5JIPA

Crystal structure of the clostridium perfringens spore cortex lytic enzyme slem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
b'GFAQDKNPLSTFGPDLNEFSRDVNFLTLAKNSDFIYLRASGSGTGKLRIDNKFLEFAKECRRLGIPCGAYHFAKPSKDLDSAVIQADQFIDVLQQGFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTDEGKLDGVGSPVDLNWGPNSIDSLMPPSAVTGLNAYISGNKIFVNWTANKEDDLNGYNVFVNDNYAGTLPRKATKIVIDKSRFYLPKGKPIKISIEAFDITGDFSKERTEYILDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cortical-lytic enzyme
publication title The crystal structure of Clostridium perfringens SleM, a muramidase involved in cortical hydrolysis during spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 95
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jipA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5jipA01
3BH8A 1BWWA 5EN2B 1YDPA 1X5HA 4PB0L 4D6EA 4YPGA 4O2EA 2ORBH 3BE1H 5IXEA 4J3VA 2WPGA 1W2VA 1OAXH 1PKQE 3U2SB 2UVEA 1IAIL 1R3IL 3LEVH 2VXSL 3VG9C 1PAMA 3RM9A 2OSLA 3MRJA 2VXVL 4L4JA 3V5DA 4R27A 1EAPA 1UA7A 4TXEA 4NJAH 4R7DB 4HQQL 5MEND 2K1MA 3WLBB 4X4YA 4C56B 4XH2A 1I8LA 4AD1A 3GNRA 3E6HA 5EUOF 2N1KA 3QEUB 5HVGB 3RIAF 3UDWC 2YEZA 5DUML 4NRYB 1BQSA 3O6KL 1UWSA 4LSRH 5B3NA 5C6PB 1OTTC 1UR1A 4QRRE 2VTFA 1PZUB 4MNKA 5JOEA 4E8DA 4ZOAA 3RX5A 2XQYK 4ZFOA 2H26A 2WB5A 3DX6B 1ETZA 4UOW1 1DE4A 4OBRA 3MLYL 5I1IL 1TETL 5CEYB 5MHSD 3MO1B 3WIIH 2BZDA 3TN0A 1UJTA 2CITA 2VC9A 4I77L 5D5MA 5D6CB 4ZFFB 5E5MA 4GRLB 1EEUA 3UYOD 4P46D 4JFEA 3ZR6A 1A9EA 3TT1L 2CHOA 1LK2A 2OYPA 4JY6A 4B7IA 1CLCA 4ML4A 5HDRA 3RWEB 4G3YL 4Z7QF 1W9BM 4UTAL 1C5CH 2PC8A 2NY4D 1RY7B 1XF3A 4NN6B 3IU3B 4M8QA 5EA0L 1ZV5A 2J12B 2VZ1A 3QP3A 2R9HD 2EEAA 4ONGL 1WFOA 4NQCB 1FIEA 1C1EH 4L4TD 3BZDA 7TAAA 1CDGA 4AD4A 2A6DB 3P11H 5L88L 4M6AA 4WJXA 3BGMB 5FK9A 3BMWA 3VXSD 1WSST 4UDUB 2HJKB 3HPJA 3D25B 1G6RH 5IQ7H 1JFQL 3P4MB 3U4BL 5JW4R 4NKDA 4JG1L 4V1DE 4Q0XH 5CHNA 3S96A 5IHBA 1CE1H 1TZHA 4UNVA 3D69A 1DBKH 1IGIL 3ZL4L 1IC5L 4ZNEE 1I7ZA 3WFBL 4WV1A 2VZTA 3S5LB 3BZEA 3C2SA 5A2IH 1N6VA 1MUJB 3ALPA 1U8JB 1IC7L 3SUWA 4XNZC 2VC2L 3HG1A 3EYPA 4OCSH 2NY7L 4UBDD 3QOKA 1I1YA 5DMKA 3KPRB 4I2XE 2DQFA 2BVPB 4ZUVB 1HKFA 1DQDH 1WZ1L 4H88H 2WMJA 1WCBA 4FMFA 4HUWB 5ETUB 5I73C 4E41B 2VX4A 4X5XB 3V6OA 1H5BC 3OKMB 4YWGH 4RMUA 1XAUA 2WMIB 1KENL 3P73A 3NOIA 1EPFA 3E6FB 3QDAA 3MGTB 4WI7A 3WF1A 1FYHB 1RZ7H 3S4SB 3MRMB 3V0AC 5EWIH 1P9MA 4Q6YA 3PABA 3QZWA 4ODHL 3BAIA 5T3XD 2OL3H 1I3GL 5DA0B 1SM3H 3LIZL 4AENB 3VG9B 1AQDB 3FB8B 5A69A 1CLVA 4DGIH 1DDHA 2RCSL 4XCNA 4WFFE 3E2HC 2PO6A 1JNNH 1QI2A 5D7KD 3FB7A 5LKNA 3NUKA 4NQED 5E2WL 3ARDD 1F11B 2P5WD 4OBSA 2V2TB 1A9BA 1Y18B 4OFYD 3L3DA 1HNYA 1FPTH 4ZTOL 4Z2KA 2JCCB 3R8QA 5JXAH 4Z18A 2ZXBA 5HHQB 5IHZA 1KTDB 3CX5J 2A6JA 5HHOE 5HYJD 1QRNE 3CIVA 2DIAA 3DPBA 4L8BA 1OGAE 3MLVL 2G3NA 3OAZH 1R3KB 4NUJA 3RWIB 3D3VE 1ZWIB 3T3MF 4BSWA 1YMMB 2B2XH 3KR3L 1PBGA 3PHOA 3QUZA 43CAA 3AROA 3F58L 3LQAH 4RFOL 4MD4B 3H9SD 2PXYD 4NGHH 4MQ7A 3EFFA 2DDQH 4XWGL 2EXYD 4JN1L 2PETA 4R7DA 5D8JL 5F7MC 1SMDA 3JVGA 4EOWH 1U8MB 1Z9OA 4PBVC 4WY7L 3BKMH 4Y4FA 2MCPH 1L9MA 4L4VD 1PGRB 1HJXA 3BDYL 1Q1JH 1XIWD 4OD3L 1ZE3C 5TF1L 2WBWB 4LASH 1EBPA 2Y7QB 1ZBWA 1CG9B 2CBIA 2XIBA 1U8QA 2FEDC 5FM5O 5LYRA 2G9HA 2CQVA 2BRRL 1NJ9B 2ZX6A 1BEYH 3OKEA 4X8JA 5CEYA 4X7SH 3QHOA 3AVEA 4MJID 1FOBA 1NQBA 3CSYA 4V2CB 5FCUL 1VBRA 4HWEL 4ELMB 4L4OA 1I9IL 1YY8B 2ZSVA 4G43A 1RZJC 1TVBA 1SJHB 3W9EA 3P9LA 4BSVB 1W9XA 1OGBA 3N9GL 4BYHA 4WKAA 1UFUA 5JHDD 4XNZB 2B7DT 1YPZA 4OLYL 4HU8A 3MACL 2OBGA 3MV9E 3SGDI 1QBAA 4G8FB 1DEEA 1MHHA 4XX1E 1YEDB 3PZOA 1UA6H 5BS0D 4PLKC 1EJ6A 1OAKH 2QBWA 1OD9A 3IJHB 4N9OB 5C09E 3ULVC 3BISA 1WZMA 3AMCA 4RRPG 5JR1L 2LAAA 4TUFA 3BKCL 5I73B 4KI5C 3EJZD 2DBLH 2W60A 3RY5A 5CBAB 4FQ1H 5C08B 4PRBB 1NMAL 3WL0A 1MYRA 3IDMA 4GG8B 2XZQL 1DBAH 2NY2C 4AIUA 4P7QA 2DH3A 4F37K 2HRPH 4U05A 2FL5B 2VUYA 1UJ3A 3RDTD 2GK1B 2Z0BA 3IKCA 4BSJA 3LSOA 4K55A 4G8GD 1V7MH 1N59B 1XCTB 3QUXC 3JTTA 4F8TA 4K9EC 3TIDB 3E2HB 3O11B 4MB5A 4GXUN 2ESCA 2EDKA 3B9DA 2Y36L 1U8NB 4IRZL 4PRAA 4M6OH 2VIRB 3F5JA 5IIEB 3FFCD 5ISZA 1J7VR 4PGBB 4V28A 1JYNA 3OLIA 1HDMA 3IJ9A 1T80A 2FWOA 4Z2GA 4M3KB 1QSZA 4XPBH 4KAQL 1RI8A 5GGUB 2IALB 4HX1B 4PP2B 1S7WA 1G5AA 4CKQA 4PBWD 2B1AH 1P7QA 4JFDE 1RIUL 3AREA 4QXUL 1T83C 4H2CA 4Q9RL 3LKRB 1LO2L 5M94B 5EG6C 2WXDM 3GTNA 