA 2GNMA 5BNQA 2X5IA 1LHVA 1ND2A 1XBFA 2BEOA 3AZXA 3N9QA 4ZY9A 3ZOIA 5CBLA 1CQ9A 3CJIA 3OGGA 2OVUA 1JYCA 2D6KA 2QTWB 4LBLA 1POV1 3HJRA 4P5HA 5K4LA 3U07A 5CA6A 2ZX3A 3KVBA 1JYIA 4CCKA 1TVGA 3VDDB 1DLLA 4QPIC 2YGLA 1V6NA 2FMDA 4KU8A 2ORZA 4BH9A 3QH6A 4CEYB 1Q8PA 1EV11 3POIA 2CWSA 4M0NA 5T3NA 3N7JA 5JWPA 4NUBA 3AZZA 3SMHA 1JZ6A 1LB2A 2QKDA 2BWAA 2VPVA 2OS2A 2WT1A 1Q5OA 1T2XA 3O1SA 5FZHA 2P6CA 1KD7A 2I45A 2RS11 1OPOA 4Y5TA 2LUWA 2XB6C 1DQ5A 2WO3A 2YROA 3LKJA 4JAAA 5E6HA 4EJRA 1YFUA 3KT4A 2HWB1 1GICA 1RXGA 1PVXA 5FUPA 5T5LA 4KNCA 5EPAA 3B93A 2QQJA 4CDQC 5H9RA 2WBKA 3H42B 4LA3A 4NAMA 3AL5A 4AFCA 3BUCA 1K42A 3RZKA 4Q26A 4LKSA 2HWD2 2XBO3 2C0ZA 3TEXA 1H2KA 1YIPA 2XPJA 1US3A 4YVSA 2ZGOA 1ZA7A 4UT5A 1OQEA 3HEIA 4MLOA 1RUI3 4ET7A 3KCCA 2BGOA 3AKQA 4FPKA 4MH0E 4PQQA 3BIEA 5JI9A 2Y34A 2HLEA 1CVNA 4Q1PA 5DAPA 3ZYFA 5C3SA 5JZGA 2VOKA 2XJPA 4FOYA 1LOAA 4RN5A 1UZWA 4LA2A 5LEJA 1WMEA 5JCTA 3N9LA 4Q4X1 3VBSA 3VN4A 3WDWA 2J7MA 5A3TA 3S6PA 1G6NA 1XRUA 1W0OA 2CSGA 3NVCA 5GJ6A 2ZEXA 1JODA 4OUMA 3BU0A 1C8NA 1PGL2 4J1XA 1HW5A 2ID4A 4I0BA 1XJAA 3I59B 1X7NA 3NAPA 3U37A 2WSVA 4XFAA 2OUJA 2ZOEB 1TNFA 1ULFA 1OA2A 4XIOA 4BE3A 3VBOC 4EZHA 5FZ8A 4YGEA 2HBTA 3DEMA 3O0XA 4IE5A 1W8UA 3USUA 4HZFA 5DUVA 3ZFEC 3EHKA 1WLWA 1MR5A 1CR7A 2R063 3M70A 1VB4A 4RD7A 2PAEA 4A7YA 5A6YA 1AR61 1Y43B 2UY9A 1UZZA 5J7MA 3FE5A 3UKTA 3KT7A 1DQ6A 4YWAA 5CISA 1U5YA 4NIAA 3GZAA 2ZAHA 1RJ7A 1V0AA 4LKEA 4CU9A 2Z69A 2XJVA 1E5RA 1UOGA 4YNIA 3KB5A 1IQDC 1WW4A 3POGA 5CFDB 3IPVA 1RUNA 4MG2A 4LR4A 2AH2A 2AUYA 2A6VA 1GSLA 5T54A 1PK6A 1VRH1 4RGGA 2CHHA 4XMAA 2CAVA 2MEV2 4YZ1A 1VB2A 2A73B 2I07B 1GOHA 4XF0A 5CG8A 2YUEA 4LOTA 1AUYA 2GALA 2WLQA 3C7EA 1C57A 2YMZA 2V09A 2RS31 3LA2A 1PZ7A 2XLGA 4QMAA 4XPVA 2YC2A 5J48A 4PIZA 1FYUA 1Y9QA 3NL1A 2QCSB 3B02A 1BHGA 5IW0A 3MHZA 3URFA 3MYXA 3NSTA 1I5PA 1MS5A 1W8HA 1V6MA 2WL1A 4FXKB 5FY0A 5A3WA 1DCSA 3K4AA 5FK7A 3GYDA 1HRV2 4TYSA 1NY71 4QXHA 4N9IA 5BNPC 3NO8A 4LOSA 1W05A 4CCNA 4P08A 4LUKA 4K8RB 3SCHA 5JOWA 4MO3M 4EN0A 3AKTA 3VZJA 3EYPA 5GLZA 1ACCA 1D2SA 5F8PA 4HVRA 5C7GA 3WCSA 4YM1A 4OQ9A 4QQOA 5AFBA 1BVVA 2MPFA 4L99A 2WAAA 1IOAA 5A80A 4AFMA 3D4KA 3LDRA 2A6ZA 3ZXFA 4Q0SA 3LOIA 4SBVA 1US2A 1R1ZA 2RS53 1N3PA 1RUC2 3H1YA 1UF2C 3POSA 3PUAA 1FMD1 2B8MA 3MBWA 2VH9A 4GB32 1GWKA 4GXLA 5A7SA 3SEPA 4FOQA 2CGPA 1NCRB 4JX0A 5A3PA 1ENRA 1NCQC 5JDBA 2E33A 1N1YA 1ZZ9A 5LCWL 4AK3A 4CVUA 2P6HA 1BEV3 1UOBA 1DQ4A 4QB6A 3W59A 1RMU1 2DUOA 1W2NA 4M4RA 2QUOA 3H3ZA 5A3UA 2HEVF 5LWBA 2DUQA 1PZ9A 4IL7A 4AR2A 4XIKA 4UOJA 2Y6FA 4LBQD 3VDDA 1J59A 4JHZA 1CJDA 1FATA 2BU9A 4CEYA 4EWDA 3OGSA 3JB4C 1AVBA 5FAXA 4FPYA 3P3PA 5CIRA 2QQKA 4XHXA 1VBC2 1YEWA 5FZ7A 1HB2A 5A7NA 2GNDA 1J58A 2P3YA 3NQHA 3D8CA 1LOFC 4PI2A 3MO4A 4CCDA 3LF7A 2JDKA 2Q0AA 5EFUA 3X29B 2BPA2 5CB7A 1CZVA 4FXGB 4CEWB 5D2AA 4JGZB 1HB1A 3ZFGC 2A6YA 1T6BX 4OUEA 1HV0A 1SCSA 3WP6A 2VMHA 5FZDA 3OD4A 1WA6X 1W8ZA 5BPXA 1KFUL 1OQ1A 4CU8A 4Q0QA 1HRI1 1PZ8A 4P02B 5KBFA 1LODA 5FOBB 2VMCA 1PMHX 1C5HA 1TG7A 1X33A 2PHRA 3HWJA 2D98A 3C3VA 4ORFA 4QHZA 4A42A 4K6BA 3PIJA 5A3NA 2VOWA 2JE8A 1SZBA 4AXOA 4Y4YA 3THPA 3G7DA 2VZPA 1AXZA 2W9XA 5FXZA 3AVSA 4OYUA 1MEC1 1ZX5A 2XUEA 3OOXA 4AQ6A 5JR7B 2DVAA 3U10A 3HVDA 2DVDA 4QX1A 1H4GA 1ZVFA 4M4PA 1MS3A 4OZXA 3QLQA 4TN7A 4CSWA 3V0BB 4XVHA 4QHBA 4AOCA 5IFPA 4V1PA 3ZXEA 3UJOA 4FPJA 4BCUA 1OMIA 1O59A 2YBPA 2W92A 4F8AA 1F15A 4AVBA 1UW8A 3CIHA 3J9SA 2PLV1 2J1UA 3NNMA 5F2SA 3RWKX 3WV6A 1JI6A 5L7OA 4QKNA 1GYKA 4EYUA 1GANA 5FY9A 1VP6A 1FOD2 1LOCA 1QJFA 1JBCA 2HWC1 3ACIA 2DCKA 2ZACA 4IERA 3DCQA 3AP7A 1PX4A 1C3HA 4WVVA 5EXOA 3RI9A 5FYYA 5C9AC 4FP2A 5IAVA 1W39A 2R043 4Q4V2 4P9XA 1W8TA 3U75A 5T50A 2VTFA 1QHDA 2WO7A 1NOVA 5IT6A 1ULOA 1VMHA 3VBFC 4DXSA 2NYYA 2PHTA 1XPWA 1JN2P 1AYN3 3FUOA 3GBFA 2V4VA 3C2UA 4YG3A 4YSFA 3SKVA 1QJU3 5J96B 1LENA 2JG9B 3JD72 3JQXA 3HOBA 3JUUA 4JTNA 3WG2A 1LAJA 1G9BA 2D7FA 3SH3A 1XC6A 2JKBA 4IXLA 4XCAA 1D4M1 2VW0A 1R1A3 1JOJA 5F3EA 1XQNA 1YJKA 5FXVA 2CDOA 1ZREA 4IV3B 1J3PA 3LGRA 2OYZA 1OUXA 2AYHA 3KQRA 5FP7A 4FPLA 2YY1A 1O4YA 1YNAA 2Y6LA 4OHXA 2E6VA 1QXJA 1ASJ3 1V9U2 3ZSEA 1PVC2 1AZDA 4KH9A 1PO22 3NNJA 2H0VA 1VBA2 2BYVE 2R072 4DQAA 5C4WA 1F5FA 2ZCWA 3KF5A 3FBYA 2CY6A 2E31A 3GHNA 3DYMA 3VHPA 4QKFA 2HBUA 2XJTA 1RUD2 2XJUA 1BK1A 3WG1A 2WNEA 2GMPA 2W1SA 2WZR1 2VOTA 4YVWC 3TNQA 5ACA1 5KC5A 1KJRA 3K3OA 1P8JA 2R1BA 2WS91 4GWMA 4YM2A 1RUF1 5B4XA 5KXDA 5EWSA 1H0BA 5D8AB 3LZZA 1W6OA 1VALA 4HK8A 1UU4A 4PCRA 2FCUA 5LEKA 5LK5A 2BP6A 4HVOA 2PAKA 5FRAA 5DDJ1 1Q8SA 1H9WA 4L97A 4LE4A 4QPWA 3WX5A 2EA7A 3ATGA 3Q9OA 5KR7A 1I9RA 4QPGC 5LY1A 3OTFA 2VQUA 4QXBA 3AMQA 2Y6JA 2Y38A 2ERFA 4YFZA 1R083 3T30A 4NIGA 2QZ3A 2ZA9A 3MIDA 