5JIBA

Crystal structure of the thermotoga maritima acetyl esterase (tm0077) complex with a substrate analog
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
320
structure length
319
Chain Sequence
b'FDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGYNGGRGFPHDWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPGPVDPQYPGFMTRGILDPRTYYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cephalosporin-C deacetylase
molecule tags Hydrolase
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
publication title Crystal structure of Thermotoga maritima acetyl esterase complex with a substrate analog: Insights into the distinctive substrate specificity in the CE7 carbohydrate esterase family
pubmed doi rcsb
total genus 123
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jibA00
3C6ZA 5AM4A 4LXGA 1LPPA 2BCEA 1XZAA 2PL5A 2GYWA 3C8HA 4BVLA 5E4TA 5K3FA 5CW2A 2IIVA 3BWXA 5JYCA 2BUBA 4B84A 4UBOA 4W1PA 5T4FA 1ISPA 3AZQA 4UBMA 4C87A 2GBIA 4JH0A 1HKHA 3IUJA 3VVMA 2K2QB 1CQWA 1K63A 2OG1A 3HLKA 3EF3A 3D0KA 4Y2XA 5HF6A 3V1NA 1TAHA 3E4DA 5LZ9A 4MJ3A 4EBBA 4L9AA 1MJ5A 2WIJA 5ALQA 4Q3OA 1VJ5A 1OCEA 1U65A 3TJMA 5E2IA 5K3EA 2X76A 3QZUA 4QNNA 1FFBA 3S2ZA 3FOBA 5IVIA 1I6WA 2Y2UA 2ZYHA 1H2XA 4NVRA 1QIIA 2DHDA 2XDWA 3I2JA 1CUYA 4BP9A 4KJXA 2ZJ6A 1B6GA 5JZSA 2Z5GA 3G0GA 2HHAA 1ZOIA 3AIKA 4GI1A 4H7DA 4G9EA 1WHTA 5CMLA 2ONCA 4JYPA 3R40A 3FSGA 4MYSA 1EVQA 2DR0A 3STVA 5CH3A 1CR6A 3AFIA 4BP8A 4OB8A 3FWHA 3KWJA 5FLKA 1H2ZA 1G66A 1IZ8A 4H7EA 4KE9A 4TPKA 5K3AA 2W22A 2XQJA 2JGEA 1JJFA 5AK5A 4AMZA 2WFLB 2DHEA 3F98A 2JGFA 1LBTA 4BB0A 4K6HA 3WL6A 4I3FA 5AM1A 1G5FA 5ALEA 1ZD3A 2XUAA 3L1HA 5FV4A 5BV7A 2O2GA 5FDFA 5BWCA 1MX5A 2HU8A 1FFCA 4V2IA 3A2MA 4UBIA 2UZ0A 4BDTA 3EIOA 1XLVA 1XQVA 1WB6A 3EQ8A 1QGED 2B4KA 4O08A 1JU4A 3RARA 1CUIA 2ZSHA 3G7NA 3GZJA 1ODTC 2HADA 2BKLA 4BC0A 1X70A 4CIBA 2BGRA 4IH1A 1EB9A 5CT8A 5K5EA 1JT2A 1THTA 3H2HA 3LLCA 5E4YA 3OG9A 3WZLA 1VE7A 4G8BA 3UUEA 4BCBA 3DS8A 4PF1A 5D3KA 4FWBA 4G1FA 5AIAA 1JMYA 2OCGA 1J06A 3D59A 5ALGA 5LZ8A 1XROA 4E46A 2ZJ7A 4J0KA 1AURA 1QIFA 4BVKA 2HIHA 2XQIA 4K6KA 2VT7A 4AO8A 4PW0A 2GBCA 4DM7A 1XQYA 2OLEA 3PDCA 2H7CA 4GXNA 1FSSA 2WIKA 1EK2A 3O4GA 5BOVA 1DQZA 5LZ4A 4GEGA 5AKLA 4UHHA 5AHXA 4WDQA 1R50A 3WWPA 4RPCA 1L7QA 5HF5A 1QO7A 1DT5A 3MVEA 2CMFA 3O0DA 4L0CA 4E14A 2VJDA 3WYNA 4Y2VA 3HSSA 4P93A 4I19A 5AOAA 5ALLA 1GPNA 1HDEA 2VJAA 3PICA 3I6YA 5K3BA 2EEPA 1XRLA 1ACLA 5K3CA 5ALDA 4ARBA 4X6XA 4YPVA 3IULA 4UUQA 2R11A 2DHCA 3BXPA 1XQXA 2H9YA 3MGAA 1BROA 1UK7A 4JNCA 2HFKA 3WWOA 4MEAA 1MT3A 5AKGA 3A6ZA 3R3UA 1EB8A 4IQ4A 2PU5A 2I3ZA 5CBKA 1VLQA 4FTWA 2XUQA 5HFAA 2LIPA 5AKIA 1JI3A 1CUXA 5ALFA 1UOPA 1YASA 1H2YA 4EY5A 3G0DA 2XUHA 2X5XA 1YR2A 4X95A 3F96A 4KAAA 3BIXA 1AC5A 2HRQA 2OGZA 1LZLA 1E5TA 4W63A 4X3CA 1FFDA 1QJ4A 3WK7A 5LIPA 2WUFA 3CXUA 1A8QA 1N8SA 3C6YA 4A23A 2CJPA 2EDCA 5JAHA 5A7HA 1A7UA 2ES4A 5JAOA 3WL7A 1AKNA 5CT6A 1EHYA 4DMFA 5EIEA 1EDEA 2YYSA 4JUIA 2HA0A 3C5VA 3HABA 5ALKA 5LZ5A 2BJHA 1NU6A 4FLMA 1P0PA 4EY4A 4UHEA 1MN6A 1KU0A 1VE6A 3DYVA 2XUDA 1BRTA 3F67A 4RGYA 2JGKA 5DNWA 4XWGA 3AILA 2C5FA 3OTQA 1GXSA 1UOOA 1XRMA 1AUOA 4G8CA 2W6CX 2XUFA 1CUHA 3ESDA 5ALPA 3IB3A 3PUHA 2WUGA 2OCIA 5AI6A 3E0XA 5LYYA 1JKMA 4X97A 3STYA 4KEAA 5J3JA 2VAVA 1BEZA 1R9NA 1CUCA 3OURA 5IVHA 1QTRA 5AO9A 1UXOA 2ZVDA 4DSAA 2WG0A 3ZLUA 2D0DA 4BE9A 3FYTA 5FPPA 3WLAA 2NW6A 3BL8A 2Y6UA 4AN1A 2AXEA 5CXUA 2WIDA 1UT6A 2E3JA 5DYYA 3WL5A 1QTIA 3C8DA 1D07A 2PBLA 4ZRDA 5E4JA 3O4IA 2HRRA 4LXHA 2XI4A 5CRIA 4X6YA 3HJUA 4OSEA 1QE3A 2WJ3A 1DWQA 3HYSA 5FPQA 1ZIXA 4FLFA 5FRDA 3BIWA 1VKHA 5HFNA 2P8SA 4A5SA 5KREA 3L1IA 4C89A 4Y2RA 2JBWA 1KU6A 3W2TA 3G9XA 4CI9A 2HA3A 1LPSA 3WWCA 5ALJA 4EZIA 1A8UA 5DJ5A 5T4EA 6YASA 1T2NA 3OM8A 4M0FA 2HM7A 3WI7A 1U2EA 3BJMA 1XZBA 3R3VA 1G4HA 1GKLA 2I03A 2WM2A 3FCYA 4ROTA 4BZWA 3NWOA 3ANTA 4I4CA 4HZGA 4OU5A 2V96A 1E8MA 4B83A 1XRPA 4M0MA 4KE6A 5LZ2A 1E3QA 2CEKA 4AO6A 3I6ZA 1Q84A 5SYNA 1XZFA 2CKMA 1PFQA 2CZQA 4RNCA 2WFZA 3LCRA 1HLGA 1O6GA 5HZGA 4J3JA 1C4XA 4X92A 1GPKA 4DYHA 3QM1A 1DQYA 5EIHA 4BRZA 5EI5A 2WHQA 4AZ3A 3BE8A 3O9MA 5CXXA 4B81A 1VA5A 4PQEA 5KWIA 3BF8A 2PU7A 5FKJA 3EQ9A 4QWWA 4BAZA 3A70A 1GKKA 1WHSA 1QIMA 5C8ZA 4XVCA 2OCKA 4YK7A 5DYTA 4MWTA 4ITVA 4ZGBA 5AI8A 3G9ZA 5CT5A 3PI6A 3E1GA 4DMCA 3DL7A 5T4HA 1TQHA 4OD0A 3HEAA 3DNMA 3WKAA 3N2ZB 5DTIA 4MQMA 4CG1A 3FCXA 3SWWA 3H04A 1Q0ZA 1WPRA 2PX6A 5LKRA 1SCIA 5JANA 4U2BA 3N0TA 3OC0A 3T4UA 4ZREA 1AGYA 5AK6A 4G4GA 1LZKA 4Q3LA 4L72A 3PE6A 4KYVA 3C43A 1EI9A 4FFWA 1EDBA 5AI9A 3WJ1A 1WM1A 1T4MA 1ZJ5A 5DNVA 4J0DA 4DTCA 1F6WA 3HXKA 4U2FA 5ALHA 5A2GA 1DU4A 1P0QA 1Q0RA 4F60A 1GQRA 3JW8A 4FNMA 5JIBA 5HQ3B 2WHPA 5ALNA 2C7BA 3FVRA 2RI6A 1QONA 1UZAA 3WK6A 3V48A 2WUDA 1BCSA 4KE7A 5HF9A 1Q83A 1DT3A 1J07A 3Q0TA 5C81A 4DSZA 5JARA 2HL6A 4U2DA 3M81A 2Z8ZA 5ALVA 2HA7A 1XZJA 2WHRA 3ZPXA 5IVKA 3DOHA 2V97A 3IVMA 2DCMA 1LBSA 4QA9A 5EIAA 5HCUA 2C4HA 4W1QA 3OPMA 1QIEA 3WA6A 5JASA 1L7AA 4G4IA 1VZ3A 3IUNA 4B9EA 3I6MA 1ZICA 3GROA 4B0OA 2G5PA 2WJ4A 3TGLA 4LXIA 4OYLA 4DNOA 3R0VA 1SC9A 5LP1A 3AIOA 1L7RA 3V1KA 4AXBA 3DYIA 5JALA 3AJAA 4QE3A 2OGTA 2VF2A 