5JIBA

Crystal structure of the thermotoga maritima acetyl esterase (tm0077) complex with a substrate analog
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
320
structure length
319
Chain Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cephalosporin-C deacetylase
publication title Crystal structure of Thermotoga maritima acetyl esterase complex with a substrate analog: Insights into the distinctive substrate specificity in the CE7 carbohydrate esterase family
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
total genus 123
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jibA00
3D3NA 3CXUA 2JGLA 3KSRA 3CCCA 3RK4A 3BXPA 2VJBA 1LPNA 5ALRA 4ZRDA 1XRRA 1TCCA 1MTZA 4WY5A 4K6HA 2IITA 4DMHA 4PO3X 5EI5A 3DOIA 4ZV9A 2DQYA 3BE8A 1ZGBA 4GHWA 4Y2VA 1JJFA 3QPAA 2XUKA 3WZLA 3VISA 2BUCA 2YXPX 4QDXA 3AINA 5LLSA 4W1SA 1LZKA 5JAOA 1UK9A 3I2FA 3GFFA 1XRMA 2GYVA 2V98A 5AK5A 5AO9A 3FBWA 5IKXA 3WJ2A 1JMYA 1XZDA 1UKBA 3A2LA 4X92A 4DMCA 2V97A 3AILA 3HZOA 1DWQA 5ALGA 2PSFA 1R4ZA 3BDIA 3PUHA 4Q1VA 5ALNA 5LKRA 1CUYA 3AIMA 2XQGA 4AN0A 1EA5A 1XZAA 3FCYA 3O4HA 5CH3A 1VLQA 5DWDA 2X8BA 4QNNA 2HA6A 4HRYA 4G8BA 1CUJA 5C8ZA 3H2IA 4LXGA 4AXBA 4CFSA 1XZLA 2JGJA 4WY8A 3ZLUA 3G9TA 2BAGA 2E3JA 3C70A 4H7DA 4BE9A 3RARA 4GXNA 1P0PA 5EIEA 4P08A 5AKYA 2WU3A 2C58A 4OPMA 2VJCA 3WL7A 3DLTA 2XQJA 2FUKA 4HTAA 2QKYA 5LZ5A 2I03A 2WFZA 4UBJA 2OG1A 1LGYA 4AMYA 1G4HA 3FYUB 4LYDA 5KWJA 3R41A 5FRDA 3R40A 5I9IA 4G8CA 3ESDA 1W1IA 4H18A 3S8YA 5DYYA 2BGNA 5DTIA 5A7HA 2Z3WA 2ZYIA 2RHTA 1IMJA 1EVEA 2D0DA 1FFDA 3WQHA 4B0OA 5ALSA 5JIBA 1YR2A 4JEIA 1XZCA 5AICA 4H7IA 2FJPA 2WIJA 5AJHA 2QS9A 4WDRA 2I3ZA 5C8VA 4BCCA 2HIHA 1AZWA 1E5TA 4OUKX 3WK7A 5K3CA 2QUBA 4NVRA 1XZGA 3F9CA 4B83A 4HS9A 2QXUA 4K2AA 3DKKA 1N5RA 2H9YA 3WWDA 1OCEA 5A62A 1TK3A 1ZD2P 5CT8A 1QIEA 2CBGA 3ANTA 3STVA 3UMJA 2WILA 4EHBA 3R3YA 3S2ZA 2I3DA 1VXRA 3PF8A 4UHDA 2AJCA 3R3XA 1ZIXA 4CCYB 3U1TA 3NWOA 2GBCA 1M33A 2WHQA 1P0MA 1XZHA 5IVDA 3A6ZA 2V9ZA 4KYVA 2QT9A 4BCBA 3OTQA 1TKRA 1KEZA 5JAPA 4RE5A 1DX4A 1R1DA 2XUAA 5ALOA 4J0DA 4FFVA 5AKXA 1A8UA 1MAHA 3VXKA 4B0PA 3FWHA 2XMDA 4Y2UA 2HA3A 1LPBB 4DNFA 4KRYA 1G42A 3OM8A 2QM0A 3I2HA 2PU5A 4DTCA 1MAAA 4LKOA 3O4GA 2DSNA 1AX9A 1MNAA 3ANSA 4DM7A 1YB6A 2XMGA 3R3ZA 2JGFA 3DNMA 4QE3A 3QPCA 4J7AA 3ZLVA 2Q0XA 4DIUA 5AI9A 3PF9A 1R3DA 3KDAA 3ZPXA 2B4KA 3DL4A 1HDEA 4Y7DA 1AQLA 2WUEA 3H2JA 1MPXA 1H23A 1HQDA 3O9VA 5E4YA 3VVLA 4XJVA 2OAGA 2XLCA 4OYLA 2OPHA 3IIIA 3MVEA 3CN7A 4WFJA 4UHFA 4X3CA 4RE6A 4ARBA 4G4IA 2Z5GA 1UFOA 4AN1A 4M0FA 4U2FA 4UFOA 4A5SA 4KJXA 3HSSA 3EIOA 3I6MA 3ZWQA 3TJMA 5T4FA 1UXOA 1QTIA 3QM1A 1VJ5A 1JU3A 3HLKA 4AQDA 5AI6A 4EY8A 2XMSA 2AJ8A 3AUKA 5DNUA 2VAXA 3LCRA 4BP8A 4E14A 2JF0A 5DTJA 4LYEA 4HXEB 1L7RA 1GKLA 2OAEA 3BIWA 2PUJA 5FV4A 4GDMA 5D7BA 3WL8A 2ZJ6A 3C43A 2J3DA 4ZI5A 3WKCA 1EB8A 1N5MA 3VVMA 4I19A 4QDTA 1EHYA 5FXMA 3IBTA 5DNWA 3IURA 3FNBA 4S0XA 5FKJA 1HL7A 1R9MA 2WFLA 2WG0A 5A6VA 5CT5A 5FOQA 5HZGA 3R0VA 3G0IA 1B41A 2CMFA 2W6CX 2PUHA 4UBKA 3C6BA 5DYTA 2XUGA 4FNGA 2VA9A 5AKHA 3I2IA 3WIBA 4X7BA 1UKCA 1C4XA 1VXOA 2WJ6A 1H2WA 1VA5A 1E89A 3NGMA 2O7VA 5AK3A 1QIMA 3NUZA 5AH0A 4UFNA 3E1GA 2ZJ7A 3Q0TA 3BWXA 3R3VA 2ACEA 1JU4A 2Y2UA 2CUTA 4FHZA 1YS1X 2VT7A 4KRXA 5LZ7A 1EK2A 3AJAA 3H19A 2JGEA 1CUIA 5JZSA 3L1IA 2HA7A 5IVHA 5ALMA 1EVQA 1Y7IA 3KWFA 4MEAA 3FYUC 3IB3A 4C4ZA 1VE6A 4AO7A 4EY5A 1LBTA 2OCKA 1CFJA 1SFRA 5CXUA 4XVCA 1W52X 4BZZA 2ACKA 1FFAA 5K3FB 1E8MA 1CUWA 4B9AA 4KACA 3MUNA 3HXKA 3WJ1A 1UKAA 5AI8A 4EUSA 2PKYX 5FPQA 2QR5A 1ZOIA 1AKNA 1X2BA 4XIIA 4RPCA 4OD0A 3I2GA 4LIPD 4QA9A 4BRSA 2HA4A 3KWJA 1ZD5A 4LXIA 1Q84A 1FJ2A 3L1HA 4WDQA 1NU8A 3H1AA 3PICA 6YASA 2CEKA 1K6EA 4Y2TA 1CQZA 1IUOA 3G02A 3P2MA 1CUEA 3ESAA 1ACLA 4G5XA 4N5HX 2HHAA 3IDAA 1QZ3A 1QLWA 3WLAA 3JW8A 1CUCA 3ICWA 3GUUA 1XKLA 5A7FA 5EHNA 4UHHA 1PV1A 4UBLA 5CBKA 3EQ7A 1LZLA 1XLUA 5E4TA 4PW0A 3RM3A 2FX5A 3V1MA 5ALXA 3V9AA 2VF2A 1HBJA 5ALPA 5AKGA 4YPVA 3G0DA 3V48A 4F60A 2ROQA 1EB9A 3DCNA 5CRIA 3D5EA 4X6UA 4UBNA 4B82A 4QDZA 5JYCA 2AJBA 3ED1A 5C8XA 5CH8A 2H7CA 3STXA 1X70A 1NX9A 5HKAA 5AK6A 2XUHA 2Z3ZA 1YA8A 2ZVDA 1S8OA 3AFIA 1CIJA 4N5IX 2B9VA 1QOZA 1SOMA 3G9XA 4X6YA 1G66A 1HKHA 2WHPB 2QXTA 5ALDA 2CZQA 4Y2YA 1THTA 1W4LA 2HRRA 4K6GA 3U0VA 3V1KA 1E3QA 1T4MA 4U2CA 4IH9A 1UZAA 3V1NA 1GPLA 3ZV7A 4C4XA 4DYHA 1TRHA 3GELA 4MQMA 3D2CA 4G8DA 5T4HA 4ITVA 4P92A 2WUGA 1AGYA 2JEYA 3WWPA 3B12A 5EHQA 1H2XA 1BEEA 1WPRA 4PQEA 5D3KA 3QMWA 2OQIA 1YCDA 4U2BA 3FYTA 5AIAA 3X3HA 3EQ8A 1ETHA 4DMKA 1CUGA 1QJ4A 2G63A 4ZREA 4ZWNA 2HL6A 2WSLA 2Y1KA 5CH5A 1R9NA 2DHCA 1J06A 1QIKA 4Q34A 4AO6A 1XQVA 5A7GA 3IA2A 1DWPA 3HACA 3BDVA 3W2TA 4Q05A 3WIOA 3SK0A 4BC0A 1VOTA 4GEGA 1N1MA 1LLFA 2QMQA 5FLKA 4W1QA 2WKWA 4WJLA 4RNCA 3G0BA 3DDUA 2HU7A 1GXSA 3VJMA 2EEPA 4ZGBA 4J03A 2HFJA 5JZBA 1AURA 3WL6A 4W1RA 2VATA 4AZ0A 2XUFA 5HK8A 1XZIA 3D0KA 1VE7A 3FYUA 3EF3A 5AI0A 4HXGA 4UHCA 2ZSIA 5K5EA 2OCIA 4IH4A 1K5PA 4QWWA 1N8SA 4W63A 3KOOA 2XLBA 4Y2QA 2WTMA 5HKBA 1DQZA 2VTVA 1K8QA 4X91A 1CUHA 4B84A 3M3DA 4IHAA 4H35A 4ROTA 2OCLA 1JJIA 2QRUA 4BZWA 1O6FA 1B6GA 2Y6VA 3FSGD 2BFNA 1U8EA 