1FRGH 3UG4A 2Z35B 3G5VA 3WXVL 1QLRB 5MP6H 1JDCA 3KDMA 3ORJA 4KXZH 3QQ9C 3ZKND 3MNVB 2VISA 3ZHDA 4FFVD 1AJ7H 4LLDB 4FHBD 1TZ7A 4ALAH 2DOCA 1KXQA 4BF7A 1GZJA 3CDFA 5B21A 4Q97A 4F9DA 4NKMB 4HLJA 3WFEL 1A3RH 1UADC 3QDMA 4M5YL 4F7TA 2GFBA 3VWJD 3WENA 5DLMH 4YAQA 4CMMB 2JIXB 5EOTA 3HR5A 3BZFB 2FD6L 2PYFA 1JDDA 2W9DL 4HF5H 3C60D 4OLWH 2G75B 2NZ9D 3U0WH 3CVHL 1N4XH 3Q1SH 2XVNA 3VG0H 3TM6A 4RGNE 3RWHB 1VFAB 4IPNB 5HI3D 1M1SA 2ICEB 1S7RB 2O5ZL 4YDIH 2HFGH 3D85B 2NX5E 2OI9C 1CTNA 1G7PB 4PJIF 4XT1C 3RRQA 1H8NA 3RMEA 3L3IA 2BXZA 5E5RB 5IK3B 2GJJA 3VWKD 3WS6A 1JZ7A 1UZ8A 2Z4QA 2CRMA 1G1CA 4FQLL 4HPGA 4LBEB 3TF7C 1QD0A 3VUPA 1FG2B 4OUUB 4EI6A 1FZMB 3LRSB 5I1AA 4KK9C 2V5DA 1FCCA 5DJZA 2NMSA 1AGDB 4Z5RA 2CUIA 4MAZA 3FO1A 2D7TH 3ROLA 3QIUA 3GNML 4U1NB 3L3GA 2AW2A 2NW2A 2NY2B 4JFWA 2DQGH 5F1KC 4G6ML 4KUZH 1YY8A 1LNUB 1R85A 3RPKA 3W6LA 5ICZB 2UZXB 3LHPL 4QRTA 3FQTB 4HEPG 4G6AD 3U36A 1K3IA 3B8SA 2FBJL 4NM8L 1US2A 4CVXA 3QUXB 1KIQA 3L95A 2NXZC 4JDZA 1FNLA 1RZKL 2O5YL 4HUKB 1MJJB 4ATDA 4Z7OF 1NL0H 2QMKA 1IT0A 1H49A 4XB3A 1XT5A 3NN8A 2MJWA 2EKJA 3KS0H 3ARSA 1L7IH 3X3FH 1WFNA 1DUZB 2DH2A 3G6DH 2OMBA 1HHHB 4P59L 5CZKA 3B9KB 1H5BA 3NZHL 5GSVA 1R7OA 2EPMX 4H8VA 4E4PA 1JHLL 1QFWM 3NCJH 4W93A 3UTTE 2EECA 3PP4H 4OT1L 1N64L 1H15B 3NIDE 3FO0H 1A7QH 1FO0B 1F13A 4IDJH 3ARGD 1FVDA 4IRJD 25C8L 3I75B 4PTTA 5ECUA 5FUZH 3FRUA 1AGFA 1EMTL 2VKWA 2ATKA 4ZNEA 2VRQA 3VFTA 1NCCL 4QY8A 4ZFOL 2DKMA 4D8PB 2PN5A 1S5HB 1CEOA 2XACC 2QEJA 3P9MA 1MPAL 2EIBA 3N06B 4M6NH 1KUMA 5IT2L 2EDFA 4JO3L 4ONFL 5FDWA 3U9PH 2X89D 4WFHE 4LPTA 1A4KB 4HUUB 1C8PA 4PREB 2V7NB 2WBKA 1HVQA 1ZS8A 4JCLA 3R0MA 4PMYA 3U7WL 1T0PB 4H7VA 1FYTA 3M8OH 5FOBB 3C5JB 4BFIB 3DURB 4G7VH 5D1ZC 4G6JH 5ECJE 1OF2A 3FO2B 5SX4I 2CLZB 1BIHA 1VHPA 1AQKL 2OWXA 2GHWB 3U1SL 4Z7VE 4JFFE 4MDOA 3SKJH 1HP5A 1QI5A 5A2JH 4WW2C 3STZA 5IFTA 2R2BB 3WKML 3ZT6A 4S1RH 3ZLQC 1NANH 2CKBB 2P1YA 4JFHE 1RP8A 1CBGA 1K6QH 1JTOA 4UT6H 3VFRB 32C2A 3RIFF 3ULSA 2F8VA 4Z7WB 4FABL 4J4PC 1CFNA 4D0CA 4Q9QL 1OLZA 1FE8H 5J12C 1U2YA 4QRUB 5SWZE 2CMRH 2APTA 5HBFA 3BW9A 3L5XH 5JPMB 5FO9B 4YHZL 5HHVL 3SE9L 3RHWF 4R7NA 1GOWA 4DFIA 1HQ4B 2BVEA 1VFOA 4PJGB 3UBXG 4LDEB 1EDQA 2F19H 4OFIA 3NJ3A 4QDMA 1IAOA 1JYVA 2D4FA 1S9YB 1YHTA 4U3HA 5HHOA 4JJ5B 2FZ3B 4CGTA 1IFHH 2BC4B 1QFWI 5CP7A 3RAJL 2RHEA 4HT1L 3CDGA 3F6IA 5KSBE 2CETA 1VFAA 3OZ9H 3MRKA 4G6FD 3W26A 4A3HA 1E6JH 4Y4HC 43C9A 3ZHLA 3BVNB 3M17B 4S1DD 3D18B 4NO2A 3DSNA 4MXVF 3WFCH 2NXZB 4UCFA 1C8YA 1XH1A 3EMCA 2QQKH 5IB5A 3RGVD 1U91A 3AI0A 3UO1L 3IFOA 3A4XA 4TULL 1YUHA 1BZQK 2DTMH 1V0MA 1A6PA 1G9ML 2WVVA 3T1WA 1U8KB 1PYWA 3B2UD 5BVJB 1ONQB 2EDBA 5I75B 4OZIF 4XCCH 4U5KA 4H1LH 4PRPE 4BH7A 4AW7A 3FMGH 3SDCA 2OS7A 3V52L 1AGCA 4FP8H 1BM3L 3PWLB 4O58L 1A5FL 2F58H 3BPOB 3SDXB 2QSQA 1K85A 4F3FB 4OF0A 3P77A 3DTXB 1SYSA 4ATWA 3CZKA 1Q9LB 3BAYA 5A6KA 4MNLA 2W07A 4UILL 1KGCE 3BP6B 5KTEH 4WGVB 3GH4A 4R5EA 4WFGD 3S35X 2WC4A 4GINA 1AIFA 1K3ZA 1W2KT 2FECI 2CIKB 1N2RB 1IGCL 1NLDL 3L5JA 1GHRA 3BRGC 1E6PA 3WELA 3T2NL 2R1YA 4X6CE 3QJFA 3L1OL 5J9PA 4EVNB 4LK4A 1ZA6A 2O61B 1LO4H 1W8NA 4TNVF 5TE4H 1ISWA 3V0WL 3WIJA 4L8DB 4P4RB 3MLZL 5GRZA 1WWBX 4BH8B 3BXNB 1OWWA 3WD5H 3HMXH 4PJFB 5IGXL 1UM6H 3H42H 3MV9A 2W4XA 2EICA 1M7IA 4GBXC 3CX5K 2CCRA 2HTLC 4JRXB 3SOBL 3GNPA 3F7PC 3MRQB 2IBGA 3O6MH 1HJUA 1D5IH 1A0QL 4KWUA 4X6DE 5IHUL 1N26A 1E6SM 4ZAKC 1VAHA 4CN1A 1BFOA 1WCQA 5D1ZB 4KZEH 1I9RL 1IAKA 4DGVL 3GHEL 4JB9L 3IFLL 3EO0A 5DHVH 1VB9A 5T1DH 3N12A 4I3SH 5DK3A 4HJ0C 2H8PA 1T1WA 3HE6D 2W59A 3GBNH 5MERA 5IJKC 4WW2B 2E9IA 2EYSB 2H9GA 4KPHH 4Y1AB 3BH9B 1ZHBB 1JFXA 4X8XA 1MRDL 3T4YB 4HJGB 2DI8A 3U48A 4Z7UE 1O0VA 1S5HA 2V5CA 1QQDB 5I74C 2AEPL 4JFOB 4GMTH 4JIEA 4P2RD 1Q9WB 3EOTH 4XCEA 2OMNA 5E2JA 3BN9D 3QQNA 5J12B 1DQTA 2IPTL 1A7OH 3BZ4A 5CIPA 6TAAA 3L2MA 4YNYA 5I1GL 5FOBA 2PW1B 4RMRA 4EBQL 3GMRB 4HUXB 2FATL 3HC4H 1WISA 3V6FA 3LKPA 2VQUA 5EZOH 1F8TL 2NYYC 5MENE 2Q8AH 3FQXA 3FOLB 4W6YB 4PR5B 1YNLL 4JFDA 5FUOL 1HH9A 3ABZA 4GG6E 1H1NA 2J7EA 1HH6B 4Y4HB 1B9ZA 3P4LA 3QPXL 1YYLH 2FO1A 4OZGF 4OM1L 12E8L 5L2KE 2P24B 3TZVD 2X9YA 3UC0L 2X8RA 1JUFA 1YZZA 3EO9L 2Z31C 5K9KA 3AXIA 2GVYA 4EI5B 5IVXA 2RQ8A 3VXPB 1A2YB 1BYDA 4QGTA 3WBEA 2IAMA 5M95B 3TBSB 1I1WA 5AWNH 5MHSE 1MAKA 1I3RA 2QJDA 4OV5A 2IH1A 3WJJC 3WDPP 5FKPB 4D6JA 3FT4B 2L0DA 