5JIBA

Crystal structure of the thermotoga maritima acetyl esterase (tm0077) complex with a substrate analog
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
320
structure length
319
Chain Sequence
FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cephalosporin-C deacetylase
publication title Crystal structure of Thermotoga maritima acetyl esterase complex with a substrate analog: Insights into the distinctive substrate specificity in the CE7 carbohydrate esterase family
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Hydrolase
total genus 123
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jibA00
3QPAA 1WB6A 2OGSA 1W4LA 3PFCA 2XQFA 1FFEA 4I3FA 5AI5A 1DT5A 3V1KA 4BRZA 2XUIA 1MT3A 2QUBA 3C87A 1DX6A 1MAAA 5HF5A 4I4CA 4AB1A 3RKSA 1FSSA 4B83A 4OU4A 4H18A 2Z8ZA 1XZBA 1JKMA 4N5HX 4G9GA 3IUJA 1LPSA 3A2LA 2XQKA 4UHCA 5HKAA 4DNFA 5C81A 2O2IA 2Y2VA 5CH5A 3IUNA 2XUKA 4PF1A 3C5WP 5EIEA 1R3DA 4X71A 1XLWA 4FFWA 2RONA 4NS4A 1BCRA 2P8SA 4B82A 3W2TA 4UBOA 1Q83A 3SK0A 3UMJA 1THTA 4KYVA 1E66A 3VJMA 4BATA 4UBKA 4P92A 1J07A 1XRPA 4J0GA 4BE4A 4IHAA 3S8YA 2AJ8A 1CUBA 4Z49A 4CG2A 4GHWA 4X94A 3DOIA 3HYSA 3I28A 1LPAB 3LCRA 2WUFA 4RNCA 1ORVA 2CKMA 3IIIA 4OD0A 1MNQA 4RE6A 3G02A 4B85A 3C8HA 4FOLA 3ZWQA 2HRQA 2XQGA 2CB9A 4C89A 3WYNA 2PUJA 1ZD4A 4OYYA 4GBGA 4Q3LA 5CBKA 3F97A 1MNAA 5HQ3B 5IVDA 3WLAA 4FTWA 2R8BA 4KAJA 3E1GA 3QMVA 5JALA 2PVSA 3WL6A 4BCDA 1UZAA 2QKYA 1HL7A 4HXFB 1TCBA 2XE4A 3FOBA 3DOHA 2HL6A 4H35A 3FVTA 4DMFA 4X3CA 3D7RA 3DKRA 3O4GA 1UOQA 1GQSA 2JGIA 1P0IA 3QPCA 3EIOA 2AJDA 3VXKA 5A7FA 3QZUA 3ANSA 1CUDA 1F0NA 3PF8A 3WL8A 1CUHA 1VLQA 5HF9A 1XLVA 3FCYA 2ZYSA 1AZWA 4F5ZA 3R3ZA 4PO3X 1OXMA 5C8XA 1T2NA 3VVLA 1CUFA 5T4HA 2OCGA 1CFJA 4H7JA 1E8MA 4Y2PA 2BCEA 2NW6A 2QVBA 2DFPA 2JEYA 3C8DA 2QR5A 4LYEA 1TK3A 2QMQA 4AZ0A 1ODCA 1ZICA 1EDDA 2B20A 2RAUA 5A2GA 2C4HA 3HJUA 4QDZA 4BCCA 1XQWA 4GECA 5ALVA 5AM3A 4O08A 3WA6A 3D59A 1UK8A 2H7XA 4ARAA 1XZDA 5LYYA 3U1TA 5ALTA 4BTLA 1K4YA 5HK9A 3FCXA 4DSAA 4E46A 5ALMA 2WFLB 3I2IA 5DNUA 1XZMA 4JUIA 4ZREA 1BROA 3L1JA 2I3ZA 4FLMA 2ZJFA 1XZGA 4FLFA 1ISPA 3K2IA 4DSZA 2O7RA 3H18A 1MPXA 3D5EA 1T4MA 4AXBA 1F8UA 2X5XA 1DU4A 1J1IA 2WU3A 4JYPA 4YPVA 3AINA 5EFZA 3IBTA 2IX9A 3H2HA 5CT4A 3K6KA 3KSRA 4U2EA 5JADA 3LIIA 4QWWA 4CCYA 5C8VA 2WM2A 1CUAA 2JGFA 1HQDA 5EGNA 4IH1A 1UK9A 1QO9A 1QGED 5AJHA 4H7KA 5ALGA 3TJMA 2YYSA 4Y2YA 4A23A 1IZ8A 3H1AA 3QM1A 5KWJA 4MEAA 4ZXFA 3CCBA 4GLBA 2XUFA 4HAIA 5CW2A 4K6KA 1BU8A 3SC2A 3WK7A 3R41A 3STWA 3WJ1A 3H2JA 2C0PA 3STVA 3I2FA 5ALUA 3GA7A 2JGKA 4UBMA 3I6ZA 1CUIA 3KWFA 5AKZA 3WQHA 1F6WA 3DYIA 4B7ZA 2EDCA 2CBGA 2YH2A 3QVMA 1ACJA 2WUGA 4J0CA 2H1IA 4UPDA 2I3DA 2WSLA 2ZJ7A 3F96A 4PSUA 5ALOA 1SC9A 4WDQA 2J4CA 1VZ2A 3VDXA 3FSGD 1CV2A 2OCLA 3V1NA 2AJLI 1VE7A 2XUOA 4G5XA 1OCEA 5LKAA 1KU6A 2XMCA 3I2JA 3RM3A 4X00A 4JH0A 4W63A 1XRQA 1BCSA 1F0PA 3G0GA 5A7HA 1QLWA 3G8YA 4BAGA 4CIAA 5HCUA 3FLAA 4TGLA 3W9UA 1XROA 2OXEA 1XQXA 5JAUA 4FKBA 5DLPA 2IITA 4JEIA 1XRLA 3PICA 3T52A 1ZI8A 2VJAA 4UUQA 2BUCA 2H7YA 5JD6A 5A62A 3D0KA 5HF8A 4GEGA 1CUSA 1SCQA 4LXIA 5JD4A 2ECFA 4X93A 3RARA 5DNVA 5AK6A 5CT9A 4G4IA 2HM7A 1WB4A 3AILA 4HXEB 5C7YA 2WJ4A 4Y2JA 5SYNA 4HS9A 4BAUA 5LZ9A 1XZJA 1UKBA 5LIPA 1BN6A 1G4HA 3M83A 1KU0A 2FJPA 3FLBA 4BC0A 5EHQA 2HA0A 4UHDA 4CG3A 5EI5A 1SFRA 2XMQA 3HZOA 5HQ3A 3BWXA 4UHHA 1EK2A 2V96A 2XT0A 1AUOA 1LPOA 3O4IA 5CRIA 1CQWA 1TRHA 1NX9A 3NOXA 4X85A 1XFDA 2PUHA 4H7EA 3B5EA 2VJDA 3B3QA 3CCCA 2J4FA 1K63A 2E3JA 4HRXA 4BZZA 1QIGA 1QIIA 2RIPA 2QZPA 1LPNA 3A2MA 2OPHA 3AZQA 4BP8A 4Y7DA 3ESCA 3TEJA 1E5TA 4FMPA 4ZV9A 1BS9A 5CH8A 5LKRA 4UBNA 3C45A 3X3HA 5LZ7A 2PM8A 3AIOA 1A88A 5ALDA 4B9AA 5DJ5A 1YA8A 1RWQA 4AO8A 4G8CA 4DMKA 1CUEA 2ZYRA 1XZKA 3E0XA 2G5PA 1LLFA 2WIKA 1Y7IA 5BWCA 2G4LA 4HVTA 1HPLA 2DHCA 2OAGA 4Y9SA 5ALQA 4C87A 3HI4A 3I1YA 4I19A 4RGYA 5K5EA 1G42A 1CPYA 3H0CA 5ALWA 3DDUA 3WL5A 4IQ4A 1H22A 4BP9A 2OCIA 1DTEA 1UOOA 1CUCA 1YASA 3FSGA 4PQEA 3IUMA 1NU6A 2VQ6A 1JMYA 2JGLA 2PL5A 3PI6A 3BF7A 4ARBA 3ZPXA 4H0CA 1QIHA 2X76A 3I2HA 6YASA 2PU7A 3C43A 3BF8A 1Y7HA 4KE8A 1RYYA 1SCIA 3R3WA 5AKGA 1U8EA 4Q05A 2WJ3A 4J0JA 2QS9A 2WFLA 3G9TA 1FFCA 3OTQA 2XLCA 5KREA 1Q84A 4OUKX 2WHRA 1EVEA 4K6HA 5K3CA 2CZQA 4EA6A 2WQZA 5JAHA 2XMBA 4RPCA 3HLKA 3O0DA 2HIHA 2Q0XA 1ZI9A 3RLIA 3WK8A 3L1IA 1DINA 1XLUA 3LP5A 3WKDA 1U2EA 2BJHA 2XMGA 1B41A 1MU0A 1VE6A 2C0QA 1XZHA 1EXWA 2WHPB 4G8DA 1UT6A 4IH4A 1DQYA 1WPRA 3W05A 5D6OA 5CMLA 3KDAA 3ESAA 2WTNA 4N8SA 4BVKA 4W1RA 5AKEA 5KBYA 3A6ZA 3LLCA 4UFOA 2AXEA 4QWMA 3V1MA 3IUQA 1MO2A 1UKAA 4AX4A 1W76A 4OYLA 3G9ZA 3FYUB 2ZYHA 4L3WA 3QMMA 3M3DA 3STTA 2QJWA 3BIWA 3QITA 5AI6A 4MWSA 2C5GA 5ALXA 2RHWA 2Y6UA 2W22A 3DL7A 2DHEA 4FBLA 5ALSA 4DGQA 1EVQA 3DD5A 3V9AA 4W9RA 4X97A 4F0JA 4GXNA 4EY5A 3IURA 4MJ3A 4MYDA 2YXPX 1GT6A 3HABA 1L7RA 3FVRA 3DL4A 3PUHA 1VKHA 2QJRA 4N5IX 3VISA 2UZ0A 3OPMA 1D07A 3WMRA 3HRHA 2JEZA 1HKHA 3IVMA 2O2HA 4B0PA 5AKKA 4C4XA 3WWEA 1QZ3A 2PSEA 1W1IA 2Y2UA 4C4ZA 2VAVA 3O9VA 5LZ5A 1CEXA 4N8DA 4X95A 1EB8A 2OCKA 1CUJA 1SCKA 2JBWA 3JWEA 3WZLA 1UKCA 1Y37A 5AM4A 1QIEA 1U65A 4QZVA 3A70A 4FHZA 2WIGA 