5FOQA 1QIJA 4OUKX 1HBJA 2WJ6A 3C45A 4BCDA 3KXPA 5FUMA 4B82A 1UK8A 1GGVA 4IH4A 2WTNA 1G42A 1YB7A 3VJLA 3H1AA 4HTAA 4OB7A 3HRHA 1YS2X 4MYDA 2BUAA 4J0HA 2XUOA 1H22A 1YA8A 4DMHA 5D3ZA 1M33A 1W52X 2PSDA 1F0PA 2XLBA 5I9IA 2ROQA 3R3YA 2HFJA 4N8DA 5JD4A 2FX5A 4MEBA 3IBTA 1CUSA 4AO7A 1CUBA 4CCWA 3H18A 4KAFA 3IDAA 3WZMA 3S8YA 2J4CA 4WFJA 1UKAA 3DL4A 3QITA 1H2WA 2VQ6A 3OOSA 5A6VA 1ODSA 5AICA 1ACJA 1W76A 1MPXA 1LPBB 3FBWA 2PUHA 1XLWA 4OU4A 1CV2A 4UBKA 2EDAA 1CRLA 2AJLI 5HQ3A 2HA4A 2OPHA 1C7JA 4P08A 5IH7A 1LLFA 2G63A 1GZ7A 2GBFA 2HU5A 3NOXA 4ZV9A 1SCKA 3WK5A 1R9MA 4WDRA 3I2GA 4Q1VA 5H3HA 4KRXA 3NUZA 4AX4A 4OYYA 3IURA 3DOIA 3WYDA 4HXGA 5HKAA 4TVKA 2XQGA 3PF9A 3YASA 1AMNA 2ACKA 3ESBA 1UK9A 3VISA 3ANSA 3SK0A 1CUEA 1IUPA 4HAIA 2J3QA 2Y2VA 1J1IA 2VT6A 3A2LA 5EFZA 1XZLA 2QMQA 4C88A 4G4JA 4BBZA 5AOBA 3FLBA 2JGJA 1VXOA 1YA4A 4J0CA 4B0PA 3WKBA 4Y2JA 2QR5A 1BS9A 1VOTA 2AJDA 2Z3WA 4J7AA 2WFMA 4H7JA 2D5LA 3PUIA 3WKDA 4J0IA 4QDTA 3H2JA 5JZ9A 3K9BA 1CUUA 1CUDA 1VXRA 4QZVA 3DQZA 5HK8A 1HPLA 3E3AA 3VDXA 2RAUA 2WU4A 4X6UA 2GZRA 1VA4A 4K5QA 3GFFA 1QLWA 1XZHA 1CUZA 2O7VA 5HF8A 1JFRA 5D7BA 3G0BA 4EHBA 1DWOA 1WCYA 3ILSA 4L3WA 3G0CA 4LYEA 5CT4A 3ZLTA 2ZYSA 1WB5A 2WQZA 4HXEB 1DX6A 1MAAA 5LLSA 3DD5A 4CCYB 4RE6A 5ALIA 1CFJA 1QIKA 1QOZA 3P2MA 4CCYA 2AJ8A 1ORVA 2FUKA 5T4BA 1FFEA 4BVJA 5ALYA 3DCNA 3WQHA 2WG1A 1IZ7A 3KOOA 4X91A 2XUGA 3PF8A 1CUFA 3HC7A 2DSNA 1DX4A 3VKFA 2QJWA 3FAKA 5C8VA 5F4ZA 3V9AA 3IA2A 3STXA 3WA7A 2WLSA 1EXWA 4N5HX 1ZGBA 2BUCA 4DNQA 4H18A 5IKXA 2XMQA 4GHWA 2WG2A 3ZI7A 1X2EA 4FBMA 4QDUA 3CN9A 2RONA 3LP5A 4EA6A 2BAGA 3H1BA 3RKSA 1LPAB 1XQWA 4ZI5A 3QYJA 1TK3A 1XRQA 4BC1A 4U2CA 3G9UA 4D9JA 5A7FA 2XQFA 5CT9A 3O4JA 2WTMA 1WOMA 4RE5A 3ICVA 1XRRA 1YAJA 3QMVA 2GZSA 2QUAA 1ZIYA 2PUJA 2PVSA 1B41A 4GBGA 5DLPA 4C01A 5LKAA 2GBGA 1GPLA 1JMKC 3HACA 1IVYA 4B6GA 3V1LA 1RP1A 3BDVA 3FNBA 3GUUA 5ESRA 4G5XA 4GDMA 4K2AA 3STUA 3BF7A 4X71A 5AKHA 2QM0A 1EDDA 5JADA 3DKRA 4FLEA 3B5EA 3QPCA 3FYUB 4QEKA 2JGMA 3G02A 3EQ7A 1XZMA 4X90A 2V98A 2YXPX 4Y7DA 1A88A 4XX1A 4KR0A 1IUNA 1CUAA 2C0QA 3CN7A 5EHQA 1QIGA 5ISMA 3B3QA 4INZA 5AKKA 4FHZA 5FXMA 4E15A 1KEZA 3CCCA 5K3FB 2XUIA 4GLBA 5D6OA 2B9VA 4Y2QA 2HDWA 1XZEA 4F5ZA 1TKRA 2RIPA 5JAUA 2G4LA 2I3DA 4DNPA 4AZ0A 4WY8A 2ECFA 5IVDA 2B61A 3TEJA 4BAUA 4C4YA 4FMPA 1FFAA 3D7RA 5A62A 2JIDA 1UOQA 5EGNA 2WSLA 1UWCA 3A2NA 4MWSA 4YX9A 4BYMA 4BDSA 1WPXA 3QMWA 1CVLA 2ORYA 5EHNA 1R1DA 3BJRA 3Q8WA 3M3DA 1RWQA 2OCLA 1XLUA 1K5PA 2WIGA 1RYYA 2C0PA 1XZIA 5AI5A 5ALRA 2JEYA 5AI0A 3STTA 2HA6A 4Q3KA 4H0CA 1XZCA 3KWFA 1BU8A 5A71A 3SC2A 1F0NA 2ACEA 1THGA 2JEZA 3JWEA 5JATA 2XUPA 1OILA 3B12A 4FBLA 5AM5A 3MUNA 2OQVA 5JZBA 4Y2UA 2QVBA 2VA9A 4NZZA 7YASA 3AUKA 3V1MA 2VEOA 3WK9A 4G8DA 2IX9A 5YASA 3WWEA 4PSDA 5EHZA 2O2HA 4IH9A 1CUJA 2YH2A 3X3HA 5CH5A 3T52A 3PFCA 4BTLA 4UBLA 4P9NA 3WMRA 5AKXA 2QRUA 4AB1A 1VZ2A 3WWDA 4PSUA 4Y2PA 4ARAA 3QVMA 4Y2YA 1W4LA 2H7YA 5KWJA 4QLOA 1XRNA 3HI4A 3O4HA 1X2BA 3MUOA 3IIIA 2R8BA 4UBJA 5AM3A 4WCVA 3H2GA 2PSHA 1SOMA 2CUTA 1QIDA 1EH5A 2QXUA 4KAJA 1YS1X 1XFDA 2I78A 5KBYA 4K6GA 5AP9A 1O6FA 2IITA 3ZLVA 3R3ZA 5I7UA 1TCAA 5EHXA 4KE8A 2PSJA 4UBNA 2OAEA 1UKBA 1N1MA 3ICWA 5BWBA 3D2BA 1R4ZA 4Q05A 3EBLA 5JD5A 4GECA 3VXKA 2QUBA 3G8YA 2G5TA 1ZJ4A 4ZXFA 2XMDA 4S0XA 1DINA 1W75A 2DQZA 1BE0A 4ZV7A 1NU8A 1BN7A 1NX9A 1AX9A 3AZPA 1OXMA 3K6KA 4DGQA 4H77A 1C7IA 4EY6A 3W06A 1LNSA 5AM2A 1F8UA 3VVLA 1LPMA 3FLEA 1GQSA 5ALTA 5K3DA 4UHBA 2X8BA 1XZGA 2AJCA 2Q0XA 4YASA 5AK3A 3AIMA 3KSRA 1JU3A 2BGNA 3U1TA 1JJBA 1P0IA 2AJBA 4QDZA 1YB6A 3W9BA 2VSQA 3KD2A 1ZI8A 3K2IA 3TRDA 3HZOA 4UHDA 3GELA 4WJLA 4OB6A 4WFIA 1QFSA 2H7XA 4PV7A 3RK4A 3W04A 1CUVA 3AZOA 4MQLA 2ZYIA 4BATA 1MTZA 3WIOA 2XMRA 1E66A 4FOLA 2GYVA 3M83A 2J4FA 1W1IA 3D3NA 2WU3A 1IUOA 1HL7A 4GW3A 3D5EA 1WB4A 4UFOA 3I1YA 4UHCA 1E8NA 2WIFA 3F9CA 4UFPA 3H2IA 1SCQA 2XT0A 4CFSA 2O2IA 3H2KA 2QJRA 1E8DA 4OPMA 2HU7A 2RHTA 4N8EA 1MO2A 5ALOA 5SYMA 4G9GA 2QTBA 3NGMA 3I2HA 1MNAA 4QLAA 1LPOA 2DQYA 1QFMA 2Z8XA 4IHAA 4QWMA 4HS9A 3G0IA 3DJYA 4U2GA 4H7IA 3ED1A 3FYUA 1IMJA 3O95A 5ALMA 1YSCA 1ODCA 3LIPA 4GWLA 3I28A 1LPNA 4HXFB 4JEIA 1JJIA 2JF0A 1N5MA 5I8PA 4XJVA 1U4NA 4UHFA 4U2EA 3ESCA 5AKEA 3DDUA 4AQDA 4OCZA 3QPDA 5C7YA 2OQIA 3LIIA 1Y7IA 4CIAA 2DFPA 2V9ZA 3H19A 4FNGA 4AMYA 3QBJA 1K4YA 3DEAA 4X94A 4DNFA 2H1IA 1K8QA 3QPAA 4P92A 1P0MA 4F0JA 3WJ2A 1K6EA 1W6RA 5HK9A 2RHWA 3W05A 4X00A 4PNZA 2PPLA 1UK6A 4A16A 1PV1A 1S8OA 2QS9A 4C4XA 1XZDA 3ESAA 1YAHA 1TCBA 1XKLA 2C5GA 1EINA 1QZ3A 4BE4A 2WKWA 3C70A 4BCCA 3I2IA 3U0VA 2XMGA 4DIUA 5DWDA 1AQLA 4M0EA 5ALZA 4KRYA 5CH8A 3QH4A 2XQKA 4Q34A 2YASA 3DLTA 4J03A 2ZSIA 5AKJA 2CB9A 4H7HA 1PJAA 3IUQA 1Y7HA 1U8EA 4E11A 1Y37A 4Z49A 4IO0A 3D2AA 4B9AA 4QDXA 1ORWA 4EB0A 2XMBA 1TIBA 5A7GA 2XMCA 2B20A 3H0CA 3G9TA 2VTVA 1Z68A 2QT9A 1ZD5A 1USWA 5AIBA 4C6HA 4UPDA 4W1RA 3PFBA 2PM8A 3D2CA 5AK4A 1XKTA 1ZGCA 1TCCA 3SX4A 4XIIA 2JGLA 4DLNA 2FJ0A 2VJCA 4MXDA 1BN6A 3I1IA 2Y6VA 3WL8A 2GYUA 2VATA 5FP0A 4HRXA 1YCDA 2Z3ZA 5AOCA 3ZV7A 1DWPA 1ZD4A 2XMSA 1MX9A 2BFNA 5AH0A 2PSFA 4EY7A 1DTEA 4HRYA 3WK8A 2OXEA 4WFKA 1ZI6A 4FFVA 3R41A 1GT6A 1CUWA 4B85A 2ZYRA 4X7BA 4FDMA 