3WWEA 1QIDA 1XROA 3OOSA 4EY7A 4FOLA 3DEAA 4F21A 1FSSA 3RLIA 5A2GA 2XUJA 3JWEA 5JZ9A 2XMZA 3GROA 3HEAA 3M83A 4K6KA 5AHXA 4K5QA 4FLFA 3C45A 3I2JA 2BJHA 1K63A 2HU5A 1ORVA 1CUBA 2V96A 5C81A 4G4GA 2HA5A 2O7RA 1TIBA 4J0HA 3WK8A 4Q3KA 1QIHA 3WKAA 5AM2A 4Q82A 1XZKA 3D59A 1XRPA 3O4JA 4L9AA 5SYNA 4E46A 2PSDA 1GKKA 1XRQA 5HFAA 2GYUA 2HA2A 4TVKA 4W1PA 4BB0A 1E66A 1IVYA 4OU4A 1P0IA 2HM7A 1JT2A 4FTWA 4TGLA 1GPKA 1XZMA 5KREA 2AXEA 2DFPA 3FAKA 4X90A 1CUFA 1BCSA 1UWCA 4AB1A 3H1BA 2J4CA 3T4UA 1A88A 5ALTA 4UUQA 5CT9A 4CG2A 1ISPA 1CRLA 1ZD4A 4HXFB 3IVMA 1Q83A 1CEXA 4L72A 5AM5A 1QO9A 5T4BA 1C7JA 4YX9A 3ESCA 5I7UA 1QO7A 2PVSA 4PF1A 2XUIA 1LPAB 1U65A 1ZIYA 4BAUA 2DQZA 2QUAA 3NOXA 1ZI8A 1BU8A 4X94A 3OURA 5E4JA 5HF8A 4DNPA 1Q0RA 5ALVA 5HF5A 1MT3A 3KD2A 5J3JA 1ZI6A 2PSEA 4G9GA 5LYYA 5EGNA 3H0CA 5ALEA 1A8QA 1DT3A 1DX6A 2G5TA 3C5VA 3DOHA 1U2EA 5CT6A 3I1YA 2X76A 4BATA 5AOCA 1XZJA 1FFBA 2PBLA 3N0TA 1MJ5A 4Y2PA 3WL5A 3IUNA 2HA0A 4OSEA 4JNCA 2EDCA 3I2KA 4PNZA 3B3QA 2DCMA 2K2QB 3GA7A 3D7RA 2OGZA 4H7HA 5DNVA 4J0JA 1ZGCA 4LXHA 3ZI7A 5AK4A 2PPLA 1XZBA 2C5FA 4C6HA 1QIIA 4DSZA 4N8DA 4O08A 3PDCA 5ALFA 5BWBA 5KWIA 3O4IA 1AUOA 1XZEA 5D3ZA 5JATA 1YB7A 2C5GA 4N8EA 2ZJFA 1PFQA 2PL5A 1L7AA 3MGAA 3E3AA 4PSUA 4NS4A 5JD6A 5IH7A 3M81A 4GLBA 4OCZA 4BBZA 3WA7A 4FDMA 5FP0A 5HK9A 4OB6A 5HQ3A 5ALJA 4H7FA 2RAUA 1UK6A 2H1IA 4MQLA 5C7YA 1XQXA 1TQHA 2DHEA 3YASA 2WG1A 2O2HA 1J1IA 1CPYA 1QIFA 5JALA 2QOEA 3L1JA 1JMKC 5F4ZA 3D4LA 4INZA 2XUPA 3FOBA 3ZLTA 1EDEA 2WIGA 2HRQA 3A2NA 3BL8A 5AKJA 3FCXA 4IO0A 3I1IA 4UBOA 1CUAA 2RGUA 4U2DA 5FDFA 3PFCA 5AKIA 4EB0A 2XQFA 4RGYA 2IIVA 4UBIA 3K9BA 3H04A 3BF7A 5DLPA 3M82A 4N8SA 4DSAA 1JJBA 3G0GA 3WYNA 5ALHA 5CTAA 1C7IA 4EY6A 4KAFA 5ALYA 2ZSHA 4X93A 3FSGA 2WIDA 4GW3A 2XMBA 2XUOA 1BEZA 4FMPA 2WM2A 1O6GA 5ALLA 4M0MA 3DJYA 5K3FA 3N2ZB 1WM1A 5AIBA 3RKSA 4A23A 1YS2X 3SX4A 2JEZA 1BN7A 2XT0A 3H2KA 4H7JA 2WQZA 2RI6A 4BDTA 5AM4A 2XI4A 1R50A 5CXXA 3E4DA 5LZ4A 1XZFA 3FVRA 1XRLA 4BP9A 4GWLA 1KU0A 4I3FA 1QIGA 1W6RA 4Q3LA 1GZ7A 1EK1A 3WKEA 4GBGA 1QTRA 3TRDA 2VJAA 2WLSA 1XFDA 4KE7A 2B61A 3ESBA 5AOBA 4Y2XA 3GZJA 3HABA 2PSJA 4JH0A 1YSCA 4B80A 5AKEA 2XQKA 5CW2A 1BN6A 1MX9A 1XQYA 4HZGA 7YASA 3IUQA 4H0CA 1IZ8A 1EXWA 1WB4A 4B9EA 3BJMA 2QJRA 1HLGA 1CUZA 3C6YA 1H2ZA 3SWWA 2Y2VA 1DQYA 3I6ZA 5LZ8A 5AI4A 3PUIA 2H7YA 4X97A 1SCQA 4EA6A 2G5PA 4L0CA 2BGRA 3G7NA 5E2IA 5LKAA 3UUFA 1RYYA 3QITA 2WU4A 4CCWA 2WTNA 3STWA 2C0QA 2WIKA 3QVMA 5ALZA 4EBBA 1J07A 3FLEA 3LLCA 4P9NA 4F5ZA 1CUUA 3WK4A 4QDUA 1ZJ4A 3C6XA 5KBYA 2C4HA 5AOAA 2WHPA 1HPLA 1MX5A 4CG1A 1GGVA 4KR0A 4J0KA 2H7XA 5EIAA 3STUA 3VJLA 2RHWA 4QDOA 2OQVA 1D07A 3VDXA 2PSHA 4BAGA 4PSCA 4NZZA 5HCUA 5K3AA 4CG3A 2D5LA 4EZIA 1L7QA 1LPSA 1OILA 3A70A 2ONCA 3BIXA 3AZQA 2WUDA 3WK6A 2ECFA 1WCYA 3C8HA 1WHTA 4MYSA 1FFEA 1YAJA 3E0XA 3VKFA 4BAZA 4BDSA 2CKMA 3BF8A 4GECA 3QYJA 4J3JA 1WHSA 5AM1A 1QFSA 2JBWA 5HF9A 2IX9A 4HVTA 3BJRA 2WG2A 3EBLA 4J0GA 5ALUA 4DLNA 2JGKA 5IVKA 4MEBA 3ICVA 3DYIA 2XUDA 1CUXA 1SCKA 1YASA 5LIPA 4QZVA 4I4CA 1CQWA 4DMFA 5CT4A 1VKHA 1DWOA 1T2NA 4Y9SA 1DINA 2PM8A 4X6XA 1XQWA 3C87A 3ILSA 3F67A 2FJ0A 1UK8A 2HU8A 2XUQA 4FKBA 3T52A 4FBLA 1H2YA 3WK9A 5SYMA 2VEOA 2GYWA 3STYA 5JASA 3IULA 5ALWA 5AKLA 3R3WA 3OPMA 3HYSA 5K3BA 1P0QA 1RWQA 2VSQA 3B5EA 3TGLA 3W9BA 3F96A 4C88A 4BTVA 1CLEA 1JFRA 2BUBA 1Y7HA 4C01A 3O95A 4OU5A 1GT6A 4OB7A 2Z8XA 4GI1A 4KE6A 2VQ6A 2XMQA 3UUEA 4FLMA 5K3DA 4H7EA 5ALKA 4BE4A 2EDAA 3C8DA 4X95A 3JYHA 4C4YA 1XLWA 4UPDA 3V1LA 2Z8ZA 5YASA 3DS8A 3Q8WA 1VZ2A 3W06A 5H3HA 1MX1A 4AO8A 3SC2A 4QEKA 4IH1A 4Q3OA 2WJ4A 2C0PA 1YAHA 2GZRA 3DD5A 2HADA 2JGMA 3QH4A 5A71A 2XMCA 3LIPA 1UOPA 1TCBA 3WMRA 3WI7A 1JKMA 3O0DA 5AI5A 2ORYA 1VZ3A 4H77A 4QLOA 2BKLA 4BRZA 4JYPA 1MU0A 2PX6A 4QWMA 4OB8A 4H7KA 2ZYHA 1A8SA 1ZD3A 3H17A 2Y6UA 3CCBA 4FLEA 3WWOA 4L3WA 4QLAA 2RONA 4B7ZA 4CCYA 1IZ7A 5IVIA 2BCEA 3C6ZA 2XB6A 4MXDA 1LPOA 1WB5A 1CUDA 1FFCA 5HFNA 1LNSA 3FLBA 1XLVA 1QFMA 4A16A 5CMLA 3LP5A 5JANA 4FFWA 2QJWA 2I78A 4U2EA 3WKDA 3WKBA 1EINA 2LIPA 5JADA 4X71A 4BVJA 1UOOA 2DR0A 5AM0A 4F0JA 1MN6A 1K4YA 3W05A 2J3QA 3QMMA 5LZ9A 4MYDA 2O2IA 4YASA 3D2BA 1A7UA 1E8DA 1UOQA 3K2IA 2WIFA 3LIIA 3PFBA 2BUAA 1I6WA 5EHXA 4JYMA 5ALIA 3DL7A 4Y2JA 1YA4A 4FNMA 4DNQA 5HF6A 1W75A 5DJ5A 4D9JA 4BC1A 4OYYA 3WZMA 1KU6A 3KXPA 1EI9A 2ES4A 3CN9A 2UZ0A 3LS2A 2HDWA 4U2GA 3HC7A 3HI4A 3GBSA 5EFZA 3DYVA 5ALQA 4AZ3A 2NW6A 3TEJA 1BE0A 1MO2A 1QE3A 1G5FA 1X2EA 4IQ4A 4HRXA 5JARA 4YK7A 5AKZA 5AM3A 1DT5A 5K3EA 3G0CA 4KE9A 1QGED 3K6KA 3DQZA 1VA4A 1ODTC 1TCAA 4ZV7A 3WA6A 2VJDA 5T4EA 4UHEA 3OC0A 4UHBA 4HAIA 2G4LA 2R11A 1SCIA 3A2MA 2HFKA 2OXEA 4P93A 1USWA 1F0NA 2OGSA 2X5XA 1RP1A 2P8SA 4G1FA 1AMNA 1GQRA 1ODCA 1TAHA 2OCGA 3QMVA 1U4NA 2YH2A 5ESRA 2GBIA 2JIDA 4ETWA 4WFIA 2XDWA 5BOVA 1JI3A 2GBGA 3I28A 2WUFA 2QTBA 3AIKA 4UFPA 1UK7A 5JD4A 2GZSA 1PJAA 4BVLA 4X00A 1ODSA 1QIJA 2QZPA 4KE8A 1ZI9A 2WHRA 2JGIA 3F98A 1R88A 4E11A 2R8BA 2XMRA 2VAVA 4MWSA 1CV2A 5EHZA 2O2GA 1J2EA 3IUJA 4G9EA 4B81A 1BRTA 3OG9A 5AKKA 1SC9A 3W04A 3AZOA 1EDBA 3R3UA 3WYDA 5FPPA 5I8PA 1CUSA 5JAHA 1BROA 3C5WP 2B20A 3AIOA 1EX9A 4PV7A 2WFLB 5HQ3B 4X85A 