5JIKA

Crystal structure of her2 binding igg1-fc (fcab h10-03-6)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
212
structure length
201
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEYLYGDVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVPGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Fcab-HER2 Interaction: a Menage a Trois. Lessons from X-Ray and Solution Studies.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 201
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jikA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jikA01
3VXNA 3EYUH 2ADFL 4KJQC 1QNZH 3K0WA 4H8WC 1CR9L 1OWRM 1MF2L 3MV01 1F6FB 1BEYH 1BIIB 5E6IB 5BS0B 4NUGH 3K8LA 2J4WL 1ZVHA 3PWUB 4XBEH 1KLFA 5IB1A 2Q20A 5CIPH 3RUGF 3VFVA 3TNMA 2WLYA 1P4BH 3DBXA 4NQUA 4FXGB 3SGJC 3QZWA 4OFYA 5D72H 4QHKJ 3BT2L 4FTVB 5DQ9B 5DMIH 1VESA 2Y25A 3J7HA 4WO4A 4KKBD 3P9WB 4DGIH 2R1WB 2ARJQ 2VDQH 2ICES 4OFIA 3RUGB 3MLZL 2GIYA 1MLCB 3C5JB 3O6FC 1BOYA 5D2NB 2V9TA 2ZKHH 3KPSE 4F9LA 3HAEG 2QQLH 2WSKA 3MQIA 2FX9H 3MBEA 2PR4L 3O9WC 4KY1L 3FB6B 1IT9L 5EOQH 3WE6B 2WP3O 4M93C 1DR9A 4Y5VA 2YPVH 1KPRB 2X10A 4PRIE 3C8KB 2DTML 3ROLB 3QXDB 1GH7A 1R5WB 2GJZA 3L3OA 1ZLWH 2Q87A 1G0YR 5EBWB 3PHOA 4K07A 2IBGA 5DUML 5DMJB 5IR1A 3AU1A 1QG3A 3B8YA 4RAVB 4U6YA 2ENYA 4DN4H 4U1IB 5IBLD 2ARJB 3TVMA 3KYMA 4K7PX 2WMPA 4YK4C 4K3JH 1NSNH 2F5AL 1JF5A 2CO6B 4JQIH 3L3DB 4I18B 5C0ND 2ZUXA 4UQ3A 2Z93B 3FOLA 2O5ZL 4PJFE 5EU4A 3RTQA 4OZHF 3V6ZA 4AENB 1IEBB 7FABH 2AXFB 3I6LE 3LCYA 4S0SD 4FZEL 4P5KA 3QEQD 3NGBB 2OTPA 4D0CB 2DLTA 4OZHB 5M95B 2CQVA 4HIJB 2PXYB 4FABH 5F9OH 3L3KA 5F97E 3KPQB 2R9HC 2CH8A 2Q76B 1N0LA 5DD6B 3VD9A 1I3RA 2XRAL 2VITB 1JBJA 3BMVA 1AIFB 5I15H 4HJ0C 1YEFH 3RIFF 5BS0E 5ANMB 4G6JH 3I9GL 2H2PC 1NH6A 1ACYL 3HMXL 4APQA 3AB0B 4LPWA 3CDFA 4L8DA 2ADGA 3VXOA 3ULUD 5GGVH 4FQPA 3GGWB 4I0PB 4FTVE 4PJ9B 1G6RH 1LDSA 1Q0XH 1VEPA 4Y5XC 4WJ5A 4OFYD 5F9DC 1S3KL 1UACL 5D2NE 1S7TA 3L7FB 3QEQB 3MRQB 3S9DB 3GSOA 2VL4A 5LBSH 5FO8A 4GMTL 4TRPH 3Q3GA 2GTWB 1HILA 1LO0H 2EDOA 4JO4L 5EC2A 5A40E 4W81A 2N1KA 4RDQG 4Y8AA 5D7LB 1R3LA 4HGWA 3BJ91 4CW1B 3MBED 5B21A 2BMKA 3HE6B 1I9RL 4XCFL 4M1CD 3R06A 5A2LH 4J4PC 1NGYA 1HXMB 4AL8H 2DM2A 2AI0H 2VLRA 2C3VB 5HPMB 4P9MH 1P2CB 4UZGA 1U6AL 1T7XA 1UJTA 4AEFA 2XXMB 1DEDA 4K2UL 2A9MH 3VXRA 4O00A 4G43B 1XCQB 1S5IH 3CSYA 2CD0A 5T1MB 4LOUD 3MJ7A 4NPYA 2XWJB 1Q0YL 3V5HA 4PJDA 3RTQD 1CDHA 4ODHL 3RBGA 4KMTL 5B3JF 1F4WH 3GK8L 1RZFL 3T0BA 2VLJA 1XGPA 1TVHB 1F3JA 3TN0B 4KWUA 3UTQA 1Z9SA 2MOVA 2NY4B 4KK5D 5ESAA 3B9KA 4BSVB 3QO0A 2KZ1B 2MKWA 4LPYA 1FVEA 4ODXA 3U0PB 1AGCB 1RUKH 4JHZA 4JHAL 3ULVD 3KYNA 4JZJC 1Q72L 2IGFL 4JFED 5D7IE 4N9GB 3C6SA 4ZOEA 1JGVH 1VFBB 2CLZA 2UV3A 5E70A 2BVOB 3BRFA 5SX4H 1JIBA 2F54A 2ZUQC 3NA9H 4JO3L 5E0QA 5AZ2H 1K4DA 5IT2L 3L3HA 1CS6A 2JCCF 4OCXH 2GTZA 2VKWA 4WW2A 4APQD 1T1ZA 2XTJB 5DVNA 1NBQA 1IQDB 2VXSL 5I1HL 2KZWA 4PFEA 4HFUL 4TSBH 4DW2H 3BFOA 1HI6A 5E5MB 3QEQE 2EZ0D 1AGEA 4TPRL 3SE8L 2P42B 1M7IB 3TIEB 1KG0B 5CINL 5HGDA 3NFNB 3H9HB 5INCB 2R29L 5I8CA 3ABZA 1DUYA 2A73A 2H32H 3WNLA 4K7PL 3FQNB 3L5IA 4ENEC 1A9EB 4JFEB 3GSRA 1ORQA 1EAPB 1TJGL 5HYEA 3QHFH 2X5PA 1D6VH 2ARWA 4PJGF 5HVGB 5CSGA 5F7EH 2EH8H 5GRVK 3BUYA 5E6YA 3G6JA 2FB4H 3BE1H 4OM0H 4ZDHB 2A1WH 1FIEA 2VLRD 5KOVC 4NRXA 1KLGA 4G5ZH 3ULUE 3Q6FB 4HHAB 3ZSTA 1VADB 2NY2B 4PJGB 3BI9X 3C8DA 5MP6L 4U1JB 4KH2A 5C3TA 3BGFC 4MHHG 3VXRD 1Q9LB 43C9A 1T0MA 4U6VH 2XWTB 4XP1H 4G6ML 1YECH 1KCRL 1BQHG 1T21A 3SDXF 4Y4KC 1ZLVH 5EOCL 1XF4A 2C1OB 3LN5B 4OM1L 3OMZA 1N6UA 3VXTA 2CO7B 5GZND 5F6IB 1R3KA 4GW4B 4XVUC 4M61B 4Y4FC 1ZE3C 4OQTL 1I8IA 4FQIL 1CFSB 4Z9KB 3T65B 2H26A 3LD8C 5IP4A 4LLYA 3B9KD 3MNVB 3RU8H 4FZ8L 4POUB 5J13B 1VGEH 1RZJH 3TH4T 4LSVH 4K3HA 4X9FA 2DKUA 3N1GC 1BX2A 3O6LL 1I7TA 1DBKH 3SKNA 5FV1L 2QJDA 3ARFA 1OGTA 4ZPVB 3O4LD 4MA7L 2E9WA 4HZLB 4HH8A 8CGTA 4WUKL 2F54D 1BVKB 2XTJE 4PJAA 2RAMA 2HFTA 4M48H 3TO4D 4LSRL 4UMGA 3D9AL 4CJ0A 5DJCB 1T2QL 1NJ9A 1WZ1H 4LIQL 4L8CA 4P3WA 4QHMB 5HJ3B 2PO6C 3OR6A 2RCSL 2C7UB 4P3DB 3TBWB 1NBVH 4RCAA 3MCG1 3T0AA 5BV7B 5HHOD 1O5DT 4LBEB 1OP5K 5HHVL 1H8SA 2HVKA 4KXZH 3D18A 5D7JC 2KPNA 4ZFFB 3VFMB 5IWLA 1KJ2B 2NLJA 2DM3A 3ULVE 1SHMA 5IW6A 2EDEA 3FO0H 1DQQA 4KVNH 4JFEE 1G9NL 2OM5A 3LS5H 4Y5YC 3S5LA 2GFBA 3L5WB 5IHLB 5J9PB 2BZDA 1FIGL 3MA7B 3ARXA 3W9DA 3CVIL 1XMWA 1CFNA 3ZYIA 1F90L 1JNJA 1XGYL 1U42A 2HKHH 2CGRL 1YQ2A 3MLYL 1AKJD 2CRYA 4Z7OE 2H1PH 1DLHA 2EKSA 1F2QA 1EV2E 2WNGA 5T5NF 1U3HD 4PJGE 1HQRA 4MVBC 3CU7A 3RWGB 3ARGA 4MNGA 2GJ6D 4N0YL 4EQ3A 5JW5A 4UAOB 2H9GA 4MWFA 5E9DA 2YK1H 3OAZH 4YHNB 1EERB 5FECB 5HGBA 1FORH 5HHXH 4QTIH 4LHUA 2OZ4L 3T1FA 1HXYB 3F7QA 1TQCC 3IFNH 4HF5H 2R2BB 1R6VA 4PJ7B 3UJTL 4J3UA 3V4PH 3NIGF 3QO1A 2HT3C 4YHYC 3QIWC 1UH2A 4R96B 5TFSL 1N3NB 4M43L 1PZ5A 2YXFA 2FYYA 2EYTA 3RVVD 4XPGH 3HNTH 1A2YB 4I3SH 5I17B 3CPLA 4MAUH 3H9SA 2R0LL 4K7PY 5DEFB 2XOTA 1AKJB 3MV9A 4OZ4B 2QSCH 4MDIB 3LQAC 2BOBA 1U3HB 1JNLL 3NA4A 4AZ8A 5AUMA 4KMQA 2GJ6B 2X4TA 4QT5A 5JHDB 3HI5L 3VXRE 1WQVT 3I50H 1A02N 4PJEE 1ZVYA 3MJ9H 2BOCB 3QHZL 4S1QL 1BQSA 4YHOH 5T1KB 3ECBB 2VAAB 1UB5A 1I1AA 2D31B 