4HXGA 5FPPA 4LHEA 4DM7A 3GZJA 3I6YA 5E2IA 3G0BA 1TQHA 4OB8A 4GDMA 2WIDA 4WFIA 1A8SA 1UXOA 2JIDA 5JAOA 4JYMA 1P0MA 4G8BA 1ZD2P 3G9UA 4XX1A 1GPNA 2PPLA 2XDWA 3IDAA 5AIAA 3BJRA 1FFAA 1X2BA 2DQYA 1IUOA 3IB3A 2ZVDA 3R0VA 3WJ2A 2BUAA 1WPXA 5AM5A 1JU4A 1MX5A 5DYYA 3AZPA 2XUHA 3Q0TA 4K6GA 1CUYA 3YASA 5HFNA 2HRRA 3BL8A 1H2ZA 3DNMA 3D2BA 4AN1A 4KRXA 2DHDA 3AZOA 3OG9A 3VJLA 1DWPA 1XRNA 1AQLA 5EHXA 4Q82A 4BC1A 1VZ3A 1XZEA 4A16A 3S2ZA 4XWGA 4WY5A 3MUNA 1R9NA 1QE3A 3N2ZB 4G1FA 1DQZA 5EHZA 4G4JA 4S0XA 7YASA 5E4YA 3VJKA 2OLEA 5YASA 1OILA 3ESDA 1EH5A 1LBSA 4F21A 4EY8A 1K5PA 5ESRA 4F60A 4FFVA 4W1PA 1R9MA 4OB6A 1TIBA 2VT7A 2WLSA 4BRSA 4B84A 1RP1A 4KE6A 1IUPA 5IVKA 3PDCA 1ORWA 2HA4A 4U2BA 1XQVA 4GI1A 2I78A 1CUXA 2QUAA 3W04A 5AICA 3NWOA 4X6UA 5ALIA 4AZ3A 5LZ8A 4WCVA 5AOCA 1YS2X 2FJ0A 3O4HA 3DJYA 4WY8A 5DYWA 3IA2A 3N0TA 2HA7A 2GBCA 3O9MA 2XQJA 4J0KA 4J0IA 3WI7A 5FUMA 5AHXA 1YSCA 5JANA 3OC0A 1H2YA 1JJIA 2R11A 5AK3A 5C8ZA 3C6XA 4UFPA 4FWBA 1THGA 1X2EA 1C4XA 1CUWA 3ICWA 4QE3A 4AMZA 1FFDA 3WK4A 2G5TA 4K5QA 2PBLA 5AH0A 4AMYA 5IKXA 4LXGA 1QIKA 2AJBA 1J2EA 1MAHA 1YB6A 4IH9A 2GBFA 4E15A 3JYHA 1P0QA 1GZ7A 3G0CA 3MUOA 5F4ZA 1AGYA 4HRYA 1XQYA 4FNGA 4TVKA 3WKBA 2PKYX 4DMHA 2V9ZA 2QXUA 1YA4A 3H2IA 2PSJA 1MTZA 1JU3A 2ZYIA 1YAJA 3CXUA 4A5SA 1EX9A 3D3NA 4Y2UA 3WKCA 1EI9A 2PSFA 3WKAA 4FNMA 1R4ZA 4BVJA 2WHPA 2GBGA 4U2CA 2B61A 3BJMA 1EK1A 3BDIA 3WK6A 1JMKC 3FYTA 4UHBA 3LS2A 5ALRA 2EDAA 3AUKA 3I1IA 4J0DA 5E4JA 1CUGA 4BZWA 1FFBA 3FYUA 4DYHA 1CIJA 1YAHA 4UBLA 5AO9A 2W6CX 1Q0RA 4CIBA 4E14A 1CLEA 2XI4A 2ZSIA 4XIIA 2Y1KA 5AK5A 1W52X 5EHNA 2WU4A 2CEKA 1XKLA 2XUDA 3Q8WA 3FWHA 3C6YA 1VOTA 4HZGA 3SX4A 4H7DA 5JYCA 4ZWNA 2HA6A 5JATA 5FXMA 2BKLA 2X8BA 5LP1A 2J3QA 2XUPA 2V97A 4B80A 3CN7A 4C88A 5CT8A 5E4TA 2CJPA 2BUBA 4OCZA 1QJ4A 5FP0A 2XMRA 4GW3A 1XRRA 4KJXA 3UUEA 5AIBA 5FPQA 5IH7A 1ZGCA 4M0MA 3G0DA 1AKNA 3AFIA 2DCMA 1CUVA 3H2GA 5IVIA 5BV7A 4EZIA 3D2CA 4G9EA 4J0HA 4EUSA 1ZJ4A 2ZJ6A 4KACA 3T4UA 2GZRA 3I2GA 1LGYA 1CUZA 3BE8A 1XRMA 4X6XA 1ZOIA 2XUQA 3M82A 2CUTA 5T4FA 3ILSA 3QMWA 4EY6A 3MGAA 5JZSA 3FLEA 2G63A 5AM1A 4ITVA 1ZD5A 4W1SA 2ROQA 5FRDA 3G9XA 4HTAA 2VA9A 1LNSA 4P93A 1JI3A 1VXOA 3WK5A 1WB5A 1WHTA 2HA2A 3IULA 2HU5A 3A2NA 2WUEA 5JZBA 4EBBA 3GBSA 1USWA 1E89A 2VJBA 1VJ5A 2HDWA 3ZLTA 1VA5A 4ZV7A 3BXPA 4PSDA 4PW0A 4FBMA 2HU7A 1E8NA 3OM8A 4Q1VA 2V98A 1SOMA 4BE9A 5HKBA 1IUNA 3HEAA 4YK7A 1JT2A 2PX6A 1BN7A 3DYVA 5BOVA 1LPMA 2WTMA 1IVYA 2J3DA 2PU5A 5SYMA 2QXTA 4J7AA 5DTIA 4V2IA 3V48A 4ZGBA 2XMZA 3TRDA 3DQZA 1G5FA 4ZRDA 4UBJA 3HXKA 3D4LA 2D5LA 3DCNA 1QTIA 5A71A 4N8EA 3HACA 1FJ2A 3QYJA 2ONCA 1XZIA 5AKYA 3ZLUA 1AC5A 3GROA 1I6WA 2FUKA 4M0EA 5K3FB 1GPKA 4OPMA 1N5MA 4PV7A 4U2GA 5AKHA 5AKXA 1TAHA 1GQRA 1ODSA 4DTCA 4AO7A 2WJ6A 3V1LA 2BAGA 1PV1A 2HA3A 3W9BA 1E3QA 1CRLA 3E3AA 1QFSA 3DKKA 3MVEA 1XKTA 1W6RA 1TCCA 5AI0A 2VJCA 2H9YA 1K6EA 1BEEA 5IVHA 3WA7A 3KOOA 4YX9A 2GYUA 3E4DA 4P08A 1ZI6A 3I6MA 2EEPA 1IMJA 4MQLA 4QDOA 4KRYA 1H23A 2LIPA 1MX9A 1YCDA 1LZLA 3OURA 3AIKA 3O4JA 5ALPA 2WIFA 3GFFA 4B9EA 4BDSA 3JW8A 4NVRA 3U0VA 3QH4A 1QONA 4Y2VA 1ZJ5A 1R1DA 1H2WA 1BEZA 2Z5GA 1WCYA 1QTRA 3UUFA 4J03A 3HSSA 2GYWA 4BBZA 3ICVA 3C5VA 3KXPA 4WFKA 2Z3WA 1EHYA 5JARA 1AURA 4QEKA 4MYSA 3WL7A 1UFOA 3SWWA 3LIPA 1CR6A 3PE6A 4XJVA 3C70A 5K3EA 5ALNA 1R50A 1UOPA 2GYVA 1MX1A 1J06A 2WG1A 1XZLA 1ODTC 2VAXA 1N1MA 3B12A 3R3VA 1WM1A 4BB0A 4NZZA 4Y2RA 1QO7A 2B4KA 2OGTA 3ZI7A 3ZV7A 4OSEA 4QNNA 3R3YA 4UHFA 1AX9A 3H17A 2WHQA 2QM0A 1A8QA 5ALJA 5AM0A 2VEOA 4IO0A 3GUUA 3R3XA 2CMFA 4UHEA 5D7BA 4B81A 4LIPD 4INZA 1UWCA 1QIFA 5JD5A 4B0OA 2C7BA 3AJAA 2BFNA 1DT3A 2VT6A 4M0FA 5D3ZA 4MXDA 3WWCA 5ALFA 1S8OA 2WG0A 1L7AA 2HHAA 5ALLA 1AMNA 5AOAA 3EQ8A 3QBJA 1W75A 1DX4A 1XZAA 5CT5A 2XUGA 3PFBA 1DWQA 2JGMA 1LBTA 5FLKA 3H2KA 4W1QA 5I8PA 2WG2A 2Z3ZA 1C7JA 4EY4A 2ACKA 4NMWA 2OQVA 3WIOA 1U4NA 3FYUC 5CXXA 4Q3OA 5HZGA 3DEAA 5DWDA 2WILA 2VF2A 4WDRA 1KEZA 3L1HA 5FOQA 2IIVA 3AIMA 5HF6A 3TGLA 5LLSA 4KAAA 1LPBB 4UFNA 3KD2A 1EDEA 4X6YA 2I03A 1M33A 4BAZA 4H7HA 4D9JA 4OU5A 5JASA 3G0IA 2O7VA 4ZI5A 3FAKA 4PNZA 3BDVA 1GKKA 1QFMA 5FKJA 1EA5A 3NUZA 4AN0A 4GWLA 5ALEA 1Q0ZA 4AQDA 4C6HA 4FLEA 5AI8A 4LXHA 4L9AA 2DR0A 1N8SA 2QTBA 1O6GA 4KE7A 1UK6A 5CTAA 1ZIYA 5HK8A 2K2QB 5FDFA 4CCWA 1L7QA 5AKLA 1R88A 1G66A 4DLNA 1DWOA 3H04A 1YS1X 3VKFA 2FX5A 4MEBA 3VVMA 5K3FA 3WKEA 2RI6A 4Y2SA 5EIAA 4Q3KA 1QIDA 2OQIA 3GELA 4E11A 5EIHA 1X70A 2AJCA 5FV4A 2PSHA 4X91A 1LPPA 4H77A 4AO6A 3R40A 1QOZA 4WJLA 1MJ5A 3G7NA 4L0CA 3QPDA 5LZ4A 1HBJA 5A7GA 4B6GA 4TPKA 5CURA 5DNWA 4UBIA 4CG1A 2HA5A 4QDXA 5ALHA 3WIBA 1WHSA 3WWOA 4DMCA 4BVLA 3BIXA 3H1BA 1UK7A 2O2GA 2XMSA 5HFAA 3F9CA 1LZKA 1QIJA 4ETWA 1TCAA 2OAEA 4ROTA 1QIMA 2ACEA 1JJFA 2ES4A 3W06A 4PSCA 5KWIA 1B6GA 2YASA 3DLTA 2H7CA 3STXA 5AOBA 1GKLA 1Z68A 4QDUA 2D0DA 2HFKA 3EQ9A 2WKWA 3H19A 2C58A 4Q34A 1ZGBA 3HC7A 2RHTA 3PF9A 1PJAA 4U2DA 4YASA 4KR0A 4BYMA 2JF0A 1MN6A 1HLGA 3EF3A 2HU8A 1EDBA 5AI4A 4Y2QA 2RGUA 5JZ9A 1K8QA 3ESBA 1NU8A 4OB7A 2JGJA 1CVLA 5AK4A 2ZSHA 1IZ7A 5DTJA 1VXRA 2B9VA 4U2FA 4QA9A 3EBLA 2WFMA 4KE9A 3F98A 1HDEA 3WK9A 5AM2A 5K3BA 4LKOA 1TKRA 1GXSA 3P2MA 