4BVKA 1THGA 1F6WA 2OGTA 3G9ZA 1ZJ5A 1DTEA 3PI6A 1LPMA 2ZYSA 4Z49A 1DU4A 5JAUA 2WFMA 1EH5A 4WCVA 2CB9A 3H2HA 4CIBA 2J4FA 3VJKA 2XQIA 1F8UA 4CIAA 1UT6A 4KEAA 1WPXA 3STTA 4BTLA 1NU6A 2CJPA 4Y2RA 1GQSA 1EDDA 3H2GA 4Y2SA 3F8SA 4NMWA 3EQ9A 4AMZA 4EY4A 3W9UA 1F0PA 5BWCA 5LZ2A 4KAAA 3F97A 3QPDA 5DYWA 1QONA 3HJUA 2C7BA 2QVBA 5EIHA 1Z68A 3QBJA 4W9RA 4G4JA 5D6OA 1ORWA 3IUMA 1BCRA 3D2AA 1BS9A 1E8NA 2VT6A 3QZUA 4AX4A 1W76A 3AZPA 4ZXFA 4XX1A 2WJ3A 3MUOA 3FLAA 5LP1A 1H22A 3O9MA 1ACJA 1XRNA 2DHDA 4B6GA 3FVTA 4B85A 1LBSA 3DKRA 4BYMA 4CI9A 2GBFA 3G9UA 4WFKA 1CUVA 1WB6A 1Y37A 5AP9A 5ISMA 4E15A 1GPNA 4FBMA 1WOMA 1ZICA 2AJDA 4MJ3A 4J0IA 1MNQA 3PE6A 2YYSA 3HRHA 1LPPA 2W22A 1CR6A 1CVLA 4XWGA 4J0CA 4ARAA 4M0EA 4MWTA 4JUIA 4V2IA 2XE4A 1IUPA 4FWBA 4KAJA 2OLEA 4LHEA 1AC5A 4C89A 1IUNA 3WK5A 3WWCA 4DNOA 2ZYRA 5BV7A 2YASA 5JD5A 1Q0ZA 4DGQA 5CURA 2AJLI 1OXMA 2RIPA 2PU7A 4C87A 4PSDA 4UBMA 1XKTA 3G8YA 3H18A 4BCDA 5FUMA 3I6YA 4TPKA
chains in the Genus database with same CATH superfamily
2PGLA 4K28A 2B7BA 3KAQA 1ECJA 1I0LA 3EASA 5G53C 4WE3A 3GVPA 2UYGA 4BGIA 3PE3A 4JXJA 2NWQA 4L0DA 2ZRMA 1MC8A 1DBPA 2CDCA 2H1HA 1D09A 2HPHA 1ZXXA 1EDOA 1RQXA 5ALRA 1NTRA 3R5JA 5GY7A 2LCFA 1TCCA 4IR7A 3UCFA 1H0SA 3ZW9A 1FYWA 1G59A 5NULA 1SUDA 2DBRA 4RVCA 5FOXA 3MCUA 1RAEA 3DAYA 1OBHA 3I34X 5TVGA 1OD6A 4PO3X 1UC8A 3RSCA 1ZR2A 4CV1A 2IW3A 3QUCA 4C5CA 4ATNA 2ODNA 4DBLC 4GHWA 1USIA 1XQ1A 4A4DA 4MWBA 3PRJA 2BCGY 4D41A 1JJFA 2P75A 2BBTA 4JR2A 4DEVA 1N9KA 3JWJA 2OHGA 2ZGVA 3WZLA 5CLGA 1QE5A 1Z34A 3FPBA 1E69A 4UUBA 3WL3A 2G1PA 2W58A 1O96B 1U5CA 4KIFA 5IC5A 5DGCA 5DTEA 3SHOA 3G2PA 3ZKWA 4P6VF 3TPZA 1TM7E 3SBDA 2PEZA 3GI1A 2BHSA 5H4GA 2DLCX 1WW3A 3HVHA 3TPCA 3TNFA 3I6IA 3OICA 5DHRA 4A82A 4TS4A 3A1CA 2PO5A 4W1SA 1IBMB 3GVIA 2QMHA 2JZOA 2VZ8A 4G5FA 3GFFA 5HDBB 3LT0A 5LC1A 3JQAD 4JI4B 4G25A 3AM3A 4ANFA 4EF4A 3CNHA 3H2SA 5FBLB 5EIXA 1FRVA 1PT5A 2HT6A 2JA1A 2DLDA 1VJGA 3AETB 4KGVA 4R9UC 1XB2A 5AK5A 2VBFA 3WZ2A 1VI6A 4M1EA 9LDTA 1J1UA 4H3VA 1QRTA 5AO9A 3FBWA 4HDRA 2OV1A 4ZOCA 4QGFA 4GD3Q 4C30A 4AIRA 5GM2A 2P5SA 3JAKB 5FLEX 2C3OA 3M4JA 4Q3EA 4YYEA 1N7JA 5LJIA 1SOAA 1HURA 4HFMA 1RIFA 2HV9A 4OSPA 4F85A 3MT0A 2YWXA 1T9DA 1Y6ZA 1CP3A 3IXLA 4UU8A 2V97A 4FR5A 5CD1A 1DFHA 3KS9A 3HZOA 2PGAA 3ELYA 1G8FA 3AGPA 4IDPA 4XCVA 3WXMA 4L5AA 1F17A 1B42A 1Z36A 3O93A 4WL0A 2IHBA 2NZ2A 2Z4RA 3VHLB 2ZSKA 1RXWA 5ALNA 4DBLE 3FRIA 4IWYA 4L8LA 2BFWA 4KPYA 1OKKD 3IAEA 4CDGA 1BA3A 1I3LA 3KL2A 3TZBA 1WKCA 2XQGA 4OHMA 1ORTA 1YU9A 1NVBA 2WI8A 3NBKA 5K09A 3FCYA 1UR5A 4J1TC 5KMGB 2NPIA 1R66A 3H9EO 3O4HA 4M46A 3HEMA 4WOCA 5CH3A 3RVNA 3L7BA 3A3KA 3BMCB 1Y80A 4J16C 4EKEA 2QW1A 4TN1A 3ROZA 4BE7B 3SZMA 2H9AA 3JYLA 1PL7A 5ICMA 2HA6A 1ZR4A 4HLCA 3U48A 4G8BA 4LJYA 1Y1LA 4KYUA 4PRLA 1QF6A 5AQEA 2BFDA 3AYZB 5EIFA 1XFAA 5EEHA 3ZLUA 1MTOA 2B2CA 2BAGA 2UKDA 2E3JA 1C5KA 4MZXA 2GNAA 2MU1A 4BE9A 1GVNB 1AGPA 1NFQA 1P0PA 2HGSA 3F5DA 4FYMA 2ORIA 4P08A 1QSGA 1M6WA 2CDNA 4G23A 2O2JA 2P35A 3FPHA 3S44A 4CR8A 4FM9A 3A4IA 1P9RA 1MBZA 3F8WA 1A5ZA 2XQJA 1UBJS 2FUKA 4FYWA 2A35A 5FWAA 2CL0X 4JI5B 2DQ4A 3TQIA 3QX8A 6PFKA 1KP2A 3LDUA 4CQJA 1LTQA 1S0UA 2WFZA 1A4UA 1EFPA 1LC0A 2JPDA 2OG1A 3EEBA 4NP6A 1DRWA 2CK3A 2I7CA 3PQCA 4YGYA 4ZN6A 5AVTA 4QYXA 4EMBA 4AMYA 5DCLA 2Y4OA 3IKLA 3PSAA 2ZM6B 1U8ZA 3ND7A 5FNVA 4JNKA 4DC9A 1SM4A 4MI1A 2JBAA 5KJEA 5KWJA 5A5DA 1YK0A 3LKBA 4B3DA 1BX3A 3WO1A 5P21A 3THYB 3NGLA 4MUXA 1RWWA 3AHCA 1NP6A 1FMCA 3MMZA 2FMKA 5I7AA 3VHXA 1Q3TA 5I9IA 1P0CA 4KQCA 2ZATA 1F9AA 3L01A 3CEMA 1Z4LA 1SCUA 2OP0A 2P4QA 2PNFA 4GZMA 4R2WA 4ZQFA 2V6BA 3UXMA 4YMTA 2F1JA 4Q3AA 1ZGHA 4YAKA 3V4PB 1EUYA 3S6JA 4I1IA 1WO8A 2ZREA 1F48A 2BGNA 2ZG6A 3T7TA 3ZE6A 2CMGA 3MGBA 2ZYIA 1YZYA 1BXZA 3HUDA 1KH2A 3VYVA 3JRWA 4QO8A 3GH1A 3T5BA 1ZL2A 3ENNA 2K4MA 5BV1A 1II8B 3UYLA 4C5BA 3JWHA 3TFQA 4FK8A 3TGPA 1X7GA 3LY5A 5ECWA 1CP2A 2BN4A 4B79A 1TB4A 2LKCA 3BRWD 3WQHA 4DLPA 4B0OA 5ALSA 4IQ8A 2A1TS 3J7TA 1HYGA 1C1DB 2JFOA 5A5EA 4DV5B 3DDCA 4NBTA 2PGOA 4GFDA 1BZYA 5FR1A 1POXA 1TYBE 1XZCA 3FTPA 5AICA 4ZEXA 1F14A 2FJPA 1I30A 2X7JA 3MIIA 1IHUA 2WE7A 2WIJA 3FYSA 2AX4A 3JSAA 2KLHA 2QS9A 5AJHA 3W6ZA 1YIAA 1DG1G 1ZJ6A 5HIMA 2HHJA 2HIHA 2WLTA 4OHUA 5FA6A 4YRJA 1W5BA 2GPBA 3OOJA 1THMA 5EL0A 4PR0A 1D04A 1AZWA 1E5TA 1TT7A 2XITA 3K0KA 3KZVA 1YB2A 1JI0A 1N3IA 4JYBA 4OUKX 4M1MA 1EJ6A 1M6HA 2MSLA 2QUBA 2ZJYA 4ZODA 4BU0A 5IG2A 4YT4A 1ZVQA 2P62A 2B99A 3NB0A 1TJ4A 1QF9A 3F9CA 1Z3CA 4B83A 4HS9A 3QSGA 1T4BA 3S40A 2IU6A 2QXUA 1G0OA 1VLZA 2NU7B 2IELA 3F5SA 4K2AA 5JFTA 5JJKA 2FCAA 1N5RA 4N03A 4WZBE 3S27A 4ID9A 1KEEB 1VE9A 2IZOA 4TYNA 5IT4A 3FHLA 4F2DA 1TK3A 1QK3A 5CT8A 1QIEA 3TM5A 4OY3A 1ZMBA 3STVA 5J40A 1VLJA 2PAAA 3IVCA 4RELA 2AKAB 2BPOA 3L79A 3F6PA 2EKZA 1RLJA 4OLJA 3I61A 1VFNA 3GDFA 3C4JA 3RG8A 4MWCA 1NYQA 3IYLW 1TFUA 4OM8A 3VPBA 3ZZMA 1TO2E 3GL9A 4H4EA 3QVGA 4BS9A 2Q3CA 3TJMA 2E5LB 4NXNB 3NX4A 5FBWB 1GG9A 3PF8A 4MCHA 2Z8YA 4RSGA 4ZOAA 3R3XA 4N49A 4YRDA 2A92A 3H1TA 3AFGA 4IOMA 4II3A 4CCYB 2A78A 4E30A 1TEZA 5CB4F 3C7TA 2GBCA 1RMQA 4WX2B 1TQ8A 1M33A 5E8RA 1FJHA 1IIRA 1P0MA 1XZHA 2QMYA 4GOLD 4Z0HO 3I1JA 1JYFA 