4LRIC 1DUZB 4PJDE 4XNZC 2W60B 1WT5A 3OKKA 3BD3A 3QEUA 1PW3A 3HZMA 1X4YA 1AC0A 4F3FA 2N7AA 5F7HA 5K9OA 3VFSB 2LTQC 2ZCLH 1D5IH 2C5DC 3HB3C 4OCLC 4QRRA 1PX4A 3BDYL 5FM4A 3O0RL 3OJDB 4NJAL 2D2OA 5C07A 3C60A 1IAOB 2AKRA 1KIRA 2FGWL 3MCLL 3HZVA 1F4XL 4RZCB 4Y19B 5IV2B 4I0KA 1D5XA 2GITB 3BH8B 2UUDH 4HPOH 5KANI 3MODL 4LCYB 5ISZD 3DVNA 1EHLH 2R0WH 1BBDH 4Y2DC 3O4LE 2E7LA 1SEBA 2V9QA 4U6TA 5EDXA 1FGNL 2G5RA 4F7MA 2F54E 3SQOL 1K8DA 1SEQL 2MQCA 3QUYA 3ZE1F 1JHLH 5KSAA 1DDHB 3FTGB 4WRLA 1RULH 5DRWB 5D93C 4LHQB 1CLOH 5JIHA 4P5MA 1XF1A 3BAEL 2P8LB 3OKOB 5HHOE 4KGLA 1J05A 1E28B 4R4ND 2AJXL 1S7QA 4OF8A 4K3EH 2X1QA 1LE9B 2DLIA 3DSFH 1IGTB 3TT1H 2EEBA 1U91B 1CVSC 4S1DC 5E9DD 3VH8A 3UO1L 4D9QD 2HLAA 5KVFL 1T0NA 4PJ7E 2EXWC 5AZEL 5BVPL 1RUQH 3BW9A 4OIIH 3IDXH 5ID0A 4OZIE 1D3CA 2COQA 1SMAA 1WK0A 1TJIL 1CXFA 3RWCB 4D9LH 5DZOA 3LKPB 5FYJD 2E9IA 5ISZB 1T1WA 5JDSA 2GSIA 1MFAH 3IAQA 4ONFL 3L3IB 3IDGA 1JPTL 2IQ9H 2EDDA 3KXFA 2JK5A 1LO3H 1UFUA 4XPHL 5I18L 1V7NL 3ILPB 5IMLA 1TXKA 5MEQB 4CN1A 1G7HB 2WINA 2IF7A 4C83A 3H9SD 2GJ6E 2E6PA 1XR9A 5I9QC 3MBXH 4WWKD 3PP4L 2VLKB 2VQ1B 3IDIB 1O0VA 4I77H 3T4AA 4FP8H 5LGHL 2Q7NA 1C5BL 1FGVL 1TZGH 4ZXBA 3EGSB 5IEHB 5ESVA 1Z2KA 4UOW1 4QY8B 2X42A 3QUZC 3CZJA 3OAYK 3E6HA 1UXSA 4RISH 3KHOA 4HKZA 3JVGA 3EDFA 4RNRB 1KJVB 4QWWC 3O3UN 3IU4H 5DT1L 5CEZL 4KUCF 2R2EA 5GSVA 2ZOKB 4DVBB 1C08A 4FMKA 2D4DA 1IJ9A 1DQLH 4OGXL 4Q6IA 2V5MA 3CXHJ 5TE4H 1YPZF 2BRRH 1EO7A 4X7CC 3C60D 4DGYL 4N68A 5J1AB 3VGBA 3RWIA 5ACZB 4K71C 1UT9A 1T7VA 4WWKB 4UOW0 5BZDB 3QAZB 4X4YB 2HTKC 3STLB 3JWDC 5L0QB 1OP3K 5CBEA 5C2UB 3HAEA 3QCVL 4OLXH 2IPUG 4LCUB 5KSAD 3ES6B 4G80A 5DJYB 5DD1H 5E2WL 4LVHC 2R4SH 2DMCA 2EIZB 3SO3B 1RUML 4MXWH 2GAZA 3A6OA 5IMMA 3QULA 6FABH 3J8F7 1BFOA 1KCSH 1PKQB 4L4TA 3FRPG 4OCWL 3ET9F 3MREB 2DQDL 1MFCL 4JANB 5T3XL 4PV8B 1SYVB 4U1KA 5BQ7A 5C0JB 1A1NA 4NN5B 1JHKL 3LKOB 2IBZY 5DGQA 2R15A 2EE3A 4FFZH 1JPSH 3BPNB 3ZTNL 1IC5L 5DD3H 4RGOL 4X99A 5ISZE 4PJCE 2APBA 3LKSB 2FIKB 2Z4QB 1J1OH 3IDJB 1ZANH 4MA3B 4P2QA 4YHIB 1HHGA 3RJQB 1F6AA 1IEAA 2HVJB 3NACH 1DCLA 5T5NG 5C6WH 4M8VA 4N90D 3UTSA 3QI9A 1RIUH 4X7EC 5D1ZB 4QXTA 5DO2C 4YXHL 4PJ8B 3FO9B 4MD0B 1BBJA 1YMMA 3RBSA 4IMLA 2YR3A 1INDH 2VLKE 5I1CL 2RJMA 5MEOB 4J6RH 5K93A 2B1HL 1H15B 3FONB 5CP7A 4JAMA 4MX7A 4H5SB 3H6JA 5HDLA 2ZPKL 3FB5B 5E9DE 2IPKB 3EO1B 4XNMB 4GXVH 4D9QE 4LLUB 1VA9A 1R24A 4ZXBD 2DMBA 2RQ8A 5IB5A 5ERWA 4TUKH 5IGXH 4WTXA 1AXTL 5MHSD 4DTGL 2W92A 1N64L 3O3BA 3S37X 3NMEA 5FYJE 2BFVH 2P8MA 2UY6A 1RK1A 2HFFA 4Y4HB 3RKPA 3DXAB 3PV6B 4K8RD 4AEHH 2JJTA 1G7QA 4YAQA 4M02A 2YOCA 1AHWA 1AE6L 1BWWA 2FSEB 4LDEB 1SJVA 1N2RA 5KW9L 5HI3D 1FZKB 4QEGA 3NBNA 3H9SE 1P84K 3BX7C 5GRJL 2P5EB 1YY8B 3PWLB 4Y16B 4YZFF 3V2AR 3NH7H 2GQHA 4NNYB 1AO7A 5IBUB 5L2KB 4H20H 3PL6B 1ZHNA 3IETA 5E4EB 5GRVL 4XHJC 5GS0C 3VGHA 1MSPA 1NUGA 3B2VH 2ESVA 3VDBA 5K59F 3UXFA 3KHQA 1FFPB 3BIKA 1YJDC 3H3PL 4I48B 1AD9A 1PKQE 3MCKB 5DR5H 2R8SH 2DLFH 4K23H 3MRIB 4YO0A 1ONQB 1DFBH 3CFJB 4ZAKD 3GIVB 1M7XA 3GRWA 2V7NB 3LH2H 3O45A 4L4TD 4QRPA 4K3GA 2Y07H 1SMOA 4NKIL 4ZO6A 4MDJA 4TUOA 3QUMA 1UVQA 1JN6A 3KPOA 4CMHC 5ALCH 4OSUH 4LAQL 5GRXG 1FNEA 1LNUA 3MLWL 1OM3L 2NX5A 1A6TA 1G9ML 3V6OC 3PGFH 2VL5A 2VZVA 3PWPD 1S9XA 4J3OC 4HAGA 5HY9B 1J8HB 1F3DH 4LL9A 1A21A 4NQEB 5F1IB 3JV6B 1CICC 1MPAH 4OLWL 4KROC 2K7PA 1INQA 4N0FB 3QI9D 4PG9A 4F7EA 3IDNB 1B2WH 1EEZB 4HSQA 1YMMD 5GJSH 1F4YL 2WUBH 3PWJA 2V2TB 1OAZH 3TNNB 2EE2A 4R90H 4JG1H 4ZAKB 4A6YA 5EG6C 4G8FA 3ARSA 2VXTH 1NKOA 3GI8H 5I74B 3MRBB 4EDWH 4U1HA 3V4UL 2XQYK 1IGCH 4XGZB 3E3QE 4HKXA 1MCWW 3HPJA 4XX1E 4PRHA 3F7RA 4E41A 3NN8B 3MC0A 3QA3B 3W2DH 3M17A 1EO5A 3GKZA 2DQHH 4OD3H 3N1PC 4BSWA 3AXLA 1AQDA 1QFWI 1FNSL 1XEDA 4N90E 4HPYH 5JW4N 1X5XA 3EAKA 4XHQA 1AP2B 2BNRD 3P4NA 4DUVA 2Z8SA 1RUPL 3MXVL 4PLOB 4YX2H 1P4IL 2Q3ZA 3JV4B 4LRNL 4XH2B 2R0ZH 3V5DB 2IADA 3UYRL 2YPKB 1RD6A 3NFPA 4Z7VF 3S4SG 1HSBB 1AGBA 3O11A 2FHBA 25C8L 1NMBL 4LPTA 5BOPA 1EUTA 1FC1A 4IIQC 1YUHA 1BOGB 1ZLSH 4PG2C 4JQVC 3MV7D 1G0XA 5IOPB 3ZDYE 1S7VB 2RFXB 1FSKC 1J7VR 4PY8I 3UBXB 4PS4L 4KV5E 4UT7H 4LARH 1FH5H 4V1DA 3VFOB 1F4HA 1J12A 5MHSE 4XPFH 3V79C 3LEVL 3U9PL 1MQKL 4EN3A 3AS3A 4GAYA 3RUGA 2OJZL 1SVZA 4MNHA 2H6PB 1R3HB 4JO2H 1KIQA 4GG8B 1FBIH 4PGEA 4UDTA 2IJ0C 5DJZB 2A77L 1FVCB 1KFAH 1URLA 1QP1A 3QCUH 3FCTB 2YBRB 4NN6C 4QRPD 3WE6A 4KTEH 1PDKA 2BNRB 5F7DA 5TGBA 1RV6X 4ERSH 2AS5M 2AXJA 2V7HA 2R56H 4NQEE 3QXDA 1VDGA 1G7PB 4FQQA 2NX5D 4HLZH 2NY3C 3VJ6B 3HPLA 5DRNA 4I9WD 5I73B 1CK0H 1ZTXL 4OFKA 1NMCB 5DJAA 4YEFA 1BQHA 1MIML 4HS8H 1AD0B 3WS6A 2ZCHH 2BSSB 3QIBD 4PLNC 3MV7B 2W0KA 4UU9B 4MAYA 3S37L 3VW3H 5J6HB 1JFQH 1B0RB 1AI1H 5EU7C 3MOBH 3THML 1KELL 4LSTL 1K3IA 1MY7A 2Z93A 5DEGB 2W1NA 4RAHA 1FRGL 3EIFA 4FMFA 4F58L 5KSBF 4L4TE 5SWSB 1ZKAA 4P9HC 5HYJB 2I26N 2SEBB 5DEZA 1NLBL 2EDJA 1IEBA 3WHE0 4KRLB 3UPRA 1CDYA 2JJSA 1W0YT 4S1SL 3PABA 3SE9L 3MRJB 3HG1A 3EOBB 1NEZA 3ZKXC 5L2JB 3PWPE 2OYPA 4D0CA 3TIDB 5KSBB 1IGFL 3MV8D 2AVGA 4IS6B 4PRHD 1JGUL 3HAEH 4E41D 1CGSL 2PXYA 1S7XB 2D03L 2Q7YB 2P24A 1KTDB 1REIA 2NXZB 4ZPTB 2UVEA 4K9EL 4WEBH 4XBGB 5IK3B 1MJUL 4OAWB 1JNHB 