4PO3X 2HA5A 2XE4A 1ZI9A 1N5RA 1R3DA 4J0GA 4X93A 4BRSA 3DKKA 3FLAA 2WILA 3RLIA 4LYDA 4AN0A 4W9RA 5JAPA 4NS4A 4HVTA 3WKEA 4JYMA 5C8XA 4N8SA 5ALWA 1R88A 2ZJFA 4X85A 1CQZA 2XLCA 4TGLA 4FKBA 2XUJA 2JGIA 3D4LA 4H7KA 1BCRA 3VJMA 4N5IX 5CURA 4UFNA 4WY5A 3GA7A 4LKOA 3QMMA 3L1JA 5ALSA 4NMWA 3WIBA 3CCBA 2QXTA 1CPYA 2OGSA 4LHEA 1J2EA 1MAHA 4Y2TA 4LIPD 4EUSA 1ETHA 5CTAA 2QOEA 2PKYX 4J0JA 1EA5A 3AINA 5DTJA 5ALUA 3I2KA 1XZKA 1EX9A 1FJ2A 1LGYA 4B7ZA 1E89A 2PSEA 3FYUC 3W9UA 3ZWQA 5ALXA 1MX1A 3F8SA 2HA2A 4F21A 4B80A 3VJKA 1CEXA 4QDOA 3C87A 2WFLA 4ZWNA 3C6XA 2FJPA 3C5WP 2Y1KA 3WKCA 4BAGA 1QO9A 2XMZA 2RGUA 1A8SA 3RM3A 2WUEA 3I2FA 5AM0A 3M82A 2WHPB 1HQDA 3F97A 1CIJA 3C6BA 4Y2SA 2QKYA 1CUGA 1BEEA 4KACA 1CLEA 2J3DA 3FSGD 4CG3A 3JYHA 2QZPA 2XB6A 5AKZA 5HKBA 3O9VA 3GBSA 3H17A 5AKYA 1ZD2P 5JD6A 3FVTA 1SFRA 1QIHA 3WK4A 4DMKA 4EY8A 1EK1A 5AI4A 4CG2A 2VAXA 2O7RA 4H35A 3UUFA 5DNUA 1EVEA 1UKCA 4H7FA 4W1SA 4PSCA 5AJHA 4BZZA 5DYWA 4ETWA 2CBGA 4BTVA 3BDIA 1MU0A 1MNQA 3R3WA 3R3XA 4C4ZA 1AZWA 3IUMA 2C58A 3STWA 1H23A 3KDAA 3LS2A 2XUKA 3UMJA 2OAGA 5LZ7A 2VJBA 1UFOA 1TRHA 4Q82A 4Y9SA
chains in the Genus database with same CATH superfamily
4OA5A 1E4EB 4C4PA 4KFUA 2DSTA 5DHRA 3IQDB 1LPPA 2YWRA 1XZAA 3KLMX 1A7AA 4CKWA 2QN8A 3PTAA 3CLSC 4RH0A 1HZZC 3CYFA 4BNWA 1Q57A 2E48A 4FX2A 1ZNYA 4YI5A 3SSMA 2ZBVA 3QHPA 1ZJJA 4BS9A 1Z4KA 2Q1YA 3C8HA 3GJ3A 1R6DA 1JSRA 4R0VA 1BH6A 3BXGA 2FUNB 4WH0A 5DSTA 4FIZA 5E4TA 1HG0A 2IPLA 3GP8A 4REQA 3A31A 1RKUA 1P1KA 2ASVA 3SM9A 4MVJE 5JNSA 5T4FA 2IV7A 4MRRA 2WWFA 4FZRA 3ACCA 3EA5A 3RIMA 1UEXC 3DA8A 5E0KB 3FTDA 2RDMA 4JENA 1OFUA 3EZ2A 3GLIB 3KX2A 1V47A 3CZQA 1HKHA 2H3EA 4LRYA 5F76A 5IARA 1NVBA 4YAKA 2XYVA 1CQWA 2BEUA 4IDPA 3IL2A 1L5OA 1F4LA 2OG1A 1T5LA 1T1IA 2VZLA 4GM1A 1X7ZA 2CUNA 1NFRA 4C7JA 1SH7A 2ZI6A 5HF6A 1U1EA 2R7NA 2X4LA 3EMDA 2VHJA 1ZC3A 1U3UA 3GY0A 3G7UA 3E4DA 2E82A 4PGHA 4RK0A 3AEZA 4XGRA 5DRTA 1L5SA 1PS0A 2CL5A 4HWTA 4XUGB 1NVGA 5FOXA 4UUPA 4AJOA 4CMIA 4WK6A 3ROPA 4IIHA 4W9NA 2PL1A 3OOJA 2GTIA 1W36B 1U65A 1RJGA 3GEIA 1E64A 2XNSA 5E2IA 4NR0A 2X76A 1D6MA 3TJMA 2HT1A 1P7YA 2PGAA 2ZZKA 2ZUSA 4O2BA 1Z7GA 2VPWA 2CB0A 5DI3B 3RWOA 4PU0A 1Z4JA 4EF5A 3GLHA 4AXXA 5B55A 5LXTA 1ZCFA 2N1BA 3FOBA 2A78A 3MUEA 2RGAA 3NH9A 4CQJA 3PEFA 3ZHUA 4CIWA 1U0NA 2ZS8A 3W4KA 5BSHA 1X14A 1QIIA 4LJ9A 2BSQA 2QX6A 2GETA 5IDWA 3FZQA 3AUXA 1M1YA 4HBZA 4M1KA 3AEKA 4PPNA 3TH5A 4Y98A 2P9FA 2YV2A 2NTYC 2WE8A 2OXTA 2Q62A 2D1FA 1TZJA 4BLWA 1B6GA 1MGPA 1QVZA 1GPBA 3I04A 4MICA 2O8BA 2VAMA 2HHAA 4OQNA 4C0LA 3DBLB 1FFXA 2ZB4A 4DZRA 1ZOIA 2VYFA 4H7DA 1BMDA 5FEMA 2XEDA 1JQEA 3C98A 4HGYA 3C3EA 4I1VA 3EAFA 4NYMR 3W1VA 4G9EA 2FSFA 1VLMA 1V5GA 4POAA 1SCNE 2P35A 4DADA 3G1UA 1CJTC 2R6R1 4FOTA 3KO8A 1X1QA 2BTOA 1VKZA 5HJ2A 3PC4A 4MUYA 4TT3A 2E18A 3R40A 2WIAA 3LUBA 1CULC 3EVBA 3EVZA 2WZBA 4HDRA 4UATA 1BWSA 5CH3A 1ZOOA 1Y7PA 1YS4A 2C59A 1BXRB 1O94A 1B0AA 1UJ5A 2P4EA 1A04A 2IQ5A 2G5CA 5BO5A 1V5EA 4IUDS 1G66A 2B30A 4KPUA 3WQRA 4F71A 3HJTA 3S8EA 3SR0A 4QRIA 3ZYZA 1H2RS 2FSIA 4MRMA 3P7MA 5G4LA 3GLSA 1FXSA 3KBBA 2JGEA 5FLYA 4QXQA 5A4FS 1JJFA 4LJKA 4AMZA 5EZSA 1O8BA 2WFLB 4L95C 4UE3S 3DBVO 1TW3A 2H51A 3ZDZB 5JC8A 3RS4A 3U81A 4PAMA 1OASA 1UOEA 4K6HA 5ICSA 4C5AA 4QGBA 2OFXA 4CLRA 3GLIE 2Z6QA 4A8JB 3IO3A 3LUCA 1ZQ1A 4MUFA 4Q4HB 4FFOA 4DDKA 1H5QA 2H2GA 2WU1A 1QQBA 4IDAA 3AETB 2ZBDA 1S9HA 2NSHA 5JCXA 5KC8A 1P9LA 4D3SA 1EAMA 3KLBA 3WGUA 2CHEA 3JXEA 3RUPA 4QUBA 4BVGA 2XUAA 1RAEA 2CT8A 1SQ6A 3RFVA 3DLCA 3W5AA 2QW1A 1XXHB 2PWBA 3IB6A 1O7JA 2IFTA 5BV7A 2C2GA 4RIFA 4UXIA 3WHLA 4YGXB 1R5JA 3BAZA 3DC2A 1EFUA 1XVAA 4KSCA 5F2KA 1TA0A 2EW1A 2N46A 3KQUA 2CNLA 4EG8A 1KMNA 1E2JA 1PT9A 3LVBA 4LWOA 4YDQA 1ZA1A 3BZBA 4PQFA 1DLIA 1FFCA 4DV4B 1EUCA 2UZ0A 2OO7A 4H27A 4M7PA 5ILQA 4BDTA 1BW9B 3AQ4A 2IEDA 2IZ0A 5TS2A 3NYIA 1Q1QA 4FSDA 1PRYA 5EPUA 1P8JA 3LKZA 5JFTA 3BB1A 4HX2A 2YUIA 1T5SA 1YJAA 2YNMA 4KQIA 4WINA 5CP8A 4BO0A 3U44A 1B15A 1DUSA 2DBZA 5PGMA 4PONA 3PWTA 1VPWA 2XYQA 4JQZA 2V7GA 3LF1A 4GBJA 4GD3Q 2JI4A 3UAXA 1BFUA 1M83A 1M6HA 2W48A 2ZSHA 4KOAA 1PBNA 3G2OA 4M8SA 3NBFA 2ZYDA 4M88A 4PX3A 3TZ6A 4MVJA 4R05A 3FR8A 4G84A 2HADA 1RDFA 2IP1A 3LI2A 2J30A 3RVSA 4P4SB 4CIBA 4DV0B 4OLBA 1QH0A 2QP4A 1GNTA 4D4JA 4QTUB 1Z0JA 3RROA 1E2MA 3OQVA 4GICA 3DZFA 3IP5A 3W5IA 1XB2A 2GNAA 4JL8A 4UMDA 4Q21A 4Y0NA 4DMUB 4FUQA 1Z2DA 2QPAA 1E9RA 4S1PA 3P4YA 1DIHA 2HLHA 4GC5A 4DLUA 5E95A 3ESZA 3OG9A 5E4YA 3VO9A 4YB8A 2ZYGA 5BQ3A 4XGQA 1GZ4A 4A1FA 3VTAA 1LBIA 1HF3A 3OESA 4EDHA 4EBFA 1Y42X 2VT2A 3FH0A 5A02A 1Q6YA 4KUEA 5LUBA 3OBBA 2VOJA 3ZGVA 1JLKA 1VE7A 4NDZA 4RPKA 3UUEA 2PLFA 2J5RA 1R4NA 4BIMA 3GEMA 1KZ6A 4WOCA 2XZLA 5C3UA 3LBNA 2QG9A 4E32A 3Q8LA 1JG7A 4BFTA 2AN3A 4RXMA 1QVWA 1BX0A 1G1MA 2EGGA 3N86A 3Q9NA 4G1FA 4PYNA 4WK4B 1LC0A 5CJPA 3GEBA 5DPMA 1OPXA 5TQVA 3UHJA 5CITA 4DB4A 1G291 4ZJZA 4L50A 3BXHA 3CNQS 3K1JA 4KGZA 2OFPA 4XDZA 3ZU4A 4E3WA 3EAGA 5LQNA 2O14A 4F45A 5K0JA 2OV4A 2IKSA 4DJJA 1T3LA 1S96A 1Q7CA 5FL3A 5EQJB 3CW2A 4CV1A 3OEYA 3AKYA 4K6KA 2ZB2A 1LH0A 4XR4A 4V38A 1DCKA 3QF7A 2BFBB 1OI3A 1X1SA 1NJ1A 4BVEA 3BE5A 2AMFA 3JTMA 4G0WA 4DM7A 3ZU3A 5A6SB 1U99A 2RG7A 4TKUA 4HWGA 