4NC9A 3NU1A 3IKTA 3A6ZA 1A9YA 2H65A 5I3ZA 1PZHA 5DLYA 1WPQA 3PNKA 1IBRA 1ES9A 3W5BA 3AH8A 4ESHA 4YXWA 2QT9A 1JA9A 1SU7A 2W2TA 4XX0B 3WDLA 3I01M 3DO6A 3TCNA 3DV0B 4L5JA 1ZH4A 1FQOA 1R00A 3V2UA 5J2UA 3L6OO 5T8KA 2SNIE 4PTLA 4RMHA 1B16A 1PT8A 2H9IA 1OASA 2X9QA 4E08A 4C2TA 2ABWA 3QU5A 1A8UA 2VNAA 4B0PA 1CYEA 1ULBA 3W8DA 3OSZA 2XMDA 3PL1A 2A0XA 2D5BA 4QYSA 1LPBB 1CY0A 3BFKA 3A6EA 1QMGA 2QX4A 3IBGA 1V45E 2W11A 2QLFA 5EXPA 2IYUA 2CE7A 3E05A 2Q21A 2I8LA 4EJSB 4DTCA 3QOXA 4WK6A 3NDRA 4O2RA 3DV9A 4LKOA 5C1OA 3GLFB 1DC6A 4ZMRA 1LX6A 3FBTA 5A5GA 3U09A 2XWPA 1A96A 1C7QA 1SOVA 3R0JA 4OKNA 3LNTA 2I2AA 4WUVA 3MQ4A 3MT7A 5EXXA 4UPEA 1E2GA 1YB6A 4DM7A 1Z4PX 2AYXA 1J5XA 1FNBA 4D6XA 4QE3A 1HZZC 3TLMA 3QU4A 1G1MA 1U0LA 1HE2A 3ZLVA 1XEXB 3LLMA 5AI9A 1K8RA 2XODA 4XH9B 2O4CA 5M2QA 2OZVA 3KDAA 4LPKA 4KVZA 3X2SA 4NU5A 4UMEA 3DL4A 3R5HA 1HDEA 2B34A 4Y7DA 1QAOA 2O7NA 3CINA 4I36A 3ROPA 3ZX5A 3H2JA 2Z0MA 4PWZA 3QQ5A 4TVOA 2RGYA 4FT4A 4QPPA 1MPXA 1XTKA 3UJAA 3BXFA 3EX7C 4X41A 1GA1A 3FDXA 5GWXA 2X5KO 4TMKA 4UEJA 3VVLA 5B7PA 5C3MA 4I1VA 4X1YB 5JJBA 4J0FA 1WZ2A 1AZSC 1XWFA 2PXHA 2XLCA 4BNDB 3Q1KA 4LSWA 5JTTA 3DBLB 3HMQA 3IIIA 2OPHA 1TA0A 1XD8A 3CW9A 3CN7A 4WFJA 4UHFA 2H54A 1Y1PA 1MVLA 1DCMA 2NYRA 2QP4A 2AFIA 3CEAA 2R5FA 4RE6A 4ZMBA 5B36A 1I3OA 1P3JA 2WA1A 4O3FA 3UJ8A 4D1YA 3DOUA 1UFOA 1HQCA 4JLSA 4BGEA 3GF4A 3INRA 4MO2A 4U2FA 4V0MA 4KJXA 1CR4A 5EWJA 3S1AB 3TF5A 3UKDA 4OAOA 1JXMA 2XTNA 1A7KA 1V1MB 1I5RA 3SYRA 1Y3DE 3TUJC 1UXOA 2W2MA 2IP2A 4PIPA 4AF8A 4L07A 2BEVB 1C50A 4WINA 1S1MA 3A4NA 3M8KA 3BE6A 3HLKA 3L0YA 3ZWKA 1SMKA 4AQDA 1XTSA 4Z5XA 3LQFA 3B1YA 4JBXA 3QX3A 4WADA 1PG5A 1Z88A 2AJ8A 4XSHA 4Y9RA 4LTDA 4YCAA 3LFUA 4K86A 3DBRA 4AWBA 3RKUA 3O4RA 5DNUA 4BXOA 2BWJA 2YZKA 2YMPA 3PQ4A 2C88A 2VAXA 4MI3A 3S2UA 3VKUA 4QRHA 3KVVA 3REGA 1JWLA 1L4FA 5DWQA 4NPHA 1FJGB 4U39A 3TW6A 2YXBA 1YGPA 2X0DA 3OLZA 1Z5WA 2Z2YA 3IILA 5CD9A 1YD7A 1K2VN 1TQ4A 4RHUA 5B1IA 4WASA 1IN1A 4HXEB 1OXBB 5ARDA 1G38A 2QTVA 2RGGA 1GKLA 2OAEA 1VTKA 4C78A 1AGNA 4URHA 1DDIA 4TM7A 2JAQA 5I7HA 1YZLA 4HWGA 1OB2A 3FPGA 3NWBA 2G5GX 4S04A 4X6LA 1U28A 4A0SA 5A4DA 3UANA 3T3EA 3TR6A 1AO0A 1SD2A 2AXQA 5HBGA 1KHTA 2AUMA 1RYDA 1GRCA 4B2IA 1N5MA 5DTRA 2VYQA 4FOSA 1ODFA 5LQKA 3NH9A 3UAXA 2Q6VA 3TVTA 1K9SA 2QEQA 2GKOA 3IBTA 2OFWA 3GG9A 4ZAXA 5F23A 4M99A 1XX6A 5JQGA 2ZE5A 2RG1A 2OFOA 3IURA 1I7QB 3ULKA 4I4TA 2J4DA 5FKJA 3FHTA 4AP9A 3KO8A 1SUEA 3BMQA 4IDGA 3JU3A 4KO8A 1C3OB 5ER6A 2G1UA 2QY9A 2H1SA 1G5HA 1E2MA 4AC9A 3FUTA 3ZK9A 2KE5A 2WG0A 4MGZR 3MERA 1YF3A 2H57A 4OHCA 5ITWA 1SNYA 3DHNA 2R7KA 4HLUC 5KYWA 1IXYA 5HR5A 3MUEA 4JLMA 1P5HA 4S0ZA 1U7PA 4R1UA 2L82A 3CLHA 4LSZA 1W4CA 2IRWA 3BQMB 1Y3CE 3IMGA 5AVVA 1S6YA 5E9WA 4R68A 4DJEC 4GOMD 1BHO1 3BJIC 1L7BA 2QTNA 1QCZA 3M0EA 2ZIAA 2FVYA 1OXXK 3WMFA 3GT7A 4OUDB 2ST1A 2AQ8A 4HN2A 1R74A 1F8FA 1L3BA 1WV1A 3P5BA 2VA9A 2HMUA 4FNGA 2UUPA 4HJRA 4XJSA 5TJ9A 2TECE 1M34B 2BGLA 4FI3F 4MUAA 5HVNA 2P3SA 2PRYA 3CR8A 2O07A 3TW4A 4PHTA 5I7EA 1F1BA 5BP7A 1C4XA 5KVSA 3OP4A 1OGIA 1VXOA 3BEOA 3EEIA 2HIMA 3IX7A 4QDJA 1E98A 2WJ6A 4FKZA 3QTLA 3D8HA 3GNTA 1BD3A 3ZHSA 1J90A 3ZDDA 1CF2O 3WLQA 3AQ4A 1E89A 1RYZA 4J90A 3GEIA 1WY7A 1ZZGA 1PG0A 1QIMA 3RS0A 1HORA 4Z0TA 3OZVA 2XWJI 4BEBA 4QELA 1X13A 3E1GA 3DSRA 1SRRA 3R3VA 3JAMA 4AFNA 5L6LB 1JU4A 2I7TA 1D3AA 4FPXA 4Y9DA 3DTVA 2DPGA 2HHLA 3ZHOA 3L2OB 4JUAA 4BKOA 3CZAA 4R1NA 4IILA 1E79A 1M2NA 4XGIA 2AUNA 4PZUA 4ZKDA 2DFNA 3L82B 4FIZA 1N2ZA 3MT8A 5HXAA 2FPWA 3WMEA 1JALA 3UF0A 5AJXA 4P80A 3RT9A 4J2OA 1JEQA 3A9WA 5LZ7A 2MCFA 3FCUB 2BT4A 1L7EA 3AJAA 2J6HA 3T7DA 1Z74A 4O5OA 5DO9A 5K0FA 4BLTA 2JGEA 4XXHA 1DAHA 2GAJA 3RRXA 4D3YA 4PQFA 3QJGA 3U7QA 3K1JA 3RCBA 3ZBQA 5BNWA 3HVKA 5HJEA 3FYUC 4RJLA 4LOJA 5BT8A 4N3GA 1NJFA 5JSZB 1U63A 5EJ8A 1XMPA 2Y76A 4BBJA 5TEWA 4C4ZA 4AO7A 4WNCA 2HK7A 4PM4A 1F7UA 1LF5A 3R24A 2JH8A 5LUBA 5HFJA 4D6PA 3AERB 1PKEA 4OKSA 1UJCA 3A1FA 1JR3D 3A1UA 3C98A 4QM7A 1PNQA 4R84A 1J0DA 4IV5A 1Y8RB 1ZEJA 1W88A 4UAJA 4CF3A 3U1BA 5AD1A 2V4ZA 3KSDO 3NXKA 4FFBB 2Y1FA 3IBSA 3DP9A 4K6OA 3IAM1 4MH0R 4RY9A 1ZW1A 3MG9A 4ZQCB 3DWGA 3LY7A 2JI7A 1G9TA 2XGMA 3RTBA 1MO4A 3RKRA 4NMHA 1GDHA 3EZXA 3G2QA 1CUWA 3ZUPA 3A26A 2AC4A 1S3IA 2H4FA 3HXKA 3LC1O 5E6UB 5C46F 5IRCD 4JOQA 1T5SA 1YHNA 1Z7GA 4KR6A 2R1VA 4LY0A 4CM7A 1DAPA 3HN6A 5JJ5A 1JJAA 1C4KA 3OQIB 3WX0A 3FIJA 3AU9A 4RJ2A 5TMDA 4ARSA 5TRTA 4PYOA 3WLOA 3A4VA 2VQ3A 1KXZA 3IV9A 2GRAA 4YJGB 4UCQA 4LHYA 1YE8A 3ZH2A 1X2BA 1G8MA 2NAFA 2WK1A 5J5CA 3QJYA 4TTSA 4DNXA 3ZVMA 3HKCB 1KMHA 4RPCA 4WEOA 1USVA 3T0IA 1YZKA 3NO4A 4OD0A 2N9UA 2QRLA 4H16A 2IWHA 5IJ9A 2OZLB 1SCAA 1T2UA 4N6OA 3ZGXA 4MITA 2YYYA 5EAIA 3WNDA 4LE0A 4KC0A 5LNK1 1BH2A 1HLPA 4IGKA 4K1XA 4DVJA 5FWYA 2X86A 1NASA 3WRXC 1FPQA 2PUCA 2XZLA 1KPGA 2IDMA 2NTNA 4PAQA 3SVLA 4EK9A 4FYKA 4FDTA 4M60A 3WMGA 1FXSA 6YASA 3G1WA 3QEJA 1EWTA 1U8XX 2PKEA 4GYYA 3GEBA 5JXIA 3U7IA 4Y2TA 4RK1A 1W48A 2B78A 3V34A 1DEHA 3NBZC 2VO1A 3G02A 2OV2A 4O4IF 4ESVA 1KI6A 1ZG3A 2F8LA 3NM4A 2MOKA 3OEEA 2X0EA 2ZDQA 5LQRA 5K0GA 2GK6A 1YUNA 3ESAA 4QOHA 3INTA 3NKFA 4M76B 3WLIA 1QLWA 3DLHA 3BD8A 3JW8A 4L22A 3FKJA 1CUCA 