4OCYL 8FABA 2XICA 3KAAA 1L0YA 3U1SH 5MI0C 1C1EL 3QIBB 1YMME 1DLFH 4LQFL 5JXAH 2VITA 5HGHA 1OAYL 3DGCR 3O3EB 3C6LC 1N7ML 3RWHA 5ANMA 1KB9K 3GSQA 4XPBH 3ARUA 3D0VB 1HYSD 2APXA 5HVHC 3GFUA 3G6DL 1DBAL 2VDNL 5GIRB 2Q8AH 4LSDA 1LDPL 4NT6A 5TDOB 3W9EA 2DQIH 3PV7A 2GK0B 1MRFL 3D0LB 4PJ9A 3BO8B 3BP7B 4V1DD 1N5AA 3KPNA 4N8PA 1QHOA 2HTLD 4KJPD 3RWDA 2IALA 1OGAB 3FOMA 3L7FA 3C9NB 3VDCA 1S7WB 4EN3D 3MUHL 3BZFA 1YZZA 5J1TC 3QEHA 3GBNH 2GTWA 1I3GH 1PJ9A 2OCFD 2BNRE 2LAAA 2RIKA 4Y89A 2AJSH 1GPOL 3HFMH 5I66A 2BCKB 4G7VL 5D6DA 4GQ9H 4WNQB 5EIIA 1HXMA 4FG6C 3U9UB 5ITBH 4U0RC 4J1UB 1N26A 3QB7C 2BVQA 3MV7E 3QDJD 4MS8C 1QFPA 1JZ6A 2HWZL 4BFBD 1S78C 4OD1L 2AJVH 2AV1A 5K9KB 5B8CB 5I8OH 2I60H 1VGKB 5CJXC 4E42A 4MAYD 3OSKA 4BFEA 1UM5H 4HMCA 3ILQD 4WEUD 3H7BA 3X11B 5H37G 3MNZA 1G9EA 1A14H 1ETZA 2ED8A 5GJTH 2FZ3B 5EA0L 2P4AB 1KCVH 4HUUB 3MTRA 3ZKQD 2W0PA 4ISVB 4NM4L 3PJSB 5BW7A 1WWBX 2EDHA 4EKXA 2YRZA 2MCG1 1AR1C 4LVNB 4NKOA 5LCVH 3WUZA 1DBML 1LEKB 2LAGB 4LLQA 4LCCA 1MJ7H 1UWXK 2NX5E 5HVFB 4IRJD 2AEPL 3BDXA 5F96L 3ARTA 3LKQA 4QRUB 4UILL 4I9WE 2DYPA 4RSVA 3GNML 1H3VA 3CLEH 1UWGL 32C2A 1U93A 1GIGH 3R8BB 5SX4I 1GGCL 3MRRA 2QLVB 5EULV 1CGXA 3DO3A 3N1FC 4PUBH 1HSAB 1VFBA 1WAAF 2ORBH 2OX5A 3VA2C 3EYSL 4ORGB 1CCZA 2PW1B 2YS4A 3GRWH 2HLFC 3SDYH 1ZGLM 2IG2H 3FZUD 1KYOK 4NQXB 4AJ0A 4HUXA 3H3BC 4OCSH 2DI7A 2NYYC 3P77B 4O9HH 3DVFA 5GGQH 1MJ8H 2XFXB 4ZYKA 2F19H 4JKMA 3WIIH 1NCNA 1ZLUH 4Z7UA 3MLRL 2CR3A 5IG7B 4LKCA 4ZOBA 3KPPB 1S5HA 4NP4L 1IEHA 3MV8E 1CBVL 2JCCA 4PRHE 4E41E 2Y5TB 3H9HA 3EDJA 4IRJB 1FZMB 4LP4A 1AY1L 1BZ9A 1V7ML 3UBXG 3S3JA 2J88L 4HT1H 2YKLL 1HNFA 1ZA6A 2FH8A 4N0UB 5CJ8A 5JR1L 1RK0A 1OVZA 3VFRB 3JWOL 4IOIB 1BQUA 5FOJA 5IB4B 1R3IH 4I5BA 1EVTC 3GBLA 4NN7B 3RIAK 1G1CA 5EO1B 2DOCA 4A6YH 2VDKL 5GGTL 3BPCA 3MGAA 2KH2B 1IC7L 5FYLH 1JWMA 3L6FA 1WF5A 3MUJA 4NFCA 1IE5A 2Y6SC 2AW2A 3ZTJG 1FHGA 3EYVA 4JRXA 4Z8FH 4Q9QH 2HJLA 4V1DE 1U92A 4RX4D 4JDTH 1KBGH 4XC3H 3MFFA 1IZJA 4CU6A 2VLMD 3TYFB 2HFEB 3SGJA 3VXUD 1TQBB 1FYHB 2XWTA 1QKZH 2Q1EA 4Q9RH 3GO1L 4H8WL 3ARRA 1RMFH 3MZGB 3DX6A 4QXGH 3LB6D 3GI9L 4PRAB 3UTZA 3SDCC 3BPLB 1QSED 3ARVA 1X5KA 4GRLC 1KTLB 5DJ0B 1X4XA 1V5JA 2OQJB 4X7SH 1QBML 3SDXA 1TNMA 4YDVB 1OHQA 2B7DT 5JQHC 3MNVA 5DD5L 4FA8A 2F58L 4NC2B 3UCRA 1HN1A 2FD6H 3HLAB 3QDJE 1NCUA 3NVQA 1RJYB 2DQCL 4LCIH 4JJHA 43CAB 1NUNB 3DROB 5EZJA 3KLHC 1U2HA 2QSQA 3QQ9C 1DN0B 3HRZA 5F88A 3H0TA 1RZ7H 2FJFA 4O5LH 2FECI 1IILE 3N0PB 1I7ZB 4ODTH 4XNXH 3JTTA 4LPCA 3GJEB 4M7JL 3SJVA 4LFHG 5F72S 1WBZB 4JFYB 3KJ6H 1KJMA 3T3PE 3DGGB 3IRPX 4KC3B 4TQEH 5E8PA 1XIWD 4I2XB 4OLYH 3VXUB 4QLRA 5FA4A 3D85A 4IDJH 1NANI 4UT6H 3VGGA 5KVDH 1SJHB 2B4CH 5F44A 3ARBB 5E94A 3TWCH 4KXZI 4P3DA 4RBPH 5SX5H 1YEDB 4HJGB 3L1OL 5CJOL 4J3TA 1SJEB 5I1DB 1QSEB 1HH9B 1XF5A 2X7LA 3L95A 1WITA 3TZVC 5JO5B 3VFMA 4UOJA 6CGTA 5KVGL 4HLJA 1JNNH 3D3VB 1KPVA 4N0UE 4U49A 4L9LA 4TULL 3H42H 4P0DA 3MV11 3QUXC 1K8IB 5DHYB 2YPLB 3TJEH 1G7JA 4PGCB 3L5WA 1UGNA 5J9PA 5GS1A 4NM8L 1FNFA 4Q7DA 2DWDA 5I71C 1J0JA 4NQSA 3B5TA 4N5ED 4HULB 4L4VD 4BQ9A 2UZIH 5KVEL 1F11B 3FRPA 3QRGL 4DAGH 2Z8RA 4X7TB 2QHLA 5JQ6H 5FUOL 1MUJB 2NY1C 5DJ2A 4L29B 5F9WC 1E4XH 3GMLB 2MPAL 2EKJA 2ZOLB 4HH9B 5MERB 5BMFH 4R3SB 4AG4H 4KJQD 2FJHB 3MJGX 3LVEA 4R0LC 1LP9F 3BPOC 4OB5H 1NCDH 1EBPA 5FOBB 3NAAL 4LASH 3O8XC 4JRXD 3LRSA 1YEEH 12E8H 4DCQB 35C8L 3PWVB 4GSDH 4XWGL 1YMHB 1HWGB 4O2EB 4UTAH 2VLLA 1LP9B 1Q9WB 1RIHL 4L3CB 1YNTB 3RAJL 4YH6A 4MCZB 1Y6NR 5IEKB 4YDLC 1ZS8B 3O6FD 4M3JA 4X6CB 4POZC 1XGRB 1MH5A 3O9WD 3RL1B 4L4VB 4FFVC 2BJML 4XCEA 3CSGA 1FZOA 5DEFA 2WLZA 1J1XH 2X9YA 4I3RH 1PSKL 1H3TA 4UB0L 4KZEL 2GY5A 4NNPL 2VMFA 2F5BL 2VLME 3I3DA 4AMKH 4M4PA 3PQYA 3VXUE 1T4KB 1W8NA 1U8MB 2ADFH 1A4JA 1CR9H 2HA1A 5HDBE 2ADIB 5ESQB 4P5TB 2BDNL 2P47B 1FNLA 5IVXA 2J4WH 1S9VA 2D31A 1FG2A 5F89B 1DUZA 2IQAB 1S7SA 3D85D 3EYOB 3VD5A 5CGMA 1QSEE 2NY6C 3F58L 2VXQL 2R23B 4WY7L 1GZQB 3HI1B 5HDQL 4FQLL 1C5DB 3O6FB 5ECJE 3IU3A 1KN4L 1JPFB 5FO7A 3BT2H 3HUJB 2ICWI 4XVSH 1VFAB 5FUCE 5ACLA 2YUXA 1OAQH 3DHJA 3MLZH 3WFBL 4HX1B 2J5LC 5I2IA 3R0NA 5C9JA 4M93B 4Y19A 3D69B 4EBQL 1ZWIB 4OFDA 3MGOB 4WTZG 3BVNA 2PR4H 4KY1H 1IT9H 4JM2F 3G9VA 1ZT4B 5GSRB 4NIKB 1RY7B 1SYSB 4GW1B 3RY6A 2R9HD 1KENL 2CDFB 3QXAA 2DTMH 1MAJA 5E7FA 2Z31C 1KSRA 3FRUB 5A43C 1Z9OA 3FTGA 1IKNC 4GS7C 4NFBA 2NTFB 2QBWA 3DV6B 4HJ0D 1UADC 2B2XL 4YK4B 5D5MF 5DUMH 3T09A 4EUPA 2H2PD 3ALXA 5IMOA 3V0WL 3SE4A 2D7OA 3GSUB 4Z7UE 2AEQH 5D70L 4X6FB 4EDXA 2AXGA 3G5VA 3ZT7A 1YN6B 2W07A 1UB6B 2F5AH 1IGTA 3WNPA 3RVTC 3FHAA 1ADQL 2O5ZH 4PTTB 4X6CE 3CH8A 2P8PA 3N9GL 2G75A 5EORL 4RQQA 1KCLA 1YNLL 3I02A 1A9BB 4UQ2B 4L4VE 4FZEH 1FL3B 1TETL 3T2PA 4WV1C 5GISL 1MFDL 3WDIA 3TBYA 2EC9T 4NZJA 1H0DA 2DJUA 3A67L 3QUKA 4O2CB 5CZVL 4NO5B 1A7PH 4U4BA 1DSFL 4LLWA 1ITBB 5AD0A 5B39A 2BX5A 1OSZA 1KOAA 4JRXE 4ACPA 1UH4A 1P53A 4X6DE 2XRAH 5DJDB 2XA8L 3KDMA 3CX5K 4ZTOL 4PP2B 3PQYD 2X05A 3EGSA 4M8QB 3I9GH 1RJLB 1ACYH 4ZUVA 4NO0D 3HMXH 3GMNB 5DURD 4PJHF 4FQXB 3PHQB 4Z18A 4LEOB 2N56A 4Y5XB 2VZ3A 3MMEB 1HHIA 4Y4KA 3S4SA 4Y88A 3HUJE 4LLVB 5SV4A 1KT2A 2BVPB 2ZOKA 3WLBA 1S3KH 1UACH 2E27L 