3WWDA 1VA4A 4X92A 4EHBA 1P0PA 3NGMA 2C5FA 2PSDA 5T4BA 4Y2TA 4X7BA 5A6VA 4CI9A 3F8SA 4XVCA 1CQZA 4DIUA 4DNQA 2VSQA 2BGNA 2HFJA 2WFZA 2HADA 4L72A 4KAFA 3OOSA 3ZLVA 1EINA 1XZFA 4J3JA 3ED1A 4H7FA 4WFJA 5CH3A 1JFRA 5JAPA 3ANTA 1E8DA 4EY7A 1GGVA 5BWBA 1PFQA 4FDMA 2GZSA 2XQIA 3RK4A 4H7IA 1XZCA 1O6FA 2ORYA 4QDTA 3FBWA 3R3UA 2Y6VA 5AI9A 1BRTA 1A7UA 4JNCA 2QRUA 3PUIA 4MQMA 2XUJA 1C7IA 5CT6A 5I7UA 3WWPA 2XUAA 1CUUA 1ACLA 2QT9A 5JIBA 4EB0A 2XB6A 1YB7A 4RE5A 4P9NA 4BCBA 4BDTA 3DS8A 3EQ7A 5D3KA 5DYTA 4K2AA 3WYDA 1JJBA 5AKJA 1WOMA 3KWJA 5CXUA 3F67A 2OG1A 4C01A 2XMDA 1H2XA 2VATA 5H3HA 3D2AA 1YR2A 5K3DA 3FNBA 3C6BA 4DNPA 5T4EA 5ALYA 4Y2XA 2JGEA 2Z8XA 4MWTA 5J3JA 4KEAA 3M81A 2GBIA 3I2KA 4G4GA 2WUDA 4C4YA 5AP9A 2WIJA 3CN9A 5ALZA 2DSNA 4X90A 5ISMA 4CCYB 1GPLA 2BGRA 5I9IA 5AKIA 1ZD3A 4QLAA 3WZMA 1BE0A 4QLOA 3K9BA 1ZIXA 1EB9A 1A8UA 3C6ZA 1N5RA 3O95A 5LZ2A 4LYDA 2OGZA 3STYA 5ALKA 2DQZA 4CFSA 3STUA 4DNOA 2XLBA 1ETHA 2QOEA 5K3AA 4BTVA 2VTVA
chains in the Genus database with same CATH superfamily
2CUNA 3UF0A 1FVXA 5ES4B 3F1LA 4RVUA 4P4SA 2V3VA 1DEKA 2FSIA 3AIIA 3ONNA 4A1FA 4BPRA 1FIUA 3GB9A 2E5WA 4B17A 1TU4A 3AR2A 1M54A 2VDUE 3KYCB 5ECGC 1DT5A 5FA5A 4ARZB 5ELMA 1A4RA 2OBBA 4Q3NA 4MWBA 2VDNB 3CW9A 3FHOA 4BRZA 1X38A 1MT3A 1W5SA 2RC5A 1MMFB 1F3LA 3G0OA 4G65A 3ZWKA 1XWWA 4BX9A 4DPKA 1HC7A 1P61B 2VTBA 3DXZA 4IYJA 4BQSA 4J1SA 3DMTA 3A1UA 2G4CA 1C80A 2R84A 2BFWA 4O0LA 3VZBA 4BFTA 1QH8A 4LF4B 2ZRPA 5JO0A 3O1IC 3WAJA 4P80A 2XIJA 3IIJA 4KX3A 2YHBA 2J9GA 1K98A 3P9SA 2F8MA 1QVZA 4IQGA 5CW1A 2A7QA 4O4LB 2CUZA 4NBLA 4TS1A 4HWKA 1FJXA 2ZSUA 5T57A 1XZBA 1D4AA 2QX8A 4PTLA 2GJKA 1JKMA 1XYYA 1G9TA 2Z4SA 3QUCA 2B6NA 1NP3A 2ZJ4A 1PZMA 4N5HX 3CVUA 1EJBA 1LPSA 2O8DA 3DULA 3N0XA 3DTVB 2WJGA 3ZWVA 2AKAB 1SD5A 2OBFA 1CJVC 4X44A 4D56A 1CR0A 4D3DA 4UHCA 2REOA 2VXYA 4L3VA 3TKLA 3RV3A 4PYNA 4JBXA 4JQSA 3UPUA 4GWGA 4L2IA 4EKEA 2ZRKA 3IUNA 3WQSB 4PF1A 3DPUA 1KC3A 1I94B 2ANBA 2JFNA 1R3DA 4WQMA 3UK1A 1N7HA 4Q48A 4AY3A 2OC9A 3EIHA 2HV9A 1G4AE 4HYEA 3RTCA 2RONA 3H4MA 4ZO6A 4L7QA 2WAAA 3HE3A 3BXXA 4LF9B 2P8SA 3K20A 4OOFA 1L7VC 1Y9EA 2DFVA 3IS3A 1G3IA 4GE3A 3TNDA 4YXWD 4LHVA 2UKDA 3VH2A 1T36A 2NACA 3I58A 1Q83A 4PXYA 4UBOA 4ARIA 3DMFA 3QG1A 4PE5B 3GEGA 3L8MA 2VDWA 3SK0A 4BNNA 5SY4A 3NAGA 1UM9B 4LNUA 3AHGA 1R0CA 4OK5A 1Z3IX 3DPSA 2ZU0C 3TZBA 3UT5B 3MJSA 3VJMA 1J07A 2QL5A 4IXWA 2XW6A 1YIDA 3KZKA 2GEVA 2IYTA 1LBQA 5IBQA 4EMBA 4IHAA 3EC2A 3KKPA 5LQRA 1BIFA 2O48X 1KAMA 1UEJA 2RBEA 4O4IA 5BYKA 1EXNA 4V03A 5CPFA 1JIQA 1QCYA 2G07A 4X6LA 4GHWA 1ICEA 3DOIA 3HYSA 3KJZA 2Y77A 2GR9A 3O26A 1G291 1MVOA 3L6RA 2NNLD 4YHBA 1AO3A 3IIIA 1MNQA 2YVLA 3V3TA 2HDNB 3PZBA 1F5NA 1PTJC 2FEOA 2AKYA 4G24A 1QE5A 2KB0A 1ZN7A 4ZAGA 5FD8A 5BVGB 2CV0A 3N6RA 3NR2A 4XX0B 4ZYYA 3Q5EA 5GONF 2PGDA 2CMHA 4FXOA 2AN4A 2NVOA 3N0VA 4F38A 4DV4B 2Z9BA 2PYIA 3GJ5A 4FOLA 2NT3A 3BGIA 5CB0A 2IXFA 3QSYA 1E0SA 1H1LB 2YZ7A 1CDOA 1GUDA 2BFOA 1LJLA 1P4JA 3QVSA 4AULA 3TX2A 3ZWQA 1VQ1A 2WSYB 4WFQA 1EX7A 1G21A 1J8FA 2C94A 3PX2A 4Y98A 3MF4A 2BBSA 2IZ1A 5BW5A 3M6MD 2CB9A 4U3JB 3G2MA 3ZK9A 1Z16A 2PUJA 3N07A 4M4SA 2J45A 4OYYA 4GBGA 4P5PA 4U63A 3K9NA 1BWSA 4LYJA 4QGSA 4KYUA 5ADHA 1Z4LA 2GEDA 3NEYA 4QYIB 4OLBA 4WOKA 1PZXA 1LDYA 3LF1A 3QLTA 3C4QA 4ES6A 1V11A 1GUZA 5AVKA 1XCPA 4OXNA 1F9EA 5ITZB 3DVRX 2FW1A 3HYLA 2HF2A 4FTWA 2LCFA 5CR9A 3RFCA 2ZSBA 4QD3A 3QMVA 5ESXA 3W5UA 1OWOA 1NUQA 1OAAA 2DKNA 1LW7A 3GLHB 1ID8A 1A1VA 1UFKA 2QX7A 3CUVA 3NHWA 3UMSA 4MDFA 2PFSA 1Z08A 3UT0A 1EDZA 1MHPA 2ZS9A 1U0OC 3DDHA 4ZALA 4IHJB 1V1MB 1LF0A 1HR0B 4KSCA 4YV2A 4HN9A 1JA0A 3SYMA 4GP7A 3IKTA 2IYZA 4MPDA 5A3SA 4RHUA 2C0CA 3HJBA 1NVGA 1JJ7A 1PT5A 5BSHA 4KHPB 4OA5A 4QASA 2WICA 4EFLA 4DMFA 4G2TA 5JJCA 1SG9A 4O4JA 5C9ZA 4TTAA 1U5AA 3NCTA 2GXUA 1RWXA 1XMSA 3D7RA 3UWKA 1UOQA 4E6PA 4YAKA 4ZO8A 3S29A 4BJ3A 4RQTA 1GCUA 5KB3A 5AVSA 1SPBS 2PCJA 5A3JA 1CUDA 3O3MB 5B6PA 4PX9A 2A30A 2JFPA 1JHRA 1XMVA 4BWVA 3T7EA 4E2ZA 2BHNA 2FP4A 1Q17A 2H54A 5E0OA 2H85A 2IGBA 3GDWA 4J75A 4O1HA 3DWFA 2BH9A 2OV3A 1PWEA 1WHTB 2ZYSA 1CHDA 1XKQA 4QJ3A 1H66A 2YQZA 4EKNB 3JQGB 3AHHA 3B2EA 5AJVB 2CJXA 4IFIA 4QPPA 3GOHA 4KAXA 3R3ZA 1SZDA 2KMLA 1OXMA 4QQKA 2VOEA 3GP3A 4IDGA 4WOCA 2P5UA 1ZHOA 3VVLA 5JDIA 5TR9A 5BQXA 3BXGA 1EGHA 3WLFA 2ORED 1ZWKA 4FHDA 4ZVUA 2ZK7A 3VGPA 1NBHA 1GL9B 5K4GA 3OE7A 4XB1A 5L51A 1I4EB 1I13A 1XA4A 2D00A 4ENTA 3B13B 3C8DA 4MR9A 5L6LB 4X1IA 3X0DA 3RREA 3K9LA 2FZGA 1XU9A 3RBXA 3EA5A 3HCOA 3P71T 4B3CA 4R31A 1ZHFA 1ZICA 2F59A 4UXJA 5DBOA 3B36A 1ISGA 2B20A 4QU5A 4QRDA 4F11A 3EAGA 5FB3A 1V9CA 1Y6RA 2EHJA 2RAUA 4FONA 3OEHA 4GXTA 4RXUA 4C6SA 4EM6A 4DV7B 2EFYA 2O0HA 1PJ4A 3E35A 4QDZA 4L6IA 5EFOA 4BB5A 4BCCA 1KE1A 2XZDA 2OV6A 4L16A 4O5AA 1PHRA 2DM6A 2GD0A 2XYHA 3PJGA 1KBZA 4X1KA 5EP1A 5AT1A 1XEWX 1UPBA 3TYXA 3V4OA 1W85A 2CNNA 5E6SB 2OZKA 3MXOA 3ZS9A 4O0MA 3IIEA 4BFUA 5AM3A 4V1CB 1XK7A 1VE5A 1T9GS 2RHGB 4A26A 2YXDA 1XZDA 3P2OA 3RDPA 4RPIA 3KETA 1E60A 3Q9NA 3U1TA 4D3SA 4BFYA 2A4MA 1MOZA 2YOHA 3CZ5A 3L0YA 2WU1A 3QEMB 4FMCF 4KLRA 3T3MB 5BSWA 1GZ5A 4A8JA 2PL3A 2VP0A 1WXDA 3QKWA 4HWSA 3AQIA 5ALMA 4YRIA 2C8KA 3AKEA 4AJKA 