2UVPB 1KZ4A 2BI7A 2OFXA 1W59A 3KSZO 1JTFA 3V97A 1KBQA 2EIXA 3GUUA 4G09A 4B6QA 1GCOA 3VNRA 1D2EA 3LECA 2RG7A 5EHNA 4KIGA 2POCA 1PV1A 4C4AA 3IDZA 5CBKA 4HAXA 5HOEA 1X0VA 2HF7A 5FUYA 4PW0A 4YBRA 2JGRA 3EF1A 1Z4OA 3HDQA 2FX5A 4NY1A 5D2CA 3UAZA 4EPXA 4HFJA 1ZAYA 1SK8A 4G0VA 3P9PA 2R5WA 5GJWC 4E5VA 2BKXA 2PO7A 1I33A 1BVYF 3A9TA 2YIMA 1FS4A 1P62B 1N6NA 2FEOA 2YXNA 2DQSA 1WS6A 4IVPA 5K01A 3ODPA 4GSLA 2A2ZA 1Q92A 2E7ZA 3DCNA 1H05A 3D5EA 3FH0A 1G8AA 2XD9A 4TUYA 2OYCA 3TTYA 3IAS6 3GIDA 5A02A 1WCIB 4GP6A 1CDDA 1TK2A 4IKPA 2AJBA 3ED1A 4GKKB 5CH8A 2ERXA 3ZQ4A 2QAGB 4K0RA 1FTNA 5CM9C 2JIMA 1XMXA 4N18A 4BV2A 2W6ZA 5AK6A 2RB4A 2VP0A 1T3LA 3QENA 4CKEB 1WQ3A 4ZK6A 1EFUA 2QB5A 3ZDYB 5BWNA 2HBYA 1QOZA 4R8SA 5JNLA 4QARA 1G66A 4TTVA 3BDAA 1FW6A 3TDNA 2XKAA 4IF6A 1YFLA 4XVHA 3ISTA 1DTWB 1SIOA 2J30A 2Q5HA 3KPUA 3Q3HA 4I8DA 4Y2YA 2CHUA 4DUGD 3DAHA 2GJ8A 1UQTA 1L4UA 2IOHA 4YRPA 1GZ6A 1KOLA 5DNCA 1OTYA 2OHIA 3T3GA 1Z08A 4H08A 5KNLA 2V74B 3GUVA 1FCJA 1P6XA 3KXKA 3L3BA 4G81A 4IDNA 5FO1A 3ZJ5A 4EFLA 5FEMA 1KPIA 2IYRA 4QOFA 3X1DA 3V1NA 1MA3A 1O96A 2C8JA 5BVHB 1R9JA 4KX5A 4RZ2A 3AB8A 1QFJA 1VHJA 1BWSA 1ZIPA 1CY8A 4GR4A 1AQJA 3GELA 1MEJA 1YHYA 2OKCA 4IZOA 4Z86A 2YW9A 2Z6VA 4OHXA 5HKLA 3K8ZA 2H4WA 4ITVA 2WUGA 5C9ZA 5HZHA 4GZ6A 3HCDA 1G4AE 2JLSA 1AGYA 4I7EA 1XL1A 3LOUA 4XGNA 5KOHB 2B21A 2NZVG 2PT9A 2KPOA 2WZQA 1UUFA 3WOVA 2ZXFA 3AOEA 1N0UA 4YMGA 4X64B 3I62A 1KSHA 2GZHA 3G85A 1ZOSA 4KUHA 4NNPA 4XM1A 3HRIA 2H06A 4QODA 3GFRA 2OQIA 4HTFB 1ISRA 3WRWA 1YCDA 2E49A 2WU8A 1NXOA 5HWSA 3IQIX 1S3SA 3FYTA 3JAKA 2PJZA 2QJTA 1WHTB 3BPSA 3ROEA 1GNTA 4C0QC 5AIAA 5J63A 3MOGA 3UPUA 3QV1A 4DMKA 2B82A 1CUGA 5ITVA 3Q7SA 1QJ4A 4QU5A 4ZREA 3NBUA 2C2WA 2D0IA 5CH5A 3ZY6A 4BN0A 3DLCA 2ZIUB 4LBWA 1E5LA 2GEBA 2VAPA 3G5AA 1J06A 4XLTA 5IAEA 3OIUA 3FGZA 3K6JA 3MILA 4ACAA 1ZC3A 2JIBA 3MOIA 4AKHA 4EVSA 5CLFA 4BNUA 2O50A 2XE6A 3A1WA 5EXTA 1J20A 5A7GA 3SR0A 3L7AA 3OC6A 3ZCVA 3O47A 1SKYE 4D0SA 3FGPA 4CG0A 3DBIA 3ELUA 2BI4A 3D3WB 2XBLA 1RZRA 3HACA 4UTPA 2YOHA 3IXMA 4FI3C 3A6GA 3W2TA 4NHOA 3WIOA 1P3DA 3UKOA 4V3BA 5KMGA 5MDHA 5BXYA 4GEGA 1V37A 1ZD1A 1KVRA 2G9QA 2O2ZA 4H4DA 4RV9A 1GCGA 4TV9F 2FFBA 3CH5A 3N87A 4OLAA 1QX4A 5JVDB 3ZGYA 4QRDA 4MW7A 2CFRA 3N0VA 4WEQA 2WKWA 4L02A 4UM8B 4IXNA 2JLVA 1L7PA 1EP2B 1VGRA 4WJLA 3QF4A 5JO9A 2V4MA 4WXHA 4LDNA 5DBFA 3HP1A 4WBSA 4A6DA 1GT91 2NO9A 3UJ6A 2HU7A 4RJIA 1Z13A 4QPNA 4JLVA 4KQMA 5F1PA 6CHYA 1UDRA 3SXUB 3FUCA 3HFGA 3MLAA 4TWRA 1QLJA 1HX7A 1DBQA 2C4VA 2Z6QA 3DTNA 3W78A 3NRBA 5DGIA 3HZZA 4RWEA 1QRRA 4ECEA 1KBOA 4HI0E 4OI2A 3WL6A 1D2NA 1LBEA 4G5SA 1ZKMA 1OVMA 2BH2A 1IE3A 2B2NA 1H8ED 3O73A 2FFAA 3PGXA 2XUFA 4EO9A 4QQKA 5BW8A 5GOZA 3T7EA 3JAWB 3BSFA 3WB0A 2R4QA 1NZFA 3D0KA 4G1EB 1MJNA 1OXVA 4QQFA 4FGLA 4LFBB 1I51A 1NMSA 2PR7A 3TLZA 3U2QA 4Z9BA 4MCIA 2O54A 4QX6A 4MAFA 4KWIA 3ZY3A 2PLAA 4BNDA 4E88A 3THYA 3A6LA 4IHQA 3GFQA 3IL2A 1Z6AA 2WTEA 2OCIA 1COZA 1QTNA 2H08A 5KHAA 2OGUA 5ICSA 2V5UA 1I7DA 2ZAMA 3G0OA 1USKA 2J9YB 2W4MA 2XD4A 1K5PA 2WYWA 3FCAA 2Z98A 4P5PA 3T9CA 4MVYA 4QXOA 4LF8B 4W63A 4JI6B 3TTXA 1RWOA 2PFSA 3LPLA 3PHIA 2YZGA 1WL8A 3H4VA 3BM5A 5FL7D 2WTMA 2PUDA 4B73A 4DQXA 4E5NA 1MABB 4L5YA 3PEEA 2VTVA 3NJ4A 1B0ZA 1K8QA 1E58A 2ZKLA 3MELA 4TMVA 4X91A 5FWNA 1CUHA 3BFPA 4B84A 4O4JB 2RE8A 1ZAKA 1C1DA 1WSDA 2O5VA 3HCWA 5KQSA 3M3DA 5CDFE 2G71A 4GWKA 4H35A 5FI1B 3ZD7A 1G6KA 1T24A 2PMWB 3HB0A 4ROTA 4GICA 3FNEA 1NVVQ 2G1KA 2W2LA 3G82C 1H8HD 3LPDA 1NRWA 3OLQA 4H1TA 4O29A 3GP5A 3OPYB 3N3AC 2Y6VA 1RADA 1IN4A 2VNKA 3H1EA 2CVPA 3L7KA 1Y42X 5CJPA 2JD1A 1DJQA 1U8EA 3EDQA 3PXUA 3WWEA 1N77A 1LQUA 3ML1A 2NUPA 2CXSA 4UTOA 1QIDA 1XMSA 2BCJQ 4G0XA 4M22A 4D8UA 1E5DA 3OY7A 4P3NA 5DVZA 4G85A 3OOSA 4R1LA 3RBXA 3BC1A 3DVLA 3DONA 4UMFA 1MVOA 1R37A 1Z6QA 1BIFA 2MINB 3NANA 3OVMA 1BRMA 2FSSA 2EG9A 4C03A 2O05A 4YRNA 3ZTTA 3F4BA 5DULA 3JWEA 3GLUA 5H8WA 3DZKA 2GGSA 5BSVA 2LUOA 2YUTA 1XJ5A 2FN4A 3KR9A 2OXIA 3FMIA 2UUOA 1J33A 3H11A 2PMBA 1EG7A 5DGXA 1KEEA 3ZHUA 1CVIA 3C45A 1TMKA 2X22A 4BX3A 3I2JA 4OGWA 1TM4E 2NXNA 2I0FA 4HGRA 2XXBA 2BMFA 5A3VA 4AJOA 4OA8A 3RGWS 1E1QA 4M8IA 5JLAA 4ZV4A 4HAZA 3CZCA 5C81A 4ER0A 4ZAYA 5CPFA 2PXAA 3BORA 4TTAA 4WWHA 3T0GA 5B6IA 4GIBA 5JAQA 1QBGA 3C16C 5D1HA 1WMEA 2O2YA 3U17A 1WZUA 3W6NA 4F11A 1R0BA 3ESZA 1UKVY 4JX8A 2YYZA 2O7RA 2C04A 2O8CB 5I51A 1I3NA 3WK8A 4OGGA 1YRHA 3HDTA 3WKAA 5AM2A 4Q82A 2XZOA 3P4UA 2FWPA 2WP8J 1OBCA 5KQPA 2DT5A 1GQQA 5BUQA 3GPLA 2FMXA 1XJCA 5FNVF 1DAGA 3QXJA 4KQGA 4MV0A 3M49A 3RV4A 2VTBB 3DE0X 4OGFA 3P9XA 4Q12A 5J2TB 1ZVMA 4HNQA 3GJZA 2GHQA 2MSWA 5CVJA 2PSDA 3HDHA 2E1PA 4UOZA 1O6ZA 1P1BA 4XX0A 3KUCA 2HF2A 4XUCA 3PNBA 4OX9Y 1XNJA 2ZTVA 3DV0A 2CMKA 1HFEL 3RHFA 2EX4A 1E66A 2FPPB 1FYFA 3BK1A 1UFVA 3X1WA 1R0KA 5EEGA 3PC7A 4EHFA 3IOEA 1SXQA 1PDWA 4TGLA 4HZUB 3KYDB 1YRAA 3LUGA 4W5RA 2FRDA 1YZQA 2J5RA 3JQ7B 3GXBA 4IX1A 4G84A 1PJ8A 3P0JA 3D02A 3GOQA 3DPUA 3L8FA 3NM6B 3Q5GA 4KVAA 3KELA 4U3JB 5TS3A 4CTOA 1LDBA 1A9PA 2BM8A 1L5KA 1OZFA 1SUWA 3KQPA 5IU6A 3DJFA 2J4CA 4RD1A 3FNRA 1A04A 1XLTA 3QKIA 1WW8A 4HGPA 2P40A 4MIOA 1GTJ1 1B0PA 4B40A 2ZB7A 3P19A 4CG2A 3GLFA 1GU7A 2H5JA 