1LD3A 3QLUC 1BYUA 1RLJA 2G06A 1BGWA 1FMLA 2QMOA 2X2OA 3PDCA 4E4TA 3GJ5A 3IOYA 5J4KA 2WJGA 4GXNA 3EXHA 4NV0A 2DHRA 3ZN2A 4B73A 5IULC 2C9YA 1KIMA 2QIPA 2RHHA 1UBEA 4CKEA 4ZO7A 3V5NA 4WI1A 2X2FA 3LF2A 2DECA 4MA0A 4REOA 1U6KA 5AKLA 1MQ8B 2I6GA 2JGRA 3TI7A 1PZEA 2YVKA 4V02A 1R6TA 3LHKA 2FGJA 3R0JA 4CTOA 1YS7A 3JWHA 3BL6A 2VPQA 4QGGA 4RPCA 5ARCA 3UT6A 1PO7A 2I80A 4O63O 2AEFA 4NBKA 4YPFA 2VYNA 4E14A 4BMVA 2VJDA 3FI9A 3WYNA 4OY3A 2X41A 2NVUB 3HSSA 3PC8A 3MTDA 1FFWA 5MFPA 1WQ4A 4IMPA 3HJAA 1GNSA 5J43A 3LPDA 3R74A 1GPNA 1HDEA 2VJAA 3VR3A 1UDRA 1Z8FA 3UGQA 2EEPA 3DE6X 1XRLA 1U80A 3TMKA 2VCYA 3DFFA 3W5DA 4YAIA 1ISRA 1LLCA 3PHGA 4PG5A 4ARBA 2YMLA 4POOA 2C2OA 1J0CA 1JQ5A 3I6QA 2PK3A 1KRHA 1MJGA 3IULA 4QGAA 5B58C 1LSJA 1SURA 2D2VA 2G9ZA 3BXPA 2H9YA 1ADBA 3MGAA 3EK2A 1AF4A 3VX4A 4AP5A 3MWLA 2PT9A 5FV7A 4C07A 1J25A 2WF8A 4M46A 4AZVA 5AUPB 3TOSA 4JXJA 1XDGA 3A6ZA 5C8YA 3V33A 3QVOA 4B2PA 4JA2A 1EB8A 1Y8QB 2IYUA 3PGVA 4HUQB 4IQ4A 5F7XA 1FW6A 2PU5A 1SVOA 2GMWA 1QU2A 1VLQA 5HVNA 3E23A 2Q0HA 4LYHA 5HFAA 3BMXA 5EA2A 3HVUA 5J5VA 1CUXA 3RHZA 3DC7A 2R6CA 2O4CA 1HYHA 2WMYA 3AL2A 4LJ5A 2QYTA 2HJSA 4BNVA 5IT5A 4Q4JB 3G0DA 1QPGA 4EVIA 5BUQA 1O4VA 1YR2A 2X13A 2Q5IA 2AF4C 1Z0DA 5IAKA 2ZJ1A 1LS6A 1E92A 3F96A 3LLUA 3NJ4A 3BIXA 2HRQA 3LQYA 3R5TA 1U8UA 3LBYA 4FW9A 4KLZA 3IO5A 3OZTA 4TRJA 5F1YA 4ESOA 3MBKA 1E5TA 4HUTA 2H1RA 2HWUA 3O21A 5FX2A 1FK8A 4GOKA 4XUCA 4URHA 2RD2A 3THOA 4DCJA 4HEQA 3ZHBA 4I1IA 4AG3A 2BFMA 1UIMA 4KQ9A 4PRZA 2P9CA 2V3WA 4GMHA 2XIJA 4TV9B 4Y30A 1LSOA 4UW9A 5JAQA 2GM4A 4LXTA 4I5DA 1IULA 4IV5A 1KPHA 2MYPA 3K92A 4II2A 3ONWA 4DYDA 1K66A 1U9IA 3C6YA 2GSDA 4A23A 3U09A 4KNYA 4A36A 3ZHCA 4TTTS 3FTPA 2R44A 4HQFA 1ZITA 3G1WA 1DOZA 5A7HA 1AGRA 4LKRA 4OHPA 4RSRA 3P52A 4XW2A 3UAGA 3ZD9A 1GRNA 4X9XA 4R1OA 1J2RA 2JLSA 1T4DA 4DIOA 1T1JA 1JFLA 1HNNA 2JI8A 3UAVA 1AE1A 4DMFA 1K7EB 2VSNA 4P2BA 2DTEA 3JD2A 1PIWA 2RJOA 1MB3A 3ENZA 1GGHA 5HM6A 2HA0A 2WD7A 1J09A 2WINI 3IR7A 4KCGA 3C5VA 4S24A 1B1CA 5ALKA 2Z43A 4ZT7A 4MCHA 4RANA 4RSMA 5LZ5A 2BJHA 3RC1A 4RZHA 1KO5A 5FOUA 3U4DA 1K7CA 1P2SA 1D09A 4AWAA 1MFPA 3EULA 4RD0A 3WGJA 2X0RA 2BP7B 1ODKA 2I7XA 5FWAA 1VPVA 3AEYA 1BFDA 2R8PA 4OJYA 1JHUA 3OO1A 1C7QA 1MN6A 2W37A 3QA3E 5FQOA 4OM7A 2VUUA 3E0QA 3T5TA 2BC9A 4KXWA 3STYA 1Y4UA 1WABA 2Z95A 5C5DA 1ZWKA 1YULA 1ZOPA 2P62A 5ESDA 3W8EA 1BRTA 3F67A 2Z09A 3OJFA 4RGYA 3T0IA 2JGKA 4ARVA 4R5HA 5AW5A 2R8OA 4FHEA 5J5AA 4UULA 5JZMA 3OOYA 1GGMA 2HF8A 3Q41A 3WLNA 5TJ9A 3EFEA 3UKDA 2FXVA 4AVYA 3OTQA 1OR8A 4KDEA 4EKIA 3DUWA 5KSOA 1A69A 2X58A 3AP1A 5CW1A 3VH1A 4M2LA 1WZIA 3QNMA 1K6JA 3R75A 1DG1G 5FHQA 5CA0B 3LNCA 1BA2A 2QTHA 4UMEA 3FRHA 4RELA 4AJ1A 3EGVA 2XUFA 1BJTA 1V3VA 2GN8A 2I7VA 3DPSA 1JBEA 4OX9Y 3TYXA 3HM9A 2IE0A 5AW9A 2Z2YA 4QXRA 3IB3A 4X54A 1Z45A 1I3MA 1MAVA 3HFGA 5J59A 4C1NA 1Z47A 1Y3CE 3HCCA 4JJEA 3QE0A 4EUHA 3KSBC 2QVLA 1R12A 3Q98A 2VHCA 2AZXA 2H2HA 1NW3A 3LKVA 4IGFA 2QENA 2Z4SA 1U2TA 2RMKA 4Q37A 4AS1A 2WBLC 1I51A 2P78A 4WRRA 2JFHA 2QW0X 2VAVA 2NTEA 2AOUA 4QSHA 4Q1BA 5DYGA 5T64A 3U3MA 5DNYB 2ODWA 2Z4TA 1L7PA 4ZDIA 2ZR0A 3ST7A 1U0OC 1QTRA 2G1JA 4JA0A 5AO9A 3MD9A 3G5LA 4ZGWA 4L1KA 1E1RA 4NFYA 3O4FA 3BEDA 4JWKA 5DGXA 3ZLUA 2RGWA 2D0DA 3H1TA 4H4DA 3QENA 2HK8A 2VK4A 1N0VC 1KNXA 2PZKA 2CFRA 3H3XA 3HDHA 3CJRA 3W6PA 1WX1A 4M1OA 2E5FA 3G79A 5D1NA 3IALA 5DYYA 1PSWA 1NYLA 1AHHA 1D07A 1R37A 3C3DA 4ND4A 5F51A 4FJ1A 3ZU2A 5E4JA 2QSZA 3P5SA 2JIZD 4JQSA 2G9VA 4P4GA 5FBRB 4XGNA 3SBXA 3TINA 1WCIB 4K6OA 4DILA 2IZ6A 2R4UA 3F2VA 3TZKA 4UTNA 4YDRA 1V2GA 4IYRA 3FUUA 2Z8YM 4YRCA 1QE3A 1DWQA 3HYSA 1UXKA 3QLVC 4GOOD 1Q0LA 5CUQA 2ZE8A 2FLKA 2D6FA 4FLFA 2WU8A 1J2TA 1RU3A 5BN4B 4QM6A 4XIYA 2P8SA 1O8CA 3THSA 2WD9A 3BMQA 5DP2A 4A5SA 2VLIA 4RDHA 3ZI0A 3K6SB 1OD6A 1JKXA 2D06A 1NBMA 4YAEA 4J2HA 4L28A 1ZH8A 1IONA 1KOJA 2JBWA 3DHVA 3LE8A 3MRSA 4JVNA 4Y9UA 2A5DA 1EGVB 1O08A 1YZTA 1JTEA 1C9EA 2YINC 3PNLA 3PWSA 5T7BA 3MXTA 5AJXA 3ZE6A 4W5RA 2EIXA 3K9FC 1OKKD 5EIWA 3ZOKA 1G2IA 2A1TS 2FZGA 2G9UA 2J5KA 2QD5A 3BYZA 4Z6KA 4AWBA 4ARZA 2HCFA 1WV1A 4D4MA 3TJRA 1HM5A 1TZBA 1U11A 1U1CA 3CEHA 2ZJ4A 1DXYA 5DJ5A 5KYUA 3ZVNA 4PEVA 4S05A 5JXHA 2EL9A 2A5YB 6YASA 5IYZA 3B5JA 5KVVA 2XRMA 3PXBA 1D04A 1E5VA 1U2EA 1R4MB 1T0UA 1OYOA 2NZJA 1G7RA 3BJMA 5H83A 1EXNA 3MTJA 1DJLA 3HK2A 1K2VN 3AKDA 4JBHA 5U4QA 1X7XB 3MOSA 3R3VA 4HP8A 3VDNB 3VV3A 4U8HA 4WXHA 2QF7A 3RF7A 3ZY4A 4ACAA 3CVUA 2AFIE 2RGXA 1GKLA 4RK6A 1ETUA 1E9CA 4F6CA 3UW1A 2GZAA 1PR9A 2PQ0A 1SUPA 1A4IA 3H0EA 3MJVA 3O5AA 4HN4B 4I4CA 4PG8A 5EVCA 2PD4A 3NC1C 4F1KA 1G4AE 1LDNA 3V8EA 3WBBA 3ZDAA 5I7RA 3U9SA 4H6VA 2QPLA 1I24A 3O8OA 4INOA 1RFLA 4KE6A 1Z06A 1TJYA 1DC5A 3L6DA 5K3SA 1BJKA 1UFQA 2GYYA 5SYNA 3WISA 3WL4A 4EG4A 2NZYA 2QX7A 1XZFA 3DHWC 3WO1A 5DLYA 2XKKA 2CZQA 1WKCA 3ETCA 1R16A 1CRZA 2BW0A 1NLYA 1FQOA 1O6GA 3GCGA 4CM8A 1RM3A 4CTMA 5LD2B 5I45A 1XD2B 4LAFA 4X92A 2JK0A 2XB8A 1XVTA 4BWYA 2CHUA 4MHOA 2Y1EA 1F48A 5E7IA 2BDEA 5FWYB 1P17A 1M2FA 4JLKA 1NVDA 1W88A 3RS9A 3QWHA 1U9YA 5EI5A 4ISBA 1RTKA 1RQLA 2WHQA 3VNVA 3CFYA 5AXAA 3K0FA 2O0KA 4BFCA 3WSVA 5JVDB 3EQ9A 4B43A 1DBQA 1JLMA 5IZCA 2NQ2C 1UZUA 2EFJA 3EW7A 4GLOA 2Z5VA 1IHYA 