3WIFB 4OGZA 1LO2L 3QNZB 5LXGL 1RZKL 5DUPL 4GMTH 3LQZB 1MCPL 2J7LA 2NY5L 1P4LA 3WEXB 3ULUC 4JO4H 3KPRA 1XH3A 1FZJB 4N9OB 1BMGA 3CFKA 4Q97A 1JWSA 4LHJB 5F7LB 5HHMB 1JTOA 1RZJC 5BZDA 1I9RH 4XCFH 2LU3A 1YPZA 3NTCL 4X9HA 1KTRL 2JE8A 3FQTB 3LEYL 4Z0BH 4Z5RB 5TE7L 4MXVE 4WO4C 1BFVL 1FO0B 3JUYA 1CTNA 3ES6A 1FYTA 5F6HJ 4F9LC 1ZMYA 5B4MC 5EN2B 5KS9B 1FL5A 3U83A 4P2OA 4IEFB 2AEIT 4CUCA 4HKJA 4P2RA 1T66C 1UZ8A 4K2UH 4Y5VC 5DS8A 4JZOB 4CRPA 4JANA 5DVLA 4ZUUA 1SYVA 4NGHH 3OX8B 5C0JA 4IRSB 1JUFA 3MNWA 4GAJL 3CFIC 1QO3B 2BERA 1A3LL 1R5VB 2P44B 1I75A 1XGQB 3QH3B 1Q0YH 4PLKD 3V5KA 4LF3B 4ODHH 4KMTH 3GK8H 3LKSA 3HNVL 2DQFB 1RZFH 4Y5YA 4MA3A 2V2XA 3LSOA 3TVMC 4JPIA 4JZJB 4ENED 4NQVB 4PRNA 2VQUA 2H8PA 1T04B 1HWHB 4QRTA 5IJVB 4JHAH 1Q72H 2WANA 3ZDZE 2A6IB 2ZUQB 5C6TL 5ICZA 1U8LB 5IKCA 5C92A 2XZAL 5FYKL 5DUBA 3BP4A 2QEJA 4JO3H 1XZ0A 1X5IA 5IT2H 2PCPB 1B0WA 1UCBL 3DIFA 3Q0HA 1A1MA 1H3XA 3AS2A 3DVGA 4DOHE 2YA0A 4EOWL 5I1HH 4ETQB 5IESL 4L1DA 4HFUH 1GCFA 3NPZB 1F45A 4NQTA 4Y4KD 1UZ6F 3RQ3A 5D8JL 1NFDF 4TPRH 3SE8H 4CJ1A 5JLZA 4NQDA 4G7YL 2R29H 4Y4FD 4KK6D 4APQC 1KXTB 3WKNA 3IKCA 4JFFB 2F74B 4M6OH 3EO9L 4JDZB 4K7PH 3RWEA 2XPGB 1U8HB 3JSSA 4YHPA 4HUVB 3KPRD 4X8XA 3OAUL 1E4WL 1QFHA 1ZSDB 3PL6A 2HMIC 4JFZL 1Q94B 1A4KB 3ARDA 1B6DA 1TJGH 3VRJB 4XCNB 1UEMA 4RAUA 3T2NL 5JIPA 3K8MA 3QJHA 5KS9E 5IVXE 4RA3A 2F8VA 2PUQT 2YWZA 5EBMA 3BGFB 4B5EA 2AJZA 2ITDB 4ELMB 1FYTD 5DLML 3LQAL 3MRIA 3MLPA 2WUCL 4P2OD 5C6PB 3O6ML 1KC5L 5MP6H 3FT3A 4K7FB 1J86A 2Z92A 4P2RD 3C08L 1I4FA 2X70A 2PO6D 4KGJA 4DZ8B 2YUWA 4G6MH 4WU7A 1KCRH 5GGSA 2F53B 4MXQC 15C8L 5EOCH 4OM1H 4F2MB 4P4KA 3DTXB 5IVZA 2GUOB 4JDVB 1YQVH 4CMMA 1J8HA 4MLSA 4XNQA 4OQTH 1OD7A 1TTFA 3JV6A 1ZEAL 2O26U 4Y2DA 3NIDE 2XKNB 5HHQB 5F7WC 1F13A 4FZ8H 3CDCA 4OTXL 2WM0A 5H35B 5A2FA 5BZWB 1PG7X 5FK9A 5GZNC 3O6LH 4F7TB 5KN5B 5CCKL 1MCSA 2VZOA 4MA7H 2VXUL 4WUKH 4ZTPL 2PO6B 3OTTA 4PJBB 4LSRH 5CHNA 3CFBA 1P7HL 3D5OF 2BXZA 3VD7A 4POYA 1T2QH 2YD5A 1A64A 4LIQH 2XA3A 2NTSP 1TIUA 3C5SB 5D7JB 3PP3H 1EIBA 2RCSH 1JGDA 1JGEB 2DJ4A 4WHTA 1UENA 2IFFL 4WFED 5HHVH 2XQYG 1YC7A 2OL3A 3UJIL 2JKXA 5LGJB 4JFFE 1U8NA 2HT3D 3I85A 3QIWD 1G9NH 4NQDD 3LPGA 2FH6A 5A16B 3WL9B 1FIGH 1HQ4B 3HZYA 3ME0A 4PD4J 4G6FB 3C5ZB 3MRCB 1BOGA 1PYWA 3CVIH 1F90H 3T0DA 2NW2A 2ZCKL 3RKDC 3VRIA 1XGYH 3ARDD 1ND0B 4NO3A 2CGRH 3MLYH 4Z7VA 4ELME 3WUWB 5CBAB 5HTSA 3RIAF 3RGVA 2R1YA 4N0YH 3FFDB 1IL1B 5I16A 3LAFA 3BP6B 4QF1B 5CJBA 3VXQA 4UUJB 2X09A 1FNGA 3X3FL 4GG8A 4JFQA 5C0BA 1TQCB 4FXKB 2F53E 4G6KH 5DJZA 4OBSA 3T3ME 3IFOB 1EHNA 1RZ8A 3FCTA 3SGEI 4BK5A 5EBLB 4EZMA 5L8JB 3HB3D 1QPPA 3QIWB 2DLEA 1WISA 5MEND 2IMMA 3GSXB 3KPRE 2NZ9C 1BF2A 4MQ7B 3U46B 2J12B 3FO2B 4PRDB 3UJTH 4EI6B 4P4KD 5GGRA 4GG6F 5TFSH 1JGLL 4PLJC 4M43H 4RFOH 4GRWB 4CN6A 2V6HA 1D6EA 3V6FB 4NO2B 4S2SB 2WV3A 4Y2DD 2AJ3B 1QSVA 1B0RA 2R0LH 5BVJB 1D5MA 5C0EB 3WNKA 4BQ6A 1OPGL 4GG6B 4LGPB 1JNLH 2FIRT 4P2RE 1LK2A 4U7SA 5SWSA 3HI5H 4PJBE 5TQ0L 5HYJA 2F15A 1EAJA 4HWBA 3U2SA 2QSTA 1BZQK 5GRUL 3QJFA 4C56D 4W4NA 3EOBA 1L0XA 4DKEL 3SCMB 5JORB 4S1DD 2LTQB 4TVSa 1QRNA 4IS6A 4RWHA 5MENB 1HZHL 1TZIA 3OJ2C 1JTPA 4YDIL 2VB5A 1KTDA 3GMRB 3ARFC 4WCYL 5CSBA 1A7NL 3B5HA 5AAMA 5C7XL 5C09A 1EJ6A 4UNVA 5FYKE 5HYSG 3BDYH 5IK3A 1DEEA 3O0RH 3IDMA 4ZS7L 3X17A 4U31A 1JNHA 4NJAH 4D9RD 1M7DA 1CT8A 1C16B 1WZMA 3GHBL 4BUGA 2FGWH 4ZOCA 3V0AC 5DYOA 3MCLH 2X4SB 4R2GB 2D7MA 3ZKSD 5C3LD 3O3EA 2UYLB 4XPTL 4BH7B 3MODH 4MD4A 4L3EA 3KYOA 1T5WA 3G5ZB 5KSUA 5D93B 4BH8B 1FGNH 3HN3A 3SQOH 1SEQH 2AK4B 4LNRB 2EDNA 4YXKL 4KKNA 4C56B 3BAEH 2JIXA 4CVXB 1OGAA 4HWEL 2H45A 5CLTA 3RZCB 1S7WA 3QUZD 4WFEE 2AJXH 1CD1B 4YLQT 3BH9B 1PG7L 2D7TL 4WW1A 1EBAA 1NCCL 2V5YA 4MCYA 4QWWD 5CGTA 5C0BD 1RUAL 2IANA 3QWOA 2YC1B 3K4AA 4NQDE 3U4EA 5GQBA 5KVFH 5C0RL 3S3PA 5AZEH 1JPGB 2R4RL 4PJXF 1JZ3A 1ES0A 5C0FA 1WBXB 2GT9B 4HBCL 4PJ5B 3ARGC 1U8PB 1TJIH 4GRWE 4R4NC 3ROOB 1H3UA 3MJ8A 5D7KD 1ROWA 1A8JH 4UI2A 3CLFL 2DWEB 1AGDA 3MGTA 1QSFB 4ONFH 4YHLL 3BEWB 3RI5K 5B8CA 2YMXH 1J0HA 3B5GA 5EZLB 4XPHH 5I18H 3GBML 3I3EA 1V7NH 4LSSL 4NRZB 1LHZA 1LO5B 2HTKD 4RIRA 3WMSA 2H3NA 3GSVB 4E0RB 5C0AD 4ZG1A 3GSNB 2BY1A 2NPLX 3AM8C 4KVCL 4HIHA 3PP4H 4U3HA 1I7UA 4FQHA 3DX9B 1JF1A 3NFSL 3QUZB 2PKDA 5LGHH 1C5BH 1FGVH 5HGGS 5DMYA 4KDVA 2BSTB 4IBLT 5GS0L 3F7PC 2CK0L 2JTDA 3K2UL 4FN0A 3T2QA 4KI5F 5MENE 4HUNB 4R26L 1IM9D 2OTUA 2DBJA 4OCMC 2WWKT 3WSQL 1S7UB 3VWJA 3PGCB 1OT2A 4M3KB 3TBSB 5DT1H 3V6OA 5CEZH 4LMQI 4UINL 1FCCA 5C09D 4OGXH 1JL8A 4K71B 3DRTA 4KTDL 3I2CL 4DGYH 1WBYB 1I1AC 4NQXA 4N5UA 2A6KB 4X4XA 4PREB 5DO2D 3S96A 3WS3A 5E1AB 1WT5C 5C0AB 3CD4A 3QDGB 3N50A 3P73B 4ZUTB 1GOHA 3QG7L 4LVHB 4X80L 5T3ZD 1C12A 4Y1AB 3VXPA 5DJXB 4D8PA 1JYXA 4C56E 3QCVH 1EEYA 3KS0J 1MY5A 4WTZA 5H37H 1PEZA 3A6CL 5E2WH 2FNBA 1C7TA 3PXJA 3O2WL 5DC0A 1IGJB 3CZFB 1RUMH 4G9DA 4QCIB 4JKWA 1MWAA 2Y5TA 1Y6MR 1X5AA 4PJIF 3CVHA 2VUOA 4OCWH 5JHLL 2D0HA 2E7LC 1CXLA 2DQDH 1MFCH 2J1KA 4HV8A 3VRLF 4Z77A 5T3XH 2IPTL 4D9RE 3QBTB 3WUWG 3RDTA 3QUYC 5CEYB 3QQ3B 3VFRA 5KSAC 4AQOA 5JIIA 2X4OA 5JNYA 4KJWC 4OF7A 3GMPB 1BLNA 1IC5H 3T0WA 3ZTNH 4RGOH 5F9AC 2EIBA 4KHXL 1EJOL 