4RGAA 2VMFA 2EIBA 4LKDA 4DEQA 3TEWA 4QX3A 4OMDA 4MZUA 1RUH3 1W04A 4QX2A 1H2MA 2VQ0A 3W5MA 1PGW1 1COV3 2WFF1 3AYEA 4DXRA 2IUWA 4DPNA 5GLUA 4YZ2A 2BUKA 3EQEA 1NX9A 4BU2A 1H2NA 2HWF3 3M3OA 2CYFA 3NNLA 5FZMA 1PO11 4AEMA 1NCRA 3B01A 2A1XA 2VU9A 2Y0IA 1GV9A 3CF6E 1OOPC 4NHKA 4Q4X2 4LK6A 1Z7S3 1ND3C 4DUVA 3BCWA 3O14A 5FZLA 1LR5A 1G7YA 1BCXA 1E5HA 4RFRB 2VVDA 1RVF2 3J7MA 4XF9A 5I8YA 4P00B 5A6XA 3B7MA 5FBJA 3WG4A 1HQNA 4RS5B 4XOGA 4XUPA 3W20A 4FOWA 2O14A 2C1FA 5JSRA 4CDWB 1WW6A 1EYBA 1WW5A 3B3QE 1WCKA 1XNKA 5C5UA 3ZXGA 5BNOC 5APAA 2NP0A 4NPLA 4R52A 4XILA 4K1YA 2XG3A 5FY8A 4NIDA 3HR9A 4JZRA 4Y24A 3UT0A 2V5YA 5K8SA 1WCDJ 2WZ8A 1QJY1 2ZGNA 1J83A 2PMWB 3ZYRA 3O1VA 3WF1A 4FOVA 1JZ7A 3T2PA 1RUG2 1SFPA 2CV6A 1MZ5A 3D6EA 4CEWA 1LULA 3PTYA 1DYPA 4FTSA 1TMF1 3MEPA 5FY7A 5JMCA 2WINB 3KGZA 1T6GC 4AEJA 3GBWA 2ADEA 1B35B 1KITA 1UMZA 5AC93 1N47A 3N36A 1WLTA 4M3CB 2QDRA 4Z8BA 1AL22 1LNSA 1YI7A 5FYCA 1UWWA 1HXS3 5CYYA 4NRQA 1AR83 4DEVA 4IW3A 5D1IA 5L9RA 2D43A 3T0AA 1BBT3 3KHCA 3IDBB 1UN1A 5BNNB 3S0MA 3HN3A 4AI9A 5JPMB 1XXNA 5JSOA 3NJVA 3WNNA 2RE9A 3DYPA 1DGLA 3C7HA 2GMEA 5DXDA 2FZ2A 3V0BA 4A6OA 3MIGA 3JU9A 2P37A 1O3SA 4AZZA 5FZBA 2W1QA 3MZHA 2BZDA 1AR73 4I0AA 3ZSJA 5FPXA 4QX0A 2K9ZA 1XSQA 1GQGA 4MOAA 3JCIA 2RR13 4HT1T 2YB7A 5JZGC 2X5IB 1NY72 3IB3A 1N3QA 3NKTA 1K5MB 2AACA 3ETQA 4FPHA 2OXBA 4MGQA 1IZ3A 5FPAA 1YQ5A 3OPTA 5FREA 5I93A 3BIWE 3OBAA 4DY3A 4FBFA 2VUDA 4LK7A 5BV6A 1SLLA 3U4XA 3J8F2 5FWEA 2YU1A 1SBDA 1OHFA 2WNVB 1YQ6A 2ZZQA 1IS5A 3SLIA 4YM0A 3WDUA 5IVBA 5KXCA 3AYAA 3MV01 3BKZA 1CZTA 3FFQA 2JECA 2O8QA 2W1UA 2D6PA 2RM21 2TNFA 4N43B 3SQOA 1RHI2 1L7LA 3U11A 3ZSLA 1ZYBA 1IS6A 1G8WA 2A3WA 1O7FA 2JG9A 2QNKA 5IK4A 4QQ2A 5C3PA 5ISLA 2ZTNA 2ZHKA 4FPGA 3J7HA 2VZTA 3TNPB 1ST8A 2PQQA 3E1F1 2B5HA 3RZMA 2ET7A 3LPFA 3HMYA 2C24A 2YPDA 3CZJA 1AX2A 1JTZX 2PYTA 4XACA 3UETA 3ABZA 1TQ5A 3IKWA 1CIWA 5JVVA 2IXCA 2ARAA 4DUWA 2Q1ZB 4FTBA 5LRRA 2BVBA 2PTMA 5FTTC 4CUGA 1S0GA 3QACA 4AF9A 1D7PM 4YG6A 4HKWA 3GZUC 3H3UA 3I2GA 5E16A 4XZPA 2OX0A 4PDWB 1RUOA 2BW8A 1JZ4A 1XE0A 2UY8A 2V72A 4PBOA 3VBUC 4XC9A 2GC3A 3RYRA 1QOTA 4DINB 4NHYA 4JRAA 2HWD3 3UESA 4XJWA 2GC2A 2GP5A 4JGYB 4A4AA 1VBB2 4W65A 4DOUA 4NHLA 4FAHA 1A78A 2TBVA 4FCAA 5IHRA 4A44A 2ADDA 4YPJA 1VR3A 1EP0A 1HJGA 4FFGA 4L2NA 4PLMA 5D21A 5JSPA 4GH4B 1UXZA 2JDHA 5AVPA 3ZLIA 1DBNA 2RMU1 3WNLA 5FK8A 4DY5A 1NG0A 1GZCA 3S7EA 3V64A 2P34A 5FXXA 3WW2A 3O1RA 1RIRA 5DPNA 3RQ0A 4RR3A 3T1LA 4AVTA 1OLMA 2OIIA 4FQ4A 2HH9A 1OQDA 1H8VA 3VD4A 2VZ3A 4YW3A 1QOOA 4XF3A 5K0UC 1O3RA 2JICA 2VR4A 3POEA 5L73A 4WM8B 3VKLA 3USUB 1GNZA 3BVCA 3WDTA 1ONAA 4I01A 1PM4A 4JC1A 2BV4A 3H7YA 1C8M2 2YPJA 5C71A 4MYEA 2ZEZA 1MEC2 3U4SA 4UFLA 3SEEA 3DPRA 2O8OA 4A7ZA 3NWKA 5BUVA 5JIAA 3HNYM 3S57A 4IEWA 5FP3A 4EN7B 1XNBA 4A45A 4JDMA 2SLIA 5FPLA 1VBD2 3D0JA 2DCJA 5C33A 5GZEA 5FY1A 4UW6A 3UGHA 3H7JA 4BXSV 2DWRA 1Y9GA 2VCBA 1AF9A 1I3HA 3KSCA 2JX9A 2XKOA 3IPVB 4RQPC 5FMCA 5A7OA 2NN8A 3UGGA 3WXPA 4CCCA 3BTZA 5A3LA 4YLZA 3LEMA 1GP5A 3JQWA 4IDZA 3OBTA 4CE8A 2J1RA 2R49A 3R6SA 3RNSA 2P17A 3KGLA 2HWC2 4YW1A 1BYHA 1NUKA 5DAVA 4CDWA 2ZGSA 4XFCA 2XXZA 1NA1A 2HYXA 4BQ3A 5FR3A 3RDIA 4DXTA 2Z42A 2VZSA 2VCMA 2XBO1 3E5QA 1A3KA 4LTAA 3VD9A 5EZWA 4CDXA 5FLIA 3D82A 1S0FA 2VW1A 4XJUA 2DU1A 1POV0 2G19A 4N53A 1VMFA 2K2SA 2IFWA 3OPWA 2MEV3 1RUI1 4CUAA 4XFFA 2FDHA 1WKYA 3OUIA 4XBNA 4LHNA 1MQTB 1QQP2 3MUZ1 2R16A 4QXKA 1YCIA 4CEYC 1OD5A 5LZ6A 3GZEA 3PURA 4HKLA 4BMEA 1AR91 5C70A 4GALA 1OXCA 1ENXA 2GNTA 3VLBB 4XF1A 3T08A 4C0BA 4XAAA 5JIUA 1PIV2 5CAZA 1GKBA 3POWA 4Y1ZA 4LLOA 3KCXA 4OI2A 1B35A 3VZNA 4M3CA 2JG8C 3TN92 1W9WA 5FZ3A 3E6CC 1JZ2A 2R30A 4MVTA 4V2WA 4RL7A 4OULA 2PAMA 1LEDA 1S0EA 1XE8A 3LIGA 4FFHA 1HRV3 4HN1A 3SC7X 4B8EA 2WABA 4CA9A 1Y4WA 4P9IA 5BNNA 4IEZA 5GKAC 4GWJA 3LOBA 1LU2A 3ZSKA 3A4UA 2DTYA 1CX4A 2F17A 4GKXA 2EIDA 4KWKA 5ANNA 5IVFA 3WW4A 2EF6A 3W5NA 5L9BA 2YFZA 3E6BA 1A8MA 1EAH3 1WWYA 4J25A 4EN9B 2R061 1B09A 3RWNA 1VBE2 3K3NA 2PHXA 1H6YA 1JYNA 1F8VA 1SHWB 2XVLA 4CP0A 4S2DA 1RYYA 1RUC3 3J26N 3VDAA 3C7FA 3TAYA 1RJ8A 1STMA 1MPXA 1YC61 1O5UA 1K5MA 4NPRA 5DABA 2W95A 3RYKA 4GB33 5SV5A 1RUJ2 5ABJB 1SMVA 1DFQA 3LCPA 5GZCA 3JBG1 3I7DA 1NAEA 4MGYE 1IS4A 1ZBA2 3T2QA 2RDSA 2DUPA 5C3OA 1W2OA 2KR2A 2G9ZA 5L9VA 1F31A 1V6LA 3A22A 2YBKA 1RL3A 4O7XA 1AYM2 1RTVA 2WNVA 3D3AA 5ERLA 1TNRA 3WNKA 3GM8A 4JRLA 5KWRA 3BOWA 1O4TA 4ZXEA 5JUVA 5FZ6A 4R9DA 1UO9A 4N43A 1UYYA 4UW3A 4CXYA 3KV5A 4CDUB 5J3UA 1D0GA 1PO12 1QIQA 2AENA 1W6NA 2W68A 4IEUA 4XJ8A 1JH5A 2WNUC 1F4AA 4COZA 3MIHA 5FZ4A 4EQVA 3NRUA 1VBC3 2QJVA 4AHWA 4GA9A 3AL6A 1QJX2 1U5ZA 4I09A 3N7KA 3DUIA 4Y20A 1MVQA 5EYYA 3P1IA 3RFRA 1ZBE2 4A3ZA 3T0DA 2WIIB 4K40A 5L19A 