1V3UA 1OT5A 3B8EA 1YR6A 1EFKA 4XSGA 5ECDA 4AAYA 2ZZNA 1GKKA 1FTWA 3WGHA 5CNMA 2CL6X 5C8ZA 3S40A 4OM8A 5CVCA 4XVCA 2GASA 2D5IA 3QKTA 4KREA 5DYTA 1IAVA 2I8AA 3DCYA 3K09A 4AZ3B 1XC7A 4F93B 3NLLA 3VX3A 3GOQA 3UHOA 1KEEB 4Q7LA 1GU1A 4UOZA 1CD5A 2WM9B 4NY1A 5KHLB 5KOJB 2XECA 3R8CA 1DDGA 3JD3A 1ID1A 4X1IA 2ERCA 3K5HA 1T0IA 5LMZA 1UP6A 1YJBA 1PVOA 4L0MA 4C6RA 4HWOA 4PO1A 3ISVA 5BYAA 2F62A 3BSSA 1RLTA 3CVYA 4OD0A 3CKKA 1ISGA 4YALA 1JEEA 3DNMA 3WKAA 3M0EA 2DUMA 3DAYA 1GDDA 5DBFA 3OLCX 4J7UA 4QYMA 4ALJA 5FPHA 4MQMA 1YZ3A 4XCVA 1WXEA 3MFQA 3M9XA 2ORED 1NVWQ 3HRKA 2IHUA 1Q0ZA 3KHKA 3I01M 2ZJ3A 3AC0A 4KQHA 3QY9A 1SIUA 4TM8A 4BECA 4TL9A 4PLYA 2SNIE 4E2XA 5IJWA 2P0YA 2WMOB 3ORHA 4C21A 4Q0MA 3GCDA 4ZIRB 3E1KA 1II9A 2ZE6A 3GR6A 1UBJS 5IFKA 1DIGA 3T4UA 1RM5A 4I1YA 2H1WA 3E2MA 4KG7A 5E0OA 4RKQA 2YFKA 2GD1O 2NQTA 1AQJA 3AI7A 2PX4A 4FHDA 4G4GA 2R96A 3GFOA 1VBKA 3FM9A 4ALMA 2F17A 4L72A 3NP9A 3FZYA 4YP6A 1JG4A 1ZKMA 1AOXA 4C7KA 2WMDA 1G8AA 3MC1A 4AF8A 3MJHA 3IXLA 2EFCB 2BJVA 2VI5A 1EI9A 3IP3A 4I1OA 4BP3A 3SZLA 1UKEA 2BGIA 1G6HA 1BMFD 1JXMA 5ICMA 1QRAA 1T6XA 3PFGA 4BX0A 5B2FA 5F2OA 3WJ1A 4DNXA 1AMOA 1ULSA 2Y8EA 2ZJOA 1E6WA 1WM1A 4WN9B 2MHCA 3DMTC 5TVGA 1SN7A 1VHJA 2DFNA 2EF1A 3SS7X 1QFYA 1TQ8A 4JJGA 5B30A 2YCLA 5BSKA 4J0DA 1ECFA 4JUAA 4WESA 4D9HA 3I53A 1C7EA 4DTCA 1CZNA 1F6WA 2NP7A 1THZA 1BNCA 3HXKA 2QL7A 4MVCA 4KWIA 1N9ZA 2BSAA 3BHJA 3G5TA 5ALHA 1I1QB 4KXUA 4F60A 2CXRA 4RMNA 2DUNA 2G71A 1NL3A 4CMEA 3O8OB 1SXQA 1GZSA 1LSSA 1E2HA 5B58T 4FS3A 4I0WB 4IVQA 5LYJF 1RHUA 3NVKI 4V39A 3DE0X 3A28A 4G24A 4Q3BA 2WHPA 1DXQA 2D74A 3BXFA 4LMPA 3FVRA 5TQ0A 2RH9B 1L5GB 3ZE0B 2WPNA 1JSXA 5KOHA 2QQ0A 2DFKB 2WHYA 4NU8X 1GVNB 3WGOA 1WSDA 4QKQA 3TCXB 1QONA 3A0RB 4JEMA 4MVYA 1UZAA 2LDBA 3QEOA 4HI0E 5DLEA 4BJ6A 1NQAO 1AUPA 1Y5LA 2GCNA 1JECA 2D1TA 1I6KA 2G5GX 2WUDA 4UCWA 4KE7A 4WSOA 4DUZB 4MKHA 1P5ZB 2ZXFA 3L7LA 1DT3A 2YC2C 4AD8A 4GPIB 2LCIA 5JARA 3GDHA 4FFBB 2VUIB 3M81A 4GL2A 4IV0A 2JB9A 2ZAMA 4R9NA 2JFVA 4GMXA 5TRTA 1GNLA 3B51X 5EJAA 5L4SA 1A71A 2WHRA 3AMVA 1DRJA 3MS4A 1SBTA 4ZC8A 3BJZA 5KYXB 4F5DA 3G3EA 3QA9A 1A5AB 2Q27A 2V97A 2DCMA 1LBSA 1CQXA 1V9SA 2C9DA 2JLRA 1E2IA 3A9CA 3OIWA 4OJQA 2J9GA 4P86A 2WB4A 5EIAA 5ITSA 3BT7A 2B1JA 5HCUA 1ZJYA 4W1QA 5CCDA 3R9XB 1F8XA 2G09A 2H7VA 2I1QA 2VJKA 4ARUA 1B23P 3OPMA 4AIIA 4DLBA 1N2JA 4WXMA 1EFHA 1K8RA 1O4WA 4NZNA 3S2YA 5D1HA 1DAKA 2YDYA 4HDNA 3SE0A 4K9LA 2CYAA 3KP1A 3NXKA 2WD8A 2Q5LA 3PDJA 4LF8B 2NACA 4CM7A 2PPVA 4P5PA 1DSSG 1DDIA 3PPXA 1Z3IX 3G8BA 4Q66C 4Q1CA 4R6XA 2EW8A 2E4AA 3ANMA 3DBHA 3DTVD 4S35A 2AF3C 3HV0A 4NYMQ 4YBZA 4FDTA 1U3CA 2B6HA 3R0VA 4DNOA 1A96A 2RGCA 3NVDA 3NDJA 2HYDA 4OKNA 1V9LA 3LXUX 3OT1B 3WLRA 3GLFA 3G2KA 4DLWA 4MZDA 4UAGA 2DXIA 5C1OA 3CUWA 2ZB7A 4DLVA 1FRFS 3NQ41 1ZS9A 3VR2A 3HU1A 3PHLA 2BM8A 2WT4A 2CMHA 3HN7A 1D1SA 4BJ5A 2AN1A 3L8GA 1P4SA 2QVGA 3ZE2B 1EWYA 1H6AA 1BDMA 1XWFA 5FWNA 2H57A 2WYUA 1IN1A 5KJ6A 1NR5A 1TZKA 1IOWA 2ZRBA 3H1GA 4DGSA 1JR3D 4HAUA 3FDXA 1Q1NA 3KL4A 1JIVA 1VHWA 3LX6A 4A82A 1NJSA 2QYSA 3Q87B 4B46A 3RI3A 4B3FX 4BCDA 5L95A 1C2TA 4JODA 1BKYA 3EWSA 1FTYA 2ZJ0A 2IS1A 4OH7A 4HNVA 2IQIA 4JDPA 4AYWA 4RO0A 2VCEA 1VI6A 1J8YF 4IH4A 2CE7A 2FQ1A 3EH1A 3PUKA 4HDKA 2O6HA 1BO6A 3JZFA 2CFCA 2GBPA 2IU4A 4ZQCB 1X1BA 2DFVA 3F6PA 4ZHQF 5JPCA 1QH1B 4F04A 2HWXA 3AJ9A 1T4BA 4XQ0A 3FWKA 5D01A 5K0TA 4IGKA 3RUCA 2FEAA 4TKVA 2C94A 4YTEA 1BEUB 1E6CA 1GNRA 4YH1A 3GLGE 3DO6A 5IBRA 3ZUPA 3TQHA 3O03A 1SD1A 4B34A 4XPIA 2G7ZA 2P3LA 2PXHA 3A4LA 3PSAA 4PLVA 3I9V1 1H6DA 1XVLA 1YA8A 2FG7C 5G2OA 1SHLA 4BMCA 1ZVMA 2O3QA 1ILWA 2JLXA 2C7GA 5BOSA 3K09C 2JHPA 2OYSA 1F0PA 1JWAB 5I9IA 2ROQA 4US1R 4WZBB 2EGUA 2D7DA 1HETA 1YQEA 4HFRA 2YJGA 4XARA 1EZ1A 5FPYA 2FX5A 5JD4A 5DI9A 1YR1A 3A4VA 1JDNA 3DZHA 1GPAA 3IBTA 4QQKA 2E4YA 5DBEX 2P27A 4OP2A 1Y9DA 2VNAA 1BQEA 3ZE7A 1CUBA 5A6SA 1H5NA 1I7LA 3KTOA 3OTGA 3ZH9B 5JSZB 3IDAA 2WWGA 1WA5A 5KU7A 1V48A 3BK7A 4CT5A 2Q4TA 1T5DX 2P67A 3KV1A 1NQUA 1SY7A 4NL4H 2IEBA 4OBBA 4O4LB 1UKAA 3SAJA 3PYMA 3LA6A 1M2EA 3A1SA 3CHYA 5EIOA 4FOOA 1BCRB 4J16C 5FI1B 2QRZA 3DDSA 4L07A 3U7FB 4QAJA 1SB9A 1ODSA 3LLMA 1NT4A 4A6XA 1Y98A 1ZP6A 2VHEA 2W2TA 3T9AA 4D46A 4AUMA 3FBWA 4MWDA 3X2SA 3ZWOA 3TLGA 3ZI4A 1XLWA 3A9TA 2K2WA 2FF5A 3BD8A 1H9BA 5L7TA 4RTKA 3NIBA 3IIMA 1CRLA 5HQ3A 3MGKA 3ZBPA 3MBOA 4IF4A 5HKKD 3H3FA 4JXZA 2O8NA 4BN5A 1GQ2A 1C7JA 4IJMA 2QJFA 1WOYA 2WYVA 3W7BA 1VJTA 3PQ3A 1LLFA 1JLSA 4OQFA 5IH7A 4FD3A 2OHVA 1KSJA 1P2UA 4NCNA 1GZ7A 5AW2A 2O2JA 3HY3A 3FYSA 3U4QA 2GBFA 3NOXA 1N2CA 1ZD9A 2N42A 1TKAA 2HJHA 3SEFA 3V8RA 4DDVA 2EQBA 3GDFA 3T3MB 3WK5A 2XSZA 4PXYA 3OD5A 4MRPA 1JA1A 4E5MA 4PNEA 4OFBA 4UKDA 1IXRC 3N6XA 2OZEA 4KIWA 1E0SA 1NHGA 3VGJA 5TJHA 4EGFA 4WN9A 4JVSB 5H3HA 4GZLA 4KRXA 5E2BA 1UBCA 4EFDA 1X38A 5DEIA 4A0FA 1UBHS 3O8BA 2A0WA 4HNTA 5CLFA 5A5GA 2O8FB 2H92A 1GTSA 4WWHA 1VGRA 2MR6A 4RV9A 3A4NA 4GPZA 2FZWA 2IPMA 2CJFA 3BH6A 3CVWA 3GFQA 1BIFA 4K28A 3T7DA 5CBPA 2F67A 3U44B 3QBTA 1JEYB 5KX5A 3WDSA 1UXGA 1U90A 2G80A 2JPDA 5D5PA 4RGQA 1KS9A 3RVOA 2JDIA 1MIOA 4DMMA 5KPJA 1OX4A 1UK9A 3I23A 4DV7B 4LRUA 4AMBA 3BH7A 2O2CA 3RIGA 1JZTA 4W5JA 2DJ5A 4IS3A 4N3GA 