1T7WA 4Y16D 3QWRD 5EUOE 4PJCB 3O3BA 2VLLA 1CQKA 2CH8A 4MNQB 1HYRC 4QTIL 1E3XA 4JJ5A 4OCNC 4LRNL 2EDLA 1ZLVK 4NRSA 4MJ2A 1I85A 3SDAD 5CEZH 3QNXB 1UQZA 5I3DA 2E7MA 3PE9A 4Y5YA 1I8KB 5IB2B 3U5YA 2AJUL 3FOMB 3QUMH 1MRFL 5BRZE 5DEFA 3FQUA 4PSRA 4J3OC 2D3VA 1JBJA 1NFDB 1HIZA 5F7HA 5JQ6H 1A1NB 2NNAB 1A3LL 3HAEA 4L4TE 2D31A 3WDQA 2WUBL 1TR1A 1JXJA 4W4OA 1FNGB 3WDRA 3VXSE 1T7ZA 5DC0A 1Z6JT 3AZSA 5A8QA 1GZQB 1RJYA 2B4CH 4X7TA 4GBXB 4EEEA 1H3PL 2XTKA 4K8RH 5TQ2H 4LLVB 3LKQA 4XXCC 1UUQA 4Z7QE 2VR4A 4ZOCA 4ZAKB 4KRPD 1A64A 1JJUA 4OF7A 3KPLA 3O41B 4U6VL 1OAYL 3RL2A 3VU2A 5JBFA 3C8KB 5A3IC 4M61B 3VJ6B 2BNUA 2I07B 5EBLA 1EV2E 4JHWH 4NC2B 3E3QE 5ABHA 4J8RB 5JW4Q 3IDJA 4Y5VA 3UPCA 4P2YA 1CGSH 3GGWB 5I2UA 4XZUA 4MA3B 4D3CH 1CIUA 1DN0B 2AEWA 3B2VL 4NP4H 5TQ0L 4F15C 1XYZA 4X98A 3CFEA 5I74B 4X4XA 5C0CA 2HVKB 1ISZA 3BXNA 4D9LL 3EGSB 1W91A 4N0CD 1HILA 5GRJL 1E1FA 3BP7B 3O9NA 1U42A 3CVHB 3QA3B 2XGBA 3PIQB 5IFAL 2VLKD 1BF8A 5T3XE 5GRXG 2YUZA 4DWHA 4GUPB 4HUVB 4WENB 4YDKL 4RSVA 2VYRE 3MLWH 4APQC 1AKJB 5A6BD 1JYXA 2CKNA 5KW9H 3GSUB 4NNXB 1XF4B 2UY4A 1R5WB 1QR1B 2W5FA 4O4YH 3DUHA 3HRZB 2Q1EA 4NQEE 1KB3A 1TIUA 4XBEL 2YSSB 3T0ED 4FXKA 2MQ3A 5DEGA 2V7HB 4MSWB 4QWWC 2X4PA 3LQZB 3A4WA 2A9NH 5BZWA 1NUFA 2XNAA 3IETB 2YN5A 3M1BB 2HLAB 1JZ3A 4HAFA 5HYJE 2Z31B 4RMQA 3FQNA 4E0RA 3WO3B 1ZS2A 2AJ3B 3MBEA 1FDLH 1ODAA 4UOJA 3VH8A 3X17A 5KVMC 2BOBB 1LG1A 1PX8A 3TC9A 2EDWA 3WSQH 3KL0A 5CSBA 2FRGP 2XWTA 1HKMA 3BCFA 1JGVL 1N3NA 1N0XL 4HJJL 2XYCA 1CXFA 3WJLA 1MJUH 2VH5H 1NC4A 3ZOAA 4LX4A 4F57L 5HGBA 4ZENA 4GW1B 4TPRH 3MJ8B 3H9SE 3L5WB 1F90H 5GS0L 5F1OB 4HC1H 4MVBD 2GTZB 1CE6B 2VDOL 5CD3B 1UZ6F 4XCYB 1GC1H 3GRWL 2GT9A 5DO2C 5TDPA 3KPPB 1KNOB 4LSUL 4ZUSB 4L4VE 3KPTA 5T3ZD 4JFFA 1TG7A 1OAUH 1XMWA 3PWPB 4XNUL 5MEOB 1A21A 3T3ME 1JPST 4W86A 1WQVT 4LCIH 2P24A 5JIKA 1FFOB 3KPSD 1ZT7A 1A6VH 3QBTB 2E27L 2HMIC 4YIQB 5F7LB 3NCBB 1HE7A 4PGCB 3CH9A 2R0WL 1ROWA 3K80A 1D9KC 2DM3A 2C5DC 5EULV 3VE0A 2BSTA 2YK1L 1S7UB 4Q22A 4MJIE 3N50A 2IFFH 1G01A 3E8UH 5BW7C 3OLEA 4P2OC 5C07D 5SWZA 3KLAB 4X4ME 1RZGA 4M8UA 2XN9B 4MMZC 2AXJA 4WI2A 3P3YA 4N42A 3KEHA 3QULB 1R3LA 3QJHB 2V3GA 4FNLH 3RGHA 4Z2HA 4FZEH 1MXGA 2BSRA 5GGRA 1FNHA 1G9HA 4J27A 2K7QA 4ZYKA 4QT5B 2EE6A 4YQXH 2D7QA 3IFPB 3DROB 2W0FA 3LV3A 1ZVSA 2GCYB 5JHDE 3MUJA 4WDIB 4NO5A 4IEFB 1UG6A 4MJ4A 3WE6A 1PX3A 5E2UH 1A6AA 1FAIL 4IIQC 1BBJA 4I3RH 1KIRA 4OZHB 5BS0E 2JB5L 1SMOA 1ACYH 1X6LA 4F15B 1KN2L 5E9DD 4GMSL 1IGJB 4P4KC 4TX8A 1RU9H 2BNQA 5GGQH 1EAJA 5CJBA 4NQXB 1GIGH 1Q9KA 1IGFH 3TH3T 3MFFA 3QG7H 1HSBB 3WY1A 1BG9A 4O51B 2W9EL 5GGTL 1Q72H 4TNWF 1B2WH 2HH0L 5E2VH 4GAJL 1BX2B 1NGYB 5MEQA 3QCVH 3N11A 4LSVH 2FX9L 9CGTA 4APQB 4G8GE 3O6FD 1MCIA 3SJVA 4OD2B 1E6ZA 3CZLA 3KYNB 2BFVL 1CVRA 4JFXA 4WK9A 5IBUG 4NYLA 1MFCH 5FYLD 1ZKAA 4JO2H 3CX2A 4C58B 2ADGA 3MBXH 3K7UA 4NKOB 3FQRB 3FFCE 5IHLB 1DSFH 5I76B 3GJEA 3WD1A 4N90D 4K71C 2AQ2A 2I5YL 5JIIA 1FHLA 1NEZG 2WP3T 2AJXL 1E28A 4BZ1H 5DMIL 4OLEA 1FNSH 2GAZB 2CNCA 3ECBA 4H1LG 4X0NA 3O4LB 2XQYG 4LLMB 1NAMA 4OLVL 3VOCA 3SCVA 2L4OA 2HVJB 8FABA 3ZO0A 3THCA 2C9AA 2ESVA 4HUVA 4XNXH 3OAYH 3ZTJH 3HE7C 5I30H 3SE4A 5HI4D 1B4JL 1JF1B 3I6KB 1CDYA 3EYQC 2WBGA 3GSUA 4YHPA 1ZHNA 4HBQA 3FONB 4W6XB 2EO9A 4BA8A 4Q7NA 1IEAA 4I0PD 4B5EA 1BLNA 1G9NH 2V9TA 1SY6A 4IOFD 2GTWA 4NQDB 2ICCA 4OLZL 4BQ6A 1J11A 5CILH 4MSWA 3H8NA 2E5EA 2VURA 3OKKB 4HXBH 1SBSL 3PGDA 2Z31A 1KG0A 1OHQA 1KGXA 1CBVL 4G5ZL 2BOBA 1D9KB 1I1AD 5B8CC 3BD3A 1F4AA 1NEUA 4JFUA 1RUAH 4F9LA 3HUJF 4JO4H 4ZS7H 1OAQL 4ZFZA 1FFNB 1CF8L 4P2OB 4OFKA 1FZJA 4OZ4A 2HT3D 2VXUH 1W1VA 2J7CA 4TSCH 5E4EC 1HHJB 5AC5A 4WWKC 4A6YA 4PMVA 2W0KA 4G9FA 2X1OA 3B9EA 1KULA 4U1JB 4YLQT 4LCWD 3SQOL 1BVZA 3SO5A 5E2TL 1MFEH 5JUEL 3CSBA 2QLYA 1A8JH 4W7WA 4LU5H 1IE5A 3D5HA 1ZGLM 5ALBL 4JHOA 3CPLB 4XBPA 2OTUA 4AD0A 4IIQB 1WZLA 1LO3H 3SQBA 1FFOA 4GG6A 4D6GA 2OYMA 3HLAA 1A7RH 5HHNB 4ZPVB 3WFHB 2DQTH 1OT1A 4P4KB 3ZYIA 4YXKH 5L2KA 4PJIE 5DJ8A 4KV5F 3I3DA 4AZIA 3PG2A 5FB8B 1VJZA 4LOUC 1MFBH 4KKLC 4XVSH 2ZJSL 4L29A 3MCG1 3VDBA 3QJHA 5FKAA 1LE5A 5DJCA 2QADD 1MF2L 3QO0B 2ZCKH 1U3HC 3T0WA 2RFXB 4HG4J 2FDMA 1RHHB 4TTUA 4OJFH 5DJ2B 3B5HA 1QO3A 3M45A 2YBTA 4FXLA 4Z0BL 1TQCB 3QUYC 4WDIA 3RJXA 4CW1B 4PN2A 3PQYE 1YEFH 3DMMD 4LNRA 1XH0A 3C6SB 4WU7A 1C5BH 1X7QA 5GZOC 3I85A 1Q94B 4K71B 2XQBL 5BRZA 