5JI7A 4BOWA 4TLFA 1ULEA 3APBA 4LPLA 5CFDC 1FPN2 4XBQA 2GN3A 2YFUA 4PDWA 3IMNA 5C3QA 3SCFA 3NJXA 3HBKA 3OD0A 3OB8A 2CGNA 3HT1A 1GWMA 4META 2QQOA 3WP5A 4K7JA 5FY5A 4XQWA 1RITA 1LU1A 3ZO0B 1CGPA 4JGYA 2YBSA 3ES4A 1SFYA 3A0KA 2Y26A 1TZOA 4LORA 3BTYA 1LHWA 4CU6A 5IVJA 1GOGA 4YYOA 4AI0A 2BOIA 4XXAA 4GH4A 2QFEA 2RS51 4UF0B 2DVGA 1OA3A 2ZGKA 3I54A 3UK9A 5CFCA 4OI0A 3GXUA 1W03A 1NZCA 1UPSA 3Q8CA 3FFZA 5L7OB 2A71A 4ASKA 1X8EA 1W8OA 2Z79A 4D7TA 3WW3A 1JUHA 1BEV1 4BQWA 3TWIA 4KGQA 5EYXA 1WBLA 3R4UA 3J7LA 1VPHA 1J1LA 3OF1A 4Q4Y2 4WM8A 2ZAAA 1QU0A 4CUBA 4EV0A 1IS3A 4C1XA 5E89A 2FDKA 4S2HA 1H1AA 3BPZA 1BMV2 2A3YA 1YQ8A 1CJPA 3WD5A 1Q8VA 4LBNA 3N3HA 2WNOA 3NNGA 4AG4A 2JIJA 1CIYA 5FZEA 3NV2A 1JYTA 3O0VA 4OZOA 1LOBA 5A7QA 2GAUA 1SBEA 2VNGA 4K8FA 2GSYA 2WQ8A 4KBBA 2LALA 2XONA 3DL3A 5F5IA 3DF0A 1GNYA 5I0TA 4K9SA 4PHZA 1W8FA 1U5IA 1NCRC 3HN1A 4EWAA 4TZDA 4GMP0 4QX7A 3C8XA 5HV0A 4CRQA 3ZXLA 2W0XA 5FOJB 1FNZA 2BBAA 2XHNA 1MS8A 4FPEA 4JKMA 5FLJA 3WCRA 4CDQB 1W2TA 1W90A 5FO8B 3ZM8A 1XU1A 5FP8A 1KDMA 1RUE2 5C4WB 3AX4A 3LQCA 3BB6A 3OY8B 1RB8G 3LIHA 5FPZA 3OBRA 4Y1UA 4O9GA 4YRDA 5HV4A 1GMMA 1ENSA 4KMQA 3WINE 3L9JT 1V9U3 1MQTA 3VZLA 1PVC3 5K7PA 1PO23 4YGDA 5EP9A 2E9QA 1VBA3 2R073 3EJKA 1W6OB 1W9YA 1U5XA 4E4SA 1XNDA 3LSDA 3RJ2X 3FMGA 3ON7A 3A21A 5DMYA 3GDBA 1DHKB 1RUD3 1GR3A 5B4NA 2FDJA 2BGCA 5I0DA 3WT3A 3AP6A 3E5UA 4ATFA 1UIKA 2XJQA 4WM7C 1SLAA 2KD7A 2ZABA 5F6KA 4AVCA 5FUIA 4CEWC 1OUSA 2CWMA 2DU0A 1QEXA 4JGZC 1H30A 1G86A 3WNMA 4AEDC 1F4HA 4ES9A 2A6WA 2XVGA 5A7WA 1Q8QA 4XAEA 1D2QA 3CQOA 4Q27A 5LBBA 2DYCA 3FWEA 3MLLA 4LKFA 4BK5A 1CAUA 3PNAA 3MDPA 3KS7A 1L3JA 1W8WA 2VW2A 1JZ5A 2R041 4CP2A 1AXYA 2R7EB 4LO6B 4UFJA 2P5BA 2OT7A 3LPGA 2XJSA 5B2GB 4PF1A 1UYZA 3TEYA 2VNRA 1Q3EA 2HJIA 4UW5A 2VVEA 4OUSA 4Y1XA 3CL1A 1WLCA 2Q5TA 3GHMA 5FMDA 3THTA 1NXD1 5JAXA 2Y33A 2CGOA 2RMU2 4P9JA 5EHDA 3RI8A 3N35A 1QJU1 1SBFA 4JDOA 2ARCA 2WR9A 2ZKNA 4BQYA 2BRTA 2VNVA 3ZVXA 3MIEA 1R093 5ABJA 4QAWA 4W50A 1R1A1 2G1MA 5GLWA 4BZ4A 4Q4X3 4Z2AA 4HKOA 5F7UA 3GF6A 3A0NA 4COUA 2WDBA 3IAQA 1RVF3 3ZXDA 4A41A 1ASJ1 2EALA 2ZXQA 3T0BA 4XE9A 4AW7A 1HQLA 3VBHC 2DURA 1APNA 2D6LX 2NPIA 4CDUA 1DYOA 4XBLA 2DVBA 2OKXA 4E8DA 2XGXA 3T2TA 1VLNA 4E27A 3VKNA 1SLIA 3ZYBA 4MSVA 1K12A 5IK5A 3UJQA 1F9KA 1HLCA 4X8NA 3R0RA 4Q4W2 1IG3A 4N7IA 4AL9A 4Z2WA 1RUG3 1XNTA 3DN7A 2YZ4A 3HNMA 1I1EA 2CNAA 4ISQA 2BFUS 4D7SA 2EAAA 2HYKA 3LEGA 1N1VA 4IV3C 5FPVA 3S7IA 4XHBA 3WP4A 1R081 4Q0VA 1GZTA 1TME2 2ORXA 2PA7A 4LT5A 2B46X 3PL0A 4XURA 2W08A 5KHGA 5JMOA 1W6MA 1AL23 3ZKYA 1CESA 3PU8A 3PHMA 1RUH1 2VG9A 2HWE2 3O5SA 4X6QB 5DZEA 2ET1A 5FCCA 2EIEA 1COV1 3VD7A 4B1MA 3QBQA 1YFYA 1DQ1A 2AEYA 2JDYA 4UF0A 1C5IA 2EXIA 2D93A 1AR92 2HWF1 5FYVA 4IETA 4UBGA 3N7MA 4DXZA 4ARXA 3OEBA 5A1FA 2X8KA 4UFIA 1YQ2A 4QM9A 1S0IA 1NYWA 4NROA 2VBBA 5C3RA 5D8AC 1JHNA 1Z7S1 3EO6A 5CKMA 1URXA 1NCQB 1QDCA 2VULA 4AGVA 1X9PA 4HSLA 3AZWA 4DZGA 4XUQA 3PDQA 4QX8A 5JXIA 2VMIA 4M01A 2RDNA 3VBRC 1DGRN 1WMXA 4M3CF 1CD3G 3M4FA 4QKDA 4RYDA 2GZWA 3BU7A 5C8CA 4YM3A 4K21A 3ZXJA 5FDBA 2W87A 3IBMA 3K2OA 5L36A 3WDVA 3MFCA 3B9IA 4YZ3A 2FHRA 2WN2A 2ZGUA 4QPIA 1LOEA 1ZRIA 4XDQA 1GUIA 5KC6A 1MZFA 1LTEA 4FTEA 1HX6A 1XNCA 3J8F3 3IAPA 5FP4A 3ITQA 4FO9A 1HB3A 4BIOA 2V73A 2D97A 2VMEA 5F6LB 3VZOA 4C8DA 3QOPA 5HCFA 3WVJA 5HCAA 1Y7BA 4LEJA 3ECQA 5C8CC 5IYYA 1RHI3 1Q43A 4LO5B 1ZZ8A 1GWLA 2XMLA 3JBG2 1FAYA 4GMP3 3ZFGB 2A70A 2IXHA 4YZ5A 3GNEA 1QKQA 1BK0A 3WF2A 4CDQA 1S0CA 3U78A 2ARXA 5AC91 3CLPA 5CADA 1UNBA 1W6PB 1E57A 1QXPA 1EV12 2ES3A 1HXS1 3PUSA 2CAUA 4JKKA 4R4XA 1AR81 2J1EA 5HPOA 4RS5C 1SLBA 3OY8A 2D40A 4FAGA 3SH4A 1BBT1 4AEKA 4CDWC 5FMOS 2ZZJA 4IE7A 2QE3A 1XB9A 1JUIA 3LFIA 3PTRB 3IDAA 5EV7A 3HPNA 5DUWA 4IV1B 5LATA 2BQPA 2RS12 1G9CA 3OGVA 3SKJE 3VD5A 2HWB2 2UURA 3OUJA 1JOPA 3MIFA 2IVJA 5A1AA 1AR71 4DB5A 4AI1A 1UD1A 5J98B 1BVP1 4BQXA 4R8HA 1VBB3 4RR3B 3NV3A 4FSJA 3VD3A 1S2EA 1AJKA 2WQ4A 1A6CA 2Y60A 2YG0A 5LBFA 1KS5A 2RR11 2IWGB 4URTA 3VKMA 3POJA 4BQ1A 1DYKA 3RRDA 4UFKA 5IAXA 2FD8A 2VZRA 1HB4A 1QH6A 2BWCA 5SV8A 4LBOA 4QU2A 1ALYA 4XCBA 3K75B 4ES8A 5FYMA 3ZIXA 4P9WA 4V2VA 1IPKA 3NJZA 4CPBA 1LHOA 1XOYA 3DPRB 5FMBA 2QQIA 3V0AB 1L7QA 1IPSA 1UPIA 4G3YC 1DU3D 2MNGA 3T2OA 1VRBA 3AJZA 3THDA 1NE6A 5F5AA 4A6SA 2BTVC 4DMIA 3QH7A 3ZFEA 4NE9A 4AGRA 4CZSA 1W28A 2WN3A 1RGSA 2BDRA 4HOOA 1ZZBA 4XETA 1C8M3 1H4HA 3PVEA 1KGYA 1MEC3 1CX1A 3SXWA 3CO2A 4C0HA 2FDGA 2F4PA 5FZCA 4K1ZA 3H1WA 1DZRA 4XUOA 2PQSA 1VBD3 4XFGA 1BEV2 2C26A 3DXUA 4ZONA 4P14A 4BLJA 2XLFA 3AFKA 2W3JA 2XHKA 4U36A 1NA1B 3W58A 3RS6A 2X5IC 1ND2C 4LMFA 4GWIA 3CJIC 5A3MA 1K5MC 3P5BA 4AQSA 4CDXB 2WO1A 1C1LA 4MGZE 4WZCA 3CMGA 4N53B 3R4DB 4WBBA 4Y4RA 3BOPA 