2VPPA 1KEEA 3INRA 3PXAA 4I1VA 2B4RO 1NDUA 2BTOA 3WLJA 4RIIA 2W6IA 3CR3C 3VC1A 3A4TA 1YONA 3O8LA 4B7UA 3L1JA 2I3ZA 4FWTA 3HBFA 5KNCD 1IZZA 4J7CA 4BV2A 1ISPA 1T6BY 1ZOOA 3KP1A 4HNHA 4MKZA 2PUAA 2WYWA 2QRGA 1QYWA 3D4OA 1Q1AA 4KCGA 1U81A 4A27A 4DBLE 3GY0A 3CLTC 5IKMA 5C31A 5CLFA 4PQGA 3D5EA 5CDUA 5C37A 2H4ZA 4M1EA 1APBA 4AXBA 1DQNA 4OJTA 3J81k 3M1IA 2M32A 2FPOA 3IOCA 4RM2A 3WGHA 3WL3A 3PK0A 5KJ6A 3VTAA 4ZMRA 1BX3A 3BHIA 1OZGA 2AN1A 3HJAA 3IILA 3M5CA 4Y8VA 5ESDA 2QPLA 3SKYA 4ZI3A 3UKOA 3K5HA 2OCPA 3PLAE 5EFZA 1I7PA 5FL3A 3K6KA 1K6JA 3ZJTA 1CR4A 5D3MA 2C78A 3GCXA 4NEQA 4U2EA 3RHFA 4DG9A 2Y1FA 3USES 2H29A 1TUBA 2VPTA 1V5GA 1OXVA 3MJ4A 5B7NA 3BCSA 2WQ6A 3KM0A 3FYDA 3QI7A 3J80A 1QKJA 4LJRA 5K51A 3RRXA 4R41A 3NKVA 3PL5A 2WAYA 4EHFA 5BYJA 3CKMA 4C0WA 3KHTA 4ZMSA 3FTPA 2VPYA 1CUAA 1NZDA 2JGFA 2H3EA 4JZYA 4TKLA 1LY1A 2IU4A 5IYZA 4IH1A 5DHPA 5H9VA 2V7EA 2D5IA 4C08A 1QGED 4G0PA 3TI9A 5A03A 3T1TA 1P6QA 3B48A 4H7KA 3I5XA 1QGUA 3VOAA 3ND9A 3MINB 3NXKA 3BXOA 3ZWMA 1P7YA 3B1JA 4HNAB 2PK3A 3K16A 2XJ9A 2YYSA 3OQIB 4WH0A 3NHKA 1K0UA 1RI4A 1ZEMA 1RC8A 1YIAA 3W9YA 2UXBB 1YZTA 3SN6A 3RUDA 3TLGA 2DPXA 3W5HA 1QH1B 1C0IA 3H1AA 4DJJA 4FEAA 1DRUA 1N0UA 1S02A 5JXHA 4MEAA 5KQPA 5KWJA 1J9GA 1I7NA 3CCBA 3RU9A 1S0UA 4GKBA 4HAIA 1QYRA 2J7PD 2MSWA 5IP5A 3HTXA 1PFVA 3GAAA 1FMFA 3A4LA 1GGEA 3SC2A 3FVWA 5LMCA 3STWA 1NKSA 3M4XA 4H1TA 1AQIA 5AW4A 2Y99A 1BVRA 3LP6A 1U2GC 1IM8A 4OLHA 3H2JA 4AUKA 2MYPA 1SVLA 1USUA 3DMGA 1U5BB 4OQPA 3U39A 2I1QA 3KAQA 1MKYA 1Y4DE 4Z4QA 2IYLD 1Y4UA 4UASA 1QKKA 4WJZA 2VZ0A 3KYCA 3N3BC 4A0FA 2F3RA 3K5PA 3NQ41 4ARZA 2JLZA 2ZUCA 3H5LA 2LBPA 1DAGA 2NXJA 3GA7A 2JGKA 1H5NA 2IYQA 2HPHA 1M2JA 4MULA 3I53A 1GDTA 2QYOA 3GJ0A 1EUZA 4PPNA 3I6ZA 2WTBA 1F6WA 3LW7A 3WDKA 4ESEA 1SN7A 1UBEA 4P35A 4DAOA 4CM7A 2CL6X 1G3MA 2WUGA 4R40A 5EERA 3KV1A 1DIRA 1OXUA 2RAFA 1UMKA 2YY6A 1DJPA 3EWIA 3F4BA 1EXDA 2IVFA 2HK8A 3LFHA 4MB0A 1FJHA 3AFOA 4FFBB 4WDQA 3EJ6A 2J4CA 5FL7A 5KSPA 4JI6B 5HM6A 4TKVA 1QVAA 3JYQA 4F4FA 4O4LA 4C22A 1CV2A 4TT3D 3UMRA 5JLJA 2W2LD 2L19A 4IOKA 2Z08A 4R4JA 4IG9A 2EWVA 5ETJA 3WHLA 4M21A 4E4TA 1E2NA 5HIKA 1KFBB 1ZHHA 2PMCA 2D5CA 2R5NA 4TMKA 1A9XB 3JQ9C 4D2IA 4MQFB 3DTVA 1O96B 4QTUB 2XTAA 4DCPA 4NI5A 1QZXA 4F6CA 2ZVPX 3ZC3A 4TV8F 2C4NA 1GWNA 1PS8A 3TXAA 5CJJA 4Q9HA 4RL4A 1B6RA 1E1QA 1BCSA 1F0PA 3EZGA 1UWVA 4QOEA 2AOXA 1SXJC 4UULA 5EJFA 4DA8A 5FIUA 3UMFA 2YKGA 1XD9A 1Z25A 4JV5B 2OBXA 2ZM6B 3E58A 1MO6A 3FLAA 5FOUA 3WNVA 5MF6A 1MW8X 3E9QA 2V8OA 1IIRA 1BH6A 3PV0A 1NVXQ 3EQ6A 4PQYA 3IKMB 3K8YA 2VCYA 3RVDA 3ZCPA 1O0BA 3GT3A 4U7FA 4QTTB 3PICA 4FCVA 4MKXA 4Z3OA 3ZHRA 1UM9A 1WXQA 4E3WA 3ENVA 2B83A 2VK8A 3A6GA 1ZI8A 1NLMA 5EIBD 3RF6A 3UT5A 1JIUA 2G1JA 2X2OA 4UUQA 2H7YA 3BDAA 1GP2A 1N6RA 1DAMA 1PZNA 1OSNA 1SIUA 2A0KA 1W35A 3JARB 1CUSA 2QP9X 3SEZA 5CGZA 2C20A 3VTFA 2EP5A 1XJ5A 3V8QA 3VDNB 1G55A 1SCQA 1XVLA 2P9QA 2X40A 4LXIA 5JD4A 1Q7BA 3C1AA 4UVHA 2YS7A 2RARA 1UBLS 4X93A 3RARA 4QOFA 1LTQA 3COPA 3HUEA 4JB3A 5D87A 3AKDA 3BHJA 5FBRB 5IZCC 2VHJA 2HMTA 2YN0A 2O8FB 3ZGZA 1B4DA 4YYEA 2ENWA 3VNBA 2Q3LA 4CL8A 3R0XA 1YTUA 5L3RA 2YZNA 3AILA 1I7LA 1NVAA 1UKYA 5DYGA 4XX0A 4RH1A 2PFKA 4IEFB 1ECLA 2H1CA 4LV5B 4KQ9A 1RW4A 2QTVB 3K9HA 3OPVA 5DN6A 2C5LA 3BIOA 4HS9A 5BNFA 1DSSG 1QFZA 5NULA 4CGZA 1G4HA 2GCPA 3M83A 5KTTA 5KYTA 2E89A 2FJPA 1TE2A 4Q9IA 1ZBQA 2TMDA 2HLDA 1N9GB 3PEUA 5ARBA 4GZ5A 2BBOA 2HA0A 1XUOA 2VQFB 4L4YA 1I3LA 3OHPA 5FR2A 3RYHA 2HYIC 4GQIA 2XNSA 3NC1C 3ER9A 2P9YA 3CTPA 4K46A 4RETA 5AXAA 4ASUA 4IMIB 4AUMA 5FQOA 3NNDA 3OM1A 4QYIA 3ZU4A 2P3QA 1JLKA 2PUTA 3MOSA 4UUOA 1VJRA 2D0IA 4RXMA 2FZLA 1DP4A 1QYIA 1D6MA 2YFYA 3NBQA 4UHHA 5K9ZA 3U7QB 1IH8A 3CS3A 1SUBA 3TLJA 3ME5A 3ONVA 5I7EA 4R7TA 2PUEA 2FG7C 1NJGA 1JX6A 2ZBQA 2DCUA 2JI8A 2V9PA 2NQ2C 2RK4A 3BE4A 1KE2A 3GLHA 2QYSA 5CRIA 2BSQA 1SBTA 1TRHA 2LV8A 5CXQA 1NX9A 3QW2A 1Y89A 3NOXA 4X85A 4O2BA 3KV3O 2FZEA 3UHOA 3VZPA 4RMGA 1UBKS 2XB4A 4KDFA 4IHJA 1BHQ1 1V1MA 4LXXA 1I3OA 1QOPB 4PPFA 3SOZA 1D3AA 3AETA 1X8JA 5JJIA 2WE7A 1N1GA 1NY5A 3MLAA 2FSHA 2QZPA 2WSMA 3A6DA 2P4QA 1Y9ZA 3D6AA 3JX9A 1H42A 1Q14A 1K2WA 2HT6A 3AZQA 4YP5A 1O77A 1W34A 5D5HA 4B32A 4BP8A 4U9UA 2RJNA 4UVIA 4YAWA 5DX8A 3UWDA 2FSVC 5B7GA 3GGCA 4KXWA 1MD9A 2CLCX 3TLXA 3GIWA 4BO7A 1M6VB 3MWDB 4Z6KA 5CH8A 5J2UF 5LKRA 3INGA 2YXLA 4JODA 3MTGA 3C45A 4CR7A 3COYA 5K0SA 3OZ7A 4XYLA 2R3SA 3AIOA 2YZ2A 3QTLA 4MPRA 1TT5B 2ZBGA 3BL6A 3FROA 4RFVA 4B9AA 4DR4B 1T3SA 3OHSX 2IX3A 4OQNA 5TGZA 4RD0A 3EOZA 5EJ4A 1U28A 5FULA 3LU1A 4S3MA 1RWQA 1VKZA 2RGWA 3JQGA 3B6IA 4DMKA 4CKEB 1F1JA 3COZA 4N0PA 2HF9A 4XCQA 4E5YA 3DVAB 1N77A 3OBIA 2VOJA 2ZYRA 2J67A 1OD6A 2H18A 2VO1A 4HG2A 3PFNA 4DC9A 4MP8A 4MUBA 2G5PA 4RH0A 2N46A 1KEUA 1GCOA 4IVPA 2D2XA 2JATA 1LU9A 3D8BA 1MIHA 3HKBB 1ZUIA 5BWCA 4R2XA 3AOEC 1GNPA 1UBUS 4DJEC 2ZYAA 2DF8A 5L40A 3BHNA 4UDOA 3AVWA 1IN6A 4GUDA 1DE0A 2OAGA 1DX9A 4CEHB 2P0YA 3DBHB 4H4EA 3ZWWA 3I8SA 3AHCA 1AF7A 1J23A 1MABB 1TYBE 1KK3A 3FI9A 1KIAA 2QRNA 2P35A 2Y76A 3D3JA 1NMXA 4I19A 4WXMA 1BJRE 3ZY3A 4A36A 2VR1A 3OOYA 3T9AA 3R7SA 4LJ7A 4E6EA 1CPYA 3WL4A 3DDUA 4Q24A 5DNEA 3K31A 5D3QA 1CF9A 2OV4A 