1UWGH 4UAOC 5I8OH 1PEWA 2B0SL 4HIHB 3CZFA 5ENWA 1CXHA 4QOKB 1FC2D 4YR6B 2Q6WA 3DC0A 3IDNB 1Q4NX 2ZUUA 3BDBA 4M43L 1GOGA 2YKLH 3DRQB 2ZUMA 5IHRA 1GGYA 3QT2A 5KSVA 2C3VB 4L4TA 3QNYB 3NCCB 4R4FH 4Z7OE 2QHRH 3HI1A 2XKNA 1GW1A 5FYJH 5F8QC 4RGOL 1BAFL 35C8H 3BHBA 4C83B 5L2JB 3DUUB 5IB1A 1P7KB 1CGWA 3HE7B 1KEGH 1HINL 4GT7A 4L5FH 2O9PA 2IMNA 1KJ2A 1MRCL 2VN7A 1VFMA 2K9UA 3QDGB 5F6HJ 2WHJA 1N5YL 3ZSTA 1MY7A 2C3HA 4KTDH 5J6GA 1AH1A 5M7QA 1F3JB 4YZFF 3VI4F 1AHWC 2BVOB 3SCNA 4RL3A 1OSZA 5JIPA 1CXKA 3NMEA 4HXAH 2YS4A 3JBG7 2VZVA 2AJZB 1SR0A 5CQ1A 1DBJH 2BNRB 5FHBL 3BAWA 3TT3H 1GXEA 4U31A 4EUPA 4WEMB 5DDHA 3KWWA 1XCQB 4LYPA 3TVMC 3UXFA 4DM1A 5IMKA 4DGYL 5GS0C 2CD0A 5B8CB 4FXGA 2DM7A 5BVPL 3MRDB 3QNZB 3EDEA 1Z9LA 1FP9A 3EJYD 2Z8WC 4X6EA 1CENA 4ORZC 1XD0A 3MOQA 4F58H 1N6QL 1T21A 3GMQB 4KY1L 3LPGA 2ED8A 4KKCD 3L3OB 1KSRA 1CK0H 5E4EB 5DYOA 4PJAB 5D7JD 4WWKB 4ZD3H 1FVCB 3KPNB 1O7AA 3H6JA 2EDJA 2FJFB 1W1YA 3VFMA 2UWEA 3OHXB 1XF1A 3CUJA 3DETD 1TCRB 4QTHB 4F7EB 1BECA 4KQ4L 3GXIA 1QNZL 4UQEA 4YUEH 2J6EL 1TVHA 1OSPH 3BIKA 3BMVA 4CADB 1WBZB 4RBPH 1W3LA 5IWLA 1T0MA 1MIML 1NGXA 2Q8XA 4H0IA 1IBGH 1GSMA 4QLLA 2DQJH 3S3SA 3T09A 4PGEB 1JPTL 1T7VA 1WAAE 3KXFA 5LGKA 1A4JA 4N0FB 1LL4A 4KRNA 1NP0A 5JXED 5HYJA 2FECL 2J88H 3DBXA 2R1WB 4HMDA 4LSPL 4YFLI 1B0GB 1FFNA 5F88A 5D4QA 3ZDZF 3NCEB 2E9JA 4PP1D 5KZCB 3AM8A 3ARPA 3CDCA 4JZOA 4P5TB 1U0QA 1U92A 4O2CA 5LCVL 4QHMB 3FT2A 2QR0A 3QO1B 1ZBVA 3TO2A 4XP6L 1U3HB 3QWOA 4OCXL 4PFEA 1WPCA 2H6PA 4GXUM 5ERWA 3SIMA 3L6FB 3U0PB 1NCBH 3IFNL 2JELH 3EOBA 3QUYB 4MLSA 1MREL 5HHPA 3V7MA 3CUFA 3MXWL 5ELIA 2IAND 3RU8H 3LB6C 3CHEA 4IIQA 4W8BA 5CG0A 1LO5B 1AO7D 3NIFF 2P5EB 4PRHA 1AFVH 2GQHA 5AYIA 2BHZA 1S7SB 1CFVL 3MV8D 4UAOB 2VAAB 4KMTL 1ZANL 3AFLA 1Q0XH 1PKQB 1QNPA 2Q8BL 2ZSWB 3PNWB 3G04B 1U36A 2X41A 5E8OB 5GS2H 1JGDA 3LKSB 3VNYA 2XVLA 4MAYA 3K0WA 4MXVE 4D0DA 3UPRB 5J06A 2OJZH 3QEGH 1TTFA 1YECH 3CMOH 1WICA 3I02B 4MNHB 3SPVB 3QIWD 1ORSA 4OUEA 5KVEH 4P23A 4Y4KC 5HJ3A 1LQ0A 4MJIA 4WFGE 1JNEA 4TVCA 2B8OT 2XIIA 4N0UE 3HPLB 3L4VA 2QQLL 3QXAA 4U0RC 1FV1B 1ZLVH 4TUJB 4U6XB 3SCWA 3NCMA 4YJZL 4OZIE 2HFEB 2DYPD 1IKFH 3IRPX 4FQIL 4LMQI 1QOXA 4PRID 1T0NB 1W72A 4UV7H 5CFHA 4QRRB 1B0WA 4NIKB 1EGZA 1AHWB 2EC9T 4ENEC 3VRJA 5DMGD 1ZBCA 1Q94A 1EVUA 1UD2A 5KVFH 5IOPA 3SE8L 4QOKA 4HIIA 1EXUB 2DIBA 1U41A 4HKBA 1BZ7A 3JV5A 5CGYD 3T1FA 2EE2A 3EMQA 3DRQA 3VFNA 3TVMB 1V3IA 4RA0C 3H2WA 2FB4L 1J5OH 3VXQA 1XR8A 4R0LA 2PB1A 5EU6D 1RUKL 1MNUH 3LN5B 2YD7A 2HT4D 4K23L 3VXUE 3DRTA 4PJ5E 2YRZA 4L9LA 4J1UB 4XPHL 3UZEA 1JHTB 1PJ9A 5JZ7C 1UZ1A 2V9RA 4Z2JA 4KJYB 2DWDB 2OSXA 1JGLL 1TLKA 3NVQA 2DQDL 3B9AA 4P2RE 4UB0H 3S37H 1D5ZA 2J5LB 3SBWA 3D2UA 4LHUB 4LSQL 3PZ9A 3LS4H 3A6BH 3ZJKA 1RZJH 1LWJA 1KPRA 3LD8C 1II4E 2ZOLA 4LPCA 4V1DB 2CDEA 2BHUA 4J23A 3AFBA 3EOAA 4FFZH 1HCFX 5JW3H 1I3VA 2F8XC 1T5XA 2Z93B 3KYMA 4L3EA 4CU7A 5CPSA 1DANT 3MX0A 2D03H 3TA3C 1T66C 3IAPA 3UCRA 3PJSB 3CFDA 2EEDA 4U6YA 4W85A 5E5UB 2X4SB 3ULVH 4POZC 4LSDA 3DSFH 4U1LA 5D9OA 3BOVA 1AQ0A 1L7TL 4U1IA 3VGHA 5BMFH 3GSNB 3O2VH 4J2XA 4DN3H 3N15A 3ILPB 3VD9A 2F5BL 2DQIL 3Q5YA 4RQQB 4QAWA 3ZKXC 1MVFA 4X99B 4A4AA 2J8HA 4HMEA 1R86A 4LPXA 4P9HL 4WFED 4PJXF 2A1WH 1JRHH 1LDPH 3MOAH 5DD6A 1E4LA 2OXGA 3MV7D 1D2KA 2AXGB 3CJJA 4LGSB 5IJVB 1EFXD 1E4XI 1NCTA 1S7TB 4K9EH 1AVAA 4JZJA 4G8EB 5ESVA 5D7SL 4XUYA 4ACZB 4OZGE 5C2BH 5SWSA 2NR6D 3QHMA 5HPMB 2E4TA 4PJDA 1OSEA 3BAEH 5CGMA 4TVSa 1UWXK 1GGIH 3RUGA 3WIFA 5ADPL 3HS0B 1QI3A 1C16B 1IAIH 1R3IH 2VXSH 4IOSD 5I1DA 3NFSL 5C0EA 1NDGB 1FQ9C 4U0RB 1JF5A 2VE6B 1EO7A 3RZCA 4N8PA 1NBZB 2C4FT 3CUPB 3RWCB 3LZFL 5K59F 3RP1A 1JFHA 4I18C 1FO0H 2G5RA 2CO7B 1QRNB 4XPAL 4WI4A 4LYQA 2OWWA 3VWKA 1PG7L 1OGAB 2Z91A 1S7SA 3QUKA 4S2SA 3D3VB 4Y19D 5D9MA 1P4BH 5CJXC 1I8IB 3MMDA 3O6KH 4ODSH 4XXDB 4NNPH 5I2IB 1M7DA 3GMPA 2PF0A 4Q2ZA 3GK8H 4M00A 3WQ8A 2XTLA 1KN4H 4HOZA 2DWEB 4QHNB 1DQQA 3QB7C 2J8UF 3FZUC 3I02A 3REWB 4QRPD 4AISA 2MNUA 1SY6L 1S9VB 4PJBA 3ZTNL 2LU7A 5I1IH 2I9LB 5M5DA 1HJSA 1CICC 4NQVB 3MYJA 4Z78B 2AABL 3RKDD 3C6LC 3DXAD 3MRHA 5D2LF 3N85H 4WF7A 2AJVH 4DZBB 1NCDH 4JPKL 1J0HA 4HWUA 5T5NF 2ZUQC 3ZKMC 4QCIA 4MS8C 2AJSL 1PZ5A 1TCMA 2R56L 3MYZA 1E0XA 1AGEB 3PHSA 1J88A 4TYUA 2A3CA 1M03A 3MRBA 1IEHA 5HDQL 1XEDA 3S5LG 1DBMH 4KDWA 5C0BD 4JHAL 5I19H 4G3YH 3Q3GB 2YZ1A 3DHPA 4UTAH 