5FLHA 4IUGA 5JR2A 1AR62 2GC0A 2HWC3 5FBZA 5KXEA 3FHIB 2WA3A 2VCAA 2R0FA 2JJ6A 2P4EA 3SISA 2VZQA 2VY0A 2HWD1 4NVPA 1XSRA 1IKPA 2ZS6B 3POBA 4LIUA 3USSA 3VL8A 4KQ7A 4BB3A 4XEZA 4CP9A 4YG0A 4HL0A 2Q8DA 4YFWA 3FUQA 4H2AA 4HLTA 3AKPA 4N43C 2F4LA 1UKRA 1AX1A 3ASIA 3G6JB 4PIYA 4YVWB 4L0PA 2XQXA 5CEHA 2YGMA 1VRH2 4F3JA 5JOZA 5FYSA 1QQP3 4BQ5A 3AMNA 2W94A 1ZRDA 1M4WA 2VQTA 1O91A 1NT0A 1ULGA 3FBMA 4LLFA 2HEYF 3QD6A 1YJLA 4RHV3 1ZZCA 4BDVB 5K9YA 5BNPA 1AXKA 3KF3A 3I2OA 1W9TA 3ZYJB 1PIV3 2DCZA 5CZKA 4AI2A 4ZKTB 5JPNB 1W99A 2RS32 4OLLA 5CNAA 3RG0A 3E97A 4YVSC 5HCBA 3TN93 3VHOA 1PGL1 1LKNA 2OZJA 4Q2FA 4PDWC 3FHAA 1I6XA 1NLSA 3I3EA 3M8LA 4B3NA 4XQDA 1X8MA 2YV8A 1ZM1A 3ZMOA 1IHMA 3Q8EA 2DV9A 3KMHA 4TTGA 5ANQA 1L7RA 1ODMA 1KS4A 3VZKA 3WP3A 1ZNPA 2WZPP 4C1WA 3I2DA 3RVHA 2B45X 1K5JA 3AXDA 4Z1VA 4FQZA 3U14A 1YHFA 4NRPA 1GP6A 3VBSC 1VBE3 1NCQA 4H7MA 4I0WB 3V56A 2VL4A 3AKSA 1ND3B 1KQRA 4WVZA 2ZGLA 1X50A 4YW6A 3H1MA 4Y33A 4ZZ8A 3U1XA 5DG1A 2Q30A 4R4ZA 5T5JA 4XABA 4ASMB 3NAPC 1IPJA 1NXMA 2OA2A 5IFTA 4ZU4A 1CZSA 2YC4A 1F5JA 1RUJ3 2VQAA 1WA4A 5GLVA 4BM8A 4BYYA 4E8CA 2LW8A 5HBAA 4CTEA 1FI2A 4JHTA 1ZBA3 4Z07A 5FIXA 5LA2A 4J1WA 2ARBA 4BK4A 4HVQA 1FMD2 1UOJA 3N4MA 1J84A 1W6NB 2CDPA 1ULDA 4MV2A 3ZIWA 1AYM3 4Z92B 1LRHA 1D4VB 1MS1A 1OKQA 1GLHA 4QHOA 1WW7A 5FV3A 2EXKA 4B4PA 1LOFA 1QJU2 1TE1B 2WFPA 3RMXA 1RMU2 1OF4A 4P9YA 2HKXA 4H55A 4Y20B 2EICA 1K45A 5F32A 5CG9A 3ZDSA 4DRVA 1PO13 2WAOA 3B5LB 3CJXA 4AE2A 3ZFGA 4Y5Z0 1HIXA 2AZ5A 2D5HA 2LRPA 3O1OA 1K3IA 2XQRA 2RJLA 1PK6C 1W6PA 1QH7A 1WMDA 2JXAA 1QJX3 3ME2A 4BA6A 4D94A 4LXLA 4ZU5A 4OHWA 1ASJ2 2J1SA 1ZBE3 3J7NA 3S5AA 1ZA4A 1W06A 3TB0A 1UYXA 1EPWA 1W6QA 2UWAA 2ZPXA 2ZX1A 4BQ4A 4Y1VA 5H9PA 1CAWB 1WD4A 4XDOA 5FZKA 1FPN3 3MUY1 4S2FA 2W2IA 4HANA 4IV1A 4HONA 3VB9A 5T5OA 3HT2A 3FLRA 1UU5A 3PLQA 5LA9A 1EAH1 1YWKA 3POYA 4B4RA 5CFCB 5DAWA 1LEMA 2E53A 5F39A 1MQTC 3WR0A 1UY2A 1OBNA 3WHTA 3I49A 3WOGA 3DV8A 3LAGA 3GCWA 4JQTA 1BZWA 1HRI2 2D3PA 2XVKA 5E8AA 3BTAA 3KLSA 2Q8OA 1RUC1 2VOXA 3DECA 3N9PA 4PIXA 1M06G 4D69A 2JB4A 5FJKA 3VV1A 4ZU7A 4QT6A 4GB31 1IKQA 2WLPA 5A1LA 3R4SA 4LULA 5FY4A 1GP4A 1O5LA 1NE4A 3FX3A 2YYOA 4H14A 1PM7A 1YLLA 3OCPA 3V0AA 4MUVA 1VAMA 4HETA 1REFA 1SCRA 2ZGTA 4A3XA 4JDNA 5IVCA 3AMPA 3I3MA 1XYOA 4Q4Y3 2GDFA 4EZ4A 4NRMA 2WJSA 4CCEA 4IEYA 4GULA 4D6QA 5EJ3A 3T4VA 3VBFA 3I3QA 4MGTA 1UIJA 2IXKA 5KXBA 4LO8A 1DF0A 1W9SA 2PLV2 5LW9A 1ULCA 2VGDA 3IMMA 3KWVA 5A32A 3VUOA 1S1AA 5AVAA 5FZAA 2WA4A 4DFSA 4ZS2A 1DIWA 5LA1A 1DDLA 5FZGA 4NPMA 5KHIA 1W0NA 4IGQA 5CKNA 2X10A 5BXXA 3K4DA 1WBFA 1QNWA 1OVSA 5ABJC 5J36A 4L11A 4EE2A 2ZX4A 2ZX2A 1V00A 3VDDC 5A33A 2UU8A 5FZOB 5KHJA 2B4KA 2XH6A 2IXLA 3OG2A 3M1HA 3MI8A 1S0BA 4F83A 2WKKA 3VBUB 2WC2A 2PELA 1C4RA 1RUE3 3PJYA 4QKBA 4R9BA 1V6JA 3ZXAC 4H3WA 4MXWB 4N8MA 1JS9A 2VMDA 2GMMA 1D4M2 4N7UA 4QQLA 2H6BA 3SH5A 3ZFFB 2OQ6A 1UX7A 2BOJA 4YVWA 3T4HB 2VUAA 1F35A 1W2AX 3CU7A 3P3NA 3WNPA 4JQRA 1YO8A 2W1WA 2ZHMA 2ILMA 3DYOA 4BPZA 4YW7A 3KV9A 3WLUA 5A7WB 5DZGA 1J1TA 4XFHA 3VDCA 1OH4A 2ZMNA 4QPGA 2ZKLA 3ACLA 1CAUB 4PLNA 4KBZA 4AWDA 5LRSA 1MZEA 5FZ0A 1SEFA 4M0HA 4UI9L 5T5PA 4O61A 3UV9A 3AP5A 2IXIA 4Z82A 2WZR2 4X6RB 3FLPA 1GFF2 3VDBA 1X82A 4I30A 5ACA2 1CWPA 5F37A 4LQRA 1POQA 2WS92 3GZTB 3MF9A 1RUF2 2WRAA 2ZHNA 4INDA 4JKLA 3ZX7A 4QWNA 4EROA 1PMIA 1LCLA 2R32A 5EJ1B 3AK0A 2Q4SA 4OFGA 2RV9A 1CAVA 1KFXL 5DDJ2 2I74A 4CXXA 3UNPA 2D6MA 5IUQA 5TSWA 3LSEA 4JVAA 1OOPA 2WYSA 2ENRA 1BXHA 2JDPA 3KZ4C 3LD8A 5J1XA 2EXHA 2PHDA 1ND3A 3NNFA 2YDEA 5L7OC 2YHJA 1W2UA 2WT2A 2AEZA 5FKCA 3AKRA 2W52A 4ZHNA 1MS9A 1PGW2 4WVMA 2WFF2 2H6CA 2VZ1A 2OW4A 2C5DA 2XUMA 2XWBB 1H8TB 5JXJA 1CONA 3H3LA 1A8DA 2BNNA 3NMBA 2BFUL 5BNOA 2NMNA 1UY3A 4XYXA 4BIFA 2QQNA 5JXHA 2FQPA 3LEKA 5KHHA 1OF3A 2VM9A 2B9UA 4CPBD 1V9U1 5F9TA 1A34A 1PVC1 2NLRA 4YGBA 1PO21 3O1UA 2IFRA 4AVAA 5HI0A 1VBA1 2R071 5CU1A 5GZDA 2VUCA 4QU1A 4YW2A 1PGSA 1MZ6A 2Q8CA 2VBPA 2OZ6A 3Q8BA 3OYWA 1Z0HA 4Q8LA 1RUD1 2AR6A 1LESA 4BHPA 4KU7A 1KXGA 3D0SA 2D6NA 3N7LA 1XE7A 4R9AA 4IEOA 4M00A 3AMHA 2OUHA 2Y64A 3HNBM 3LWCA 3LE0A 1DZQA 4OI4A 2Z2SB 4Q4W3 4BQ2A 1CPNA 1N1TA 2JG8B 4K20A 4AFBA 1W6MB 5JLVA 1RINA 2P1BA 4NHMA 5J09A 1U12A 5LB6A 1CAWA 1LHUA 1QJY2 2G9FA 5GLTA 3VKOA 4L92A 3W9AA 5C4WC 5BY5A 1PNGA 2RHPA 1E5SA 4FFIA 1EPZA 2VJXA 1FV3A 1IG0A 1WLDA 1N1SA 1TME3 3B69A 1OT5A 2X09A 3KVAA 1TMF2 1S55A 4HPKA 5F3GA 3O0WA 3E6DA 2LM3A 4EN8B 4AI8A 3ZYIB 4BMBA 2VTXA 2QQVA 2Z4FA 4GJZA 4W6XA 1NZIA 2C9AA 4B1LA 2A7AA 1WZXA 2HWE3 1OURA 4LBMA 2XJRA 4DUXA 3LDKA 2PHWA 3BN6A 1QJEA 4I3PA 5FP9A 2BBVA 1UL9A 2FDIA 3LA7A 4ZXKA 5I8SA 1AR93 4KI5M 2B9VA 1ZRFA 1R091 4CP1A 3EB7A 4LE3A 5A7PA 3E5XA 2AC1A 4E2QA 5C8CB 4W6YA 2WT0A 4CCMA 