4OHBA 1EFVB 3UG7A 1TCVA 4N5DA 4RO0A 4EB6B 1OH5A 5GZ6A 4E1BA 1CUCA 2GASA 4EG1A 5HMMA 1RLUA 4EMTA 1SBZA 3G7UA 2RGNC 3IUMA 3OCUA 5AVJA 3GNSA 3J7TA 1C3JA 5E6SA 2JGLA 3RSZA 1X80B 3D6FA 4AYTA 2D5BA 4FSDA 1LRJA 5DBIA 4CM9D 1JLMA 1JAHA 1WCWA 4BB6A 7AT1A 1QIHA 4G89A 2D7DA 1M6WA 2PU7A 5EOVA 3RFFA 1JHQA 1I5RA 3QEMA 5ADWA 4YJ2B 5C35A 3L7MA 4KE8A 1HYQA 5IG2A 4Q18A 2DT8A 1DAKA 2CE2X 2MSCB 5B4VA 2WR8A 2FPXA 3GUHA 4L22A 4WZBB 5AKGA 2XA9A 4FBGA 1DFIA 3UJCA 1PW7A 5C5DA 2ODAA 1HX7A 1FFCA 3NOVA 2PMKA 1O2DA 4IXMA 2NO9A 4D1YA 4EVSA 3M4YA 5E9QA 5T41A 1YFZA 2IXGA 3UMCA 4NCHA 3O8RA 2J0EA 2O8VA 4RGBA 5EJIA 3SJZA 1I01A 1TEXA 3OOEA 4OUKX 1ULTA 4BNLA 5K09A 1XNJA 1Z5GA 2OD2A 1E7RA 3CQ9A 4IDPA 4REQB 5E1DA 1ZD9A 3U7JA 3P9PA 4PFQA 2NO1A 2ZI3A 5AXBA 4EA6A 3KDPA 3MTIA 3WYCA 3WLNA 3GUZA 5CHYA 4YTEA 1BJTA 3X1JA 2XMBA 3H1GA 4PAMA 2BFAA 4OSPA 2HIHA 2BH2A 1KBQA 1PHPA 2E49A 1ZI9A 2LTAA 2XSZA 1U0SY 1UADA 4PLGA 4XTRA 3IEKA 3RLIA 3NO4A 4AJ9A 4YUYA 2ZRDA 4BL5A 3DPIA 1P31A 1KDOA 3TJRA 2V6MA 4FGZA 1QYVA 3U4DA 3WKDA 3L01A 2FOIA 2I33A 1F20A 2PQ6A 1ECBA 2ZB4A 4JKOA 5F73A 4D8WA 4PZEA 2YVUA 2XITA 1MU0A 2Q3EA 3K0FB 1SHUX 4AK9A 4NJEB 4DGSA 1KAHA 1XZHA 1K7EB 2WTXA 3HWSA 2IXAA 4XVQA 1U0EA 3OIDA 4UPVA 2AFRA 5EE9A 1MVNA 4HOYA 2BZSA 2PKRA 2C1ZA 1DKQA 1NHGA 4TRNA 5AVYA 5E4FA 1B73A 1Q20A 4J0EA 2GTHA 3GLTA 1DQYA 1WPRA 2G7ZA 5H59A 3M4ZA 1T26A 3JASB 4IIEA 1JEYB 1R7RA 3HR8A 3KWLA 4OKSA 1NW9B 2AG1A 3KDAA 1FRFS 1Z36A 3N6VA 2JHGA 4YAEA 3H1PA 4BO9A 1X7YA 1ZW1A 4DLRA 3FF4A 3VU8A 2QP4A 4JB2A 3ESAA 3NC0C 2Q9BA 1KSJA 2VJOA 1HOXA 2GRUA 3MINA 4OMCA 3U7RA 1IG0A 1PL8A 1PWHA 4NEHB 2EERA 3AEXA 3FIUA 1UEXC 1O94D 2ZUSA 2C7GA 3LLCA 3HP7A 3N74A 2MR6A 3Q0EA 1LF5A 3PU6A 1NGSA 1UKAA 4LHYA 2GMWA 2ID4A 5B58C 1W76A 1P19A 2P2LA 3PNYA 1QH1A 2XKKA 4MGIR 4D0LB 1OH6A 3FYUB 2PLAA 3FYCA 4KIUA 1M2OB 1RTKA 2IELA 5DHRA 2PGAA 2G5GX 3PGLA 3STTA 1QGAA 3UH1A 1WLYA 3QITA 2FK8A 1BFDA 3CLKA 4ZO7A 1HA3A 5DNAA 4EA7A 5FBHA 2C5GA 1JF8A 2Q6VA 1A1SA 1KFEB 2Y6UA 4H6PA 4HI0E 3R7NA 1FTGA 2CXSA 2P4UA 1R4AA 4RTRA 4NZ9A 1U5BA 4DGQA 4DV1B 3TQFA 2H1FA 3CH6A 1HLDA 5B1YA 2P77A 1GADO 3AGPA 3V9AA 2II6A 3PUXA 3CA8A 4Q3DA 4W9RA 5G3YA 4BKUA 5JSUA 3JQBA 13PKA 1C9JA 1OJ7A 2LNDA 1CE8A 3IEIA 3JRXA 3NPAA 3WGTA 1PSDA 4EY5A 2IEDA 4MJ3A 4MYDA 5KSOA 2YXPX 1GT6A 2JZCA 4NV1A 2Y1WA 3WRYC 3INTA 2IIBA 1PWYE 1Y8ZA 1AF4A 5EMLA 5D00A 4EW1A 1YDHA 3I12A 3V7FA 1OKKA 1BGVA 2A9OA 1E0AA 3PPYA 5E9AA 2JBAB 5GJBA 1E9AA 1TFRA 3DTTA 1TVMA 1NF3A 1VI5A 3WMRA 3HRHA 2JEZA 2P2CA 4G0NA 2G0TA 1GN8A 1CU1A 1GPDG 1RM3A 2ZU6A 3HFRA 4MRVA 4F04A 1AM4D 4GKKB 2HI0A 1ENZA 1W25A 3Q3EA 2C3OA 2VHXA 3OAAA 1A9XA 1UANA 1FW6A 2IE8A 3LC0A 1O96A 2H92A 1UBTS 4E7OA 1I6KA 1AKMA 2VSYA 4MUXA 4FEEA 5FTLA 1JMVA 1FNNA 2P1RA 2VUUA 4II7A 1QKIA 4KGXA 1L7DA 2D3WA 3OT5A 1Q6YA 5BSEA 1T0UA 1WNTA 1EB8A 3NM5A 3OZSA 4GOMD 3ZQ4A 5IPFA 4XH9B 2YFKA 2HGSA 3Q1LA 1EFHA 1GRNA 1N5KA 2P9BA 2PTHA 3WZLA 1VL2A 3CX7A 4XUCA 4DSOA 2I76A 4ND4A 1U65A 3L7BA 5J23A 2WOOA 4M6WB 4U6QA 3TLMA 2HK6A 1KDRA 3PI7A 1AQ6A 3T41A 2BYTA 3ROMA 2Q4RA 1SG6A 3RCBA 1OU0A 4DM7A 1ZLXA 1UZNA 2OXCA 3P8ZA 4EHKA 3AVVA 5CDSA 3GMTA 1QHIA 1JDVA 4D3ZA 2DGDA 5BQOA 4ECEA 1XMIA 4BRUA 1JHUA 4NBRA 5EXPA 4FIZA 4IIYA 2VAPA 2PT9A 1QGOA 3MTJA 4WFIA 4S1NA 2WSBA 3RC9A 3IBFA 3WQRA 3TZKA 4JYMA 3D64A 1NKTA 2BGGA 4IY1A 2BE9A 4XX1A 1V3QE 4KGVA 1PJQA 4OTZA 3K73O 3WGIA 1DOAA 3L5OA 1IBRA 4W5QA 1QVWA 5JYEA 5BOSB 4AJEA 1WPQA 2B94A 1A71A 1NVMB 1ZD1A 2Q5JA 3MT7A 1PUJA 3JRNA 3GNLA 3BJRA 3G23A 4Q3CA 1WB9A 2PGNA 4TMTA 6AT1A 4Y1GA 4A8HA 2ZVDA 3FDZB 1A2OA 3ZG6A 4ZTUB 3SE0A 4A92A 1V5FA 3WJ2A 3K70D 1DO0A 1NNI1 1QRTA 2WMDA 3Q9LA 5FYQA 5JQGF 4KQWA 1MX5A 5D1NA 3E81A 4AJLA 1RXSA 5DYYA 2JNWA 1GDDA 2QTVA 3RWMB 3NVKI 4JR2A 2XUHA 3AHDA 5HMLA 4D98A 3YASA 4WADA 4D5GA 4U39A 4I1SA 3WYFA 3BK1A 1RXVA 3QIAA 2PUBA 4CF7A 1U8AA 1EFTA 2JJ1A 2FPIB 2ZWAA 3IR6A 1N9GA 3AZOA 3PHHA 4M1YA 2SCUB 1OVGA 4EVRA 1K1EA 3IJ5A 1P60A 2FH5B 3CEJA 4BX0A 5IT9A 2V5AA 3ED5A 2OBYA 4PLPA 3AC0A 4K9PA 2BSAA 3CW8X 4OMFG 1DLJA 4CVNA 2R7AA 3BX1A 4RTNA 1KGSA 2NVWA 5MN6A 4CMIB 4EPXA 2X3UA 4HNGA 3ROPA 1HMYA 5KHOC 2WB4A 1RJ9B 1Z13A 5DO9A 3OF3A 5ER6A 4S35A 4EW3A 1E9VA 3BFPA 5J5AA 4LYYA 5E7QA 4Q1AA 4S1PA 2X9NA 3U7QA 2R8YA 5ADVA 5L3QA 4WY5A 4MYTA 4TQGA 4C2TA 3KB2A 1YRQA 1K86A 4G1FA 1VYVA 2AW5A 1NYRA 2WAXA 4BV3A 4YV7A 4B3RB 2B2NA 2OQ2A 3OZBA 4G67A 1D2HA 2WWWA 3U9SA 1DKLA 4B6RA 3KAKA 1WUIS 1TJ3A 3QE2A 4KPYA 3T0GA 2YFQA 4GP6A 1VCNA 3VYRB 3AUJB 3PWSA 3Q7EA 1IC6A 3VJKA 2OLEA 2RGAA 4RPHA 2IC5A 1JDUA 2ZANA 3RSLA 4B8YA 5B3KA 4KBFA 5DXJA 2VSNA 2P90A 2EU8A 3ZDFA 1EH5A 2IH4A 2I6UA 1LEHA 5KQLA 1YU6A 1RXCA 1SXGA 3AEKB 3R6GA 4MUJA 3TOCA 4YCMA 2O52A 2O8FA 1RADA 1CBUA 1TIBA 1UXHA 3IKVA 3MC1A 1PJZA 1ZCAA 2WLSA 1M6VA 3HB0A 3MWDA 2X9VA 4B84A 3D4BA 1W8DA 4ZZ3A 4KZPA 4OREX 4N6GA 5CA0B 2FSPA 1RP1A 1Y48E 1NF8A 2IEGA 1RQ2A 2NYAA 4HRVA 3WVNA 2R5WA 3ZHZA 1TT5A 1C30A 1K5GA 4R3WA 5IVKA 2NXCA 5HJEA 3NHLA 3GQBB 1BYUA 4QX6A 5HXAA 1BXZA 3IUBA 5ICGA 2BHRA 1TM4E 2CGEA 4TXLA 5DTEA 4JFAA 3LQ4A 5ALIA 4YT5A 4QPDA 4CKEA 4DC1A 4EGAA 1NQOA 3DVAA 4YXWA 3EN0A 3EXIB 1L1RA 1RQRA 3BWCA 3OQPA 1XSEA 2JCSA 