3PWNA 1ITCA 1NUFA 3NCFB 2BHYA 3WFHB 1XF3A 3VGAB 3B3IB 4W6XB 2D9QB 3SKOA 4U6HA 3OHXA 1LQSR 5ADOL 3BQUA 5ENWA 3PDOA 4PG2A 1UG9A 3QNYA 1YY9D 4YXHH 2OI9C 4XHJD 4DVRL 1LEGB 1QBLL 1TCRB 5I1CH 2OL3H 5CFHA 3QWRD 5EU3A 2B1HH 3PGDA 3P2TA 3C2AL 3DV4A 3MX0A 2APVA 3TO2A 2ZPKH 4ZFZA 2ATKA 3GMMB 2KKQA 5C0BE 1HCVA 4OD2B 4YGAB 4OLVL 1RHHA 1CGYA 2VIRB 4FS0A 4P46B 1AXTH 1H9VA 4DTGH 4KRMB 1N64H 1U95B 4XWOC 4JFDB 1KLUB 1F5WA 2XY2A 4YDVA 4GUPB 5D7KE 1FFOB 1E6OL 2JLLA 1MVUA 5F7KC 4C4KT 4C54A 1CL7I 3QRFM 4PTUB 4RRPG 4ZXBC 4Q9CA 2A0LC 1FNAA 4U1NA 3HNSL 3RPIB 3R4DA 4JJ5B 5KW9H 4HIEA 1CICD 1MEXL 1WBZA 5C0AE 2HT4C 5GRJH 3X12A 3LHPH 3JVGC 3T1WA 4ODUB 1CFQA 1KNOB 5JPMA 4XVJH 3MRFA 4MA8L 4I2XA 5JPNA 2ATPB 4GRMB 3ZTJH 2G2RB 5E99L 2A74A 3W39B 3RRQA 1MJJB 4X8JB 3ARBA 1TZHB 2B5IB 4GAFB 1KPUA 4Q6IC 2QADB 3CMOL 2HH0L 1NAKH 1S9YB 2R1XA 3MACL 5IB3A 3H3PH 3WHXA 2C3XA 1RZGB 2CLRA 3D3VA 2CXGA 4OLZL 2QR0B 3V52L 4CMHB 2YPLA 2PYEB 1PFCA 1U8IB 2I9LA 4NKIH 4Z7QF 3PDDA 2VDOL 3WFZA 3X13B 4OGYL 4DGVL 2GEEA 3BYTA 4UIMB 2Q3AA 4I4WB 2P43B 4LAQH 3MLWH 1F11A 1OM3H 1OF2B 4HWBH 4WDIA 4KROB 5CJQL 1LEIB 4TVPL 4ZS6C 2CDGB 2JF1A 3EZ8A 3SEPA 3BXNA 5DRZA 1NBZA 1FL6A 5T3ZE 4OF6A 2ED7A 5C2BH 5BCAA 5HI4C 5HHNA 1EFXD 4ZO7A 4QRQB 5TH2B 3UZVB 5L8LB 4PR5A 5KG9A 4J3XA 1F4YH 2E9BA 3AREB 4WI5A 3VCLB 2ZNXA 1S7RB 3VMNA 3QWQB 3T0VA 5HXMA 3FQXB 1X4ZA 2P49B 1QR1B 1Q9WA 3FO1B 3W11D 4ZQKB 5GGTA 1AXSA 5K9QI 3EFDL 2EO9A 3QI9C 3UJJL 4F7CA 4U1LB 1Z5LA 4JKPL 1EK3A 4JFDE 4YPGA 4LLAA 4J7RA 3PF2A 4P23C 5C0DA 1G7MA 2WBKA 4HEPG 5E2UL 1TVBB 2WQRA 2C4FT 1OP5H 1I3VA 1A7OL 3ZDXE 3ZMRA 4GJTB 1FNSH 5DDHA 3T4YB 5IROC 3IVKB 5J8OA 3MXVH 3P9LB 1P4IH 1QFOA 4LRNH 5D6CB 3R1GL 2ZWLT 3UYRH 4U1MA 1EFXB 1RAMA 4IIQB 4Q0XL 2EYSA 2PTTB 4O2FB 1HHHB 4ZOAA 1RJZB 3GUTA 1FSKB 4PBWD 2GSGB 2A6DA 5ESQA 4CL7A 4P5TA 1NMBH 1RVFL 1EEQA 1IM3B 1UXWB 1ZK9A 5HGAA 2JJTC 2BK8A 4PS4H 5EUOB 3PIQA 2R23A 4LKXB 1AHWC 1E4JA 5FO9B 5I1EL 1P6AB 4D3CL 1UH3A 5D96C 1C5DA 1D7FA 2I5YH 1F58L 2EEDA 4QHLA 3U9PH 3CFEA 1MQKH 3W0WB 1A6ZA 1TPXB 4TNWK 2OJZH 3SDAC 1PQZA 3V6OE 4F80A 2OK0L 2CKBL 4AM0B 1BD2D 3IJSB 2A77H 5FF6B 3VE0B 5HBBA 1DQJB 1NAML 4BSJA 2NY3B 4TSCL 4GW1A 5I1KL 3K2MC 4NUJB 4WFGD 2MHAA 5TPWL 4U1GC 3BN9C 2NTFA 4N0CC 4ODWB 3QHTC 3C6LD 1MIMH 4JM2A 4UIKH 3WN5C 1KCKA 4JFXB 4X5WA 4G42A 1EH9A 1NDMB 3EJZC 3GSUA 4HUWB 3S37H 1L6ZA 2G5BA 1Z6JT 4QHUA 3THMH 4Z78A 1KELH 4LSTH 2N7BA 2B1AL 4BZ2L 3U36A 1FRGH 3S98A 5D5MA 4HUMB 1W72B 4F58H 4YGVB 1H8NA 1NGXB 5C8JB 1NLBH 3DI2B 5FKAB 3DX7A 5D4QA 4YFEA 1I7RA 3EYQD 3QDMD 1Z0MA 4KJYA 1XT5A 1D5BA 3F7VA 5E8EB 1W0VB 3VFGL 3O2DA 1IGFH 5I19L 1T3FB 1JGUH 1YYML 4M7ZB 3DUUA 3U0WH 1CGSH 2D03H 3FFCB 1MLBB 4NO5A 4PRPA 5CGYC 4Z0XA 3RGHA 4OUUA 1D9KA 3P0YL 1ZXQA 1MJUH 3QG6B 4YIQA 2X4RA 2EYRA 2PW2A 1NGZB 4OCYH 4RFEB 1C1EH 4MS8D 5B3NA 1S78D 4LQFH 1OAYH 2W91A 1N7MH 1RJLA 4BFIA 5CEXB 1IGYB 5CIPA 5EUOE 1KCUL 3G6DH 1DBAH 2VDNH 1LDPH 3RX7A 3Q5YA 4M1GL 5ICXB 2GCYB 5DJ6B 4OZGF 4DZBA 2F8OA 5DMKB 4EXKA 1P7QD 4P4RA 3QDMB 4TUJB 4PJHA 1AR1D 4NQCD 3X14B 1I8MA 1DQML 1W8OA 2PF6A 1HYSC 1BWMA 5F71A 1U3YA 3JTSB 2E9JA 5C0CA 5GZOD 4ZUWA 4LPUA 1F2XK 1F00I 3X3GL 4M9PA 4UNTA 2IH1B 4DGIL 3ELAT 4U0RB 4DN3L 2L7UA 5DTFB 3SY0B 2CRMA 5HYFA 4G7VH 2YSSA 2ZKHL 1CDJA 3FT4A 3RNKB 4Z5RA 1YEGH 5EU7E 2IH3A 2QKIA 3SBWA 3IFLH 3AFLA 3IGAB 3PG2A 5EOQL 2HWZH 3FN0H 2D0GA 2YPVL 1L4IA 5LWYH 5EN2A 2NYYD 4YDJB 4M4RA 1HEZA 4NWUL 5CAYB 3JWNC 3IJYA 2CKBB 3WJJA 3WV0A 3LKNB 2B4CC 1P7QB 2Z35B 1NAMB 3HC4L 4H1LB 2OBGA 5EA0H 4C55A 5LAXB 4NQCB 1IAMA 3EDEA 1CZ8L 2QQNL 4OI8A 1BD2E 4NM4H 1U8OA 2VR9A 3WS6C 5F9JA 1NSNL 1HDMB 3OAYH 3ZYOA 4ALAL 1DBMH 5J57B 4MAYC 1FV1B 4RGND 3ILQC 1BZ7A 1MCLA 4PP1C 3CDGB 4XI5C 4WFGE 3SDDA 1T5XB 2AEPH 1T04A 5F96H 3CUPB 1AXIB 4UILH 5ICYB 1BAFL 3GNMH 3UTTB 1UWGH 4E5XB 5IFJA 1GGCH 1B4JL 3UROR 5D1QA 3O3DB 1U8LA 3EYSH 2JJSC 3G04B 1ADQA 1TITA 3M8OL 1XGTA 1N5YL 4JHWH 1H8OA 2Y6SD 3QDAA 1VPOL 4X7FC 1WFUA 1X5LA 1T7ZA 5E00B 3OQ3B 4G6AC 5C0GA 5I0DA 2PCPA 3ZE0E 5HYSA 4OIBA 1NGPL 3O3AA 2PXYC 1BM3L 3IF1B 4H26B 1OP3H 3EOYG 4PGBB 1IAII 4WWID 3STZA 3TBVA 1GAFL 1G6RA 1OTUC 5I15L 1CIUA 5I6XC 1OAXH 4LCWB 2XN9D 3QDME 3D48R 1EXUB 4NP4H 4YDKL 1U8JA 1CBVH 3SDCD 3QFJA 3REWB 1U8KB 5E08L 4GRLD 2IAMB 1AY1H 1V7MH 2DRUA 2J88H 3M07A 2YKLH 4YHKL 5DK2A 1K6QL 2YHGA 4HFWB 4WI9A 1EGJL 4Q2ZB 4I0PC 3JWOH 5FGBA 1NFDA 1CG9A 4YQXL 4PJ9C 4QRSB 4WGVB 1IC1A 4MNQD 3FB7B 2VDKH 3KGRA 5GGTH 4MJ6B 1QLEL 4GKSA 5F3HA 2I9TA 4L1HA 4JN2A 2XNAB 3AS1A 2J6EL 4RMQA 2ITDA 5D2LE 1X44A 2EDBA 3S35X 4QXWA 4BFGA 1HOCB 5I76B 2J8UB 1J0KA 3V9FA 2XN9B 3KWWA 3SPVA 1E6JL 2E7BA 3P4LA 4Q6YA 4NQCE 4P57A 4U1SB 5D6DC 3RI5F 2BY0A 3D25A 3GO1H 4OFVA 4H8WH 1IARB 1NLDH 3CC5B 3OKLA 4EI5A 5T1LB 4DEPC 4GRLB 3TZVD 1RU9L 2NW3B 1JCKA 4Q9BA 2YA2A 3GI9H 4F2MA 4QOKA 5J56B 5IM7A 1I3UA 2W9EL 3QUXD 4LSPL 1NGWA 1K2DB 2D4FA 5IMKA 1A7BA 3CFDA 2L7JA 5C86A 3AS0A 1QBMH 2EDRA 1OT1A 4O51A 5F3BB 5DD5H 4MNQB 2F58H 3SDDD 5D9SA 1GGBL 5GGUB 2DQCH 2HJKB 1UJ3A 4RMUA 1I1YA 5BW7C 3LEXA 2R69L 4LSQL 3Q6GL 4U2ZA 3VFTB 3TN0C 4M7JH 3VWKB 4YR6A 4GW5A 3TBTA 4KAQL 2NY4C 4QYOB 1GSMA 1T22B 3KPSB 4LCCC 