4AVVA 1FOD3 5F3IA 1QMJA 2KM2A 4QPIB 5E1RA 5F5QA 5H9QA 1RVF1 2VAUA 4W4ZA 2V5DA 5FO9B 1DQ2A 4LIVA 4Q4V3 3BTXA 1JZ3A 4HSJA 2P3KA 3MLJA 1REEA 4HMZA 4COWA 1J3QA 1SDWA 2VXRA 5FMOL 4ITCA 1CPMA 1KJLA 1SPPA 2RJKA 4IE6A 4KWLA 5F3CA 1ZZ6A 5FYIA 4BXFA 5DUXA 2J1TA 4TWTA 3AP4A 3JD73 1UY4A 2WNUB 3VKFC 1LECA 1YFWA 2JENA 5FYZA 2DBIA 3NJYA 4O9EA 3AMMA 1NQDA 3AP9A 3OEAA 3Q8FA 4N90A 1W3VA 3UYJA 3RZGA 1JYVA 1VJ2A 2QZ2A 4ARYA 1RUG1 3HBZA 3MW3A 4Q29A 4QGMA 4CCLA 2ZEWA 1POV3 4QPYA 5A70A 2ZX0A 3FN9A 5FZOA 3OGRA 2RM22 1WGPA 3JBG3 4WV8A 2DFCA 2Y6HA 1U0AA 2KA3A 4QB2A 3M7AA 1QY4A 4NMIA 5EQUA 3VZMA 5DAXA 1SACA 3H0OA 3VBUA 5I0RA 5HXMA 2E32A 3F2ZA 1AL21 4MGKE 2YXSA 1EV13 4MXWA 2VMGA 1QXRA 3AFGA 3GALA 3DKQA 2DCTA 4ONUA 4OVEA 3ZFFA 4NIHA 2PHLA 2VXJA 1UMHA 4L8QA 1J3RA 3BPSA 3WZ1A 2QBXA 3HQUA 3OGJA 4MGSA 4CYDA 2RS13 1O3TA 1GNHA 1UU6A 2GNBA 1PHMA 4XJ9A 4RA0A 2HWB3 2A5ZA 2BGPA 5IJRA 3TBDA 4FVVA 2J1AA 3IZOA 4XJAA 4D8MA 3MF6A 4AFDA 3I97A 4RSUA 4UAPA 4K3UA 1NLQA 3PU3A 1DP0A 4TLGA 4Q0PA 5K0UA 1WCUA 3VBOB 2VO5A 2XDVA 4CCJA 3I2HA 4PQ9A 5GZFA 3HIFA 3TRSB 4JTOA 3ZFEB 1AJOA 2LROA 1UYPA 2OQ7A 2VTXJ 5BYNA 5I0SA 2D3RA 2Y8KA 1AYN1 1SDDB 1LHNA 1SLCA 2V4AA 4GIQA 5C6CA 1D0HA 5GZGA 5I8TA 1EAH2 5FZ9A 4LBKA 3PUHA 2XOMA 2Y6GA 1PNFA 3J8F1 5KHKA 1OLME 3H8OA 1OLQA 1JXNA 2ZGPA 3IWZA 4FPCA 1Q8OA 1W9FA 3A7QA 2EIGA 2VVFA 1H6XA 4IESA 2MHFA 2QQWA 3WUCA 4RQPA 1RHI1 2FCTA 1UZYA 3PJQA 4SLIA 2WQZC 3MW4A 4IE0A 2X29A 3FLTA 4F7ZA 4XTPA 1AHSA 3GJAA 4LITA 4D0QA 4QD2A 2P3IA 1UZ0A 4GMP1 5FZ1A 3CEWA 3IDEA 4ASLA 3FC0A 5DUUA 1GZWA 1QF3A 3BGAA 3FJSA 1H8TA 5M0TA 4I02A 4KGGA 5E88A 3D5OA 3GJBA 2QQMA 3OPZA 4AFAA 3WQ7A 3ES1A 1S2KA 2VOVA 5FQ0B 3UKNA 4A2UA 4AVSA 3TOJA 4CP9B 2TUNA 2GH8A 3PVBB 4ATEA 5IATA 2DF7A 3H8XA 3M3IA 4EN6B 1UY1A 3ORJA 4NWVA 1R64A 1AR63 1UCXA 1Y9MA 2JIGA 5EIYB 1ULPA 1DGWX 1XU2A 2JG9C 3B9CA 3PIGA 3PVOA 3TYJA 5FFOC 3SCGA 2W39A 2F6BA 4D6RA 5LBEA 2BERA 3I2KA 3KCYA 2PXJA 1JZ8A 4QX5A 1AX0A 3ACGA 1VBB1 4MXVA 4W8JA 3I8TA 2VZVA 4FPOB 4P9LA 3VHNA 2GC1A 3SITA 3WNXA 5BNPB 4A7KA 3JZVA 2XBO2 3ILFA 2UWBA 4WM7B 2D44A 1S2BA 4NR1A 2E63A 4Y26A 1VRH3 1G9DA 2JG8A 1SG3A 3KD4A 4AEDB 1PMJX 2VD7A 1JYXA 3ALQA 1RUI2 4XUNA 4Y3OA 4QB1A 2JE9A 1N3OA 3HQXA 4CXWA 2XR4A 1XNAA 2CL2A 3EMRA 4LO7A 3I2FA 3UL2A 1Y3TA 5FXWA 2H0BA 4E4HA 5JXGA 1EY2A 4CCOA 1I5ZA 4Y5SA 3WDXA 2RS33 3MLKA 1YFXA 4GWNA 1QDOA 3J4UH 4UXAA 1GU3A 1XYNA 2JDMA 2OPWA 5G05L 1ZRRA 1C8M1 4IV1C 4M3CE 4PT6A 1OVPA 1OFNA 2FMYA 1F2NA 3KV4A 5DG2A 3WF3A 2WZEA 3ZYPA 4AAXA 2ZHLA 3ZR5A 2IC1A 2XKPA 5LBCA 5JOYA 3I4IA 4X8PA 2VNOA 4RR3C 5LK7B 1VBD1 1EUUA 2PN5A 3RYPA 3T09A 1ZRCA 4PF5A 2R6QA 2W91A 3LEIA 3OUHA 2UYBA 1WD3A 3C7OA 4LJHA 5FWJA 2C4XA 2YU2A 1BJQA 4FPFA 2ZJCA 3WY6A 1QWRA 2R062 3I59A 4OCTA 4I2OA 4NJ4A 1UMIA 5FO7B 2GN7A 2J1VA 5A6ZA 2E26A 1O8PA 3DPRC 3NV4A 3VBHB 2J42A 3FZ3A 1DG6A 1FV2A 2QDNA 4JV4A 2B39A 2JDUA 2KXLA 4R9CA 4OQ8A 1FMD3 2I2SA 1YXWA 4XZUG 5T55A 1VE0A 2N7GA 2WNUA 3CKHA 3RSJA 3ILRA 1BQPA 4KG8A 1YRZA 2X53S 5DAQA 1QQP1 2GH2A 3ZYHA 3UGFA 3ROUA 1RMU3 3ZXKA 1H9PA 1UZVA 5LY2A 3K51A 2HEWF 1HN0A 4I3GA 3R05A 1SQ4A 4RHV1 1WUVA 2L9LA 4DRRA 3GCXA 2RVAA 3F95A 1W6QB 1NA1C 5CFDA 4PJYA 3RPQA 1PIV1 1H1MA 2RDQA 4HG6B 1HKDA 3FHQA 4Q8KA 4CDXC 4YW5A 5T52A 5FZIA 5FKBA 5A6QA 4NO4A 3TN91 4N53C 5IVEA 4UBHA 4NAOA 4LO4B 2JDZA 4FP3A 5FUNA 3WF0A 2DBNA 2JD9A 2NQYA 5I91A 1H2LA 3M2MA 4HBNA 4LHKA 5LA0A 1MVEA 3GBGA 4IEPA 3JXSA 4YARA 1WMFA 4LHSA 2BJSA 5FJHA 4D3WA 2VZUA 4N9HA 2E7QA 2JKXA 3Q8AA 1VBE1 1OPMA 4TSVA 1HQWA 2Q8EA 3SNMA 1JHJA 1B35C 3VL9A 4BJ0A 1GQPA 3K77A 3V65A 2XL9A 3ZDVA 3BODA 5H9SA 4LBQB 5C9AB 1HRI3 3VBOA 1BKZA 4UWDA 3DKWA 4U2AA 1V70A 3VBRB 1SFNA 3WQ0A 4NWWA 3MPPG 1CAXB 5BNNC 2P3JA 1RUJ1 3WQ1A 3WF4A 2RS52 3VBFB 1KDKA 1ZBA1 5A3OA 4KWJA 1FX5A 3ZN6B 4MADA 5J37A 2K0GA 2QQLA 4IEVA 3KV6A 4QM8A 1AYM1 3FL7A 3LFMA 5A32B 3K48A 2R0HA 3A23A 3AYCA 3I2JA 2IXJA 4IQPA 3WG3A 4XXPA 1IQAA 2FZ1A 1ENQA 4P9GA 1REDA 2WSUA 4GQ7A 5HXVA 4WZFA 1BLZA 4RGKA 3VGIA 4EWEA 1R092 2PLV3 5F5CA 5JOXA 2NM1A 3O7OA 1OC1A 4UW4A 4D6SA 1XYPA 5LASA 1QOSA 5IVVA 3AZYA 4D7YA 5IK8A 4QGLA 2VCCA 3CBNA 4O65A 4AHYA 5A33B 1QJX1 3LDBA 2ZEYA 3DGTA 5IVYA 2FBEA 2WNVC 4UYBA 1ZBE1 5C8WA 5FQ0A 4XFBA 4QXCA 4ZS3A 2AREA 3I2IA 1JMUB 2OPKA 4B7EA 4QGNA 4W6WA 1FPN1 1X9TA 3MW2A 3EBRA 5FYTA 1RXFA 3MIBA 3P6BA 1MACA 3KM5A 4KG0A 4E4ZA 4XDPA 2D6OX 1X36A 2XL7A 4E4DX 1CN1A 1NKGA 2A75A 1OLRA 3ENRA 1W3XA 3NV1A 2VE1A 1GBGA 2CTVA 3LB9A 1D4M3 3I3DA 4GKYA 2EAKA 3ZPOA 4ISRA 4WM7A 1OD3A 4QPGB 2RG4A 1LJ7A 5EJZB 5HCHA 2Q1MA 4G4FA 1O6UA 3CDZB 4BWOA 4JGZA 4AEDA 5DQ0A 2LS6A 4DO0A 3O1PA 3S5QA 4Y22B 3GGLA 1QJZA 1G9AA 3MPBA 1AL0G 2JD4A 2JB8A 2E51A 4LHLA 1WCQA 3AXEA 3WHUA 1OFSA 2FDFA 5GM0A 1E5IA 4JGYC 3RMYA 3U0ZA 3ACHA 2B42B 3K46A 4Q4Y1 4C90A 1CAVB 3PMEA 1HV1A 2WZR3 4B29A 3K4ZA 3RZLA 4GD4A 4DS0A 5ACA3 4GH4C 2WS93 2E7AA 1DQ0A 1OOPB 1RUF3 1BMV1 3O1TA 5CFCC 2G9GA 3T3YA 1LGNA 1YYNA 3THCA 2IVIB 5FPUA 4OHZA 1FNYA 4LUMA 3ZMNA 3C7GA