5AOCA 4JBWA 4OQFA 4RVDA 4AF8A 3ILVA 4PZYA 4HWOA 1A69A 1J25A 1JLRA 3DE5X 5DYWA 2O0MA 1D8AA 2ABWA 4MJ7A 2Q6LA 1YZ3A 2HA7A 2PIAA 1DRVA 4WXRA 1GCAA 1GZUA 1V8FA 3HKBA 3DMHA 4J49A 3KUDA 4KDCA 3ACCA 5HDQA 4F3CA 2UUCB 5LQSA 3BWYA 4D3FA 5CEFA 4CEHA 3DBHA 1X7GA 3AVPA 3DE7X 3EF0A 3ZIAA 1MABA 4WLNA 1K2VN 2C9BA 2I62A 3OC0A 1JJIA 2VNSA 2NU7B 4XQ9A 4ZPJA 1BOOA 2YJGA 2NYVA 4A0GA 3U62A 3FFXA 1H8EA 4CMHA 3NDJA 1TIKA 3SSNA 2X1VA 2YOGA 2DBQA 5CDHA 2ANCA 2Z83A 4YI3A 1C4XA 3N05A 1E9RA 3JAKB 4W9NC 4B5LA 4EB6A 3ICWA 1KI1A 4ZAVA 3GBVA 2O0KA 2W83A 4AMZA 5DLYA 3PTZA 3AL0C 2JGDA 2G4VA 2PBLA 2ZUDA 4KMSA 2V65A 1HL3A 1QPGA 1X80A 4AMYA 4HVAA 5TB5A 1QIKA 3MRTA 4GGOA 3KU4A 4V0LA 4NOMA 3FKJA 5GV8A 4JASB 2V7TA 1MAHA 1L9KA 5B7QA 1AQNA 3WHPA 1LWOA 3GHHA 1NQVA 2PUWA 1EFAA 1ELOA 3DOEA 2HBZA 3NBKA 3G1WA 2DKOA 4GYWA 4YJ2A 4HO1X 1PBNA 2C54A 3DBVO 1AGYA 3I1FA 2HD4A 4GVPA 4IIJB 4WZBA 1XQYA 4GR5A 3QVXA 2VF7A 4ERXA 3QUTA 1UBNA 2PKYX 4M86A 1XJWA 5EZ5A 4ZGWA 1F2DA 2IYFA 2I7DA 1T8UA 4DMHA 4AMUA 3E1SA 4JBHA 1OLXB 5I7AA 3PNOA 4R8MA 3W5SA 4F91B 1RKXA 1AA6A 5DK4A 4REQA 1MTZA 5GZ3A 1H2EA 4V2UA 3VBCA 2ZYIA 1ZOPA 3SJUA 1CY2A 1LBIA 4C7OA 1DFGA 1SC4A 3NM4A 2RG7A 4HLDA 4MICA 5B1IA 4A5SA 4NENB 1WMBA 1UODA 2YJ4A 5DGXA 4WERA 1R15A 4J0QA 5FWXA 5C5IA 3FBTA 5TMDA 4XFDA 3D3NA 3TZEA 3ZWDA 4DUGA 1PJ8A 5IBPA 2QXYA 1Y82A 1KKUA 4J1TA 3MJHA 4O25A 4WGFA 5IC6A 3TW8B 5FLXA 1I2AA 3DB2A 1WZIA 4WVLA 1EI9A 3NTRA 1E69A 4ZHQF 4LYFA 3TLZA 2P11A 3KPUA 4JSYA 1X1EA 2XECA 3I76A 3K0FA 3D6MA 4JT9A 4NJEA 4C0BA 2UZ4A 4BVJA 1QAQA 4D80A 2YJ6A 3KKOA 4EP1A 4D8XA 5E9WA 2HEGA 3EDYA 3L7AA 4U2CA 2B61A 1P1FA 4UAUA 1DPGA 4CMEA 3AVTA 2ATVA 2CUKA 4V3CA 2EV9A 3GK3A 2VYVD 4X63A 3IO5A 3H4IA 3IHWA 3ND6A 3KVNA 3T7KA 3ZEAA 1J97A 2GPNA 1EK1A 3LUGA 4G3XA 4OJNA 4ZXPA 1FBNA 1ID1A 3JASA 4M7PA 1FU8A 2ZJAA 3BDIA 3KS9A 5TPZA 5JS2A 4N01A 4FB4A 5A4FS 3P4YA 2QE7D 3I4LA 3OOHA 5JE8A 4FGWA 4KIGA 4OQYA 5KAPA 4H2DA 4EITA 4UHBA 5I7RA 2JCGA 1ZCFA 3U09A 4HTFB 2EDAA 2F9FA 2O2YA 2VK2A 4OVKA 4YMSA 3OX3A 4R83A 2C9ZA 2PLWA 4II3A 4QHTA 4GC9A 4MWEA 3G5MA 2VQDA 3FYUA 4TKUB 1M2OA 1E2EA 1YAHA 4GO1A 1SVUA 4U2KA 4UOQA 2W6CX 1Q0RA 1PVDA 2OM6A 1ULZA 3G13A 3LYAA 4OGGA 4P58A 2EGHA 4FNAA 5LDGA 4TROA 4YR7A 5EE1A 3SF0A 4ZDJA 1M6HA 3NP9A 1LD3A 2GH1A 5FJJA 5TT0A 2Y1CA 4LJAA 1H9BA 3F8TA 1CLEA 3AV0B 4JI7B 1WRBA 4M7OA 1NQUA 4GL4A 1DKOA 2ZI7A 2OO5A 3RHSA 1AQJA 4V39A 2XBUA 1YNSA 4RLSA 5EUCA 4XIIA 3T5TA 1U11A 3UWOA 1XEWY 3IEMA 2Z30A 4X1YB 4BEBA 5LQCA 2CSXA 4KFUA 4OXKA 4AP5A 1FSPA 5CM2Z 4H3SA 1YFKA 1XKLA 2GFHA 3C3DA 2MYTA 3JWGA 3VU9B 4BN4A 4FDUA 2FEMA 2OORA 3HL0A 3EYAA 3LUKA 4QECA 5T67A 2GZMA 4HZGA 4C14A 3EX7C 2XJ4A 2GA9A 3JU3A 3LQKA 1XT6A 2PLRA 1C9EA 3UT6A 4KO8A 3VC7A 5JYCA 3UPTA 1KMNA 2F3UA 2I80A 3LWDA 3PIDA 4Q0MA 4KC0A 2QLNA 3EDCA 4PSAA 3MCVA 3RJ9A 5LOVB 3FZEA 3AB8A 3A3NA 1KO5A 2A9RA 2I4NA 5DRYA 2K7FA 3PSAA 2ZRIA 2ZQ5A 2IZ5A 4KDRA 5DWVA 3GRPA 2J3QA 5FBQB 2O2SA 3TVYA 2GETA 3LUHA 4OIFA 4HKTA 3DZJA 3EMBA 4BX3A 4C88A 4EZBA 4DABA 4P0PB 3B1YA 1PG5A 1LJ8A 4H3HB 4UHKA 4UNSA 5E4TA 4CDMA 4DBLC 1G8YA 2DBRA 2KJQA 3AL3A 2CJPA 4LOJA 3W7AA 4H9GA 3RHZA 1UBHS 3N2KB 4KI7A 1CY7A 2XMRA 3CC8A 4UQPA 3WNDA 4I55A 1BJKA 4Z4IA 3L8GA 3LCCA 3PR1A 2AFIB 3FCAA 3ZNOA 4PZDA 4QUGA 2O9JA 5LCXA 3UUEA 1ECJA 1BXRB 4MRNA 4RPJA 3U5ZB 4M6WA 3BMQB 3UFXA 1RKVA 2ZW9A 3LNTA 4Q01A 5A02A 5IH7A 7MHTA 4TTJA 2C4TA 1AKNA 2QT0A 2W2PA 3H2GA 4DUYB 2OPBA 3SXPA 3CIOA 1P3Y1 1T8TA 2HCTA 5BV7A 2B2CA 3NTUA 4YQZA 2MJLA 3ADOA 1CG6A 4EUSA 2IDZA 4UM8B 2HSJA 5A5DA 2ZJ6A 4I9GA 3H7AA 2WVGA 5EIFA 4IW3B 1ML3A 3O3OB 5D8DA 3OJCA 4MVYA 3BGWA 4XUGB 4GOOD 3TINA 4WLFA 3DZDA 3GLQA 2JLVA 1F1BA 1B8VA 2AOTB 5BOSA 3ZCRA 1ZMBA 4ND8B 4WSOA 1GR1A 2FRDA 3P9IA 1ZJZA 1SEPA 2BY4A 3M82A 1ADBA 5B30A 3KVVA 3QMWA 4EY6A 2XADA 4WA7A 1KQNA 1SXQA 3AK4A 4PSVA 5I4BA 2PX3A 4G0ZA 1H0HA 1C2TA 4OI1A 4CN9A 1CJTC 3RG2A 3UQZA 1CLUA 4HD8A 1NXVA 4WBNB 2DLNA 1A9SA 1C8LA 5BR4A 2YZGA 4JLOA 4W1SA 1B8PA 2ROQA 4MZDA 2XE8A 3QBVA 4F86A 2DPGA 1H5UA 5FRDA 5A4DA 4PFKA 4NCXA 2B5VA 2C2OA 5KYGA 5GADl 1VXOA 2FSSA 4LDZA 2FQXA 1GSHA 2YIJA 1G5TA 5GQSA 3PGKA 4RSGA 4UUBA 3THSA 4RKYA 1HQCA 2FPIA 4RAQA 2GN8A 4DQDA 5HUQA 2KBFA 2YMQA 3K2EA 1RZRD 3MRSA 1CJSA 5FUVA 2WUEA 4UZSA 4ARSA 1L4EA 1K8YB 2QV7A 1RPZA 3CPHA 4B4OA 1USWA 3UC9A 1VLHA 2UUOA 1V16B 3ANNA 2GBLC 2VJBA 3AF4A 1RJ9A 4GMHA 4IWYA 5A3RA 2F8TA 1U0TA 3CONA 4L57A 1JDBB 4YJFB 5KINB 3KZVA 5C8YF 2LDBA 4Q3EA 1R6AA 2F8LA 3OLCX 1FVFA 5IM4A 1P1KA 2YBDA 1I3MA 4BQIA 4A91A 4BV9A 4MV5A 1YKGA 4DR6B 2ATXA 1KAOA 3M0EA 4KJZA 2QAIA 4Q1VA 4TWJA 3VAYA 3UH0A 1EJ0A 2AXQA 1K3UB 3H8SA 4KV9A 4YAGA 1HDRA 5HIMA 5KDLA 2ZR8A 4YK7A 2XNJA 2AZDA 5KKAA 2DLDA 3P19A 2FMXA 3TO5A 5C5CA 1E2JA 3I1JA 5BOVA 4JLAA 1JYFA 1NSYA 2WTMA 2O3UA 4WX2B 1IVYA 2JHFA 2KBEA 2P91A 1F06A 1OTXA 1S3FA 1HRKA 3CRW1 1K0FA 1BHJA 1KOJA 1NM5C 3AEKA 4NMXB 1EXVA 1HE4A 2QIPA 5K0BA 2G1AA 1LB1B 2PZGA 2CCKA 5G0SA 1IWPB 2VKQA 3ON5A 4F97A 3P4XA 4ZRDA 2EJWA 2MSDB 4UE3S 3GL9A 3HXKA 1X7HA 2BWJA 3KBOA 4UU7A 5CA0A 2CWDA 1U0LA 3DDOA 3ZBQA 3ZCTA 2D5LA 3L0ZA 3MBKA 5LDHA 1UKVY 3DM5A 1W5EA 1QTIA 1TF2A 3A10A 3BG5A 1T34A 1TW3A 1XDSA 2IPOA 1QVRA 