5EKDA 5KYWB 1IUPA 1V71A 2Y2VA 1W29A 5EXPA 1Y1KE 3PQ7A 2Z1MA 1Q19A 5AOVA 4ZCSA 4ID9A 3GW8A 3O93A 4A8HA 1MRZA 1U9CA 4AF6A 2H2AA 4FD2A 4E51A 4NI5A 4C88A 3NHYA 1P7WA 4PGGA 3NDIA 3I3SR 3FLBA 4G0PA 2JGJA 3QLTA 4MLDA 2YHUA 1E1DA 5CX1B 2MIIA 2RH4A 2XOXA 2OUKA 1Z62A 1FXWF 1XCBA 3IP6A 1H8ED 2O06A 1JLHA 1IM2A 4KLRA 2J32A 1CR1A 3VNSA 1PGNA 1BS9A 1X1TA 3VZRA 2GTHA 3HDVA 3IOCA 4JVMA 4PHHA 3I37X 4RU1A 4MGYR 4L9RA 4UTZA 4J7AA 2QTZA 5BORA 3AEUA 2HCTA 3NBQA 4NE7A 1WQ1R 4Q6WA 1D1PA 1WDTA 5DM4A 3WKDA 5MGNA 2PUAA 3KZOA 1XWWA 1ZH0A 2CNKA 4XYLA 2FW9A 1WCV1 2D62A 1Q74A 2CXSA 2I99A 2IDJA 3MRVA 3NTVA 4GL4A 4XRRA 3GLGA 1RQ7A 2EQAA 2KB0A 3A3NA 3PB3A 3NHUA 3DF9A 3DVQX 1GKUB 3QUTA 4WZZA 3PT5A 4Y2GA 3CV3A 3NGLA 5GJCA 3U13A 3WLEA 3RAGA 5BSGA 5HK8A 2B83A 4Q5IA 4EL5A 1NOJA 4IILA 4ZI7A 2Q1XA 1QSGA 3GPCA 3IC5A 2RAUA 5J9FA 3O2NA 5JNLA 5LOVB 4A91A 3GXBA 1RQ2A 4RZUA 1YZQA 4F4UA 4P38A 2GZRA 2J46A 4XWAA 4F3CA 3MINA 2Z9BA 1OBHA 1Z73A 5ADVA 4FQ7A 3KUXA 3ILYA 1ARZA 1QLWA 3SBEA 1NZFA 2I67A 3ZV3A 4IHQA 2Y1LA 3MTQA 5D7BA 4IIJB 2RGYA 2DB3A 2TMKA 1IAQA 2R1TB 2RAPA 1ZQ9A 3G0BA 1WCYA 3B1KA 4I5IA 4EW2A 3QEAZ 4MTLA 4XPZA 2W9XA 2O8BB 1OROA 4HGPA 3IUBA 3H9UA 1FL9A 4EMSA 1S9DA 3AXSA 1JU9A 2QT0A 5CT4A 1APBA 3VHXA 2ZYSA 4HQOA 1DGQA 2C5AA 2WQZA 1P1JA 1U6IA 1G5HA 1NHWA 5HS4A 3CF0A 4CN8A 2B5WA 3IJEB 3FR7A 2V8OA 1MAAA 5DX0A 1KTVA 4A10A 2C9CA 1UIRA 3DD5A 1TGVA 1X1DA 4QVKA 4AQ7A 4HQNA 1NSYA 3AVYA 2FEPA 1CFJA 4YREA 4D3DA 2O0LA 1BAPA 4JUFA 4RV5A 1E59A 4HJRA 5CVJA 1NRIA 2OO3A 2FUKA 5T4BA 4BVJA 4OOFA 3IAEA 1KI9A 1KYQA 2JLCA 5ERXA 2VPTA 3DCNA 1Q0TA 2D5BA 5JECA 4YPOA 2KQUA 4LK2A 4X7PA 1EBFA 5CDSA 2FGKA 2WG1A 1IZ7A 1CDOA 3H5LA 3WB9A 4EAQA 2IVFA 2PL3A 4PYRA 3SC2B 1DX4A 2BGUA 5J4LA 2HDOA 4Z7NB 5KVSA 2JGDB 3C7TA 1T3HA 2QL5A 2X4GA 3EVAA 4JHLA 1JHAA 2X9VA 4RMHA 4U7JA 3HZRA 1VJDA 4GGMX 5G4KA 4IS2A 3RSQA 2WLSA 2DUJA 1EXWA 3BTVA 1OGYA 4HN2A 2Z4RA 3CUUA 1B6TA 2FR8C 4H18A 3BREA 3D3KA 4X61A 2ZJ5A 3CPSA 1A5TA 4REQB 1J0DA 1Y9AA 3JYPA 4GHWA 4E4YA 3VAYA 4TZTA 1CFZA 3KQQA 3PK0A 1Y82A 3CN9A 1ESZA 1BD4A 3EVTA 4KXYA 1P5FA 3DBRA 2V54A 1E5XA 4S1TA 4MLPA 5K8IA 4TZ6A 4OHBA 3CWQA 4LJ7A 4TMYA 3RKSA 1YRQA 1UPBA 2PGOA 4ZVRA 2ZSUA 4I1RA 5T3UA 4DCMA 1E96A 4WNAA 4EB8A 5JDIC 1UXHA 2FP4A 2WEKA 3FFAA 4N49A 2Q7OE 4U9UA 4CDMA 1D03A 4RY0A 3WDMA 5CA1F 3CO0S 4ZI5A 3ZV6A 2QEQA 5JRDS 2YUTA 1D4OA 1ML3A 3SQMA 3HBFA 1AQIA 1HQCA 4B3IA 4J0EA 1NQOA 2WF9A 4MVJP 3IRVA 1TK3A 2JLAA 4PO9A 4MRMB 5F5NA 4RD2A 4DC1A 3LYLA 1NW6A 3IS3A 3LPLA 3IR5A 2DEUA 1EA7A 4ZPJA 4KR3A 1KORA 3KXIA 1GYPA 4TLDA 4OLHA 2BE9A 4O4HF 2IUUA 3OX1A 2X0NA 3U4GA 2PO7A 3TPZA 5L9AA 5E1MA 2QLMA 5KJ1A 1WG8A 3QMVA 1LLUA 4NARA 3IR6A 2QTAA 1TTTA 2PGXA 2I6UA 2VJNA 4KLNA 2GZSA 3LHFA 2RBKA 3O3CA 2X5KO 4FQ8A 2PYIA 3K35A 3P0RA 4M8IA 5DLPA 2C7QA 1MT0A 3VMMA 3A04A 3VR6A 3D64A 4PSVA 1GPLA 4PYKA 4DMRA 2V7PA 1W5SA 1IVYA 3DO8A 4WOBA 2J48A 3CINA 4B6GA 1SJ9A 1RNLA 2GF2A 4A2PA 4W8OA 3S2IA 3KQWA 1CE8B 3D8SA 3M6IA 4LDQA 5FOSA 4C4SA 3GPDG 4FB5A 2OMKA 3KJGA 1X1AA 2RK6A 2GVZC 5CTJA 2ZKLA 2JAHA 2QNIA 1QM5A 5TE9A 2CUZA 4K2AA 3S99A 2FFAA 1EVKA 4Z0TA 2CXNA 1RMTA 3BFJA 2PV0A 5AKHA 4XIJA 1FEZA 4U1RA 3AHHA 4DV5B 1KZGB 2GN9A 2BH2A 1OAOA 3R09A 1XNRB 3B9PA 3SGLA 3I5XA 5AK0A 2FRVA 4EPTA 1NUPA 2W58A 1Y8RA 4RF2A 3BDAA 4MQEB 3FYUB 2A30A 2B94A 4NK4A 4URUR 4MUNA 4DY4A 2NU7B 4LISA 1GG9A 2R2GA 3A6FA 2ZDGA 1ZRNA 3EQ6A 5E7JA 5EKXA 5CDHA 4FDLA 1QH8B 5D2CA 1DAEA 1ZVKA 1GN8A 3CLUC 3EQ7A 1MP0A 1P45A 3H9QA 1JIQA 4X90A 1V1MA 5BWOA 5B6IA 2NU9A 4KN8A 4IIDA 4ZAVA 3SKXA 3LQRA 3FY4A 3TRFA 4KK3A 4E31A 3SP1A 1GRVA 4ZQBA 1A88A 1YRBA 2K6GA 5JXJA 3P0JA 3A6KA 4R1MA 5F21A 1ORHA 4KPFC 1WIWA 5HJ5A 3CGWA 4JJ7A 3WGVA 5EP2A 1IUNA 2IHYA 2ATVA 3ONEA 3L18A 2JHAA 2Q41A 3OZCA 4AG5A 4F4JA 5THQA 3DAFA 4A0QA 5L4NA 2BFEB 3WLQA 1C1XA 1L1QA 1QORA 1O94D 1W46A 2PWYA 4H9GA 3PC7A 4QGSA 1AS2A 4JUDX 5DF1A 2QMHA 3THRA 5BYBA 4BGDA 1K2WA 1VIMA 3AVVA 1RTTA 3OE7D 4ISCA 5FXMA 4EF6A 2CXPA 5CEEA 3CTMA 3CCCA 4RYDA 3HR7A 1BZYA 1EBUA 4UVDA 1E6EA 4J3NA 3GRVA 1VMKA 2O2EA 2X8JB 5C32A 5D6OA 5I7WA 1R9JA 2NN3C 3NDBB 2XW6A 5EGSA 2K87A 2VYQA 4EJFA 4Q9IA 4YAFA 4ETMA 1RWVA 1R5OA 1SWWA 5FTJA 3ZDQA 1NYRA 3WGMA 4QXPA 4C4RA 2DZDA 2DUUA 4Y6RA 5LA6F 2G4LA 4UHJA 1KR2A 1RCTE 3F7MA 4Y9RA 3U3OA 3AEQA 2N9UA 4E6PA 3U6BA 3AR2A 4YJGB 2QMEA 5FNVF 3T7CA 1Y9EA 3ETNA 2QAGB 4R54A 1BD3A 2TS1A 2JFXA 1I3NA 4BFVA 1T2CA 1V45E 1WHSB 3TEJA 2PA3A 4DLZA 2RHRA 3GGOA 3P0FA 1J8MF 4MKGA 2PKCA 4P3YA 2CJYA 2ID9A 4F6LA 1MUUA 3CVVA 4MP6A 3LAWA 1OPRA 4KMMA 2QP3A 2UYGA 1W4AA 3T34A 1QMGA 1CG6A 1F7UA 4KQEA 3S5JA 3D0OA 2NAPA 1X7WB 4RY2A 3HLYA 2E55A 1UWCA 3A2NA 4GX0A 2JNWA 4BYMA 5BXYA 1B8UA 1E98A 3DBOB 4ZQFA 5G0UA 4BMZA 1XDBA 3AUYA 4BDSA 2RC5A 3QMWA 2Z9CA 1AXRA 1CVLA 3X0DA 2O6LA 4N12A 3GLFE 5EHNA 1R1DA 1SAYA 4Q6BA 4IZIA 1UWVA 3BJRA 1MV8A 3I0MA 3JAWB 2FVYA 3RSSA 5CAEA 5ICEA 1TD9A 1DQNA 3DTVA 3BMNA 5HBRA 3UAYA 4IOLA 3WB0A 2YTZA 2ZRAA 2OCLA 1JHZA 1XLUA 4J8PA 4XKJA 1EUDB 1IXYA 2WIGA 4R5MA 3CSSA 3BB3A 3GLUA 3NBXX 4D9EA 5L3SA 4RVFA 5AI5A 2MR5A 3TBKA 1U3WA 1ZW6A 2A57A 2JEYA 3CLRC 2H85A 4UZSA 3ZHYA 3OO0A 1K0FA 1OV6A 2BI8A 2VAPA 2FYTA 4NMLA 5DRYA 2E5WA 3O1LA 3CF2A 