3UYOD 2OJEB 3O8XD 2DMKA 1I8KA 1QLRB 4GXUM 2EDYA 1B4RA 4B53A 2Q6WB 4NZRL 5B38A 3QISA 3TZVB 5TF1L 1JGEA 5FGSA 3L1OH 1NFIB 4YE4L 2P7TA 2J8OA 2V2WA 3RA7L 4OCXL 3DPBA 1F8TL 2H32A 3V7AG 4XXCA 1Q9OA 2XYCA 3MLXH 1T1XB 2DIAA 2PYFB 4POZD 3ZSSA 3NCMA 5FHBL 1I1FA 2XKSA 4FFVD 5IF0A 5KSVA 1QEWB 2R2HA 4NM8H 5I0ZA 1CDUA 3FQWB 5IHZA 4AIZB 2A2QT 4PGDA 4Z6AT 3NIFE 2NY1B 3MRCA 4AT6B 3L5HA 4X98A 3HCVA 5KVEH 1ZOXA 2CUIA 3DRQB 1A7RL 3QRGH 2BY2A 4R0LB 3HE7A 3MRLB 3BPOB 3MRMB 5FUOH 1MCOH 3LN9A 3BKJL 3OPZH 3UZEA 3O8XB 5BRZD 1ZT1A 3MLVL 2E8YA 3F6LA 2J8UE 5J6GB 3BWAA 4H88L 3O2DH 2XN9E 1ZGLB 2QSVA 4MGXA 4X9GA 3NAAH 5FV2A 5IJKA 2OTWA 2EH8L 35C8H 4XWGH 1QOKA 2NY6D 1EO8L 3IFOA 5TJWK 3BEVB 1JWUA 1FC2D 4N8VB 5EBLA 4YNYA 4YDLB 2FWOA 4MJ4A 4G9FA 3FT2A 2M1KA 3VFNB 4NHUB 2CLVB 4JQXA 1RIHH 4EI5D 1J10A 4XXDA 3GSXA 3RAJH 2JELL 4NCC1 4HK0B 3QIUA 4M6NL 2NY2C 4QOKD 1CDCA 3JUZA 4MNQE 3VI4E 2BNQB 4L3AA 2DI9A 3V6FA 4ONHB 2BJMH 5GGVY 1M05A 3OJVC 3EBAA 1NC4A 4F8TA 4W70A 4RWYL 4F9PA 1IAKA 2Z31D 2X1WL 4OZFB 1PSKH 4NBYB 4UB0H 5BRZB 1Y18B 4KZEH 3ULUL 4GG6A 4NNPH 5C08D 3RWJB 2C1PB 3FN3A 4CDHA 3DARA 5IUSA 2F5BH 5F6IC 5JW4R 4XRCA 4XP6L 2DKSA 5BOZG 4GKNB 4U6XB 3KLAB 2NY6B 1GRWA 5T1DL 1ERNA 4RRPA 2BDNH 4PY7B 4WHCA 1OCWL 1VERA 4IHOA 1MHPL 3RVTD 4GKZA 2VXQH 4WY7H 4I13B 2AV7A 3BN3B 5HDQH 3LRGA 2CIIB 2J5LB 4FQLH 4JFOB 1KN4H 2A83A 1EFQA 5SWQB 3S35L 1X7QA 3QPXL 4U05A 1ZA3B 2DQEL 3WFBH 3L3GA 3H3KA 2X4SA 3VXMA 3G08B 2W0LA 1UC6A 4EBQH 3QT2A 3V0VA 2Z31B 4NDMB 5CD3A 3K1DA 1WCBB 4PIRF 4NHCH 4GS7B 4L8SA 1KENH 2OSLB 4BH8A 3E6FB 3IAPA 1FVDB 5IW1B 3TEUA 5FA3A 4O4YL 4R7NA 5MEPA 4X6EB 4JY4B 5D7IF 1ZT7B 3LN4A 4L9LC 3SGDH 4MQTB 1U8QA 5EBGA 2B2XH 4YFDB 3E1F1 4OCRL 5GS1C 5J06A 4WHDA 4JRYD 3V0WH 3RZCA 2ICEB 4NKMB 9CGTA 1OOAA 5D70H 1FFNA 1CD1A 2C3GA 1XR8B 4UBDD 1BJ1H 1UM4L 5EUKB 5D7IB 2Z91A 1BPVA 5EPMB 4UDUB 3AC0A 1ADQH 3DUSA 3ULVL 3QEGL 2H2SC 5C0IB 2YEZB 3MROB 4Z7WB 3F65A 3ZO0A 4B7IA 4G9FD 1WBXA 4ZUSA 4AH2B 2W59A 4FHBD 4PJ5A 4WV1B 5EORH 3TCLB 4GLRI 2BNQE 3LV3B 1Z3GL 3MSPA 4PBXA 5EOTB 1RFDL 1TETH 5HHPA 3GMQB 3ZKMC 4UAOC 4GBXA 1B0GA 3EOAB 5GISH 3F7YB 4PJXA 5E5RB 4XAWL 1JJUA 5BRZE 2UY7A 3A67H 3Q2CA 5CZVH 5IIEA 1NC4D 2JJUA 1DSFH 1Y0LB 3GSVA 3IS1X 4E0RA 4S0TD 5SWZA 1J1PL 4WO4D 1X6NA 2UWEA 3CMGA 4XPGL 3MJ9A 5EC1B 4JRYB 2XA8H 1OP9A 2Y7QB 5E8NA 5B4MD 5ALBH 4X0KB 4ZTOH 5CP3A 3HZKB 3BESR 3UYPA 2QSCL 5FDWB 2VISA 1JYNA 5HYQB 4CNIB 4JG0L 4ZSOB 1T66D 3ORJA 1CD8A 1YEIH 1BP3B 4TTDC 1WFTA 3ULUF 3L9RB 3MRKA 4KQ3L 1S7UA 3VXNB 4QOKE 2IBBA 3TBSA 3RFZC 3IXAA 1A3RL 2E27H 5IB1B 1QA9A 3WDHA 2ICWA 3VFVB 5LXGH 3L7EA 3D2UA 1RZKH 3TNMB 3TVMD 5DUPH 3DBXB 3KYKL 1MCPH 1FJ1A 2NY5H 3T77A 3VXSA 3QZWB 2DQUL 4U33A 3REVA 5C08E 1NPUA 4PREA 1GC1L 3G6AA 5FM5M 3HR6A 3IXTA 3MR9A 2HN7A 1LILA 4R7DB 4TNWF 3QDGA 4WO4B 1PY4A 3QCTH 3EDKA 3CK0L 3NTCH 5AWNL 4HUKB 1FDLL 3IS0X 3LEYH 4HK3N 1RURH 5TE7H 1JYVA 1BFVH 2ZUSA 3F8UB 3MBEB 2WIIA 4Y5VB 3CZFA 4ONGL 4S1RL 4HKBA 5BV7L 3I6KB 2HAZA 2GJZB 3RY6C 3C8HA 5DHVA 1WUNT 3L3OB 2WBJA 3TA3A 1KJ2L 1CLOL 4JGMA 3PHOB 2V17L 4Z7WE 1H5BA 5IR1B 3KR3L 4YUEL 4U6YB 1A3LH 4XMPH 1P69B 4PJIA 1LE5A 3BJLA 1C7SA 3KYMB 4K3EL 3OG4B 4JY6A 4MJIA 3HHRB 3HNVH 2BC4A 3SE4C 2DI8A 4UQ3B 1UWXH 1G9NC 3FOLB 4WHYG 1G7LA 5EU4B 3RTQB 3V6ZB 3ARZA 3ULVF 4N8VG 1IAIL 1J0IA 5ACMA 2HMID 1J88A 4PLKC 2HFGL 3BKYL 2QL1A 1T1YA 4JRYE 4L4JA 4P5KB 1VSCA 5C6TH 2FCBA 1UQSB 1CLYL 2XZAH 1IC4L 3DVIA 3MRDA 4ZSOE 4EEEA 2OLDA 3L3KB 2IBZX 2NNAB 4UV4L 2B20A 4Z7OF 1NGQL 1HKFA 1UCBH 3TPUA 3G5YA 4OZFG 3UBXI 4BJLA 1XCTA 2O5YL 1I3RB 2GYSA 4G9FE 4P46A 3E8UL 4HWNA 3D39A 2XV6B 4EOWH 2AQ3A 3QFDA 5IESH 3FKUS 5FKPA 4MXQD 5J11C 1KTKE 4APQB 1KEML 4HD9A 5D8JH 4L8DB 2ADGB 4G7YH 4KI5D 1NC2A 2A38A 5JUEL 3D2UD 3EO9H 4BZ1L 4PYHA 4GMSH 4OV6F 3FQUA 4YWGL 3VFUA 3VXSD 1T89C 1KNOA 4WJ5B 2XZQL 1T80A 1S7TB 3OAUH 4GRMA 1E4WH 4X4ZA 2BNUA 2HJFB 4JFZH 5TE4L 3GSOB 3CU1A 3Q3GB 3B6SA 4KK8C 1CFVL 4PV9B 1HILB 3T2NH 4HG4K 5EC2B 2ITCA 2VLJD 4KK6C 2OS7A 5F1OB 1R3LB 4JR9L 4G8EA 5IBTL 1BVLA 2Y1VA 2BMKB 4YBQC 2FO4A 1OQOA 3R06B 4R4BB 5DLMH 2YD3A 4WI2A 4H0HB 1NGYB 2WUCH 4XZUA 2QR0A 3O6MH 1KC5H 2VLRB 4PJEF 1J5OL 2YD8A 3C08H 3DMMA 2X4QA 1EZVY 1VHPA 3TA3D 2C3HA 3X13A 2DM7A 4PJDF 5ADPL 4I4WA 4JVUA 15C8H 4NZUL 1A6PA 4QKXB 3VXRB 5EB9A 3SO3C 4PJEB 5CMAB 3UTOA 3O2VL 3CSYB 4P2OC 3H2WA 2VZUA 3CGTA 1AFVL 1MCNA 3MO1A 2Q86A 1EMTL 3AAZA 5EU5A 4Z7NE 4R4FL 4YXLL 1ZEAH 2RBLA 1P1ZA 1QVOB 2ILLA 3V5HB 1NANH 4PJDB 1FN4A 1KXQE 3MRHA 2X4UB 2FATL 4OTXH 3WO4C 2VLJB 3RKDD 1XGPB 1F3JB 3DOSA 1ZHLB 3UTQB 5K9QG 3AREA 1A6WL 2FX8L 1MCRA 5ESAB 3B9KB 2VABA 3FQXA 5DQDL 5LGKA 5DC9B 5CCKH 3F12A 4X9IA 1FVEB 4ODXB 4BKLA 5IHUL 3L5JA 2VXUH 2AJYL 4ZTPH 3C6SB 5H94A 3MUGB 4WW2F 2CLZB 5JTWA 2X1PA 3O4LB 3QXUA 3HMWL 4DK6A 2F54B 3TO4B 1NKRA 1PAMA 3L3HB 2IFFH 3BGMA 3IYLW 2DIBA 5IGXL 1E0OB 2GTZB 3UJIH 1F42A 4WW2B 4DQOL 1T1ZB 2NZ9D 2CK2A 5FYJU 2I07A 3O41A 4PJ7F 3SQBA 1V3MA 1W2KT 5HHOB 2K9UA 3FMGL 3W81A 3WDJA 3BP5A 4PLJD 5I1IL 1HI6B 4OZIF 3V4VL 4O2FA 1U3ZA 5KTEL 4ZD3L 3S34L 1AGEB 1Q9KA 1SVCP 2UWEE 2B39A 4NC0B 3BOVA 3AM8A 5I8CB 1IM3A 2MQ3A 2ZCKH 2A73B 5D1XA 3HR5A 3RWFB 4DKDC 