2I22A 3LGAA 4PAWA 2X3FA 4BMVA 1S4QA 4KR7A 3UJ7A 3DKPA 5LB2A 3ZHYA 1XK6A 1YOBA 3QWBA 2B4TO 4HFJA 3P0FA 1TEHA 3OZEA 1W44A 4JBYA 4IICA 1C4KA 3TAHA 3TBHA 3EXIA 2DTXA 3N7AA 3RSSA 1RLIA 1YS6A 3I6IA 3LI2A 5K3SA 2ESRA 3D3WB 3RJ5A 3T5BA 3VNQA 2ZR7A 2Z43A 1TM1E 1S2LA 4K28A 1KVSA 1X1QA 2O50A 1H8HD 5L6MB 1P1CA 2UVDA 3TVDA 1RWOA 2W6NA 4HBGA 4EUHA 2HLNA 5I8ZA 1F9AA 2JFBA 3KVRA 4TLBA 2ZYUX 3SY8A 2W6MA 1YU9A 1VSBA 3E61A 4E0BA 4FX5A 1EZZA 3P5BA 4DYDA 1HXHA 1GM5A 1N5MA 1P6XA 4OIMA 2H5IA 4EZEA 2AMVA 3HM9A 1JN0A 4U2GA 1RHRA 2IPNA 5AKHA 1DL5A 3MBOA 2DU8A 2LCIA 3DCYA 1ODSA 1CZUA 1A9QA 2WABA 4AO7A 1RKUA 5JNRA 3O8BA 2ZRJA 4TYPA 1CYDA 1HETA 4W5WA 1C50A 1V9LA 2PD3A 3NC4A 3U7GA 1D9XA 2IHJA 2X0IA 2ZJ0A 2Y1EA 5BY2A 2HGZA 4V0RA 5A2QA 1PZGA 2DPMA 4AS2A 1BOFA 3M6UA 3LPCA 3FWNA 3EDRA 2GBPA 2GF0A 1FLNA 3W8EA 3TECE 5L45A 3WYAA 1QFSA 1TZJA 3QU5A 2R0QC 1ZITA 1FDRA 1QUFA 3NWJA 2JCYA 5JC8A 5I3ZA 3TPZA 3H1FA 4Y9TA 1DJLA 2YDXA 1E32A 3MTBA 4YEDA 4RTQA 1BVYF 1ZVVA 3ND7A 1I4WA 4LDPA 4M0DA 4GZMA 2YDYA 2NPIA 3O1LA 4MNTA 4YRCA 2PQ2A 1J56A 5JSHA 2ZAIA 3CZ4A 4FI3C 4U7GA 1GYPA 1SUWA 2OFXA 3I52A 5LYJF 1J22A 4IIJA 4NFSA 3BJEA 1NY6A 3KAPA 3TGPA 1T5LA 1BEEA 1T9GR 4F1KA 2OD9A 3UJBA 5LP6F 1NBAA 3KJNA 1JQEA 3KOOA 2E5LB 1FL9A 2FEWB 3OCYA 4DR1B 4X60A 1FSZA 2GYUA 4YX9A 1QHGA 3OQOA 3B7PA 1E2IA 1P77A 3LQ1A 4RANA 3UPDA 1OLXA 1QQAA 2B8JA 1OWNA 1RPAA 3VSAA 1JNXX 1ZRSA 1CF4A 3QLVC 1JRLA 2WJJA 1IMJA 5B64A 3GPCA 4QDOA 5BSVA 1PFGA 3PCXA 4KWTA 2P4EA 2XHEA 3AV3A 1Z38A 4QGBA 1W93A 3I5MA 2IBSA 3SQLA 1MX9A 1ZSNA 1YCDA 1K6MA 5HVNA 3W5AA 5LXTF 4NENA 1SIOA 4XM2A 4Z3KA 4OQXA 1QHHA 1L4LA 3LGXA 1Y81A 5KX5F 2QTHA 2X2EA 3FMIA 4YRAA 2ZT8A 4LSWA 4AECA 4FM9A 1H3EA 1QHYA 3QFFA 4YACA 3MHPA 4XGKA 1JIXA 1NQXA 2EBFX 2A9QA 1M8PA 3WLSA 5C51B 3FW1A 5IXSA 1SKQA 1LH0A 3U9LA 2ZEJA 3JQFC 1IZYA 2MU1A 1XNHA 4M88A 4GMFA 5K0GA 1R1DA 5KNDH 4RF3A 1BC5A 2JH3A 1L5NA 4E5KA 4EGCB 2XCSB 1MG0A 2Z5GA 1WCYA 1OIWA 1AKEA 1I3CA 3CPEA 4GM1A 5BN4A 2QVCA 1FW8A 4XLTA 1OAKA 4R2LA 4MI1A 3RTDA 2DHQA 5FQNA 2IUSA 1AKWA 5KYXA 4GFDA 3TTXA 1S2DA 2D8MA 3TLKA 3VOBA 2EKZA 2WF7A 1G64A 3VUEA 1A2BA 4N3NA 1G1MA 4DQ0A 1R27A 1M1XB 1G3UA 1DJNA 4UU8A 5KJ1A 5KQMA 3L7IA 2ACVA 5AW6A 3TUZC 1VGQA 3KXPA 4XYMA 4N48A 5DV9A 2DY0A 2VNJA 1E9DA 3BZUA 4RWZA 5CBPB 4AKSA 3UJNA 3DLHA 4XASA 4IIHA 2PTGA 2O2CA 3ESRA 3W8RA 4P54A 3OFVA 3T15A 4CCAA 4R6XA 1IOWA 3IAUA 4TL7A 1FXUA 3N9IA 1PSWA 1QFXA 1K9VF 1QORA 1XU4A 3B7WA 2GN2A 2PZEA 4BFWA 3HB1A 1ZM9A 3IOYA 5HJ7A 1Y5RA 4MYSA 2XDAA 4TKUA 1GXSB 5EEGA 4J3FA 1XMXA 1KYQA 5JCJD 4EW6A 1C14A 1EP2B 4K1XA 1GHTA 3A32A 4Q4JB 5FNZA 4R8VA 4YIHA 2BHSA 3H05A 4Q93A 2RK3A 3NH9A 4XJVA 5KNDA 3T99A 4FMBB 1DIAA 4KQHA 2IWHA 4EG3A 1NYLA 1UOPA 2R00A 2VTDA 5ITWA 2GPTA 1J06A 1TX4B 1IM5A 1DB3A 2C4UA 4NX2A 3EUWA 4WW0A 4FDVA 3F5DA 5BQ5A 5JRDS 4EYGA 3ZGNA 3GBPA 3B12A 1WM1A 5KKCA 1XV5A 4KODA 3NKLA 1D1SA 3G8DA 4X1YA 1K3FA 2V7UA 3RS0A 2EF1A 1DEOA 4TYQA 4D8VA 3QPWA 3ZGVA 2PWYA 3ITKA 4YHHB 4NZZA 1KKLA 3NX4A 3G89A 1QO7A 3OKFA 4Y2RA 4DLXA 4BNFA 4CM9A 2B4KA 3JQEA 3ZI7A 2JL1A 4ZQGA 4H7PA 3TQQA 2YJZA 5G2OA 3PRYA 5BMVA 3WR5A 2KYRA 4PGGA 2P2YA 1IN5A 4BMXA 3A0RB 5AFSA 4QJ5A 2VPWA 5LA6B 4RZHA 2XIQA 1J99A 1ORDA 4R0MA 3OIUA 5LOVA 3OJEA 3TTSA 4GBED 2BCGY 3QWAA 5A4IS 3HWRA 3DBLA 2WV7A 2LR0A 2VPXA 2XBLA 1DBPA 2WHQA 3C7DB 2P9ZA 1FDWA 5FO1A 2HO4A 3H9JA 4I5GA 5A1TA 1E3TA 1L4HA 4AY2A 1R0BA 4UNIA 1PV2A 4UCXA 2XGSA 3ILHA 3ZJVA 4DWOA 1E5DA 1ESMA 2OCAA 4KVFA 4QUEA 4XQGA 1KY2A 1W0KA 2A9PA 2RGBA 3R3XA 1TPZA 2QI9F 2DFNA 2O3RA 4NXNB 4UHEA 4W4TA 4B81A 2FFQA 4CQMB 3BEDA 4UTVA 2JLXA 2FVYA 5IAEA 1FFYA 1FP6A 5BMOA 1V7ZA 1E1RD 2REXB 3BGSA 1SCBA 1BXRA 4UUPA 2G7MC 3IIMA 5EWMA 2FRVA 2R62A 3BMQA 1F3OA 2Q4TA 1D4FA 1O03A 5J59A 2GEUA 3UB2A 4NFYA 4MQ5A 2NYUA 1OTHA 2A7XA 1KBOA 3GCDA 3NONA 1FMLA 3LVRE 4MXDA 1YDMA 1AU9A 1S3IA 5ALFA 4YR9A 3ND8A 3BXEA 2D5AA 2WG0A 1L7AA 3C1UA 5ALLA 1AMNA 1ZUD1 3E9ZA 5K0LA 1DMRA 4RDXA 4IZIA 1PNRA 3TPFA 1T5BA 1DX4A 1RQNA 4NFLA 4ALNA 4GUAA 3ZD8A 3GYBA 4FZRA 2E4XA 1RD4A 1PR1A 1XF1A 1JGTA 5DOVA 1DWQA 1DAOA 2MYNA 1S89A 1LQUA 2AOTA 2GSDA 3KX2A 1A7JA 3QUAA 4NR0A 5D51S 5I9LA 4TXHA 4G1MB 2BDTA 4B40A 5KQGA 2UZIR 3F6RA 3HFJA 2WG2A 2Z3ZA 1C7JA 3JQ7B 4F8YA 1DPFA 3I45A 4ZQBA 1WKVA 2VF5X 2A35A 3HVKA 3FNIA 8GPBA 2IYWA 4NMWA 4RM3A 4EEKA 2Q9UA 2XGJA 5DGDA 2HSDA 1WZ2A 3IRVA 4BWGA 3E48A 5HZGA 3DEAA 3LUCA 1D2RA 2MTBA 2D1YA 4PRYA 5DWDA 2MT9A 5GONB 1V4VA 5KYYB 3EPKA 2HMUA 1BVUA 1SHLA 4GZ6A 3SLKA 2WYVA 3HJHA 4GI5A 3PUWA 5JFTA 4L8WB 2B37A 4HLUC 2XEDA 4D41A 1B2RA 1N7IA 1YBVA 3QWHA 1CJCA 1UPUA 2HK9A 1XRJA 5EHGA 5JVDF 4UTXA 5EWLB 2Y1OA 4CKBB 4TYNA 3KB8A 2COUA 1N2GA 2C99A 5LLSA 1DAEA 3B9RA 4LYHA 3KEOA 3U9TA 3WNBA 3PVSA 1NVKA 1FU4A 4RD4A 9GPBA 1V16A 3Q6IA 3PQ2A 3NWEA 2OLKA 4U0KA 5DBEX 4LDNA 3O5AA 1X8XA 2J7KA 5J1SB 1TYZA 1D6JA 2F9MA 1GPJA 2OXRA 2BGTA 4KB5A 4YJFA 2IT1A 3T5GA 2JFVA 1N8NA 4O4IF 2ADFA 1XCLA 4OJKA 4UNQA 3GJ4A 1YKFA 3QKRB 4Y67A 2NSYA 1U3DA 3HV0A 3OLXA 3HYNA 2B25A 3OIGA 4V0NA 1M34E 2IHKA 2WP8J 1JUDA 3N3AC 3P94A 3NDBB 3HCCA 4RHFA 5AUNB 2FF5A 2V8BA 4UTOA 3SG0A 2DP4E 2XTZA 4FFPA 2D6FA 5JASA 2BKVA 3G0IA 3JAMA 3DT8A 