5JBDA 2A6IB 4DJMA 3PQYA 1OCWH 3JZ7A 4MNGE 4NZTL 1UWEL 4U7SA 1CFTA 4ORGA 2ZNXA 3LD8B 4C7DA 2Q7YB 1E4NA 1N82A 2CKBH 4ONGH 5B39B 2VDPL 4MCYB 2G3MA 4RGNC 5I79A 1MELA 1O7SA 4A6YL 1KTRL 2Y23A 3MJ9H 5T5FH 3CZGA 1A7NH 1CVSC 2O5XL 3GKZA 3CNKA 4PJ8A 1REIA 3O9WA 3BJLA 1OB1A 3VDHA 3IXTB 3MODH 4GW4B 5FGRA 2DJUA 1JTPA 2VXQL 4JG1H 4YHNA 1AGBB 3S4SG 3HR6A 5BOZG 3QEHB 3T0EE 5ID0B 1KELH 1KLFA 2YC1B 5CS7A 3WFBH 2XZCH 5C09B 4CBPA 2YZ8A 4FG6D 2V2XB 3ZKXB 5FA4B 3RIKA 1UKPA 4HIXL 3BKYL 2BCKA 3PV6B 4N8CH 4XTRD 2P8LB 4UZGA 1FCGA 4LDOB 4Q6IA 4YHOH 1E56A 1J1OL 1WZ1H 1SFSA 3OKNA 2WHMA 5IQ9A 4U1HA 3MRIB 4M29A 3W29A 4E9LA 4LF3A 4Z8FL 1JGIA 1KENH 3KLDA 1LK3L 3EW3B 3HI6H 1JGEB 1T1YA 5I18H 4ZEPA 2X4QA 1OQXA 5DQJA 3QCTL 5D1QA 1E4KA 1KJVA 1FZKA 3DIFA 2E6JA 3QDJA 4GRWF 1BVLA 4HH9A 2EDHA 4HG4K 1NPUA 5KSUB 3WO4C 1KBGH 5T3ZE 1PVHA 2A3AA 4AEIL 4R8WL 3U6RB 1S3KL 4Z95H 4RQQA 3KPSE 1PLGL 3QQ3B 4HIJB 2WVUA 3QGVA 3QCUH 4CL7A 4NSKB 4H8WL 1ZJBA 4I18B 1G7HB 3VM5A 4PJHB 1UZ6E 5I66B 1S8DA 2IADB 2IQAA 1INEH 4NNYA 3RM4A 8CGTA 2F15A 2PNDA 1WEJH 3BQUC 5E6ID 3REVA 5T33L 5C07E 4DW2H 3RJQB 1KJ2L 4IRSC 2X70A 4ZPTB 4ACZA 5EOQH 1GRWA 5EZIL 1M6OA 4QKXB 5KS9E 5HPMA 3P4NA 4PV8A 1V6UA 5F7DA 2XG5A 4D6HA 5LWYH 4TX6A 1TJIL 1MEXH 1MJ7L 2C26A 1W3JA 4KQ3H 4JM4L 1WAAA 3RPIB 4HKXA 1WWWX 1U95B 3LCYA 4Y4KA 3LN9A 1CICB 3KR3H 1B3WA 3C6LB 4K7FA 1IGTB 3PL6D 3AS3A 4OUOA 1KPVB 1WGOA 1WT5C 1K8IA 1YEHH 4RDQG 4B9ZA 4NCC2 3VIKA 2IXUA 3KPQA 5EMYA 1TMQA 1EH9A 5I0ZA 5E9DE 4R2GC 5L8LB 1BVKB 5GHWH 4WY7H 1RIVH 1CL7I 2X1XR 4EN3A 3G6JF 1MFNA 1X5JA 4OCRH 1BD2D 5DD0L 5I1JL 2YPLD 3T2QA 4R3SA 4ODTH 2BHYA 5HGDA 4PGDA 2O92A 5C9JA 1UM5H 1FL3B 3NH7L 1OARH 3JV4A 4XXDA 3SKNA 5DGRA 5T3XL 2W0LA 2XZAL 1NSNH 4RGNB 5FGBA 2VL5B 4F7CA 5J56B 1JZ5A 2VDRL 5LVEA 2DF3A 3IDIB 5JORB 3REWA 1AY1H 1A6UH 4R90L 1IM3A 1T7XA 2HFFB 1QR4A 2BDNL 4CAGA 1RP9A 3VXOA 1ITBB 1BMGA 4UTFA 5GZND 3GMLB 5FYLE 4P5KB 5MEPA 4N1HB 1K4CB 3NTCH 5FCUH 4F33B 5GPRA 5D93C 4RE3A 3P0YH 2HKFH 3RTQA 5JPNB 3AS2A 4IMLB 4N90E 4UQ3A 2KZ1B 3WD2A 2DQUH 5L9DL 5KSAC 1UWQA 2AEQH 4HS8H 2OK0L 5I17A 4LCYB 2ZUVA 3N9GH 3OWEA 3T65A 3G08A 5I15L 1NCAH 5D2NC 4P3CH 1GGCL 4OSUL 4HOWA 4F37F 3MMEA 2A73A 4UNTA 4WHTB 1LD9B 4HKZB 1V3HA 4EKJA 3OF6A 4N0YH 4U7KA 5JR1H 5A94A 5EU3B 3QI9A 2F9BT 1MLCA 3CH1B 1CD1A 1ADQA 1UB5A 2BVQA 4ZUTB 4O5LL 4I8DA 5D5MF 3UROR 3WLWC 3ECQA 3TA3A 5GRYA 5LQBL 4JFZH 4P9HC 5EU5B 1XYFA 4I5BA 3KLSA 3WO4B 3WNOA 1DUYB 5F9OL 3VXUA 4OGAC 5D4YA 2RAMA 4NQUA 4PJ5A 4XNMA 4K2UL 4JZNB 5DVMA 3VXMA 4KTEH 5FD0A 1KQYA 4O02L 3TN0D 2DQHL 3N13A 2Y36H 2VZ3A 3EYVB 1PZ2A 2DDXA 4LLWA 5SWQB 1LDSA 2ILLA 4HFWB 3UTTB 1T89C 1UT9A 4JFED 3QHNA 4R26H 1HF6A 3NA9L 1R0AL 3ALGA 4KAQH 3ZZ1A 4PTUA 3SY0A 3P0VL 3INUL 4JQIL 3NCYS 1ZT4B 3I2CL 4NZDA 1CU4L 2ZICA 3U46B 4LCWE 3TO4A 4JQXA 5ANMB 3QHZL 1FGNH 1LO2H 1X5FA 4X0KA 1T1ZB 3UTZB 3VINA 4XBGA 3T04D 1UH3A 5A8PA 2I9TB 2WWDA 5MI0C 4IDLA 1KXTA 1LP9E 5A2KH 4KHTL 5JW4N 2Z8VC 3GBEA 5ITBL 5IW1A 4PLOB 2X6MA 4O9HH 1QEWA 1S7QA 3G5YB 4WO4C 5JQHC 1PY4A 3MRGB 1DP0A 2ADIB 4LCUA 1A6TB 3F7YA 4R2GB 5CLTA 4NCC1 5I66A 2AK4A 1HXMB 2VLRA 5EO1A 1WDPA 1KJ3L 5HYEA 2HG5B 3VXNA 2WBJA 1PG7W 4M1GH 2CESA 2UWFA 2P7TB 3DNKA 4Z7VB 1T20A 1TZIA 3WFEH 2A3EA 2OQJB 4JFQA 5IKCB 4B3KA 4FTVB 1JAKA 4FQQB 3HG1D 1UHVA 5C92A 5EPMB 2BV9A 3O8XC 2GK0B 5DK2B 3VFOA 3R06B 4JO1H 4CVZB 3QWRA 1NMBH 4RRPA 1QNOA 1PY9A 4JPWL 4GW5A 1WBXA 1KCUH 3CVHH 3UTQB 2XYLA 2CDFB 4KV5E 3PTMA 1UXWA 5F3HA 2P8PA 4PYHA 1FIGL 2VUOA 1JPGB 4GKSA 4LLYA 1QHPA 1B3JA 2X1PA 3HA0A 1FBIL 1MWAL 4IS6A 5ILTL 1FGVH 1HEZA 3X3GL 4MA7H 3S36X 2CIPA 4TSBH 5BZDA 5C6WH 1JYWA 1Z5LA 1U8OB 1M71B 3CUGA 2EYTB 3VFUB 1QPKA 5D2NB 1SQ2N 4FQLH 4ERSH 3GSQA 5FEBA 1R5VB 3IGAB 3AXXA 2PKDA 3MA7A 4TOQA 2PO6D 3EDJA 5KSBB 3FB5B 3VFVA 5I1CH 1X5GA 4TRPL 1M05B 1J05A 4PV9A 1TNMA 2VXTL 4FFYL 5IBLD 4UNUA 4PJ9B 1JNLL 5EOCH 5E0QA 4QNPF 4XP9L 4HUMB 2EH8L 5C0JA 4UQBA 1Q9OB 3S3PA 3QHFL 1PD6A 3GMLA 4N5ED 5D6DC 1TTUA 4D0BB 5C0GA 1UVQA 4M02A 4RAUB 2D7PA 4HCRL 2AXFA 3ZYJA 4JGMA 5L6YH 3LHPH 1HL8A 4FRWA 5JDSB 4NM8H 3WL9B 2V3EA 5K9JH 1MI5B 2Y72A 4M1RA 3JV0A 1A1OB 3WIHL 4PRPB 2X1WL 4GI9A 4RZCB 3QUZD 2PW2B 3MLXH 3II1A 2UZIH 1BFVH 4IMKA 3CVIH 5F70A 4AXNA 2W63A 2W91A 2R2CA 4P46C 3CMJA 5TE6L 4YZFE 1BBDL 3L4YA 5HYQB 3CSGA 1KXVA 1TJGH 2JKXA 5F89A 3VRIB 3W39B 1JNHB 1E27A 