3WC4A 1PVDA 1CRLA 1ZD4A 1JHVA 4HXFB 3EZ9A 3I9KA 3IPLA 1SUAA 3W77A 2X8WA 3I5YA 3X44A 3M6VA 1CEXA 2QTMA 3ROQA 1IPEA 4JBLA 2D2IA 4A91A 1C7JA 1UDCA 4S1NA 4D96A 4MGHA 3TTSA 1L5HB 3CRQA 2WMOB 5EZYA 4FEGA 2IP4A 1I1NA 2X5OA 1X86B 1Z8DA 1EIWA 1QG4A 2Q3BA 5P8WA 2GO1A 3NAZA 3T5DA 1LSJA 5EP3A 1KEPA 2UUAB 1JR6A 3RWOA 3WLJA 2G04A 1LPAB 4ZCPA 5FFMA 1EVLA 2B4AA 4BAUA 1WY5A 4PO9A 4EATA 1LW7A 3DXXA 3AF5A 1JSLA 3LXUX 5I9MA 2YQ4A 1DO2A 2NZWA 4JT9A 3I04M 3L8MA 3BVPA 3TSZA 3WISA 1H6BA 1L7OA 3R3JA 3L4JA 3FHCB 4CM6A 4E2ZA 3PIRA 4E3ZA 1HWYA 3BTUA 3IEUA 5F2EA 1AE1A 1OV4A 3H8JA 3JZIA 2EV9A 3PJFA 1FQJA 2C3UA 4E5YA 5JI2E 4IF4A 3LAWA 3TNJA 5ALVA 4ER7A 2F90A 4WZZA 3U49A 4L8VA 3VNBA 4B8WA 5LD2C 5TMBA 5J3JA 4YP9A 1ZM4A 4JJ7A 4G9GA 5LYYA 5EGNA 5JSUA 2CDRA 1H42A 3H0CA 3IT0A 3RSFA 1OU4A 2RGBA 1KH1A 2HPAA 4JVOA 2OD9A 5JYCA 3S1AA 5I9BA 4DPLA 2FAXA 3SICE 2JGDB 4J91A 5CT6A 2OEPA 4UREA 3ENKA 3OQBA 3LYAA 1MJFA 1FVHA 3CIFA 2X76A 4A10A 4G1CA 2BEVA 2OO5A 3QWHA 2IS4A 3IEPA 3TTTA 1GADO 1U7UA 3IRUA 4AJEA 3AUXA 1WNFA 3D54D 3I9LA 4F1WA 4OO3A 5JAZA 1TGVA 1Z6YA 4DUPA 2BKAA 3M6LA 2YV1A 1S9DA 2HA0A 4RENA 1Y8AA 3ZDAA 2IYXA 1EBFA 2EDCA 3DULA 4FVTA 4NMMA 4CDRA 1W9MA 4QU9A 4YJDA 4K9MA 2DCMA 4EGFA 1DUSA 2R8EA 3GVHA 1NMYA 3D7RA 4FDLA 4MVJA 3U37A 3BB4A 1PQPA 2BSXA 3FPLA 4D45A 5AVUA 3HPRA 1TDJA 2FPUA 2XRMA 3L06A 2CHEA 4H7HA 4WA7A 4XR4A 5DNVA 3H6KA 1M72A 5J2UF 1E5XA 3VAYA 1QYXA 3C3PA 1UPBA 2GXUA 3DDNA 1CD5A 1GGHA 3QHPA 4HPJB 4MYUA 4OQQA 3U19A 2XZPA 2IDJA 1NVUQ 1Z4QA 1U6KA 5AK4A 5C5DA 3EHDA 1HMPA 5E6SB 3T94A 2A1TR 1XEAA 4MIEA 1EHIA 2RB5A 2F48A 4L8FA 4TS9A 2OXFA 3GEHA 1D9XA 2ZU6A 5E3JA 1FY2A 2X2PA 3BCRA 3L84A 1GP2A 5BWBA 3W2HA 1E6WA 3U6KA 4UNPA 2Z4TA 4MQ6A 5KUTA 2JK1A 1HYHA 4RZXA 1PL8A 1YB7A 1UM9A 5ILGA 3LUCA 2JLRA 4N8EA 2ZJFA 5GONB 2HT1A 3CVYA 4MHTA 4JYCA 2XB9A 1BG6A 3E3AA 3ZDRA 3NBXX 1WZEA 1YZHA 3SI7A 4M6WB 4NS4A 3M81A 4M7PA 4OHOA 1VBFA 4Q7MB 4WT7A 4BBZA 5K03A 4I5GA 3ADCA 1P61B 1T0UA 4K9SA 2C95A 3KBOA 4IIFA 5DM0A 3RIYA 2HMWA 4XI9A 2YCLA 1NW8A 5CVCA 3I58A 1V35A 2O7SA 2A86A 4PEVA 3T7RA 4HGYA 3PVZA 1SCBA 1NBEA 2IEYA 1TU0A 2E89A 1W0CA 2ZI5A 3HHPA 2A1UB 3WYGA 3MJ4A 3IKMB 3B3FA 1KI2A 3GCXA 1CK4A 4QPJC 4OUDA 1P2DA 3KALA 3TIVA 1QHFA 3EGCA 3VR6A 4JDPA 4WK2B 1WDTA 1J0CA 4W8HA 4U7WA 3ZVKA 1CQPA 1CJSA 5DN6A 1GPYA 1M34A 2WIBA 3OJ0A 4ENTA 1AKTA 1CJTC 2KX7A 4QIHA 3YASA 1QUEA 3HUEA 1NNUA 1VCHA 3KV3O 4FFNA 2VWPA 1O9BA 2H2GA 5KX5F 3SQWA 1RCFA 2LNDA 2PG3A 3OZWA 3FMGA 4KSBA 4MGIR 1O97D 2JLAA 5MN6A 3KOUA 4FZRA 4CQLB 4YMVA 1ECFA 1PEDA 2Z1NA 5F4ZA 5DT9A 1DXQA 3ZWDA 3D6HA 4XIYA 3R09A 1V41E 2FB9A 2KLBA 2QUZA 3BAZA 3E1KA 3PEFA 3WMXA 4DS3A 3A4LA 4F56A 4CKCB 3AKYA 1EDEA 1BXRB 3PQ5A 1YZ3A 1TD1A 1H6CA 1R4AA 1A9RA 5AKJA 3MM4A 4UXJA 1J6UA 4UKDA 4A8JB 2EYQA 1TUGA 4E1BA 3MTAA 2WTUA 1M66A 4UBOA 1D2MA 2WF5A 3IJRA 1Y7PA 1D7OA 2VUUA 3OE7A 1XD2B 2WWXA 1RWVA 1MH1A 4RQAA 4A15A 1J09A 1YQUA 1N2BA 2FCRA 2P2NA 2HXGA 2BM1A 2YC2C 5E7QA 1ATIA 5IJXA 4ZDIA 3LTEA 1GLGA 1NNEA 2AHOA 1N2CE 1RWMA 2REQB 1LTKA 2YWGA 2I4LA 3QBEA 4X84A 1K27A 1N7IA 2QP9X 1IN5A 3F6EX 3RPEA 2HQSA 4JWKA 3EFBA 3K9BA 4QT0A 1S4MA 4WXRA 4HNRA 3ZHTA 4B33A 4RS3A 2YWCA 1A5SB 5DLPA 2WD7B 1W5SA 1YRLA 3F4LA 2ZQ5A 1EM8B 4B76A 2PGXA 2ODWA 3ILHA 4GOXA 4XUDA 5E9JA 1S1CA 5AVOA 1KK3A 2X6TA 1AQIA 3LVBA 4J0EA 3WHIA 4Z7QB 1FIUA 5EUQB 3CX3A 1YZUA 1GUDA 5CTAA 3SIXA 4EY6A 3P9IA 2R8ZA 1I1HA 2ZSHA 5ALYA 4TXJA 3ZOZA 4CZ2A 4EFMA 2HSWA 3AERA 3QVOA 3FR7A 4AKIA 3Q3JB 2JD0A 5DIZA 3FSGA 3SM9A 1UBHS 4Y1RB 3F3MA 1GWNA 2YS7A 5AYVA 2J6CA 5HM8A 3C1AA 1Y8RA 2HDHA 2XMBA 1A1VA 5EWLB 1Y34E 4CIDA 5JQGF 4FFBA 5DYNA 1LDGA 2B7CA 5ALLA 4D9CA 1V8FA 4UTNA 4HC4A 2I71A 1BCRB 2XX3A 2F4VB 2ID9A 3RRJA 3VI3B 1V6AA 1HQKA 4FE4A 5IKPA 4AY4A 1H1TA 3MOSA 2JCSA 1FNNA 3R5TA 1WM1A 4PHCA 1WXXA 2VPQA 5E6UA 4MUKA 5HYVA 4BZQA 2QN6A 4EFDA 2QX6A 2XZTA 2RGXA 2DJ5A 1YS2X 3LDAA 4P7KA 3RIGA 4JXXA 4YJFB 3K70C 3FKSD 3JQFC 3SX4A 4ZYLA 2EW1A 4H7JA 4KIWA 1ZISA 3C15C 3GZNB 1OWPA 3IPRA 1E2IA 3EPPA 4BFVA 2Z9BA 1GYRA 1S4QA 1Q15A 2CNWD 3R7SA 2R8OA 2NUTB 4M1ZA 1V8OA 5LZ4A 3FVRA 3K9QO 1Y4DE 1XRLA 3HKCA 1Q1ZA 1AS0A 4GWLA 1XCJA 2V3VA 4BP9A 4O59O 4I3FA 1QIGA 5K8UA 3GGCA 1ADGA 1CDEA 1AKRA 3QXGA 1U0BB 4GKJB 1GZ7A 2OZLA 4I5EA 3PL5A 4TMFA 3B78A 3T38A 2ANBA 2D8AA 1MR3F 3DWFA 3TRDA 4TWBA 4EI9A 1QH1A 2VJAA 3QY0A 4NEHB 1EZZA 1RACA 3EXIB 3IEVA 1R3UA 3DR5A 3IVRA 1Y3FE 2FN3A 1SCDA 2BFAA 3LNCA 1L7MA 3OPVA 3JV7A 4MHSA 1R18A 3HABA 3GUZA 1MOSA 1SXGA 2PSJA 5DF1A 1J4AA 3MAAC 4B32A 4RD4A 1JZQA 1YSCA 1RHJA 3URMA 5GADl 1XIVA 2RHLA 2VJYA 4KZKA 1BN6A 1MX9A 3MWLA 1XE3A 2ESRA 4H31A 4I08A 4TRJA 4DAEA 2W42A 4F4HA 3WLLA 3HE3A 3O8OB 4ALNA 2OOKA 1H4VB 5LYJB 3MS7A 5KNDD 2PMDA 3IPCA 2MMGA 2QJRA 4FMCF 2UVPA 4CM4B 3SWWA 3FIUA 5CA0A 4LDQA 3SKXA 3I6ZA 1A9TA 3K5WA 1XNHA 3W1VA 1V3UA 1X7ZB 2PBZA 4URXR 2Q27A 3MJHA 3PUIA 4NCJA 4XEHA 5AI4A 4DLXA 3DZGA 3D6VA 3MLEA 3CZ4A 3FCCA 4UUNA 1RHMA 5JMPA 4PSVA 1SCQA 5BSEA 1B2LA 2G5PA 2GEVA 2QGNA 1AIPA 2QN3A 3EXHC 1VKZA 3IJ5A 4YNBA 2CJWB 2BSQA 1TXGA 2AF4C 2PFKA 1DAMA 4HEHA 4L0CA 4Z8XA 1UXJA 1W5TA 5ICFA 4INOA 1U0GA 2OM6A 3QIVA 3G7NA 4X8MA 1HM5A 3SG0A 2IBSA 