1SJXA 5I75C 5FO9A 4OZIB 1CE1L 1JHTA 1DN2A 4RMTA 3GSRB 4HS3A 4ODBD 4H20L 4M1DL 5IQ9A 2VLRE 1P7KA 1M6OA 4OT1L 4J8RA 3U0TA 3W0WA 1GL4B 3OB0K 5FYJL 3PL6C 5IFAL 3X3FH 3ARDC 3DETC 5E4EC 4AM0A 4NRXB 3U79A 5J0BA 3ARFD 3M1BB 1I85C 3BIBX 4KKAC 5CP3H 5IW3A 4YHML 3ZE2E 43C9B 1T0MB 1YEJL 2Y07L 3AMKA 1QUNA 3AY4A 1JGLH 3NABL 1T21B 2VLJE 3KVQA 1XF4B 4HUWA 4MD5A 1HYRC 4NYLA 3FN9A 3VXTB 3BKCL 3RX8A 5I1AA 1R3JA 3ZHDA 1OPGH 1I8IB 4WGWB 2H26B 4P4KC 4LLYB 2VXVL 4AY0A 5TQ0H 3BKML 5IFHL 4DKFL 2BVUA 1BX2B 2YZ1A 1I7TB 3SKNB 4RMRA 4DKEH 4JREB 3ARFB 1OGTB 4JG1L 2YD7A 1S9WA 2FX7L 5GHWH 5DZLA 1HZHH 2VXTL 4YDIH 3S36X 3EDDA 4X9BA 4PJAB 3BGAA 4WCYH 3KNBB 1A7NH 5EO9A 3WD5L 1NBYA 5JOFA 4HC1L 2FHCA 2XG4A 3ARGD 1OTSC 4ZS7H 1NJ9B 4L8BA 1NGZA 3GHBH 2Z0BA 4L8CB 4WI3A 3OZ9L 1BIHA 4F15C 5FCUL 3OR6B 4JB9L 3STBA 3CSBA 4PJCF 5DHVH 2Z8VC 3RL2B 4HPYL 3D18B 2X4PA 4LHUD 2NLJB 1CFTA 1K4CA 5IW6B 2E7HA 1RPQA 3NZ8A 1DQQB 1WWAX 3ULSB 3S5LB 2GFBB 3L3JA 4PJCB 5D1XD 4YXKH 1AGFA 3V95A 4NRYB 5ID1B 1TTGA 3W9DB 3G6JE 1CFNB 1F3RB 1M4KA 4HWEH 3CDYA 5TDPA 2WWMC 5HDOA 1INEL 5FCSH 4MB3A 2NXYD 3MV9D 1PG7H 2D7TH 3LDBB 1DLHB 1NCCH 2EKSB 4OZGA 3MUZ1 3WO3B 4HWZA 5E56A 1HQRB 1RUAH 5EU6A 2OR7A 2FR4A 5EFIA 3ARGB 4MNGB 5C0RH 1A0QL 4LPXA 5DMGD 2R4RH 5LG1A 2H9GB 1PD6A 1A6AA 4MWFB 5E9DB 5FHAL 3RGVC 3RNKA 3RY5A 5HGBB 5I1LA 3OKEA 2EO1A 1I1AD 3CLFH 3BZ4B 1RZIA 1F02I 3T1FB 1MCIA 1HHJA 4YHLH 4ERSL 2QV2A 3GBMH 4LSSH 3O6KH 3T0EA 3QO1B 4QRRD 5E2VL 3KLDA 3MRNA 4HS8L 1PZ5B 5C07D 2GI7A 2FYYB 2EYTB 1SY6L 3NFSH 3IJHA 5I73C 1QLFA 3CPLB 3H9SB 4K8RL 3MV9B 5BJTA 4P59L 4ELKB 2BOBB 4A2LA 5GS0H 1AC6A 1FV1A 1OSPL 2CK0H 3K2UH 1VFUA 4XMLH 3P4OA 4R26H 4PJAE 4QT5B 3QUYD 1Y6KR 1UM6H 2X40A 2EIEA 3WSQH 4KJWD 4LAJH 4JGUA 2VWEC 4QNPE 4K3DL 4UINH 1CD9B 3TCXA 1FFQA 1I1AB 1JRHI 1UB5B 1HIMH 1DBBL 2W9DL 4KTDH 4JFPA 5L9DL 3I2CH 3QEUB 4QXUL 3MLTB 3HZMB 4AEEA 4F3FB 1M71A 5K9OB 3K46A 3IKKA 3RY4A 5JW3L 4JPWL 1EDQA 4NSKA 1ZHKA 3C60B 3DUHA 2AKRB 1KIRB 1T2XA 3H9YA 4PGBA 3QG7H 3HZVB 4X80H 4WI4A 1UWEL 3DURB 1BJ8A 1HCFX 1D5XB 4FRWA 4NKDA 3JV5A 1LK3L 1OB1A 4M7LH 3A6CH 3WXWL 3O2WH 1SEBB 1QYGL 1XGUA 5DA4A 2FL5A 3UDWC 5EWIL 3HC0A 4F7MB 1K8DB 3KXFD 4OBRA 5DI8A 5J1SC 4P23A 5KSAB 5JHLH 4NZTH 4OJFH 4MNGE 4XWOD 3EO0A 3MRGA 5AYQA 2IPTH 1L9MA 2FEEL 4P5MB 2ZG1A 2X4NA 5IROA 3NPSC 4LK4A 1N4XH 4D0BA 4F8QA 5AYUL 2QQKL 1J05B 1S7QB 2A0LD 3IFPA 1I3GL 2ZUWA 4KHXH 2MCPL 1EJOH 2CMRH 2APFA 2APTA 2HT4D 4G8GA 3VH8B 5F1NA 2HLAB 4ZODA 1QD0A 1T0NB 3BW9B 3CCHA 3OR7A 2EE6A 1TCMA 4GQ9L 4OF3A 3SKMB 5I76A 3T0XA 5ID0B 5FB8B 2W65B 5JMOC 3Q5TA 2PTUA 3S36L 1FCGA 1OLLA 2FBJL 1GOGA 3VMPA 1QBLH 1T1WB 4TSAL 5JDSB 2GSIB 3LKRA 4OV5A 5KAQF 3E2HB 1A47A 3IDGB 3C2AH 3MV9E 5A1AA 5F93C 1CU4H 3ZDYF 1MI5A 3KXFB 5T1LA 4G3YL 1JV5A 4CVZA 4KV5F 5IMLB 1UM5L 1YY9C 2WINB 3SDAA 4C83B 2MKLC 4OLVH 1XR9B 3Q1SL 2DBLL 5B8CC 1VACA 1MFEL 1MAKA 3LY6A 4WUUA 3RPKA 1KIPA 4OLUL 2ZSWA 3T4AB 1UA6L 4ZXBB 3QXWA 1C8PA 5GGUA 3OKNA 5ESVB 1E6OH 3NCYS 2BVYA 3E6HB 1UXSB 2ZSVB 4F57L 1M1SA 4ZS6D 4LVNC 2EDTA 3WN5A 2VKXA 3FB8A 3C09B 3HNSH 3HTLX 1DQDL 4QRRE 2G9HA 1MEXH 3BZDA 5HI4D 3KPSA 1T22A 5DA0B 5C07E 2OJEA 2R2EB 5GSVB 3KPTA 1C08B 4MA8H 3VWJC 4IJ3C 1TFHA 1W0WA 4Q6IB 3T8XA 1QLRA 5E99H 4HDIA 1OAKL 4PRIA 4HS6A 4CADB 1WIOA 3RWIB 3EOTL 4FFWC 4K94L 4P2QD 3CMOH 3OWEA 1B88A 1NFIA 2OXGA 2HH0H 3WLWC 3MACH 3QUML 4DFHA 3UTSD 4BUHA 1KV3A 3SGKA 5CBEB 4OLZH 3HAEB 4ODVH 2PYFA 3V52H 3KPMA 1Q38A 4P23D 3CAFA 5H2BA 4G80B 3GSWB 2CDEA 3K80A 5I8EB 1LD9A 1KUMA 1DVFA 3GHEL 3PNWA 4O02L 4OGYH 2GAZB 4DGVH 2XI9A 5CLWA 5A3ID 4L5FL 5IMMB 1MHHA 4LLDA 2VR5A 1BFOB 2ERJB 4LLMA 4PJFA 1D5ZA 2CIKB 1WFOA 4L4TB 4LDOB 3OKMA 3MRLA 2ADJA 5CJQH 4U1KB 4TVPH 5BQ7B 1S8DA 5IHBA 1WWWX 4L9DA 4G8IA 1R3IL 2Y06L 4G8GD 2P5WA 2K3TA 4X6BA 3PWPB 4X99B 3RDTC 1FPTL 4A6YL 4MJ5A 1G7IA 1DE4A 4P2QB 2XIDA 4NN7C 5D71L 1HHGB 1EGJA 1F6AB 1IEAB 3MRPA 5ITFA 3KXFE 3GIZL 3BEVA 4GO6B 2VN7A 3UTSB 4N8VA 3QI9B 2VERN 3CH1A 4PRBA 2E7MA 2OR9L 2L4OA 2CLVA 4XC3L 1YMMB 5L7XL 2NR6C 4IMLB 3VMOA 5JW4M 3EFDH 1BIIA 3BQUC 5E6IA 5BS0A 3VFPB 3UJJH 1AO7D 3PWUA 4JKPH 3SDAD 4W6WB 1P84J 5CP7B 4WFHD 2J6EA 4JAMB 1FE8L 2YN5A 4WUUD 4FXGA 5E2UH 2ESVD 1R24B 3W11C 5TDNB 4FTVA 5DQ9A 3QP3A 5IB5B 4OKVB 2EDKA 2R1WA 2VE6B 3OJMB 1K9TA 1MLCA 1DBJL 1NMAL 3C5JA 4FFYL 3RWJA 5D2NA 3BN9D 3MOQA 3BPLC 4N0CD 3KJ4B 3O3BB 3R1GH 2P8MB 1RK1B 1QPXA 2BVTA 3FB6A 3EJZD 4U6XA 1KPRA 1G7QB 4YAQB 3C8KA 4UT9L 2VDPL 1OAUL 1AHWB 3WHE1 2Y9RT 1RVFH 3ROLA 3SGEH 2X1OA 4ODTL 1N2RB 5D96B 1R5WA 1FQ9C 5JOPD 5DFTA 4LVOB 4OF5A 5EBWA 4DJMA 4NFDA 4D3CH 2CIIA 3O81A 1AO7B 4JFOA 4ZO8A 5TQ2L 4RAVA 1F58H 1ZHNB 3IETB 4IDJL 4U1IA 4UT6L 4EIZC 2ARJA 5F7NC 5KVDL 1PX3A 2YXMA 1WV7T 1OARL 4PB0L 3L3DA 4I18A 4R97C 2ESVB 2OK0H 2HRLA 4KKLC 5FXCH 2CKBH 3OG6B 3QPQC 3ARBC 1AD9B 1G6VK 3LS4L 5CGYD 4AENA 4TSCH 3HC3L 4YO0B 4U1GB 1WTGT 3AROA 2AXFA 4QHKI 3SGDI 3O45B 1H3PL 4XVTL 3EJJX 4QRPB 3GM8A 5J3HC 3HRPA 4X6EA 5FYLD 5TPWH 3VI3E 4MDJB 2IFGA 3QUMB 1O7SA 1UVQB 1LWRA 4OZHA 1JN6B 1B90A 3KPOB 3WBDA 1QFWM 4HIJA 3TYGL 4HWUA 1LNUB 2UZIL 2P5WD 4P2QE 2NX5B 1A6TB 3KPQA 2VL5B 2Q76A 4FQ1L 2WW8A 5DD6A 3UTSE 1J18A 