4L3CB 4Y4FD 3CH1A 4YHIA 3OGVA 1U58B 3FRPG 1NWRA 2ZXDA 4X6CB 1T2QL 3HC0B 2VVNA 3AIUA 4LDLB 3PHAA 2CR3A 1A7BA 3MGAA 3PWNB 2NY3D 4ZG1A 1MCPL 1ZSDB 4OI9A 4KKBD 2X09A 1HIML 5MI0B 1YPZF 5I1EL 1HXYA 2EYRA 1EMTH 2AAAA 3HKFA 1XZ0A 2YUVA 2KH2B 4KRLB 3ULUL 1MAMH 1UWIA 4X6DB 4WO4B 4FQJL 2XFXA 4GRLD 5AD0B 4LQ1A 1JV5A 2XKSA 4ONFH 5D7LA 3BQUA 3OGRA 1S46A 2VITA 4NBZB 1D5MA 3BT2L 3RY4A 5HBBA 3ZE0F 1Y0LA 1JWMB 4IRSA 1IARB 1RZFL 4UBDC 4JG0L 1SMAA 3WKNA 1X5IA 2XXMB 3O8XB 1UACL 2W92A 3W82A 1KCRL 1F6LL 1W8OA 2NW3B 4JDTL 4JDVA 3GJFB 3TJEH 5DFAA 4Z7UB 5DI8A 3NZ8B 4OGXL 1JI1A 1VEPA 4MX7B 3CGTA 2IANE 4WCYH 4RWYL 4HA4A 3WCYA 5LJYH 5E08L 3ZDZE 1AO7E 5JLZA 4LVOC 3TTQA 2D2OA 5GNZA 3RVVD 1WLHA 4HP5A 3F7VB 4WW1A 2EH7L 2WIMA 3OGCB 3ZDXF 2BOCB 1HXMA 1NAKL 3BRDA 2C7UB 4FABH 1K5NA 2YA0A 1NH6A 5LGHL 1GAFL 1ITXA 3HAEG 3VIMA 1SEQL 3HZMA 5MENB 4CKVX 2OQJA 5FYKU 1UOKA 2XPGB 4Z77B 5J3HD 1NFKA 1WIUA 4GQPH 4QGYA 3ARDC 3NIFE 4EUPH 3KPRD 1R5IB 1VA9A 4PRNB 5E8DL 3W0WE 5EORL 5EBMB 2VRJA 4AMCA 3MRRA 3SGEH 5KS9A 5IW6B 4PRIE 2Y06L 2OSWA 2C1OA 2Z1SA 3HB3D 4HT1H 2MTPA 4RIRB 3TWCL 5H8DA 3I6LE 1WWAX 2ARWA 3AZTA 5IF0B 4L3AA 1JPGA 3GSWA 3J8F7 3EO1B 4IM8A 5KSAA 1P7QD 4OLXL 3V6ZA 3QYCA 5JO5A 3ARED 5D70L 3OKDA 2EJ1A 1QFOA 5EIIB 1ES0A 1G7LB 5EUOB 4P2CG 5HYSB 4NRZA 4OF8A 5BCAA 5JW5A 1GQKA 2DSZA 2PXYC 5FHAL 3WH6A 2JK5A 1MH5B 4N1EA 3HRPA 1G7MA 2EXYC 3IGAA 3SKOB 5IVZB 4P46B 3U7YL 2QSTA 5EU6E 3KWXA 1L6ZA 4G9DB 1IAIM 1R24B 1JVKA 3UTSA 1F00I 4HU0A 3GBML 3V52H 1XIWC 4Z76A 4BUGA 1P4LA 1QLFA 1G84A 2NY4B 4NI3A 5CAYB 1DLHB 2H2PD 4G7YL 4ETQB 4U1MB 5KAQG 3MMUA 4UT7L 1P2CA 3MRCA 3QDMD 3D9AH 1C92A 1E4XL 2VRKA 2XRAL 4HW6A 3ROOA 1MHCB 3JV6B 3L3KA 3VXSB 4YGVA 1ACZA 3A6OA 4RFNC 3DV6B 3V4UL 5I8CA 1A7PL 1NC2A 5KANG 3SUUA 4JLRB 1A6ZA 2NY6D 1XR9A 5IM7A 5IGXH 2HISA 3AZRA 3CUIA 3BEWB 2CLRB 2DT2A 3VRIA 3POCA 1J01A 1K2DA 4LSSL 2J62A 4W84A 1NDMA 1QBML 4RDQF 1G9EA 2J7LA 1PW3A 3VXRA 3UBXA 1MQQA 5DRXA 1E6RA 5GSRB 1JZ8A 4DM2A 2YJQA 3WEXB 3EJZC 4WFEE 5ABFB 1UKTA 2OL3A 4DEPC 1GZPA 3ARFA 2OZ4H 2NQCA 3MV7E 3GEWB 3K2UH 3OX8A 4YDVA 1OGTA 1IKNA 3QIUD 4LVOB 5DJYB 1MRDH 1ZVHA 1QVOA 4WO4A 1C7TA 4KXZI 2RGMA 3RDTC 3V5HA 3GHBH 3DV4B 1YMHA 1VGKB 1GL4B 3B6SB 3HZYA 4ZO6A 5K9OB 5DJ0B 2FIRT 1MLBA 1UXSB 3TCLA 3VFWA 3VGEA 4POYA 3RVWC 3NDYA 3AXHA 4JY5L 4PJXE 2ZXAA 2XTJC 4W5ZA 1XGYL 3VIGA 4FLQA 1MCNA 1MCLA 5CZXD 4DN4H 1R3JA 4NQEB 1OWRM 3ARDB 1WAWA 3O8XA 3D39A 2P5WB 3PWUA 2NY1D 4H26B 4AL8L 5BYWA 4WUUA 3EZJB 2W38A 2MANA 1TPXC 2H41A 2I24N 1YYML 5K93A 3RA7H 1CFQA 1YNLH 4ODUA 3RJDA 5FUOH 3CAFA 4RISL 2DLFL 4KJQD 2VCCA 2HKHL 1HSAB 1KIUA 2HJLB 5DVOA 3MRNA 1MCOH 3IDGB 4Y19E 5DRZA 5GISH 1MFVA 5DC4B 2CDGA 5A16A 2MKLC 1UCBL 1NMCC 1LP9A 4XAWH 5IG7B 1ADQL 2JJTC 3LN4B 4OFVA 4OFPA 5DUPH 4X0VA 5EC1B 1JPSL 3WNNA 5B38B 3H9SB 2PXYB 5DFTA 3O45A 3WH8A 3ZKNC 4HDIA 4GKZB 3L7EB 5GS2D 4IHOB 1KB9J 2EIZB 3WFDH 4XB7A 1K4DA 2X5PA 1UYWL 2DD8L 3DXAE 4L4VB 4TUOB 1WDSA 4LFHG 1XIWB 4QTIH 4EQ2A 4AZ6A 1EERB 3MOBH 5EFDA 1W0VA 4JPIA 2UYLB 4LLUA 1UYQA 2KUTA 2WC7A 3MNZB 3VM7A 4NHUB 4JANB 5CBEB 2E9LA 1FYTD 5E8NB 5C0BE 1JAEA 2XWJA 1LEIA 5KG9B 5IF0A 3QXWA 3GSRB 5TDOB 2UY6A 1HHIB 5GS1A 1E6QM 5BXFB 5H94A 4PJ7B 3RVXC 4DKFL 5A1AA 4RFNB 1E5JA 2NZ9C 4ODWB 4WUKH 1ZB5A 2DT0A 1YN7B 5D2LE 1IQDB 5HI3C 4AZCA 4GKNB 3M07A 4F8QA 2YIHA 4X6BA 2ZE0A 3GMNA 3HNSL 2PF6A 2BY2A 1YEKL 2G3JA 4MNJA 4S10A 3OKLA 3F12B 5JHDB 1K9DA 2XKUA 5JA9A 1HOCA 5JIWA 3NGBC 2CJUH 4LKCB 3JTSA 2LABA 2ZCLH 3VCLA 1EGJA 2OJEB 4NC1C 4U6VH 2ZXQA 3DUSB 4M6MH 2AV1B 2ZKHL 4N8VB 3MREA 2D24A 1AXTL 3MGOB 1OAZL 4NFBA 5GQBA 1MHCA 4DAGL 4DEPB 4PGJA 3A67H 5IUSA 1QA9B 1UKSA 4Q58C 5DRNB 3DHMA 4P8WA 4ZOEA 1BYBA 1GNXA 3VIOA 3GSVB 3U30C 3A0OA 3P30L 2H32B 3C9NB 4NT6A 1FORL 3RDTB 1L9NA 4MAUL 1OQOA 1SYVA 2VDLL 4H25B 3KLHD 2ZWLT 3VXTA 4G6AC 3SGKA 4G8GB 1H3GA 5ESAB 4HK0B 5I0DA 3MCKA 5I1HH 4NO0A 3V7AG 2X4RB 5F7YC 4DKDC 1ZGLB 6A3HA 3U7VA 1EUTA 3DX8B 2XTJB 2YL5A 5IFAH 2WZEA 2F54A 3ZJ6A 4L8CB 4TSAH 2B20A 4JKPH 2WVSA 5H35A 3FFCB 4XPGL 1D3CA 4X4ZA 1CL7L 4I4WB 4PLKD 2E7CA 1MWAB 3BUYA 1TPXB 1IMHC 2GY5A 3MXVH 3SDCD 1OTUD 4ZUWB 4NRXB 4GSDL 4O2FA 5DZOA 2AV7A 5DMJB 4C4KT 3AMLA 4JQVA 5TDNB 4GRWE 3MO4A 5CJ5A 1CIDA 4OCWL 3MUY1 5IROA 4LNVA 4AIEA 1NMCB 3ARGC 4P9ML 3MA9L 2OP4L 1NANI 3DV4A 1QBLL 4OD1H 4Z0XA 2CXKA 2MHAB 3TTSA 4NWUH 5DJ0A 5C0FA 