1SXJA 3L5KA 1HEUA 1K4MA 1QHGA 2Q4EA 4UUMA 3L8YA 1JR3E 1JA0A 1NXQA 1YI0A 2WU4A 4ZCQA 1DPGA 1FTWA 3OTWA 3STWA 4CWAA 2EHJA 1FXUA 1WCIA 1JFVA 1VLMA 2C0QA 2FEPA 2YWHA 2JJ2D 4KBFA 1TT5B 1NQOA 2P3OA 4MP8A 5LP6A 1JUDA 1PQUA 4HUTA 3K0FB 2PX2A 1NWHA 2WWHA 3FLEA 4K26A 4P9NA 2NXWA 3WLTA 3ZBTA 4CKEA 4IJVA 5CCEA 5J59A 4BQOA 5A4JA 5KBYA 2IYPA 2BF4A 3NG1A 1W5AA 4ARZB 1GQYA 4D99A 1EVIA 2I2BA 3KU1A 3PKIA 2VDLB 4K87A 4QXAA 4A27A 5FAKA 4MVJG 2UYHA 1UBCA 3GEPA 4JP3A 1JYSA 1DKLA 1HPLA 1OTXA 4J0KA 1R6DA 1CQIA 1U9IA 1DVRA 3II6X 2H7XA 4O6VA 4E5SA 1G7SA 3G2LA 2XYRA 1FMTA 1O87A 3THWB 5T8KC 1QGUB 2VSXA 3SCZA 3AQIA 3GJRA 5JSYA 4DMLA 3ZDBA 2HCJB 4R83A 3ICCA 4LF7B 2W2OA 4OQXA 2OQVA 5KCMA 2WD8A 1MIOA 3FTDA 3WGTA 2VEDA 3IAS1 1BVRA 3QX9A 3CT4A 2GFHA 5REQB 1Z38A 1T9AA 4EZIA 4OJKA 2YV4A 1PW7A 2PSSA 2Z95A 3IODA 2BKVA 4AURA 1KEKA 3TBKA 3OCZA 3QHQA 4I2NA 3OLVA 3BIXA 2C9ZA 4L3OA 1OVGA 2QTHA 3AZQA 3DEJA 4JBHA 4HTFA 4KNVA 2ECFA 4PC2A 3RFVA 3RFXA 3V46A 3WSWA 4PYKA 3C8HA 3NALA 2ZEJA 1D03A 1WHTA 3M2TA 2YVAA 2BEUB 2V54A 4L4YA 1D6JA 3ADOA 4MUEA 1O95A 3IQWA 4BAZA 4IIVA 4W82A 2GN1A 4K88A 4OQNA 4OSOA 5EE0A 1XPRA 4F6RA 3QYJA 5KDLA 4EUKA 5DTMA 4Y0NA 2ZJ2A 3H5IA 2BYTA 2PGIA 1PS8A 2NX2A 1BJKA 4W5QA 2JBWA 4NG5A 4UM9D 3VSEA 1XTPA 5BMVB 1SKQA 4PNEA 1P4GA 4L5IA 4LWPA 4I50B 4MKGA 3L8EA 3EBLA 2TS1A 5LMNB 2CHVA 2B1IA 1GYPA 4F06A 3OOYA 1L7DA 3G8BA 3SE0A 1WE2A 2BFEB 5ESXA 3B9RA 3ZTYA 2EJUA 5I7VA 1W85B 2FHSA 2IPMA 3D43A 4LJLA 2A7XA 1E9AA 3ICVA 4PXYA 1I8TA 5DX8A 5L4NA 1B43A 4JENA 2NTJA 4JJGA 4DCPA 5IF3A 5EINA 3B2QA 1H1LB 2BKUA 4PAMA 1W2WB 1SCKA 4IBOA 5JVDA 5LIPA 1X6VA 2QPTA 4LQDA 4ZT4A 4MVWA 4TUYF 4KR3A 2VHZA 2E48A 4X60A 2LE0A 1KAQA 1NLZA 5CCBA 1W73A 2AW5A 1XHFA 1QYCA 1MQAA 2AOWA 2IHJA 5CT4A 1XXLA 1REQB 1DELA 1NULA 3IBCA 3VVCA 3V55A 1OFVA 1TPZA 2BTOA 1DINA 2O0KA 4P0QB 2D7CA 4DJDC 3WAGA 1RLTA 2FJ0A 3L0OA 1PJ3A 2HU8A 2OXRA 2XUQA 4FKBA 4XYGA 3T52A 3TG8A 1T25A 1G19A 1ULSA 3H87A 2VDVE 4QUHA 2WABA 1VLVA 4EW1A 1FP7A 3DMTC 2C84A 3FXAA 3AKZA 3UOGA 5IASA 2IVZA 3G89A 1NVTA 2BY4A 5ALWA 4J07A 5AKLA 1DIHA 2FGKA 3DMNA 4NU0A 3CV3A 4Q6BA 1X7DA 2R47A 1CBUA 3HYSA 4GP9A 4C7XA 2JFHA 1P0QA 3TGLA 3DG9A 3E9ZA 4EUNA 5KPDA 3A28A 1U3CA 3VO9A 5ECDA 3C3WA 2BUBA 1XTTA 1Y6QA 3T6KA 2RHRA 3PX3A 2IEZA 1V25A 3O95A 4DRXB 1G20E 3DE3X 3PYLA 4JQYA 4UOQA 1P9LA 5KDOA 2JKYA 1MQ9A 1W44A 1Z06A 4OB7A 1S8FA 5ILOA 1HQYE 5AFSA 4RTOA 1PEYA 2QG4A 3MTGA 2JFQA 2GXQA 5JZVA 3UGJA 2GCOB 2P1DA 3DMFA 4DDTA 3WGLA 2BR4A 4YPOA 4FFLA 5ENZA 2BMAA 2NIPA 2PZLA 3LUHA 4AZ0B 3BFVA 3ADBA 4KXUA 1R5OA 3AUJB 2NO7A 5ALKA 4RK0A 3O92A 4ND5A 3ET4A 1Y1QA 1JG1A 4HYEA 2E2WA 4M1TA 1DUVG 3GGDA 2ZB2A 5C3UA 4YRSA 3ZDEA 2Y0CA 5JR3A 3AVQA 2JHFA 4O4JA 1ZLYA 5IX8A 3NOOA 1V16B 1XLWA 1SIBE 1MXFA 5C34B 2ZETA 1HDIA 2IYYA 3M3PA 4M1SA 4PLGA 3V1LA 4YQFA 1IN6A 1JYEA 2Z6AA 1Z6TA 4R5MA 4I3HA 2I54A 3IHTA 3HQ4O 5BN4B 3RB8A 2DZDA 1KVUA 3I73A 3PUYA 4YMSA 5YASA 4E3WA 9ABPA 3RS8A 2P5UA 2PY6A 3M1LA 3Q8WA 1S89A 4K6CA 1BQEA 1M5TA 1N9GB 1O03A 2FPGB 2O06A 2Z08A 3KWMA 1XF1A 3PHJA 4GAEA 4HWRA 3GWGA 1OROA 2V6JA 3ZNQA 2P77A 1TVKA 1K92A 1R10A 1HH4A 2G40A 1U02A 2RMKA 4M0CA 4QEKA 4ZVKA 4DJAA 4AZTA 4MKRA 4B74A 4B3IA 2WJ4A 4O3MA 2WF8A 3ACDA 4IEIA 2JGMA 3QH4A 3TLKA 2W37A 1PGNA 2XMCA 3EPJA 4ASUD 2G8LA 4DHEA 3SD7A 3C0KA 3IAXA 4A0FA 4ZTBA 4M53A 1TCBA 3VC1A 3O2JA 4NBVA 1LF0A 1UP6A 3PUZA 5E1MA 3NCHA 2OO3A 1KK2A 4MPDA 4FW9A 4KQJA 3NETA 1QLHA 5FV7A 2FSVA 2ZK7A 2A9FA 2JAUA 1RXVA 1V9LA 1WLYA 3EIUA 4H77A 2JK0A 4MS4B 4UVHA 2NOAA 2XYQA 4QFBA 1QVWA 3S2IA 3AHIA 2WWGA 3HCEA 3GFVA 2Q29A 4MRAA 3U13A 4NU6A 1MU0A 3QOWA 1CTQA 2PX6A 4N6NA 4UW9A 3DDWA 3UENA 3BXHA 1K3TA 1J8MF 3V1YA 5L3ZA 4OB8A 3DL0A 5GGYA 3VVBA 2JLQA 4DCJA 4RFSB 3PKZA 2ZYHA 5BT9A 1IBKB 4QGHA 5I4IA 2ARKA 4ZPXA 2HWXA 5KTTA 2YWJA 2O8CA 2HBZA 3PGMA 1SKUA 2QTTA 4OHFA 5TQ0A 3W3AH 4PG6A 4FLEA 1VIMA 2WMDA 1HT1E 4U6NA 1TADA 3PNYA 1NXSA 2WKPA 6LDHA 3W1EA 1D1QA 5IVIA 1JBQA 5DI3A 2G36A 2N75A 4V1CB 5JY6A 5J2TA 2XB6A 4Q03A 4QOJA 3R9XA 2XXJA 1WB5A 4YEDA 1C8LA 5JSFA 3VSCA 1DLJA 2NADA 1UJ2A 1XLVA 3E2MA 2FPPA 2Q3EA 5TX7A 1KRHA 4UNQA 3G68A 2F3RA 2NO5A 4WOKA 3L6EA 4HZUA 1ORDA 3KYDA 4JJEA 3RJ5A 4FFWA 2RBEA 1PGOA 3PHHA 3JQ7A 3OH8A 3RVSA 2HK8A 2V7TA 4R41A 9GPBA 3RSGA 2LIPA 4U3JA 5EP2A 1T91A 1NJ2A 1A77A 3QUQA 4JP5A 3LY9A 4X71A 4XVRA 4NCNA 3A8TA 2VQEB 1UOOA 2DR0A 1O54A 3PNQA 5KYYB 3SQDA 1CERA 1GNLA 3MSXA 1MN6A 2AMFA 4PAOA 1E2UA 3VDMA 3W5CA 1XZNA 1K4YA 1OLUA 1XZPA 2AZ4A 4NBWA 1NDHA 1XF9A 2G3YA 3RK0A 3QVSA 2GZDA 3GT3A 5I8WA 1QYRA 1RI5A 3NHBA 5TGDA 4UCWA 3ETDA 3ROFA 1C7EA 1B26A 1L1FA 5GOTA 4GUDA 3ELWA 1V0JA 2OCPA 4KXMA 3GQBB 4DLBA 1HL3A 1E8DA 2AKEA 2PZJA 1NXTA 1YR1A 2WIFA 3DNPA 1LQ2A 3SZUA 1W1UA 4KSYA 1E3MA 2Z8YM 3P0HA 2BUAA 4QJBA 1L1QA 5KTOA 1CFZA 1I6WA 4O4HB 1YR7A 4EWLA 4F1JA 3NTLA 3KB6A 4US0R 2LVBA 4EHNA 3WDSA 1H9AA 2B37A 4Y2JA 3ERCA 4BNWA 2YR0A 3IRVA 5LA6F 5G1NA 1N36B 2H59A 3FPCA 2QY6A 2PRKA 3C7CB 4GKAA 3VSDA 1AXRA 4FNMA 4MX8A 4BJHB 4FHFA 3GFSA 5DJ5A 3V00A 3Q6IA 1GAXA 4BC1A 3ER9A 5BW5A 2Z2JA 1EI9A 2J67A 3PQ8A 1XDGA 3SQLA 1NY5A 1W0JA 4RIIA 4M0DA 4YO7A 3WQBA 3EN0A 2JHAA 3PLAE 4NOMA 4FX5A 1YBVA 