chains in the Genus database with same CATH topology
2D3SA 2GU9A 5DDJ3 1GQHA 4COVA 4WVMB 4G9SB 4XJZA 3ZSMA 2EVXA 2R042 3IT8A 4PBPA 4COYA 2DCYA 4WM8C 1ND2B 5BNOB 3CJIB 1YIFA 3AB0A 1H1IA 4MX3A 3L2HA 2MEV1 2AGSA 3O12A 1AYN2 1Z78A 3MICA 4OHYA 4C91A 2WFF3 3VBHA 5GALA 3MGUA 2ZGRA 3JB8A 3AYDA 1VIWB 1RUE1 1S0JA 2PHUA 4XFIA 3OYWB 1R1A2 3ZYGA 1FXZA 4MGIE 1UX6A 2VUJA 3H9AA 4RFT0 2A6XA 4J6GA 2PHFA 3ST7A 2ZMLA 3T1MA 2PFWA 1HRV1 4XQ4A 4IV3A 4DNYA 3VHRA 4HN0A 3RJRA 2DVFA 4XF4A 1S0DA 4HPKB 4YVSB 2XLAA 3WDYA 4YZ4A 2ETEA 1QJY3 1VAVA 5IK7A 1LGBA 3EXUA 4JCKA 4NN0A 4XMIA 4AGGA 5DZFA 3ZFFC 5JZGB 4E2SA 3HD8B 4YGCA 1UKGA 1TMF3 1RC6A 3INAA 1OA4A 5AFEA 2P2KA 2ATFA 3OJBA 1R082 5D8AA 1UAIA 3CNAA 3VBSB 3AJYA 4LBQA 2BNMA 4QQHA 5C9AA 1TEIA 3B94A 3BALA 1RUH2 3IN9A 3VBRA 2DFBA 1COV2 4HK9A 1CAXA 3NAPB 4QQPA 1C1FA 1GZ9A 4S2GA 1NLRA 4Q1RA 2QVSB 3H8UA 2HWF2 5I0UA 3ZN6A 4OHVA 1YI9A 2DTWA 2O1QA 1MS4A 3NW4A 3MFAA 2JE7A 1DGWA 3M3QA 1JW6A 1Z7S2 1VBC1 4NOTA 4OI1A 2ZMKA 1LOGA 3M3EA 3UKVA 2BNOA 2Y0OA 4WVWA 1YUDA 4AHXA 3L2YA 5F1RA 4Y1YA 2D5FA 2ZGMA 1O4ZA 3AM2A 4FT8A 4BLIA 4YW4A 4E9KA 2R1DA 4Q4W1 3IM0A 1PK6B 1VAKA 2LTNA 4IEQA 1WCSA 3ILNA 4RS5A 3HAGA 4L9BA 2UYAA 1H8TC 5CVRA 2E7TA 1QNYA 4B4QA 4CDUC 1NQJA 4IEXA 4PLOA 2RM23 3M3CA 1TME1 4AQTA 2ZGQA 2A3XA 1V6KA 4Q0UA 3ZN5A 2BVVA 2HWE1 3QCWA 4XTMA 5AC92 4AHZA 3AZVA 1OI6A 1KRIA 1MS0A 1HXS2 4XW3A 4AQ2A 1AR82 2QQPA 3SHRA 3WW1A 3B00A 4RHV2 5K0UB 1Q56A 1BBT2 3NKGA 4Y22A 3ZN4A 3IIAA 3ELNA 1HDKA 1OSGA 1DZTA 3PVNA 1FOD1 3H50A 1W0PA 2B7YA 2IZWA 1V6IA 2G4IA 1V6OA 3LA3A 4LNVA 2JEMA 4Q4V1 1AR72 1LGCA 4KL1A 1C28A 4HFSA 2NZ9A 1G9FA 1SLTA 1IGOA 1ZZ7A 2RR12 3ZPYA 2O0OA 2Z5WA 2WWSA 2UWCA 3KT1A 2TEPA 4RQPB 3WUDA 2RMU3 3IDCB 4AYUA 2XWJB 2ZBJA 2VECA 4AI3A 4B7KA 1QGLA 3JD71 3S30A 4LBJA 1FT9A 2SBAA 1DGRA 2YC0A 1O3QA 3PMSA 2EXJA 1GZWB 4E2GA 4H7LA 2NMOA 3RZZA 2GNMA 5BNQA 2X5IA 1LHVA 1ND2A 2BEOA 3AZXA 5CBLA 1CQ9A 3CJIA 3OGGA 2OVUA 1JYCA 2D6KA 4LBLA 5T52A 1POV1 4P5HA 5C8CC 3U07A 5CA6A 2ZX3A 1JYIA 3VDDB 1DLLA 4QPIC 2YGLA 1V6NA 2FMDA 4KU8A 4BH9A 3QH6A 4CEYB 1Q8PA 1EV11 2CWSA 4M0NA 5T3NA 3N7JA 5JWPA 3AZZA 3SMHA 1LB2A 2QKDA 2BWAA 2VPVA 2WT1A 1Q5OA 1KD7A 2I45A 2RS11 1OPOA 2LUWA 2XB6C 1DQ5A 2YROA 3LKJA 4JAAA 4EJRA 1YFUA 3KT4A 2HWB1 1GICA 1PVXA 5T5LA 4KNCA 3B93A 4CDQC 5H9RA 4LA3A 4AFCA 4Q26A 2HWD2 2XBO3 2C0ZA 1H2KA 1YIPA 2XPJA 4YVSA 2ZGOA 1OQEA 4MLOA 1RUI3 3KCCA 3AKQA 4FPKA 4MH0E 5JI9A 1CVNA 4Q1PA 5JZGA 2VOKA 2XJPA 4FOYA 1LOAA 4LA2A 5LEJA 1WMEA 5JCTA 4Q4X1 3VBSA 3VN4A 3WDWA 3S6PA 1G6NA 1XRUA 1W0OA 3NVCA 5GJ6A 4OUMA 1C8NA 1PGL2 4J1XA 1HW5A 4I0BA 3I59B 1X7NA 3NAPA 2WSVA 4XFAA 2OUJA 2ZOEB 1TNFA 1ULFA 1OA2A 4XIOA 4BE3A 3VBOC 4YGEA 3O0XA 3USUA 4HZFA 5DUVA 3ZFEC 3EHKA 1WLWA 1MR5A 1CR7A 2R063 3M70A 1VB4A 4RD7A 2PAEA 4A7YA 1AR61 1Y43B 2UY9A 1UZZA 5J7MA 3FE5A 3UKTA 3KT7A 1DQ6A 1U5YA 3GZAA 2ZAHA 1RJ7A 2Z69A 2XJVA 4YNIA 3KB5A 1WW4A 5CFDB 3IPVA 1RUNA 4LR4A 2AH2A 2AUYA 2A6VA 1GSLA 5T54A 1PK6A 1VRH1 4RGGA 4XMAA 2CAVA 2MEV2 4YZ1A 1VB2A 2A73B 2I07B 5CG8A 4XF0A 2YUEA 1AUYA 2GALA 2WLQA 1C57A 2YMZA 2V09A 2RS31 3LA2A 1PZ7A 2XLGA 4QMAA 4XPVA 5J48A 4PIZA 1FYUA 1Y9QA 3NL1A 2QCSB 3B02A 3URFA 3MYXA 3NSTA 1MS5A 4FXKB 1V6MA 2WL1A 3GYDA 1HRV2 4TYSA 1NY71 4N9IA 5BNPC 3NO8A 4LUKA 3SCHA 5JOWA 4EN0A 3AKTA 3VZJA 5GLZA 1D2SA 4HVRA 3WCSA 4YM1A 4QQOA 5AFBA 1BVVA 2MPFA 4L99A 4AFMA 1IOAA 3D4KA 2A6ZA 3ZXFA 4Q0SA 3LOIA 4SBVA 1R1ZA 2RS53 1N3PA 1RUC2 3H1YA 1UF2C 3POSA 1FMD1 2B8MA 2VH9A 4GB32 4GXLA 4FOQA 2CGPA 1NCRB 1ENRA 1NCQC 5JDBA 1N1YA 1ZZ9A 4AK3A 1BEV3 1DQ4A 3W59A 1RMU1 2DUOA 2QUOA 3H3ZA 2HEVF 2DUQA 1PZ9A 4IL7A 4XIKA 4LBQD 3VDDA 1J59A 1CJDA 1FATA 4CEYA 4EWDA 3JB4C 1AVBA 5FAXA 4FPYA 3P3PA 5CIRA 4XHXA 1VBC2 2GNDA 1J58A 3D8CA 1LOFC 2Q0AA 5EFUA 3X29B 2BPA2 5CB7A 4FXGB 4CEWB 4JGZB 3ZFGC 2A6YA 1HV0A 1SCSA 3WP6A 2VMHA 3OD4A 5BPXA 1KFUL 1OQ1A 4Q0QA 1HRI1 1PZ8A 5KBFA 1LODA 5FOBB 1X33A 1C5HA 3HWJA 2PHRA 2D98A 3C3VA 4ORFA 4K6BA 2VOWA 4AXOA 4Y4YA 3THPA 3G7DA 1AXZA 1MEC1 1ZX5A 4AQ6A 5JR7B 2DVAA 3U10A 2DVDA 1H4GA 1ZVFA 1MS3A 4OZXA 3QLQA 3V0BB 4QHBA 4V1PA 3ZXEA 3UJOA 4FPJA 4BCUA 1OMIA 4F8AA 4AVBA 1UW8A 3J9SA 3WV6A 2PLV1 5L7OA 1GYKA 1GANA 1VP6A 1FOD2 1LOCA 1JBCA 2HWC1 4IERA 2DCKA 2ZACA 4WVVA 3AP7A 5EXOA 1C3HA 5C9AC 3RI9A 4FP2A 1W39A 2R043 4Q4V2 4P9XA 5T50A 1QHDA 1NOVA 5IT6A 3VBFC 2NYYA 2PHTA 1JN2P 1AYN3 3FUOA 3GBFA 4YG3A 3C2UA 4YSFA 1QJU3 5J96B 1LENA 2JG9B 3JD72 3JQXA 3JUUA 4JTNA 