5C3LD 1PQZB 1RULL 1V6WA 2B5IC 3EYOB 2NLJB 1HKJA 2E40A 2ITCA 4HJJH 4OF5A 2UZYB 5IFHL 5I9QC 1N6UA 4L4PA 5IHSA 4NKIL 1NBYA 4RAVA 2GJ6A 2W65A 1DR9A 1EO8L 4F57H 3VFSB 5EO9B 4H26A 1NUNB 4TUKL 4FQ2L 2K3TA 5CZVL 3OXSB 2XVPA 4LLAA 1QYGH 5GS0H 5D72L 3MV9D 1D5XB 3T77B 2VDOH 3RKPA 4U6HB 1B31A 3GRWH 1C5DB 3VWJB 4D1IA 3OAUH 1MFAL 2IXVA 4JCMA 2X10A 5DJ6A 3C60B 1BD2E 3WFZA 3MNWA 5FGSA 2XWBB 4OI7A 2H3NB 5T1LB 2FSEA 3OPZL 4M5ZL 1V7NL 2XV6B 1U2CA 4JN2A 5ICXB 2E27H 2YRLA 4NHCH 2R0WH 1JPFA 2GJZA 1KTLB 2X4NB 3O6LL 2Z9TA 3QQ9D 4GQRA 1RAMA 4OIIH 4CNIB 2ICWI 4HZ6A 5H37H 3FCTA 3U9UB 1IGML 4YXHL 3G6JE 2PWFA 3ARRA 2MSPA 2ID5A 2XSAA 1BFNA 1TZGL 2DIEA 3NGBB 5EB9A 1TNNA 2RIKA 3GZAA 4BCEA 4D72A 4CD7A 5HGHB 1XGUA 3RWGB 3BWAB 5KVGH 3W0WA 5HDBF 3CFBB 5ABGA 1INDL 5ICYB 5AYBA 5L8KB 3OAZK 2OR9L 1XH3B 2DKUA 4PJIB 4XGZB 4HUNB 1K9FA 3DX9B 1YEGL 5IVXF 5GNYA 3X12B 3O3AB 5JDJA 1FAIH 4MJ5B 3S34L 3GSNH 3WHE0 5DJAB 2R2HB 2FO4A 1BHGA 1VADA 3U30B 5FCZA 4JFDD 3F8UB 4GMSH 4QXTA 1JDAA 2HFTA 2ORBL 3BE1L 1HHKB 4S1DC 1LEKB 3AHTA 3BP5B 2X7LA 4EUPG 3W9DA 1V0NA 3OXRB 3F12A 3RGVC 5GGTH 5BWFA 2HH0H 1VEMA 4RMVA 3QEQA 4PTXA 5I24A 3QR2A 2FX9H 4E2OA 1AD0A 2IAMD 1TMCB 3WKZA 3B2UC 4NJAL 1XF2A 1OP3H 3S88H 5I6SA 4BFEA 2D9CA 2BFVH 4OGZA 3LS5H 4S3KA 3MGOA 1BG4A 1MW0A 2E8ZA 3F5WB 4DKEH 3BKJH 5D5ME 5EUKA 4Z2LA 4BK5A 1HL9A 5JOFB 4LSRL 4JFEE 1S9XA 4LPYA 3MZGB 3KGRA 3CCHA 2G5BA 3Q0HA 4QHLA 1XGZA 3ARGB 5DHXB 1IV8A 3STBA 2EO1A 1GCYA 4IRJB 3WS3A 5E1HB 3QIBC 1ZGLP 4HWBH 4ZDHA 4OLVH 3UJJL 1U8HA 3WIIL 2NXZD 4JGUA 4WNQB 5JA8B 4ZSOB 2B5IB 1LO0H 1FL6B 4DUVA 3IYLW 1CZ8H 5BXTA 2VDQH 4YHML 5I9QB 4OZFA 3UTPD 3ZE2F 4L8SA 3ZR5A 3BGFC 2BSSB 2P8MA 1HN1A 3IF1B 4AC1X 3D0VB 3ARWA 2X44D 3UZQA 5L8JB 2BY0A 4XHJC 1IQWH 4XP1H 3O3EA 5LXGH 4LLQA 1I8MA 3Q6FA 5M03A 4B0MM 4P5MB 3TLRA 5CP3H 4NDMB 3GM0A 4YO0A 1JN6B 1RJZA 1E0OB 1GGBL 2FYYB 3K4AA 4UU9A 3DVGA 3H7BA 3RVUC 3B3IB 4PJFF 2HJFB 1ZHLA 3W6MA 3SUTA 3P11L 1KFAH 1WITA 4DWSA 4MLIA 3MJ7A 3HG1E 3QQ4A 5BO1L 1QSFA 2JJSC 3WNPA 1G6RL 3AYSA 1BVNP 1RK0A 4HIEA 5L7XL 1T4KB 1RZ8A 3BP4B 4X5WA 3VGBA 1MCJA 1CE1L 1KLUB 4ZS6D 4D6FA 1DBKL 5FYLL 3V6OE 5C0CD 2ZUSA 1K9TA 2L7JA 4LVEA 1FH8A 2XHYA 2A83B 3VI3F 1U3ZA 2PTTB 2FCBA 5M17A 2I27N 2MMXA 2DSKA 3D0LA 4DKAA 1O5DT 4OCSL 4MXQD 1BJ8A 3FFDA 5D71H 5FF6A 1SJEA 2WINA 2DSVA 1DQDL 4HPOH 4WRLA 2VZOA 4N1CA 1VFUA 4YWGL 1HJWA 3QFJB 2GSGB 4G6FB 3BDXA 4R4BB 1KB5B 1XF5B 5EWIL 3HMWL 4YHKH 4YEFA 2A74A 3MU7A 1T1XB 5F9JB 3L3JB 1N0LA 4EDXA 1TJHH 1M7XA 1I7UB 2OL3L 4TVUA 1E55A 3RGVB 2BFGA 4H1LA 1NGZB 1SM3L 3L4XA 2QL1A 4ODVH 3OGOE 3MBED 4DGIL 3C5SB 1B3VA 1U6AH 1JNNL 3DXAA 4D6DA 5EBGA 1C12A 2GITA 4F2MB 2BMKA 1NC4D 5DWUH 2WV3A 4Y16C 5IVNA 2LU3A 4QNPE 5KN5B 4F7PA 3QRGH 1FPTL 5E99H 5GGVH 1ZLUH 3BPCA 2WW8A 5JNYB 5JXAL 3SDAC 2XQBH 2R29L 1A1MB 2B0SH 3LDBB 3ARVA 4KKAC 5HPOA 1YEIH 2ARJB 4N0UB 1KCSH 4UTBL 4M43H 5D1XA 1MQRA 5AZ2L 3QIBB 4JREC 4JFFD 1LEKA 4M82A 3FTGB 4OZIB 1HWGB 3HMXA 2Y5EA 5EZJB 3AIRA 3TBYA 2DBJA 5J6HA 3NFPA 3KYOB 2XWEA 2IGFH 3DARA 5DUBA 3LQAL 1QKZH 1EJOH 2ADJB 4NGHL 2DDQL 3I50H 3BGFB 5DQDL 3SEPA 3CFCH 1EDGA 3NPSC 1RZIA 1H3VA 3DVNB 4R4ND 1NBQA 2C3XA 2PYEA 3OJMB 4EOWL 5ALCH 3CLEH 2PBGA 3WEOA 3GUTB 1BQCA 2WQRA 3BKML 1UC6A 4P57A 5DHVA 2MCPL 3RNQA 5SWZD 2QTEA 1CLYH 3GSOB 5D9SB 4M1CD 2GSIB 4LASL 2EC9U 4U1SB 5F9AC 1VPOL 4PRWA 4WVRA 4RNRB 2R23B 3OR6A 4KROD 5F7EL 3TBTA 2AKRB 5E8EA 1YPZE 1QFWH 3HE6B 1RJLB 2CUHA 4X7SL 4LGRB 4DGYH 4OOUA 1KB9K 3FQWB 5A8NA 5BVPH 1ZMYA 4LPVA 4TQEL 5GJSL 4CVWA 1ULVA 4UOQA 4ZXBC 2CK0L 1QOKA 2V17H 4P2RB 5ACZA 3D0VA 2BNQD 3X14B 4KY1H 2D3LA 4N0CC 3VDCA 3VMNA 4DZ8B 3X11B 4LFHD 3LKNA 4MD5A 2X9XA 3MUGA 4P7RA 2V6HA 1FA2A 5IFJB 2GDVA 4KQ4H 2EXOA 2J6EH 1OAKL 1ZA3A 4Y88A 1G7IB 2I26N 3SJVD 5CCKH 2LE9A 5LA2A 3BO8B 3CIQA 3PTQA 1E6OH 3S36H 4XPFH 5A2FA 3RWDB 4FQ1L 4LRIC 5LAXB 1LE9A 1JPTH 3KPRE 3RWFA 2YL6A 5I77A 3T0EC 1DFBL 3MJ6A 4C7FA 3O2WL 4M4PA 4LSPH 3ZDXE 3TZVB 1JIBA 2VR5A 4J6RH 1E4JA 4YX2L 3TV3H 1V7ML 5LCVH 1IEBA 2EKSA 5TFSL 1VGEH 3GO1H 1FL5A 1NOWA 1KPUA 1S7XB 3MRFA 2OM5A 5F7NC 4E42B 2XJ7A 2Y5TB 1D7FA 4G6KH 3S9DB 2GUOA 5DJXA 4U3AA 2ESVD 4M6OL 1XH2A 3PWVA 3JUYA 4Y16B 5FECA 3FL7A 4WI3A 4OZGB 4NPYA 4BZYA 2NY5C 3O81A 4X9GA 5C6TH 4K94C 3RI5K 4MVBC 2WLZA 4HHAA 4XNQA 1N5AB 3GMMB 3KYKL 4OQTA 3PHQA 4XPBL 3SDAB 1CECA 1W2PA 4CU8A 1F6AA 