4OLAA 5FBWB 2QUJA 3FPJA 3P9IA 3KYCA 4ASUA 2QJTA 3KWFA 1GU7A 1OFIA 3A9VA 1BU8A 1XAHA 4D5EA 2P9GA 3IX7A 2FUCA 3MWYW 4Q15A 1YHNA 2R8ZA 3EJWA 5EUMA 4HFNA 2ACEA 5SY6A 4ID3A 1RAAA 3A1CA 4MVJM 3RRZA 4DRZA 2O1SA 4HQKA 3GMSA 1ZY2A 2VL7A 2CNWD 2YFHA 4RA9A 2H48A 3VOAA 5JATA 4WBNF 3RYFB 3HL0A 3B12A 4FBLA 3R3JA 4IDHA 2OAQ1 4JR2A 2J59A 3E70C 1DKNA 2I33A 4KQ1A 5TSDA 1R0KA 2H11A 4LHYA 4Y2UA 1M6YA 1FXWA 1GR1A 1QGDA 4Y1FA 1WKVA 2EP5A 1OFTA 2OHGA 3B89A 4D97A 1E7YA 4NZZA 1A9PA 1XNJA 3EPRA 1O94C 2WRZA 2JHFA 5CM2Z 3L4JA 2IS6A 2MCFA 1SVMA 2H4JA 3EPPA 4WXEA 3GNSA 1MH9A 3V8PA 3VU9B 4I14A 2V03A 3EXHB 3AUJB 5YASA 2ZI4A 1M8JA 1WMDA 3DULA 1O95A 1LY1A 3RBAA 1WP4A 3RBZA 1EX1A 4DV1B 3U4HA 3EXAA 1UZNA 4EHIA 3ZS9A 3HU3A 5CH5A 4J1SA 1RYNA 2CDAA 3KJQA 4KSYA 4DANA 5KOJA 4V0QA 3OKAA 3UK2A 2VTBA 6LDHA 1EUCB 4ZO9A 4HPWA 1RIFA 1DQPA 3IAFA 4CEJB 2NTNA 4M6WB 2QRUA 2GPAA 1EXDA 3V7WA 1GO2A 2A9RA 4PSCA 1LX7A 3MINB 2PRJA 3UXHA 4B3DA 4BLSA 1M8GA 5KYXA 3FVWA 1U81A 1RIIA 3QVMA 1NFQA 4Y2YA 2X5JO 2XZTA 5ELMA 4QLOA 4IMRA 4EEXA 4L8FA 3QPUA 1XRNA 3C3YA 2JH9A 1PFUA 3QTLA 5GONB 4B79A 3PXEA 4BNZA 4NBSA 4G1CA 1D2NA 3S28A 1L4FA 1BVHA 4UPVA 2VJMA 1MQSA 2FP3A 3K94A 2E5LB 4MR7B 3IIIA 4UJ5A 3ZGYA 2CV2A 1ZOLA 1VJGA 2XGGA 2VJMB 3CY6A 4RJLA 1MR3F 5EY5B 2OD7A 3ZDEA 3VYWA 5AM3A 4OXKA 5JNTA 3W6NA 1U3GA 4B4DA 1NRXA 5KNBH 5J1SB 3DW3X 4TXMA 4LXQA 3V4ZA 3WADA 3H2GA 2RK3A 5FTLA 1SOMA 3FUXA 4TV8F 3H5IA 1RXCA 4IKEA 4X8MA 4JX9A 3DJFA 4TWZA 2QHXA 4KAJA 5TGTA 4I4IA 2VEDA 2C20A 9LDBA 1VHLA 5GZ3A 3KT0A 1EK5A 2B35A 3CQ9A 4G5FA 5AP9A 1LQ2A 5AUQA 5FEUA 5EQDA 1MBZA 2O2YA 2CXXA 3RKRA 3HCPA 2J3IA 3DMFA 1TCAA 1GVHA 1R0CA 2WA2A 1F51E 3RRJA 1O95D 3UENA 4JV5B 4GBMA 4F9TA 2YX1A 3HYNA 1PF7E 2I22A 4P1ZA 4KE8A 4P0TA 1NIPA 3PE4A 4ZTZB 5BR8B 4X45A 3KD3A 3G8DA 2N3ZA 2NO7A 2EU8A 3H4TA 4KR9A 2OMEA 3UKJA 2CMGA 3CEPB 4TXNA 1ZNZA 3AFGA 3MLEA 1N1MA 1JDPA 4TTAA 4BE7B 2ISCA 5BWBA 1Z18A 2O54A 2C2XA 3DFZA 4Y2HA 3S5UA 1R4ZA 3LC7O 1KMCA 3PNYA 3GHYA 3IQHX 4JASB 1YR9A 3EBLA 5J5CA 1MIOB 2R3SA 3K9NA 3NAGA 1MJFA 2FZVA 3OKCA 3DL2A 3G8YA 2G5TA 4PTZA 1YFZA 1G55A 3GEHA 3HCFA 1W85A 3WLIA 2HLDD 1SOUA 1DINA 1HURA 3IDQA 3BIOA 1KDZA 1SWVA 1W75A 3INTA 2DQZA 4OHFA 1C8BA 5MHTA 4TTPA 3ROEA 5TF4A 5F9FA 4CWAA 5K3OA 2Q3MA 5IJZA 1P6UA 4YCAA 1AB5A 2E37A 2HT6A 4MV5A 3U39A 4E12A 4FM9A 2YZGA 1MDBA 2VNKA 1ZUWA 2VUHB 3H0KA 1KHTA 4WTOA 4K8OA 1CNMA 4K0KB 4KVGA 1HDOA 1S2IA 3RS8A 1RD4A 2BM9A 5AYVA 3T3IA 1QHSA 3VDRA 2QMYA 3SEZA 1ACMA 1C7IA 2FZ5A 4TXHA 4EY6A 1D2MA 3EA4A 1HDCA 4FHCA 4MS1A 3UHAA 1WBBA 4Q48A 3EZ9A 2OBXA 3GRRA 4DG5A 4U6QA 2IU3A 3ROMA 1ZO8A 3MGGA 3USZA 1J1ZA 5C8YF 1XL1A 3ZW9A 7MHTA 4UHBA 1P7VA 4B7AA 1DBWA 4RIHA 1AZLA 1W0KD 2AJCA 2BMFA 1RS0A 4MW7A 4R6WA 2PKXA 3AIMA 4HVLA 4NCBA 3BFVA 4Q3AA 3NHBA 4JJ4A 5IXJA 3U1TA 1JJBA 1P0IA 2Z9DA 1O0BA 1KI7A 4WLVA 2AJBA 1W5EA 3C97A 4R4JA 3K70D 4K86A 4EQ6A 2W00A 4DC9A 5LQKA 4JI4B 3PNBA 4MGHA 3KD2A 1E5QA 4RL4A 4R2KA 1NAHA 5B1IA 4TV9A 1RPTA 3U40A 1N0IA 1WHTB 4MGKR 3SN6A 1FPQA 1XMSA 3F8TA 5DX1A 4BX3A 1XPUA 5EQFA 4J07A 4WFIA 4OFXA 4PV7A 2H7XA 5C18A 5LR6A 3DB2A 4D8XA 4KGVA 1OJ7A 2A9VA 3V97A 3LK6A 3AZOA 4MQLA 4DIBA 4YXWA 3SXUB 2WMNB 5K45A 4BV9A 4DIEA 1R6XA 5FJIA 1KGDA 3WIOA 3ZTWA 5KYUB 3D7NA 2YN0A 2GPNA 3UQYS 1C50A 5IBPA 3TD6A 4AJNA 4BQIA 5B3KA 2P4SA 2AOUB 3KQTA 3PFFA 4FOLA 2B99A 2BE7A 3EXG2 4WKOA 2ZP1A 1A3CA 1SR8A 1UC9A 3CUSA 4JFAA 3WICA 1FC0A 3KM0A 1FMTA 1WEHA 3AY6A 3GZNA 4BGIA 1KY2A 1HT0A 4UU7A 4LF4B 1IUOA 2ZSDA 3KIPA 4PGMA 3V8MA 4D9KA 2PCLA 3D4NA 2FAXA 2IYZA 2X5NA 3D5EA 3HA2A 4JOBA 4LCJA 1CERA 3GZTB 2IY8A 3ETJA 3IAS1 4QBGB 4D81A 1E8NA 2AH5A 5CVUA 3R7WB 2X19A 4LY9A 1F2TA 4XA8A 4RIGA 1LS1A 5I4BA 1K7YA 3SF0A 3QVKA 3O8RA 3MWEA 1NM5A 3WWYA 5HTOA 3VR4H 3ZIDA 4CFSA 1O96B 2XRZA 4UARA 5K0EA 3R9WA 3H2KA 3FZGA 3QTBA 2JFQA 2PV7A 3FB1A 4GI5A 4JITA 4IZ6A 4XLTA 3C41J 4S04A 1G21A 3TOCA 1ZM3A 1V11B 3QVXA 2R8RA 1JDBB 1L9XA 2QMUA 1ZK4A 5ALOA 1YDWA 4CHGA 4OQQA 5DXAA 4AY4A 1U2GA 2A4MA 2L2QA 4DTIA 2QTBA 3IAUA 3S6JA 2DQKA 4J4BA 5I6DA 4DVGA 3OT5A 3I2HA 3IOBA 1MNAA 3GD7A 1C9DB 1RZRA 5A5VA 2E2WA 4QLAA 5K0NA 2DT8A 1Z6PA 1LPOA 4E21A 1IM5A 3FWPA 5BQXA 1XF9A 5I9MA 1RACA 4IHAA 2VWHA 2EX4A 4ZOAA 3ULKA 1GEGA 1FXUA 2LR0A 3KS9A 2I34A 4U2GA 4YLYA 1WBJB 1IDN1 3C2QA 1MA0A 1YKGA 4L15A 1KIAA 4NG5A 5A3JA 3KYDB 2HO5A 4IXDA 4EJSB 4HNAB 2AJTA 1W4RA 3CM0A 1ODCA 1JG2A 3LIPA 1RZUA 4PPFA 4HXFB 5JDCA 1J90A 1TJPB 5DWQA 2TSYB 4GMFA 4FB4A 4ENQA 3G0HA 3S29A 4J9UE 1BQ3A 1IZ9A 2VA8A 2QRVB 5ER6A 5C52B 1R2QA 2HIMA 3G2LA 1WLYA 5CDFE 2QAIA 1COWD 1FNBA 4LWZA 5K1ZA 1X8JA 1YACA 1Q15A 1ZRSA 2PX3A 1JNXX 3LOPA 3DEHA 4G41A 4OCZA 2IRWA 4C7BA 3LZ6A 2FN3A 5DGIA 5C7YA 1E2GA 3E3OA 2OQIA 1Y7IA 4CIAA 1PZXA 5EXTA 5PNTA 4HTFB 4MV9A 4FNGA 5JI3E 1E1CA 4BASA 1NVKA 4AMYA 4D9MA 3OP4A 1K4YA 3QBJA 4PLTA 3BMCB 3ORQA 3COVA 4EPYA 1F2UB 4P3OA 5MGBA 1KO7A 1WL8A 3AI3A 5K2MA 1CJMA 1U8YA 4B6OA 1NNEA 4X94A 1I10A 1SU8A 2OPBA 3EXFA 4IM7A 5IKEA 3TAHA 2H1IA 1K8QA 2QW8A 4P92A 4LOLA 2ZR8A 3AOGA 1I1NA 4WZAB 4XYBA 3LDUA 3RREA 3UOWA 2Q5EA 2O8CB 2FVXA 4I36A 4RK7A 3W05A 3PYXA 1HA3A 1ZCAA 2O7NA 5H82A 5CG1A 3RRXA 3LFHA 4PCUA 1VPDA 1Y89A 1I2MA 3QP9A 4BLPA 2HUPA 