3WG2A 1G9BA 2D7FA 3SH3A 2JKBA 4IXLA 1D4M1 2VW0A 1R1A3 1JOJA 1XQNA 1YJKA 1ZREA 4IV3B 1J3PA 3LGRA 2OYZA 2AYHA 3KQRA 4FPLA 2YY1A 1O4YA 1YNAA 4OHXA 2E6VA 1QXJA 1ASJ3 1V9U2 3ZSEA 1PVC2 1AZDA 4KH9A 1PO22 2H0VA 1VBA2 2BYVE 2R072 4DQAA 5C4WA 1F5FA 2ZCWA 3FBYA 2CY6A 3GHNA 3VHPA 2XJTA 1RUD2 2XJUA 1BK1A 3WG1A 2WNEA 2GMPA 2WZR1 4YVWC 3TNQA 5ACA1 5KC5A 1KJRA 2R1BA 2WS91 4GWMA 4YM2A 1RUF1 5KXDA 5EWSA 1H0BA 5D8AB 3LZZA 1W6OA 1VALA 4HK8A 1UU4A 4PCRA 5LEKA 5LK5A 4HVOA 2PAKA 5FRAA 5DDJ1 1Q8SA 1H9WA 4L97A 4LE4A 3WX5A 2EA7A 3ATGA 3Q9OA 1I9RA 4QPGC 3OTFA 3AMQA 2Y38A 2ERFA 4YFZA 1R083 2QZ3A 2ZA9A 3MIDA 4RGAA 4MZUA 1RUH3 1H2MA 2VQ0A 1PGW1 1COV3 2WFF1 3AYEA 4DPNA 5GLUA 4YZ2A 2BUKA 3EQEA 1H2NA 2HWF3 3M3OA 2CYFA 4AEMA 1PO11 1NCRA 3B01A 2VU9A 3CF6E 2Y0IA 1GV9A 4NHKA 1OOPC 4Q4X2 1Z7S3 1ND3C 3BCWA 3O14A 1LR5A 1G7YA 1BCXA 2VVDA 1RVF2 4XF9A 5I8YA 3B7MA 3WG4A 1HQNA 4RS5B 4XOGA 4FOWA 2C1FA 5JSRA 4CDWB 1WW6A 1EYBA 1WW5A 3B3QE 1WCKA 1XNKA 3ZXGA 5BNOC 2NP0A 4R52A 4XILA 4K1YA 2XG3A 3HR9A 4Y24A 2V5YA 5K8SA 1WCDJ 1QJY1 2ZGNA 3ZYRA 4FOVA 1RUG2 2CV6A 1MZ5A 3D6EA 4CEWA 1LULA 3PTYA 1DYPA 4FTSA 1TMF1 3MEPA 5JMCA 2WINB 3KGZA 1T6GC 4AEJA 3GBWA 1B35B 1KITA 1UMZA 5AC93 1N47A 3N36A 1WLTA 4M3CB 2QDRA 4Z8BA 1AL22 1YI7A 1HXS3 1AR83 5D1IA 2D43A 1BBT3 3IDBB 1UN1A 5BNNB 3S0MA 5JPMB 1XXNA 5JSOA 2RE9A 1DGLA 2GMEA 5DXDA 2FZ2A 3V0BA 3MIGA 3JU9A 2P37A 1O3SA 3MZHA 1AR73 4I0AA 3ZSJA 5FPXA 2K9ZA 1GQGA 3JCIA 2RR13 4HT1T 5JZGC 2X5IB 1NY72 1N3QA 3NKTA 1K5MB 3ETQA 4FPHA 1IZ3A 5FREA 5I93A 3BIWE 4FBFA 4DY3A 5BV6A 1SLLA 3U4XA 3J8F2 1SBDA 1OHFA 2WNVB 3WDUA 2ZZQA 1IS5A 3SLIA 4YM0A 5KXCA 3AYAA 3FFQA 2JECA 2O8QA 4N43B 2D6PA 2RM21 2TNFA 3U11A 1RHI2 3ZSLA 1ZYBA 1IS6A 1G8WA 2A3WA 1O7FA 2JG9A 2QNKA 5IK4A 4QQ2A 2ZTNA 2ZHKA 4FPGA 3TNPB 2PQQA 2B5HA 2ET7A 3HMYA 1AX2A 1JTZX 2PYTA 1TQ5A 3IKWA 1CIWA 5JVVA 2IXCA 4FTBA 2Q1ZB 5LRRA 2BVBA 2PTMA 5FTTC 1S0GA 3QACA 4AF9A 4YG6A 4HKWA 3GZUC 3H3UA 5E16A 4XZPA 4PDWB 1RUOA 2BW8A 2UY8A 4PBOA 3VBUC 2GC3A 3RYRA 1QOTA 4DINB 4JRAA 2HWD3 4XJWA 2GC2A 4JGYB 4DOUA 4FAHA 1VBB2 4W65A 4NHLA 1A78A 2TBVA 4FCAA 1VR3A 1EP0A 4L2NA 4PLMA 5JSPA 4GH4B 5AVPA 1DBNA 2RMU1 4DY5A 1NG0A 1GZCA 3S7EA 3V64A 2P34A 3WW2A 1RIRA 3RQ0A 4AVTA 4RR3A 3T1LA 2OIIA 4FQ4A 1OQDA 1H8VA 4YW3A 1QOOA 4XF3A 5K0UC 1O3RA 2JICA 5L73A 4WM8B 3VKLA 3USUB 1GNZA 3WDTA 1ONAA 4I01A 4JC1A 3H7YA 1C8M2 2YPJA 4MYEA 1MEC2 3DPRA 2O8OA 4A7ZA 3NWKA 5BUVA 5JIAA 4IEWA 4EN7B 1XNBA 4JDMA 2SLIA 1VBD2 3D0JA 2DCJA 5C33A 5GZEA 4UW6A 3H7JA 2DWRA 3KSCA 1AF9A 1I3HA 4RQPC 2JX9A 2XKOA 3IPVB 3WXPA 2NN8A 5A3LA 4YLZA 3JQWA 3OBTA 2R49A 3R6SA 3RNSA 2P17A 3KGLA 2HWC2 4YW1A 1BYHA 4CDWA 2ZGSA 4XFCA 1NA1A 3RDIA 2Z42A 2XBO1 3E5QA 1A3KA 4LTAA 5EZWA 4CDXA 5FLIA 3D82A 1S0FA 2VW1A 4XJUA 2DU1A 1POV0 4N53A 2K2SA 2IFWA 2MEV3 1RUI1 4XFFA 4XBNA 4LHNA 1MQTB 1QQP2 4QXKA 2R16A 4CEYC 1YCIA 1OD5A 4HKLA 4BMEA 1AR91 4GALA 1ENXA 2GNTA 3VLBB 4XF1A 4C0BA 5JIUA 1PIV2 5CAZA 1GKBA 3POWA 4Y1ZA 4LLOA 3KCXA 4OI2A 1B35A 3VZNA 4M3CA 2JG8C 3TN92 3E6CC 2R30A 4MVTA 4RL7A 4OULA 2PAMA 1LEDA 1S0EA 1XE8A 4HN1A 4B8EA 1HRV3 5BNNA 4P9IA 4IEZA 5GKAC 3LOBA 1LU2A 3ZSKA 3A4UA 2DTYA 1CX4A 4GKXA 4KWKA 3WW4A 2EF6A 4EN9B 3E6BA 1A8MA 1EAH3 2R061 1B09A 3RWNA 1VBE2 2PHXA 1F8VA 2XVLA 4CP0A 4S2DA 1RUC3 3J26N 3TAYA 1RJ8A 4NPRA 1O5UA 1K5MA 3RYKA 4GB33 5SV5A 1RUJ2 5ABJB 1SMVA 1DFQA 3LCPA 5GZCA 3JBG1 3I7DA 4MGYE 1IS4A 1ZBA2 2DUPA 1F31A 1V6LA 1RL3A 1AYM2 1RTVA 2WNVA 1TNRA 4JRLA 5KWRA 3BOWA 1O4TA 4R9DA 4N43A 4UW3A 4CDUB 5J3UA 1D0GA 1PO12 2AENA 2W68A 1W6NA 4IEUA 4XJ8A 1JH5A 2WNUC 4COZA 3MIHA 4AHWA 1VBC3 2QJVA 4GA9A 1QJX2 1U5ZA 4I09A 3N7KA 3DUIA 4Y20A 1MVQA 5EYYA 1ZBE2 2WIIB 4K40A 5L19A 5JI7A 4BOWA 4TLFA 1ULEA 3APBA 5CFDC 1FPN2 4XBQA 2GN3A 4PDWA 3IMNA 3SCFA 3OD0A 2CGNA 3HT1A 4META 3WP5A 4K7JA 4XQWA 1RITA 1LU1A 3ZO0B 1CGPA 4JGYA 3ES4A 1SFYA 3A0KA 2Y26A 1LHWA 4YYOA 4AI0A 4XXAA 4GH4A 2QFEA 2RS51 2DVGA 1OA3A 2ZGKA 3I54A 3UK9A 5CFCA 4OI0A 1NZCA 1UPSA 3FFZA 5L7OB 2A71A 1X8EA 2Z79A 4D7TA 3WW3A 1JUHA 1BEV1 3TWIA 4KGQA 5EYXA 1WBLA 3R4UA 1J1LA 3OF1A 4Q4Y2 4WM8A 2ZAAA 1QU0A 4EV0A 1IS3A 4C1XA 5E89A 4S2HA 1H1AA 3BPZA 1BMV2 2A3YA 3WD5A 1CJPA 1Q8VA 4LBNA 3N3HA 4AG4A 3NV2A 3O0VA 1LOBA 2GAUA 1SBEA 2VNGA 4K8FA 2GSYA 4KBBA 2LALA 3DL3A 3DF0A 5I0TA 4K9SA 1U5IA 1NCRC 3HN1A 4EWAA 4TZDA 4GMP0 4CRQA 3ZXLA 2W0XA 5FOJB 1FNZA 1MS8A 4FPEA 5FLJA 3WCRA 4CDQB 5FO8B 1XU1A 5C4WB 1KDMA 1RUE2 3AX4A 3BB6A 3OY8B 1RB8G 5FPZA 3OBRA 4Y1UA 4O9GA 4YRDA 1ENSA 3WINE 3L9JT 1V9U3 1MQTA 3VZLA 1PVC3 5K7PA 1PO23 4YGDA 2E9QA 1VBA3 2R073 3EJKA 1W6OB 1U5XA 4E4SA 1XNDA 3LSDA 3RJ2X 3FMGA 1DHKB 1RUD3 1GR3A 2BGCA 3WT3A 3AP6A 3E5UA 4ATFA 1UIKA 2XJQA 4WM7C 1SLAA 2ZABA 5F6KA 