2ENSA 1KJ3L 5DSCB 4WENB 4XCYB 2BSRB 4JPKH 1MRCL 5T33L 4OQ1A 4TOYL 4BZ2H 1ED3B 1AIFA 5EZIL 2K7QA 4HQQL 4PY8J 4XX1G 4F7EB 4FXLA 2X44D 4CVUA 3OV6A 3PWJB 1RHFA 3ARWA 3VG9B 3GGWA 4I0PA 2VC2L 1OLZA 4QGTA 4M6ML 3VFGH 3MOAL 3BSZL 5I19H 5DF0A 4A6YB 4LEXH 1YYMH 4G8FB 3JWOC 4HW6A 2HYMA 5IBUG 3QEQA 3MRQA 3P0YH 4HKXB 3HPJB 3MV8B 4PRHB 1YEKL 3EYQC 5IQ7L 4E41B 3VDAA 5KAQG 1QBAA 3MZTA 3M17B 4KRNA 5D7LA 1AQDB 3TLRA 5FFLA 4CW1A 4CVWA 5TE6L 3HE6A 5DQJB 1IVLA 3P4NB 3TC9A 1KCUH 3W5MA 2IADB 1JZ8A 4M1GH 2C3VA 3ZHKA 5HPMA 1AO7E 3NFPB 1P2CA 1AGBB 3O11B 4WFHE 5I30H 4WUUE 1YUHB 1MREL 2ESVE 1DQMH 5F1SA 3RVUC 4G43A 4M00A 4ORZC 2FGZA 4P5TC 1WEJL 1XCQA 4V1DB 1KN2L 4ODSL 4PP1D 1QHPA 4XI5D 5T1MA 4LMQE 2YD2A 1U58B 2XWJA 3X3GH 4EN3B 4XVSL 4R7DA 4GAYB 4DN3H 1OAQL 4QRPE 2BSED 4MNHB 2B0SL 1KIQB 3TN0A 1TVHA 2P1YA 5T5FL 1BJ1J 4PGEB 4UDTB 1MCEA 3BZEB 3HG1D 1GVIA 3N1MC 4BSVA 5GZOC 5F7DB 2W9LA 5TGBB 5ELIA 1CQYA 4G6AD 5JOPE 1AGCA 3U0PA 2GY7B 3P0GB 3TT3L 2V7HB 4AIOA 3I6KA 2KQMA 2PXYD 4HJJL 4FQQB 4N9GA 3TJHD 3T3PF 4NWUH 3QDJB 3HPLB 4MSWB 5DRNB 5FM8A 1OTUD 3LRHA 5DJAB 2BVOA 1BQHB 3P9MB 3HC4H 2OXHA 2WK2A 1JRHL 3RNQB 4JKLA 1CFBA 1CZ8H 2QQNH 4MAYB 1UCTA 4ZNCD 2AEQL 4KI1A 3ISWA 4JM2C 2VUYA 2LVCA 2YRPA 4ALAH 4F33B 1IQDA 3MLUL 5FUZL 4OFPA 2DLGA 5E5MA 2AQ2A 4I0PD 3UZQA 3K74B 5FYLE 1KB9J 4PJ9D 3UPRB 2G60L 1BAFH 4KPHH 2JJVA 1M7IA 3PABB 3P4MB 3TIEA 1KG0A 3HG1B 3BUTA 2P5WE 4XP9L 3NFNA 1NEZB 1B4JH 3V7MA 5INCA 3BWUC 1EEUA 1UQSA 5A2KH 4RGNC 3M8OH 3FQNA 3NOIA 1T03H 1N5YH 1A9EA 2BY3A 4JFEA 1VPOH 2P24B 3ARQA 1A7PL 4JY5L 3U30B 3HMXA 3UMTA 1DANU 2O5XL 3BIAX 2NNAA 5D7LD 4XP4L 1EAPA 3O4OC 1PG7W 5I6XB 1NGPH 3HE6D 8FABB 1BM3H 1GGUA 1N8ZB 1GAFH 4HCRL 5B22A 1D9KC 5HGHB 4ZDHA 3SE3A 1LMKA 3RWHB 1PZUB 3EJYC 3Q6FA 3GSQB 3GM0A 4HHAA 4YDKH 1MCJA 1VADA 4PJGA 1DL7L 4NT6B 3W9EB 4U1JA 1MFNA 5E08H 1NL0L 2C4XA 1Q9LA 5GS2H 5K9JL 4FQXC 1K3ZA 3WNMA 1N5AB 4YHKH 3KPNB 1K6QH 3HI6L 2VH5L 1EGJH 3RUGE 4WHYH 3RWDB 1AJ7L 2IALB 1BJMA 2FLBT 2ZJSL 3FOMB 4YQXH 2HJFA 2C1OA 3LN5A 2O93L 3BZFB 1I9JL 3QEHB 1C5CL 4NC1C 1QLEH 4PV9A 4GW4A 4M61A 3TN0D 1CFSA 3T65A 2NY4D 1CXHA 2GK2A 2J6EH 3BYYA 5I66B 4R4BA 2XKUA 4Z0BL 5EIIB 2DYPD 3JZ7A 4H0GA 4J3SA 4BYHA 1E6JH 5CZXD 5GPRA 4DEPB 2BVQB 4OZFH 4W4OA 5HDBF 2DQJL 1JE6A 2R0KL 3TV3L 1CL7H 1AQKH 4ZPVA 4Y2OA 2AV1B 3SBWC 4HZLA 5ETUB 3F6IA 1BVKA 3BISA 4YPJA 4E42B 1RU9H 3FQRB 1FFRA 5EZOL 4PJEA 5CMAA 3H7BB 5DJCA 3DI3B 4NGHL 3MNZB 1ETZB 4PGZA 2W9EH 1CYGA 3ZL4H 4LSPH 2XTJD 4QHMA 5HJ3A 3TBWA 2C7UA 1NCBL 1KYOJ 1QVOA 3WJJC 2J3SA 4LBEA 4IRSC 2X4UA 3HG1E 1GGBH 3GJFK 4M62L 1MCWM 4NKOB 1MNUL 4ZFFA 1ZHLA 1KJ2A 4OZHE 1KF9B 5GS3A 2NCMA 1DJSA 4LLQB 4LCCB 2R69H 4LSQH 3Q6GH 1YN7B 3LKQB 1T83A 1FP5A 1RI8A 2DYPB 4XNYL 4KAQH 1SQ2N 3MA7A 5E03A 32C2B 1P6FA 1U93B 4EJ1C 3ARPA 3SDDC 3MRRB 3TP4A 3NZHH 3MUGA 5DGRA 3BD4A 3O4LA 5ANME 4IOFC 1CGTA 4Z7UF 4NZRH 1TVDA 1XIWB 5D1QC 5TF1H 3TO4A 4HUXB 3RWGA 4YE4H 3P11H 4KHTL 3RA7H 4ZYKB 2FJGB 1F8TH 2NY2D 4TNVK 1JZ5A 5F7MC 5HHOA 4Z7UB 4X6CF 4YHNA 5FHBH 3OKDB 5F8RC 5FECA 4LKCB 2ZG2A 3F5WB 1S5HB 1T7YA 2JCCB 1J8KA 1HXYA 2R2BA 3INUL 2HT2D 3EHBC 1OW0A 4PJ7A 3IT8D 5D7LE 1A7RH 1BZ9B 3RWFA 4M6OL 1ZA6B 4R96A 4OZIA 3DYPA 1UYWL 1RK0B 1N3NA 3BKJH 3MLVH 1CQKA 1YDPB 4I5BB 4H88H 1A2YA 5I17A 2J2ZA 4X6DF 1AKJA 4OZ4A 4C59B 3BPCB 5FGBC 4MDIA 4RA0C 5L8KB 2AGJL 1U3HA 1EO8H 1JWMB 2VSCA 3L6FB 2GJ6A 5JHDA 3EYVB 4JRXB 3M1BA 3SJVD 2EH7L 2HJLB 4X6DB 2BOCA 1U92B 5I8KL 3MFFB 5T1KA 1MF2H 4URTB 3ECBA 3HUJF 2JELH 4OQTA 2VAAA 5BO1L 4M6NH 1T2JA 1RZKC 2W60A 2CRIA 2NY5C 1BECA 4KRPC 4LP5A 4RMSA 4HXAL 3DX6B 1IQWL 4ETYA 3MJ6A 1FO0L 3VFSA 2XWBB 3UTZB 4RWYH 3NCCB 5DFWH 4N1HB 3U7YL 4OGAC 4EI5C 1YQVL 3OJDA 1IAOA 1SBSL 3O9WB 3ULUH 5B3JE 2VR4A 3I84A 4IRZL 4RZCA 3SDXB 5IV2A 2R2CA 4N8CL 2GITA 2DIJA 3BH8A 4ZO9A 4XP6H 4LCYA 1VEMA 1IFHL 4GAGL 5EZJB 1A6VL 4MXVF 1QZ1A 3G9AB 5T1DH 3HRZB 5F88B 3H0TB 4YFLI 2FJFB 1NEZG 1OCWH 3SJVB 3JTTB 1UJ3C 1DDHA 1MHPH 5DRWA 2VZSA 1KJMB 2H2SD 3LZFL 1QRKA 2P8LA 5E8PB 1YYLL 3KNBA 3OKOA 4FQCL 4P49A 5FA4B 3D85B 1NCWL 2WQ8A 1JMXA 1E28A 3S35H 3QPXH 2DQEH 5E94B 4LGSB 1LE9A 5CKAA 3ZKMD 1U91A 2JCCE 3QNXB 3U4BL 5E24E 2W38A 2WWKO 3RL2A 3B43A 1XF5B 2X2YA 2X7LB 3OL2A 3L95B 3GKWL 1KPVB 1MAML 4L9LB 5E8DL 3RWCA 4O4YH 3ULSA 3LKPA 1G7JB 5ISZA 5GS1B 4PJCA 4XXCC 4NRYA 5ID1A 2DS4A 3L3IA 3ZDZF 2DWDB 3D87B 4NQSB 4OI9A 4OCRH 3TFKC 3ILPA 5MEQA 4TTDD 1G7HA 3V6BR 5F70A 3C5ZC 3CNKA 5DJ2B 1CVRA 4MQXC 1UM4H 1HINL 2VLKA 2OZ4A 3DSNA 2VQ1A 3IDIA 3B4NA 1RIVL 3HE7C 5SV3A 1JK8B 3TPKA 2AJUL 1GXEA 3ULVH 5JHDD 3QEGH 3LRSB 4EIGB 3OXRB 5IEHA 3K7UA 4XPAL 4YHZL 4QY8A 1E4KA 5T1KD 4G6KL 1WIUA 5J12C 4MLIA 3VFWB 1Z3GH 5IJKC 1T89A 1RFDH 4UBDC 3S88L 2VLLB 2ICWJ 3BZ4A 4RNRA 1KJVA 4DOHB 1T20B 4IDLA 3TGXA 4AK1A 4XAWH 4DVBA 1DQTA 3SDXE 4JQXC 1J1PH 4RFOL 2XZCL 1MH5B 5J1AA 5L6YL 3QIUC 4XCEB 4Y19D 5ACZA 1KXVC 1FZOB 3VGDA 4D94A 1BHGA 1A7QL 4WWKA 4ELKA 3ETBF 3SJVE 4NOFA 5KS9F 5IVXF 4JG0H 4X4YA 5HVWA 3STLA 3F62A 1DZBA 2QQQA 4F9PC 1IZKA 2EDXA 4LCUA 3PQYB 4KQ3H 5DJYA 1U6AH 2RHEA 1CDIA 2M26A 4NO0B 1A4JB 4RGMC 2EIZA 5DURB 4WIQA 4KZDL 2ZNWA 1A3RH 5IVXB 3U4AA 4J12A 4A2MA 1S9VB