3TRJA 1Z9BA 2QS9A 1JPUA 4PWZA 4XUEA 3AJ8A 1TCBA 3NOQA 2PMCA 4HUQA 2WHXA 5JNVA 5TMPA 3PJRA 5EESA 3WXBA 4YS6A 4ZDJA 1SNYA 1NVAA 1C3OA 4BE4A 2QTLA 1FLNA 4IZOA 1SUCA 3VSBA 3X1MA 5ED0A 2G72A 5E1OA 4NXMB 3B6JA 4BLRA 3EARA 5F7JA 1BCSB 2AW3A 2QUHA 3DNFA 1LTHR 3U0VA 4YUAA 2XMGA 1LW6E 1NQTA 3DONA 3LX8A 5I48A 1DKUA 4EEZA 3WRWA 1EP2B 1ZISA 2NXJA 3LZCA 3HUDA 2AQKA 4Q9KA 1TTQB 3WNBA 2M2IA 3HWSA 3L0CA 2AHOA 4KN5A 3WHKA 4IG9A 4MYTA 1LEHA 4X1YA 1DB3A 5CH8A 1H94A 3ABIA 2FN8A 3QH4A 1KMIY 4E70A 4Q34A 4BNUA 3I05A 1DFGA 2PUCA 1DKOA 3M4YA 3WYFA 1UDCA 5ELXA 5DLQC 4H7HA 3NYRA 4QOFA 3UVEA 3OZIA 4U4AA 3IUQA 3REFA 2QN6A 3M6XA 1KXZA 1J4AA 4EYQA 1U8EA 4OQEA 4Z49A 2YWCA 1STOA 1B6RA 1TB4A 2PVCA 3JARA 4Q1AA 4BL5A 4EHAA 3IRUA 1CW2B 1IHPA 2QXYA 1QZTA 2A6PA 3RQIA 1LRLA 1SZDA 3NR2A 3TOVA 1RE1A 3ZY3A 4DHEA 4WBSA 1ORWA 2VYCA 5BMVF 2Q4OA 2XMBA 1XLTA 3L06A 2O0MA 2MT9A 3SJCA 1SQSA 3GYBA 4IDBA 4IX1A 1USGA 4RWZA 3OE1A 4IIVA 3IMGA 1Z68A 3GH3A 3HL4A 5CVVA 1ZD5A 1C4KA 3NT5A 4OLFA 4W6QA 1USWA 2X4IA 4ZKDA 2XTNA 5AIBA 4C6HA 2G0AA 4OAQA 4W1RA 3PFBA 1TF5A 5DVZA 3RUIA 3TTWA 3ZXYA 1H4VB 1M2NA 3GBVA 4OREX 2XDQB 4KQXA 2UYOA 3W06A 1YZHA 2FFHA 3O7WA 5FLXA 4X3OA 3LT2A 2P9ZA 3GQVA 3HKEB 1ENZA 5HDQA 1V8BA 2PVPA 1U5CA 1JHRA 3KFXA 1LI4A 3LL7A 1VG1A 3PIIA 3QLJA 2JGLA 3SLRA 4ETIA 4W5WA 2HCJB 3PPYA 1WY5A 10MHA 4IJVA 3ANYB 2VJCA 1P6QA 4WA8A 4AKTA 2DLNA 4Y1RA 1FZTA 3MCTA 4TYMA 1OLXB 2Y6VA 2ZRPA 1GNPA 2MYTA 5KQRA 4XIFA 4ODIA 1UDAA 3BRWA 3SZGA 4N3BA 4HRXA 4HDAA 3WL8A 3PDIB 1JIJA 1LQTA 1CF2O 1OWNA 2DG2A 3E9QA 4GPEA 1ABFA 2UVPB 4ZCPA 2DERA 1G8YA 1GNVA 5AOCA 3E9EA 3SXUA 3Q9UA 1YOVA 4PPYA 5BV1A 2YXBA 3NASA 1PL8A 1GARA 4R98A 4V1CI 2BEVB 3HYTA 5CEJA 2B0JA 5DIZA 1N7IA 1LX6A 1LW7A 3U3XA 4E1VA 4OJMX 2B4RO 3R7FA 1J8QA 1GCAA 1K98A 2RKWA 3A6DA 3F4BA 3FDFA 4WNYA 5CBPB 3AEKB 3KQNA 5AH0A 1LSUA 4RD6A 1BMFA 4RNDB 3ZC3A 1SK8A 1VYVA 2AA3A 5HEKA 2EFYA 2Z08A 2J6CA 3M1LA 4EY7A 1DTEA 1FSGA 4O0LA 2G0NA 4CT0A 2NYUA 3GPBA 4WFKA 1WUHS 2HK9A 3GK3A 1ZI6A 1TYEB 4R3UC 4YAJA 2FW0A 5DN6D 1FUIA 4UTOA 4OATA 4EO9A 5DI3A 1L4NA 2CVFA 3EHDA 4HT3B 4HFMA 1IHDA 4PTLA 5B4VA 5F98A 4DUPA 1CUWA 4B85A 2IEYA 2XXJA 4L6AA 5LC1A 1N5RA 1OFHA 1KDYA 4BLUA 3RVRA 3EOBI 1ISIA 4U3JB 3T0GA 3K73O 3QVGA 4JROA 1DL5A 1QGZA 521PA 3WMEA 3RLIA 2YFYA 3QXCA 3RBXA 3PXCX 1IBLB 2VDUE 2ZQ5A 4K3VA 4EARA 2Y1XA 1JUDA 3AUAA 1TIPA 2PKQO 1X74A 3NPAA 1XEFA 4TV9F 2RCYA 2UZ3A 3WKEA 3FW1A 3COPA 4JYMA 1MO3A 3KKNA 2BEUB 2EBFX 4PZEA 4CU2A 1V9CA 4KUGA 4HLUA 4N8SA 2WTEA 1VL5A 4JT9A 1XK6A 3JR7A 2ZJFA 4GSKA 1UKZA 5TQJA 3HR4A 4F96A 3SQDA 2VF5X 2XDQA 3EBOA 1QYWA 3BRWD 3HFSA 4LN1A 1Q0SA 3FKQA 4AUNA 4TGLA 3NWBA 3PGJA 4OXQA 2I7DA 4KDCA 5FADA 2IYYA 5A1JA 1KTIA 3V2UA 2FCAA 2LP4Y 4P6VF 2PFKA 3QSGA 1PJBA 1DAGA 1C8KA 3EAQA 3RV3A 1MA3A 2QVZX 1D6NA 4GYWA 3VJMA 1N6RA 4CEHA 4UDOA 4EYOA 4Q4HA 5DOZA 4DA8A 2RH8A 1A4RA 3KE8A 1EIZA 4LOJA 3ROQA 5BQFA 3T15A 1R6UA 4WY5A 1SQ0A 5HZHA 4UE2A 2ILTA 3EFHA 1BE8A 2GRUA 3B53X 3L6UA 2GARA 4RHFA 4CF4A 4D43A 2AD5A 1AO3A 3QMMA 2DH6A 3L0BA 1T36A 4EW6A 2NZ8A 3L1JA 1L5LA 3JAMA 1V8FA 3DVLA 4L8WB 3CH5A 3HCOA 1KSFX 1JR6A 2GN6A 3R4CA 2PWPA 3A6PC 3JPWA 1E3WB 2IBMA 2JI6A 2ECQA 2QXTA 4LHEA 4P58A 3ZBTA 3OEHD 4BQPA 3BZUA 2FOLA 3LOQA 4LCEA 4GUDA 5H68A 1I7SB 4D9FA 4OIMA 1O89A 3OWOA 1ETHA 4LIPD 4LE1A 5TV2A 4RJJA 5B6PA 3PX7A 1N2OA 3PQCA 1H8HA 4XB2A 2J3LA 3FWYA 2HBYA 4GZ5A 5C0OE 1EA5A 1ZONA 3FROA 5ALUA 3TQTA 1X0XA 2AXNA 4HF7A 2GX6A 1TM3E 1JL3A 2AL7A 1FU8A 1IN6A 2I6FA 2UYQA 3E9CA 3LC0A 4ZCLA 4CL3A 5KYGA 1TD1A 3B70A 1LGYA 3NHMA 4TTIA 4E94A 1GUFA 3FFTA 1HKUA 1I5EA 3F71A 3OPNA 2NZXA 2QAGA 5JDCC 1WW2A 4MS3B 2VDLB 3R9XA 5I7VA 4E08A 5C4GB 3KHSA 4DIFA 4IJQA 5KQLA 1XDDA 5F9MA 3EC1A 2XDAA 2JCGA 1H8HD 2AE2A 2W2KB 4IHJB 3TXYA 3W9UA 3ZWQA 4CDNA 5LNK6 4UQOA 3CVOA 2ZIGA 3LPAA 2ZYWX 821PA 5F3WB 1IOVA 3CLRD 4WKBA 3PRYA 4HEA6 2W2MA 4GKKB 4BFLA 3EVFA 2J8ZA 1HY3A 3GLHB 4HQ0A 1NXOA 2A67A 4EG0A 1M74A 4NOKA 2FJPA 1QO0A 4FBGA 3BUSA 1TJ3A 3P4UA 4DA9A 1X13A 2Y1KA 4UMVA 3GRCA 1VFPA 2GDZA 4NP6A 4ZRMA 2JH3A 2FZEA 1UPUA 3UH1A 4EAAA 1U2GC 3REQB 2GXAA 1RXIA 3GQBB 1EQUA 1A8SA 4TYPA 1GR0A 3NWPA 1JQAA 2A5FA 1L1RA 3DP9A 5KB3A 1UEIA 3M1IA 4DR7B 2VDMB 3KSUA 1EFDN 5CNJA 1UMCA 1VLHA 5KS2A 3TQFA 5JJKA 3RT9A 3RAFC 4E30A 1D9ZA 1VJ0A 3IT2A 2V3VA 4Z8XA 2OV1A 1NM5C 1O54A 5F23A 1QRDA 4W7HA 4NJEA 1XOIA 4Y2SA 2QKYA 1PLKA 3D1JA 1BEEA 3S0JA 2X0FA 1NP7A 4J0QA 2C8LA 2J3DA 3KUKA 4I1UA 3VR4A 1KEKA 1ILEA 3BMOA 3Q7QA 2FFBA 3KLPX 3OHMA 4OKIA 5KYYB 5AKZA 4B17A 1H85A 2KE5A 4GYKA 3GBSA 3GJQA 2FLVA 3H17A 4LDAA 7GPBA 3TM5A 3RRFA 4TM7A 3GAZA 2Q4BA 3FVTA 3NIWA 2GJ9A 2HF9A 2R7KA 1IRIA 1XU9A 1MKYA 3FYDA 3IUSA 2IYVA 4IJ5A 1ZMBA 5JWRA 1EK1A 1T4CA 1US8B 2YMPA 2RJNA 2VHTA 2GWRA 1FNNA 1Z6AA 4LQ4A 5AI4A 5EHGA 2G83A 4JQCA 3GARA 1KDOA 1U5BA 1R6AA 2C77A 3NO4A 2F00A 4OO3A 3PHHA 5BP7A 1Z5WA 4PYLA 1U2SA 2LKDA 3IYLW 1Z6QA 4HRAA 2AFHE 4QEZA 4YP5A 1T1EA 1YR3A 1FFSA 2Z56A 3VR2D 4DPMA 1UKCA 4GXRA 1N75A 2PGDA 2ONKA 4IHJA 4KGDA 2OA0A 4QPPA 5HWSA 3BD6A 5JCPA 3AP2A 4DXDA 2H5EA 2XYGA 1NDHA 3AR7A 1ZG3A 1IZYA 1RBYA 1UKVY 3OWHA 3KDSE 4IDCA 4I55B 4KH0A 3C5CA 5DYWA 4BZZA 2H4FA 2IXGA 1IVNA 2PX0A 5IG2A 1H66A