4AVCA 4CEWC 2CWMA 2DU0A 4JGZC 4AEDC 1H30A 1G86A 4ES9A 2A6WA 2XVGA 1Q8QA 1D2QA 4Q27A 2DYCA 3FWEA 3MLLA 1CAUA 3PNAA 3MDPA 3KS7A 1L3JA 2VW2A 2R041 4CP2A 1AXYA 4LO6B 5B2GB 2XJSA 2VNRA 1Q3EA 2HJIA 4UW5A 2VVEA 4OUSA 4Y1XA 3CL1A 1WLCA 2Q5TA 3GHMA 3THTA 5JAXA 1NXD1 2CGOA 2RMU2 4P9JA 3RI8A 3N35A 1QJU1 1SBFA 4JDOA 2ZKNA 3ZVXA 3MIEA 1R093 5ABJA 1R1A1 5GLWA 4BZ4A 4Q4X3 4HKOA 3GF6A 3A0NA 4COUA 1RVF3 3ZXDA 1ASJ1 2EALA 4XE9A 4AW7A 1HQLA 3VBHC 2DURA 1APNA 2D6LX 2NPIA 4CDUA 4XBLA 2DVBA 2XGXA 3T2TA 1VLNA 4E27A 3VKNA 1SLIA 4MSVA 5IK5A 3UJQA 1F9KA 1HLCA 4X8NA 3R0RA 4Q4W2 4N7IA 4Z2WA 1RUG3 3DN7A 2YZ4A 1I1EA 2CNAA 4ISQA 2BFUS 4D7SA 2EAAA 2HYKA 1N1VA 4IV3C 3S7IA 4XHBA 3WP4A 1R081 4Q0VA 2PA7A 1TME2 4LT5A 2B46X 2W08A 5KHGA 1W6MA 1AL23 1CESA 3PHMA 1RUH1 2VG9A 2HWE2 3O5SA 4X6QB 5DZEA 2ET1A 5FCCA 1COV1 3QBQA 1YFYA 1DQ1A 1C5IA 2EXIA 2D93A 1AR92 2HWF1 4IETA 4UBGA 3N7MA 4DXZA 2X8KA 4QM9A 1S0IA 1NYWA 5D8AC 1JHNA 1Z7S1 3EO6A 1URXA 1NCQB 1QDCA 2VULA 4AGVA 4HSLA 3AZWA 4DZGA 2VMIA 4M01A 3VBRC 1DGRN 4M3CF 1CD3G 3M4FA 2GZWA 3BU7A 5C8CA 4YM3A 4K21A 3ZXJA 5FDBA 3IBMA 5L36A 3WDVA 3MFCA 3B9IA 4YZ3A 2FHRA 2ZGUA 4QPIA 1LOEA 4XDQA 5KC6A 1MZFA 1LTEA 4FTEA 1HX6A 1XNCA 3J8F3 4FO9A 4BIOA 2V73A 2D97A 5F6LB 3VZOA 3QOPA 5HCFA 3WVJA 5HCAA 1Y7BA 4LEJA 3ECQA 1RHI3 1Q43A 4LO5B 1ZZ8A 3JBG2 1FAYA 4GMP3 3ZFGB 2A70A 2IXHA 4YZ5A 3GNEA 1QKQA 4CDQA 1S0CA 2ARXA 5AC91 3CLPA 5CADA 1W6PB 1E57A 1QXPA 1EV12 2ES3A 1HXS1 4R4XA 2CAUA 1AR81 4RS5C 1SLBA 3OY8A 2D40A 4FAGA 3SH4A 1BBT1 4AEKA 4CDWC 5FMOS 2ZZJA 2QE3A 1JUIA 5EV7A 5DUWA 4IV1B 2BQPA 2RS12 1G9CA 2HWB2 2UURA 3MIFA 1AR71 4DB5A 4AI1A 1UD1A 5J98B 1BVP1 4R8HA 1VBB3 4RR3B 3NV3A 4FSJA 1AJKA 2WQ4A 1A6CA 1KS5A 2RR11 2IWGB 4URTA 3VKMA 4BQ1A 1DYKA 3RRDA 1QH6A 2BWCA 5SV8A 4LBOA 4QU2A 1ALYA 4ES8A 3ZIXA 4P9WA 1IPKA 3NJZA 1LHOA 3DPRB 3V0AB 1UPIA 4G3YC 1DU3D 2MNGA 3AJZA 1NE6A 4DMIA 2BTVC 3QH7A 3ZFEA 4AGRA 4CZSA 1RGSA 1ZZBA 4XETA 1C8M3 1H4HA 3PVEA 1MEC3 3SXWA 3CO2A 4C0HA 2F4PA 4K1ZA 3H1WA 1DZRA 1VBD3 4XFGA 1BEV2 4P14A 4BLJA 2XLFA 3AFKA 2XHKA 4U36A 1NA1B 3W58A 3RS6A 2X5IC 1ND2C 3CJIC 5A3MA 1K5MC 4AQSA 4CDXB 1C1LA 4MGZE 4WZCA 4N53B 3R4DB 4WBBA 3BOPA 5FLHA 1AR62 2GC0A 2HWC3 5FBZA 5KXEA 3FHIB 2WA3A 2R0FA 2JJ6A 3SISA 2VY0A 2HWD1 4NVPA 2ZS6B 1IKPA 3USSA 3VL8A 4KQ7A 4XEZA 4YG0A 4HL0A 4YFWA 3FUQA 4HLTA 4N43C 3AKPA 1UKRA 1AX1A 3ASIA 3G6JB 4PIYA 4YVWB 5JOZA 2YGMA 1VRH2 4F3JA 1QQP3 3AMNA 1ZRDA 1M4WA 1O91A 1ULGA 3FBMA 4LLFA 2HEYF 3QD6A 1YJLA 4RHV3 1ZZCA 5K9YA 5BNPA 1AXKA 3ZYJB 1PIV3 2DCZA 4AI2A 4ZKTB 5JPNB 2RS32 4OLLA 5CNAA 3RG0A 3E97A 4YVSC 5HCBA 3TN93 3VHOA 1PGL1 1LKNA 2OZJA 4Q2FA 4PDWC 1I6XA 1NLSA 3M8LA 4B3NA 4XQDA 1X8MA 2YV8A 1ZM1A 3ZMOA 1IHMA 2DV9A 3KMHA 3VZKA 1KS4A 3WP3A 1ZNPA 2WZPP 4C1WA 3I2DA 2B45X 3AXDA 4Z1VA 4FQZA 1YHFA 3VBSC 1VBE3 1NCQA 4H7MA 4I0WB 3V56A 3AKSA 1ND3B 1KQRA 4WVZA 2ZGLA 1X50A 3H1MA 5DG1A 2Q30A 4R4ZA 5T5JA 4ASMB 3NAPC 1IPJA 1NXMA 2OA2A 4ZU4A 1F5JA 1RUJ3 2VQAA 1WA4A 5GLVA 4BM8A 4BYYA 5HBAA 4CTEA 1FI2A 4Z07A 1ZBA3 4J1WA 2ARBA 4HVQA 1FMD2 3N4MA 1W6NB 4Z92B 1ULDA 4MV2A 3ZIWA 1AYM3 1LRHA 1D4VB 1MS1A 1OKQA 1GLHA 1WW7A 2EXKA 4B4PA 1LOFA 1QJU2 1TE1B 2WFPA 3RMXA 1RMU2 4P9YA 2HKXA 4H55A 4Y20B 5CG9A 3ZDSA 4DRVA 1PO13 3B5LB 3CJXA 4AE2A 3ZFGA 4Y5Z0 1HIXA 2AZ5A 2D5HA 2RJLA 1PK6C 1W6PA 1QH7A 1WMDA 2JXAA 1QJX3 3ME2A 4BA6A 4D94A 4ZU5A 4OHWA 1ASJ2 1ZBE3 1ZA4A 3TB0A 1EPWA 1W6QA 2UWAA 2ZPXA 2ZX1A 4Y1VA 5H9PA 1CAWB 1WD4A 1FPN3 4S2FA 4HANA 4IV1A 5T5OA 3HT2A 3FLRA 1UU5A 3PLQA 4B4RA 1EAH1 1YWKA 3POYA 5CFCB 1LEMA 2E53A 1MQTC 3WR0A 3WHTA 3WOGA 3DV8A 3LAGA 1BZWA 1HRI2 2D3PA 2XVKA 5E8AA 3BTAA 3KLSA 2Q8OA 1RUC1 2VOXA 1M06G 4PIXA 4D69A 3VV1A 4ZU7A 4QT6A 4GB31 1IKQA 2WLPA 3R4SA 4LULA 1O5LA 1NE4A 3FX3A 2YYOA 4H14A 1PM7A 1YLLA 3OCPA 3V0AA 4MUVA 1VAMA 4HETA 1REFA 1SCRA 2ZGTA 4A3XA 4JDNA 3AMPA 1XYOA 4Q4Y3 2GDFA 2WJSA 4IEYA 4GULA 5EJ3A 3VBFA 1UIJA 2IXKA 5KXBA 4LO8A 1DF0A 2PLV2 1ULCA 2VGDA 5A32A 3VUOA 1S1AA 5AVAA 2WA4A 4DFSA 1DIWA 1DDLA 5KHIA 5BXXA 1WBFA 1QNWA 5ABJC 5J36A 4L11A 2ZX4A 2ZX2A 1V00A 3VDDC 5A33A 2UU8A 5KHJA 2XH6A 2IXLA 3M1HA 3MI8A 1S0BA 4F83A 2WKKA 3VBUB 2WC2A 2PELA 1C4RA 1RUE3 3PJYA 4R9BA 3ZXAC 1V6JA 4H3WA 4MXWB 2GMMA 1D4M2 4N7UA 4QQLA 2H6BA 3SH5A 3ZFFB 4YVWA 2VUAA 3CU7A 3P3NA 4JQRA 1YO8A 2ZHMA 2ILMA 4BPZA 3WLUA 5DZGA 1J1TA 4XFHA 2ZMNA 4QPGA 2ZKLA 3ACLA 1CAUB 4PLNA 4AWDA 5LRSA 1MZEA 1SEFA 4M0HA 5T5PA 3UV9A 3AP5A 2IXIA 4Z82A 2WZR2 4X6RB 3FLPA 1GFF2 1X82A 4I30A 5ACA2 2WS92 3MF9A 3GZTB 1RUF2 2ZHNA 3ZX7A 4INDA 4EROA 1PMIA 1LCLA 2R32A 3AK0A 2Q4SA 4OFGA 1CAVA 1KFXL 5DDJ2 2I74A 2D6MA 5IUQA 5TSWA 3LSEA 4JVAA 1OOPA 3KZ4C 2ENRA 1BXHA 2EXHA 2PHDA 1ND3A 2YDEA 5L7OC 2YHJA 1W2UA 2WT2A 3AKRA