1PX0A 4YP6A 1E9VA 2CXNA 3T3HA 5F21A 4DY6A 2QD3A 1YBAA 1IVNA 2ISQA 3HI4A 1OI2A 4IDAA 2X9LA 3DYVA 1NFRA 2EGHA 3A04A 3OCJA 1Q0QA 1V96A 3OU2A 4HF7A 5ALQA 4ZDWA 3DEZA 3DTTA 5G0UA 1SZJG 2WJJA 3TEJA 3BBLA 1BE0A 1OGYA 2EX0A 3CX7A 1MO2A 3Q8XB 5ETJA 4KNYA 3CGWA 1TZCA 1VP9A 1Z9BA 2DOKA 2FW7A 1X2EA 1EUDB 4J1SA 4DQKA 4B47A 4C4OA 4LX8A 4UC0A 4DZTA 4NZOA 3T7IA 2C4NA 1ZA1A 3O3OB 1Q1NA 4ZVLA 4KN5A 1NPTO 1R64A 2CFOA 2ET6A 1XU7A 3EB9A 5AM3A 4G3XA 4NWIA 4RGQA 1G6OA 3AJ9A 3WLFA 5K3EA 3G0CA 1YTLA 1FC0A 4DTIA 4R2HA 1DC3A 4ND2A 3A3PA 1MENA 3K6KA 5B3JA 1NXVA 1NM5A 3F5QA 3QLVA 1ZMTA 3T5CA 3ORYA 2V3CC 3ADPA 3FSJX 4DUZB 1NJ8A 1I4TD 4PX2A 4YAWA 3RTEA 4YP5A 1KYYA 3HBLA 2QMZA 3EZGA 4UHBA 2G4LA 3A2MA 1PYDA 1T13A 4WNIA 3ZZTA 2FZWA 2OXEA 3HJGA 4DLSA 2O2CA 3V1TC 3PCRB 1J8DA 5C0OE 1F0NA 2XDQB 5A6SB 4QGGA 3GLTA 1JXQA 2X5XA 1QH8A 1RP1A 1E92A 2Q3JA 4B43A 4YJ3B 1QKIA 1Q20A 5F2NA 2MYNA 3BGOS 4C7VA 2B8TA 4G0MA 4RLQA 1GKIA 2PIDA 3HA5A 5E7IA 4OHWA 2YNMA 2VYCA 4IW3B 1YC2A 1E1LA 2YH2A 1E2NA 4IHJA 2CL5A 2DVMA 4YLYA 5AUPB 2WF7A 5GONA 3W79A 2PJRA 4U2KA 1E2DA 4JA2A 2XR1A 1JDZA 3PPVA 4AKTA 4W4TA 4WTOA 3KM0A 1PFYA 4M6WA 3I28A 2WUFA 2C57A 2BH9A 2QN9A 4NV0A 4NZPA 4RF2A 1SG0A 4ZZIA 2ZUWA 3D5QA 4PLFA 2C1XA 3NOVA 5AXCA 5EUMA 5EZYF 4BASA 1GO2A 4NQZA 2OA0A 4UFPA 1G21E 2FHPA 2NQTA 5I3CA 5KOYA 4DE5A 2ZIXB 1UWLA 1ODSA 1FE8A 3NHUA 4IXWA 4KE8A 4TKMA 4X00A 2PAFA 1U2ZA 2PQMA 3UAYA 3TOZA 3V8BA 2WHRA 2JGIA 4ZEVA 4DV2B 1VKOA 1G7RA 3R6GA 2MIIA 2CWDA 2R8BA 5H3LA 2IWRA 5FPTA 1FLAA 3K6RA 4A2WA 2IX3A 2G70A 2VAVA 4MWSA 1KRWA 3Q88A 2A1UA 1GZSA 2QN7A 3FG9A 4M0KA 1R6XA 3X1MA 1SUFA 2JAXA 4G9EA 4JLPA 3TRFA 4C22A 5IAGA 5DYIA 1PDOA 1H4SA 4HRVA 1IWPB 4DV7B 4MPPA 3DCJA 3NHWA 3UXEA 3W9SA 3L1KA 2B35A 5AKKA 1Z8FA 3AZOA 4M0LA 4IQGA 3AOEC 4ITUA 3LZCA 5FPPA 4FNAA 5FUXA 2DPLA 3QYPA 1Z4IA 1URPA 1BROA 5EPUA 2F62A 2V6MA 3KJEA 1X3SA 1RQNA 4I9FA 3DDHA 3QUTA 4J49A 2XGGA 4M89A 4PZLA 1WUKS 1Y7TA 2WNHA 1M76A 1Y98A 2WFLB 4WOPA 2REXB 4YRGA 1VSUA 3A37A 4B71A 3BSYA 4LDPA 2DULA 3L02A 3WG9A 2OGTA 1KVQA 3QFSA 4CKCA 1RZVA 4G24A 5ITZA 3B1KA 1SC3A 1BXRA 3ZLJA 3EEYA 1YBFA 1Z0ZA 4EEZA 4E22A 5C4GB 4A8JA 4UAVA 3KKQA 4WZBB 4CHTA 2QW8A 1E1KA 3MD9A 5CVVA 2L69A 3DXFA 4UQOA 5DWVA 3BZUA 3H6HA 4WCVA 1XD2A 4DYVA 3P96A 4CIBA 5KTPA 1UEJA 4UAUA 2QRGA 5F2KA 4WN9A 1B6SA 1SZPA 4FR2A 4P3OA 5F9FA 1MV5A 3N86A 1AMOA 4CIYA 3T7KA 1QR2A 1UPUA 4TL8A 1KH3A 4JJAA 4BN5A 3KUDA 2YMLA 2JGAA 1Y7LA 2NZJA 2BMDA 2PBRA 4JT4A 3MJSA 4UU7A 4YT5A 1UT6A 1U8AA 2BDUA 1WF3A 5AXDA 3OEHD 4BTLA 2PZAA 3TYXA 5DT2A 3PUWA 1QZTA 6NULA 2P67A 2ATIA 3DEKA 4UVIA 2PUFA 2C42A 3KT6A 2YBEA 4KWTA 4IIEA 2CJPA 5FI5A 4Y2RA 4FQ8A 3LP8A 1EDDA 3U3JA 5KNDH 1EM8A 3LCUA 4NMWA 2R2AA 4TVBA 1DRVA 1Y1TA 5LB4A 1E3DA 1TTHA 2W6PA 2WVGA 4BRWA 4EY4A 4QJ5A 5LLDA 4AF7A 1QFXA 3D0QA 5DYWA 1SHTX 3T8YA 1FNDA 3KYJB 2GF2A 4P84A 2QVBA 3EQ2A 4Y1RA 5EIHA 3UFXB 3JYPA 5LXTB 3HR4A 3AVTA 3ZWPA 2O14A 3SS7X 4DMMA 5EVCA 4JT2A 1COWA 2EYUA 2XT6A 2GD2A 2FF7A 2Q6TA 4RF5A 2BBWA 4LHXA 1BCRA 2ID7A 4IJMA 2C20A 2G6BA 5TGZA 1EFKA 1BS9A 1E8NA 1LBIA 2AEEA 2VT6A 3P9QA 3TZHA 3NLLA 3CEJA 5JXGA 1W76A 4X65B 4ZXFA 3V4ZA 2WDZA 2WJ3A 4TKUB 3UJ7A 3MUOA 4YJFA 3CUSA 3WNBA 4D4IA 4YC7A 1KHHA 4YCSA 2ZUDA 1GRNA 2B5OA 1TUIA 3FLAA 1CHDA 4M9CA 5F73A 2JFXA 1PP4A 4C04A 1SHJA 3GZNA 4WJKB 1NT4A 1QO0A 2Z5LA 1L5QA 4DEYA 1TMGE 3O9MA 3E15A 1ADFA 3QXCA 4LUCA 2NUTA 3FMFA 3PXAA 1ACJA 2DHDA 3RVKA 4C4PA 3R0QA 4QVKA 5LQJA 2EF0A 4B6GA 3FWKA 3CG4A 3IGFA 1MJGA 4CI9A 1NTOA 1Z37A 1LSOA 2ZVPX 4BYMA 2JLZA 3OT5A 4R9SA 4P3XA 5BUSA 4IJWA 4LE1A 5JBNA 4YCJA 1JR4A 2VPPA 4IGEA 4WFKA 4S24A 1CUVA 3RTAA 4AJ2A 1EUQA 3MWDB 3ZV4A 2GI4A 2Y0BA 5J4KA 1SQ6A 2GEFA 3EAGA 4BN4A 1SZCA 3PLNA 3B9QA 3C1OA 4G56A 1U9ZA 4L3VA 2QQEA 3DLIA 2VJNA 5K5EA 1F2TB 1TEVA 3BUSA 5LL6P 4AQYB 2AHRA 1ZICA 3LHKA 3U4QB 2ZCJA 1A9XB 4MJ3A 3OO0A 3UQZA 1JRLA 4NFLA 1MNQA 4M4SA 1H5NA 3TIXB 1TU3A 4IIUA 4A26A 4ZI2A 1B15A 1NR7A 3B5IA 2JFBA 3PE6A 4LJ5A 1TIKA 3HRHA 1OXSC 4RX1A 4CR6A 4N65A 2XNHA 5L51A 1ICEA 2W22A 3OCYA 3ZWWA 1JLLB 4MAMA 5BNIA 4TMYA 4XWGA 3TAUA 3P45A 1TM1E 1LK0A 1WAMA 1M67A 1QV7A 3O8OA 1NBHA 1RWXA 4HQNA 4M0EA 1MXHA 5LYJA 1WVIA 3ZE1B 1Y8QB 1PNTA 1Z6GA 2I33A 3PRKE 1GVHA 2B4QA 2CVZA 3N7AA 4M87A 4XOIA 3TZCA 4EGSA 3CSSA 5U4XA 1DCFA 3ZXXA 4CM4A 4DM4A 2F8SA 5EJFA 3HDJA 1SVUA 1O2DA 2GCNA 4JC4A 1X7ZA 4RK7A 3GFGA 4JS0A 4ZAGA 5FIUA 4EA8A 2Y05A 1F9EA 2FPKA 4DL9A 1L9KA 2XE4A 3UMRA 1NSYA 4AJPA 4EP1A 1ZCJA 4YXWD 4RK4A 4NOJA 1TF2A 4RSHA 1YQDA 4RTPA 2WSSD 1DHRA 1AC5A 2HPVA 3FBGA 3GMTA 1F2UB 3TS1A 2V7UA 1C3EA 2QLMA 2X40A 3OZDA 4RHEA 2X3FA 4DKXA 2QRVA 4C89A 2ATXA 2M6KA 2JIZD 2ONZA 4Q18A 5IJ0A 3BMOB 5JFOA 4Z53A 2D8MA 3BEDA 3WK5A 3PWSA 3PHCA 1K7YA 4MCAA 2DQKA 1KOJA 4MW4A 2FXIA 2VHUA 3AP2A 3D0RA 3F4KA 5FOSA 4DSTA 4RC9A 5AW9A 2YIDA 1UMKA 1IEWA 2ZYRA 3P5SA 1UDXA 3VBEA 3L18A 1IY0A 4DGQA 1TT5A 4MNTA 1PR2A 2F1IA 4QNRA 4S12A 3RG2A 3E7FA 2NYUA 1ZH0A 3GPIA 4X3OA 1OXMA 3C2QA 3T1VA 3AFHA 3WGGA 1ONNA 4Z9FA 2IVFA 3EDCA 4PSDA 3SJAA 4ARZA 3PU6A 1A2QA 4HAYA 5L3QB 4G4SP 2NXEA 2VHQA 2E87A 4L7VA 2GEUA 1AQNA 4YIHA 3MTIA 1HDCA 1Z4JA 3OY2A 1LVUA 3UPTA 2C5HA 3KBBA 1XRJA