2QW0X 1NXXA 2I7VA 3TOZA 4B4WA 3JV7A 2Z98A 1NDQA 3EYWA 3HCBA 4MDYA 2NQ8A 2XVXA 2QL6A 3FPEA 3V34A 4B4DA 4DLVA 1M8KA 3FAKA 4ROSA 4D44A 2QLTA 2PUCA 3TTWA 4FEGA 4PNZA 3T1HB 1DRKA 4QM7A 5FOWA 3BSFA 3I9NA 1A50B 3WGZA 3QEBZ 2OLJA 3I2YX 4YLEA 5HQJA 2ZROA 4JENA 5AW1A 1Z83A 3B52X 1CEQA 2VH5R 3FDFA 1GGJA 3VOTA 3W3ZB 5TMPA 2HQBA 4LZLA 1P7VA 4FC7A 4H15A 3GLIE 3E84A 2E9SA 1UBRS 3TWOA 4BEJA 1OBFO 2JLRA 1GG5A 5DHSA 3C16C 4OHPA 4AQDA 4C6HA 2D13A 3GRAA 2AI3A 3T54A 4BNXA 4LJLA 3E5MA 2ZVQX 1N8SA 4D4GA 5SZKB 2I3AA 5EIOA 2QPTA 1Q21A 1ZIYA 3FRJA 1RHQA 2JI9A 2O8NA 3LUJA 4OH7A 2LCQA 1EIWA 1OFHA 2B8TA 2HY7A 4LVOA 1L8XA 3GJ6A 1RLTA 3VI3B 4CCWA 1LS1A 5J5VA 3Q6NA 3D3WA 3GX1A 3ML1A 4KGZA 1OWMA 4INPA 5TRTA 4YCAA 3GYGA 2F6RA 2JCVA 3UHFA 1YS1X 3PHLA 1ZOSA 1Z82A 3VKFA 1OZ0A 2AYYA 1KETA 1RLJA 2G6BA 3A9WA 2DH5A 3DR5A 1B74A 1FRQA 4NZOA 5TS2A 1R3UA 4CQLB 4HVLA 3MUEA 4GRAA 4TMVA 4O3FA 2RI6A 5IH3A 1ZP6A 5KMGB 3IVGA 3H1EA 5EIAA 1R37A 1YCGA 5FCDA 1NR5A 1QIDA 2GJSA 4UJ5A 2M98A 1FNDA 2FPRA 4BIIA 2J41A 3GELA 4E11A 5EIHA 5F98A 5FV4A 4O4JF 4UEKA 1IU9A 3K0EA 2XQVA 4OI0A 3N70A 4AO6A 4D79A 3R40A 3L7YA 1QOZA 3OD5A 4YMHA 1JHYA 4BEVA 1M7HA 3UV3A 5F23A 1KTVA 3KXLA 4OXIA 4ZEOA 4HX5A 4WJLA 1TLLA 4FHFA 3SSMA 4D8UA 1EG2A 2UYCA 2UVQA 1HWYA 1R6XA 3LWNA 1Z2DA 3F5MA 4EFKA 2BL4A 2ZBFA 3OCXA 1V4NA 5JJBA 5LMNB 5BN3B 3IE0A 2I4MA 5LZ4A 3QPUA 3MGKA 4IQFA 4RD3A 5A7GA 3IAS1 5C4GB 1WPGA 3OPNA 5HP4A 2BHLA 3CLUC 1M6EX 4UVDA 2XNDD 4P34A 5T6BA 1ZK2A 4CPDA 1ZRMA 1BMQA 1TLTA 4G23A 1AMOA 2P27A 4UBIA 4GPAA 2UVPB 2HA5A 1Q0HA 3MMNA 1SXJD 3Q85A 1RT9A 5ALHA 4Q02A 2IYXA 1YJCA 3IMFA 3CNHA 5AMXA 3WIBA 3H6KA 4MKFA 4ON9A 1RJFA 3BIXA 1JAZA 4WECA 2E82A 4PPQA 3WADA 1K4MA 3NG1A 2JH8A 1GFIA 3HG7A 4IO1A 3KKQA 3DWIA 4RHEA 4P3NA 1B3RA 2XMSA 2P75A 2P4HX 3ES9A 1JB9A 3F90A 4WZ6A 5HS6A 5CB4B 3HZHA 1DKPA 4DW8A 1QIJA 4XQEA 3MHTA 1JXMA 3L7NA 4CEIB 2ZPTX 4QXMA 1NVFA 1RXEA 3LY9A 1WY5A 4ROTA 3SZRA 2BR3A 5KWIA 2PYDA 2IXEA 1P7ZA 3CWZA 1JQBA 5FORA 4A6XA 3FFTA 2YASA 4H4CA 4DLKA 3FWKA 421PA 4HLCA 3HEBA 2Z09A 3B3JA 5BWOA 4ZAXA 3ZKWB 4NTZA 1GKLA 2QL9A 2BMFA 1P2BA 1DV1A 3H9GA 3KTAA 1KOGA 2YRXA 3JYLA 3LC7O 3PC8A 4U1RA 4KXLA 3EQ9A 4MUIA 3AR4A 3LJKA 1E2GA 2P41A 4PM4A 1BD3A 1ZGBA 3HC7A 1M1NA 5FH9A 1PJAA 1VL6A 2PPVA 4CW7A 2YY5A 4EHNA 4YASA 5CTJA 1WZEA 3K32A 4KR0A 3VR6D 2IA5A 1ZBDA 1IY2A 4TRRA 1MN6A 2VHQA 1ZGZA 2IV2X 3WO1A 1WWKA 2D06A 1YGPA 4PX5A 3WHIA 3RC7A 3ESBA 3HXPA 1NU8A 1U7HA 2L82A 4JVSB 1DVRA 5IUKC 3QFTA 1SAYA 2I6QA 4NG4A 5AHKA 221PA 2KI5A 1Q7RA 2GHRA 4YCJA 5LB4A 3UHJA 2DT5A 3ESQA 1S7GA 5E6RA 5KTSA 3U6BA 1A8HA 4DCCA 4G1EB 1LRKA 1PF7E 4DV0B 2W58A 2ZT6A 3T7JA 4X3PA 3RTEA 5INTA 3C3BA 5CBPA 3EBLA 3MG9A 3T4EA 2IZ7A 3RT7A 1ATIA 1BMFD 3CF4A 3WK9A 3S2EA 4FVTA 5AM2A 1JZSA 1J2UA 1H6AA 1OI2A 3NRJA 4AJ1A 4LKOA 4DDHA 2OOKA 1U7WA 2VDOB 1V71A 3BCHA 1T13A 5FUWA 3EXAA 3PGJA 4DQXA 1Q1NA 3VKHA 2BOVA 3PB3A 4N54A 4B87A 3Q8KA 1GXSA 3P2MA 3OZCA 3PC6A 3E15A 1VLLA 4LJ9A 5SZIA 3WWDA 1KR2A 3ZZ1A 3VDXA 1FDIA 3PWKA 1DEHA 5CG1A 2O06A 2IQ5A 2X0RA 4Q4JA 1VFNA 3QUQA 2FW0A 2HJ9A 1KWKA 4YRMA 3NGMA 1KEPA 4BZQA 3QKTA 1LDGA 5FUBA 2W42A 3O90A 3G79A 3NV7A 2JHAA 5C46F 3CNLA 2HTEA 1XTTA 3AMVA 1RM0A 1UQRA 3NFRA 5F33A 1NW7A 3LKBA 1M0EA 2QAGC 2WFZA 1XVVA 1EFPB 1YC5A 2GRJA 2VYQA 3DZKA 3MD0A 3QG5A 1YBHA 3OOSA 1Y8CA 4KAFA 4GXRA 1E77A 4DIFA 3MMSA 4HAOA 4BIMA 5A1JA 4OUDB 5IYZF 1JLHA 1LRLA 1SK9A 3JAWB 2DZDA 4H7FA 4IRUB 2D7CA 1O6BA 4TL9A 3R7LA 1Z4NA 3FOAA 4HNRA 4NARA 1SUFA 3BD9A 5JAPA 1E8DA 4DLAA 3NCHA 1OFGA 3F2VA 5LA6A 3W3AH 3KT0A 3QF7A 3JQ8A 3GNQA 2Q5CA 3D2LA 2Z0MA 4JC8A 3LCJA 1O3YA 4LK3A 4NEGA 2OVBA 1NSFA 2XQIA 1OYVA 2OHJA 1RFGE 4Q3BA 1MFPA 3GGGA 1OFTA 4M8LA 2R44A 3TX6A 1O6FA 4WK2B 2EKLA 1II8A 4MI9A 3AF3A 4IWXA 5LQNA 1FZTA 4ZI2A 3R3UA 1YJAA 4PYJA 1ISMA 2Y6VA 4P7KA 5EKDA 2ZAOA 4GT1A 5LD2C 2VDKB 1LUAA 4TV8B 2DUUA 4CDGA 5EKXA 1HYHA 4JJ7A 4O02B 4EFNA 4MQMA 2Z8YA 2C3YA 1C7IA 3PQ8A 5DGTA 5DLDA 4BHTA 1ZM2A 5HPYB 5I7UA 1OH7A 1KRWA 1EG7A 1DV2A 1L9XA 4ZK2A 2RI1A 3ZH9B 2QT9A 4XEHA 1HG0A 5C52B 4EB0A 4PC3A 1F4VA 2XB6A 3GGOA 1X7WB 2TRSB 4F3KA 2X6TA 1TYDE 2JVJA 1HNZB 4YLYA 4BDTA 3IP9A 4EGQA 3DS8A 1X74A 1NWHA 1S8AA 2EX4A 5DYTA 1CR1A 2O19A 1JJBA 3K72B 4FB5A 2GPYA 1WOMA 3PPVA 4LPKA 3REOA 1YIOA 2BFCB 4Y0VA 1NA5A 4BO1A 3ZY4A 5CXUA 2XPCA 3PJEA 3TZHA 5C7OO 4MRSA 4LW8A 2XMDA 3T3DA 2GVNA 2Q3MA 3QEKA 3ZK7A 3GDOA 1U04A 3RQSA 4Q1FA 1N7GA 4QYTA 3HL4A 2VYVA 4O4LF 5KWVA 2A0FA 2CLFB 3GT4A 1GEEA 1YR2A 2H1HA 2R1UA 5DH9A 5EQDA 4YQFA 3H0KA 5BYAA 5KNLA 2XCRB 4MW7A 3B85A 1R00A 1KK0A 4EO9A 3IQIX 1YF3A 5DE3A 1HE5A 1QVVA 4EABA 3EGWA 4MVJM 1SURA 1L5RA 1NRJB 2CXHA 3LYHA 2XRMA 4WZAB 4L8GA 2BZGA 2GBIA 2WWHA 3DBRB 3M81A 3X1DA 2OGUA 1HUQA 2BGLA 5CVJA 5GONA 5KYYA 5AXCA 3DZHA 1RXIA 4M2LA 5FWDA 4YRDA 1NOKA 3OZUA 4RXTA 1U6KA 1ML4A 1LVHA 4QU0A 2FR8C 3BRCA 4FGSA 4YRJA 4C4YA 1K7XB 4UDYX 1G4UR 3O8QA 1BW9B 1ZG3A 4P98A 5EWLA 3ZWYA 4RSRA 4B3TB 4CKBA 3MRXA 4X90A 4WMLA 4B2PA 1EWQA 1NL3A 4PZPA 1TKAA 3L4SO 4M0UA 2GXSA 4FK8A 4R3UC 1Z45A 3ELUA 1H9CA 1YHYA 1N8KA 3RB8A 1ZD3A 2QRHA 1OXTA 2CJFA 2V9CA 2X7XA 3PA6A 4IPTA 4IR7A 4U4AA 5KPJA 4X3OA 2MOKA 3GRKA 5ENDA