4GRMA 2F8QA 4KMTH 1ZANH 4J3XA 3HNVH 4BFGA 1DVFA 3F7RA 3ESUF 1X5AA 4P0DA 3WL1A 2B1AL 5LGJA 3HCVB 4JREB 3AU1A 3N9KA 2WP3O 4KJPD 4ZFGL 2C1PA 1DWIM 1FRGL 1CFSA 3FAWA 4P2QB 3QDME 4HZLB 3THMH 2R1XB 3W38A 4FS0A 1JWUA 2Z31D 2HLFD 4XRCA 3IK2A 4CRPA 5CJOH 3BAXA 4QHUA 4K3EH 4KJWD 2G60H 4P3DA 1DQJA 5DRWB 1N8ZA 3NPSB 1FJ1B 4ELKB 4EDWH 3AXLA 4URTB 2DGAA 3PXHA 3WHE1 1AJ7L 3PDOB 5CEXB 2C4FU 4GG6F 1RUQH 4GQ9H 4KGJA 2E9WA 5INCA 4ALAL 5JHLH 1WK0A 2XWDA 3AY4C 2HN7B 3GIZH 2A6KB 4G9FD 3VIPA 3TPUB 2F53A 2BJMH 1H0IA 1NM9A 4F9PC 5IBTH 3KPOA 1MW3A 1IL1B 3O3DA 5DHYA 3SE8H 2DN7A 3K1DA 4LHUG 1CGVA 3ARQA 1KOAA 4IISA 3LOWA 2VABB 4HF5L 5T1KA 3FTGA 4LARL 4OLWL 3ARBA 3BEVA 1UM4L 1Q8MA 2H2SD 3U0WL 5I1LB 5A6JA 3Q1SL 1BQLH 3VG0L 3STLA 3RO8A 2SEBB 4FN0A 3I6GA 1AP2B 5DGQA 3DX7B 1EEQA 1FVEA 1RUKH 4JFYA 4ZXBB 3TBVB 3MROB 2WZHA 4YDIL 5L2KD 4B16A 5HI5C 3QH3B 1LEGB 5HGAB 1NCNA 5EIVA 3FJTA 3IXAB 3UG5A 4ETYA 3TNNB 1KIPB 3ZT5A 2ZX7A 2VLKB 1QSEA 4QRSA 2HP4A 1E4WH 3CU7A 3QXDA 3MCLL 1JGLH 3LH2L 4UDTB 3PTKA 4CVUA 2EEXA 4FLRA 3O6FC 3PZNA 3SDDC 4LSQH 4PBGA 1VJSA 5IV2A 5AYUH 1BTCA 1X4XA 1H3XA 3SCMA 1V6YA 2ZG3A 4GAGH 1W0WB 1HYSC 4PRDA 1J9CT 5HD8C 4TOYL 2ATPB 3T0EB 3V4VH 2IWGA 5EBWB 1HHGA 2DQGL 2FR4A 5BRZD 1I7TB 4LHJB 4HV8B 1J8HA 5F3BA 3V0VA 2OTWA 3C08H 3K46A 4J3SA 4BKLA 1ZTXL 5IEHA 1H41A 5A6LA 4Y8DC 1S7VA 4HC1A 1ZVYA 2XFFA 2Q76A 4HZ8A 1OP5H 1QFHA 3VFPB 5A40E 1PX4A 2DQIH 4J3WA 1XGPA 3DYOA 4OIAA 4P9HH 4KUCF 3OJDB 5D7IA 3G6DL 1GOFA 4U1KA 5DC9B 2HT2D 4MWFB 5C8BB 1VKXA 4KI1A 4I0PC 2JLLA 3IVKA 2V2WB 4GQQA 1JWSB 1HI6B 4IOFC 5FO8A 2YN3A 1HP4A 2XFYA 4F7MB 1FN4B 3CXHJ 3T4AB 4NZUH 1UD8A 4PGZA 2WANA 3HZKB 1T3FB 2APWA 3FO0L 4MDIA 3BAJA 4PJEA 5DQ9B 3KPSB 4IDJL 1F3DJ 4WJ5A 5E70A 1KJMA 2E9BA 4NUGH 1FNEB 1EEZA 2CR6A 2J3SA 1FYTE 4KUCD 4NO3A 2X4TB 3GSXA 2UWEF 3BPNC 4BQ8A 3G6AB 5FUZL 3RX7A 1SEBB 1I1AC 5EO0A 5E94B 3CHCA 5DFVD 1CGUA 4MCZB 4I9WD 1K8DB 4BQ5A 1EX0A 1DJSA 3SO3C 4GIAA 2EIDA 4GXVH 4QRQB 5C07B 1G7JB 4M6NL 2HT3C 4UQ2B 1ESWA 2Q87A 3U9PL 1ND0B 3THDA 2YPKB 1YN6A 4XPAH 1IAMA 3VFGL 3ALWA 4XMKL 1UQSA 1WV7T 2DS4A 1PG7H 1IM9B 2D1ZA 2VX6A 3F7QA 1H0DB 3FKUS 4Z7NF 1S9WB 3C8HA 2K7PA 3H9ZA 1CTOA 3GIVB 4BA0A 2NTSP 4Y5XA 3PZGA 3QR3A 4G7VL 4G6JL 2CPUA 5A2BA 2LV4A 3TP4A 1CLOH 4HKJB 4NQSB 1LJYA 3I3EA 5IMMB 3OGSA 3FB6B 4P2QA 3TFKD 2BVTA 3IJYB 5C8JB 4X6FB 5E9DB 4Y2DA 1MHEB 5E0CA 2AABH 5C0AA 2IPKA 3CU1A 3KXFD 1D9KD 1QSVA 3QFDB 4S1RL 1MFDH 2Y8KA 3EDDA 4JFVA 2XM2A 3CFIC 5EN2A 4ISVB 1K6QL 3K81A 1BGAA 1D5BB 1JP5A 5E03A 4P2OD 2V9QA 1FFPB 3KJ6L 2R56H 3GJFH 5GJTL 5C1MB 2QADC 4OI8A 1FE8L 3U2SA 1G6RB 2CMRL 1VACB 4Y2OA 3L5XL 3MR9B 4X9FA 4JHAH 3O6FB 3SDDB 1ECEA 1NFIB 5DD5H 3V9FA 2F19L 4JR9H 3V5KB 2UVFA 3LKOB 3C2AH 2OCFD 3DMMC 3WXWL 1CDBA 4YDJB 4AIOA 3WLBA 1IFHL 3HZVB 1S78D 4M9OA 1RVFL 4C56A 2XPKA 1PSKH 4OM0L 4PRHD 1T5WB 3QEUA 4ODXB 2VO5A 1U8LB 3NACH 5FV2A 1UR2A 1E6JL 3RBGA 3WQ6A 4NRYA 1GVYA 2VXQH 1YNTB 1XSJA 3CO4A 4MAYD 1R8LA 3MLSL 4DK6A 3DX6A 2X2YA 2QQKL 3U83A 4U3XA 1AXSB 3QPQC 2CIIB 4M7JL 1B3ZA 4P23D 2DMBA 2DTML 3MO1A 5F93C 2ICES 3CFJB 3UMTA 4HIXH 4OAWB 3BKYH 2VQ1B 3WUEA 4H5SB 5D6CA 4KK5D 4XCCL 4ZFFA 4AYFA 2CEQA 3UJIL 4YPJA 4GRLA 2F5AH 3L9RB 4FP8L 4XB8A 1CT8B 4I0PB 2Y2WA 3LMJH 3TNMB 1FSKC 1HKKA 4GAYB 4AMKL 5DD1H 3I3BA 4Z6AT 3GI9L 3RWEA 5ABDE 5KTEL 1LK3H 3RY6A 3Q5TA 2QKIB 5E8PB 1I9JL 4QOKD 3IU3A 5E00B 1OGSA 4LIQE 3WFLA 2YA2A 3BPNB 2CO6B 4NQCA 3KNBB 4LSTH 1I1AB 1OCQA 2A6DA 4R8WH 3PBGA 3AQUA 1LO4L 3BGMA 5TE4L 3EJYC 4UDUA 1UWUA 2HJKA 1QG3A 3D25A 3SO3B 1EGJH 1PLGH 2B1HL 3P4MA 3HMXL 1RPQA 1D6EB 1UM6L 3H42L 5CPQA 2ZCHH 5D7JC 3MUAA 4ZXOA 3VKKA 2MOVA 3EYQD 1DWGM 2ZOKB 3RL1B 3O6ML 1D5IL 1T04B 4LCWB 3S5LA 5M3WA 1X5LA 4XP5H 4MDJB 3DETC 1EDTA 3VIIA 4MD0B 2X4UB 1MUJA 5HVHB 1U8JA 1GOHA 2IH3B 3GKWH 3HUJB 5EZIH 1HT6A 3D2UD 4JM2C 2FX7L 1QHZA 1IC4H 5T1DL 5DSCB 2BNRD 2A9ML 3KPRA 4I3SL 1UD6A 2BVPA 4ZUVA 1FNEA 5IEKB 1BOGB 4NFCA 4HUWA 5E94A 3WMCA 4AWEA 4KPHL 5ETUA 4E41A 2Y07H 3B9KC 5JXEC 4X5XA 4L3ED 2NXYC 4UI2A 3DO7B 3OKMA 2WMIA 4EIGB 4AZBA 1CDUA 3E6FA 4PB9H 4BK4A 3MGTA 4JY4B 1JNJA 3QG6B 3S4SA 3SGJC 3MRMA 1TA3B 2QADB 1MJ8L 3WN5C 2PBOA 4PG9B 4BZ2H 1KTKE 5CMAB 5HDBE 1RUML 3WNMA 4YFLF 4AENA 1AQDA 1IC1A 3QWQB 3FB8A 4RMWA 1V8HA 4JGJA 3VGGA 4PJDF 4EKXA 4LKXB 4JAMB 1J0KA 1OB0A 4PYGA 3HC4L 3RUGF 4Z7WE 5T3XH 3DMMB 1R3HB 5IVXE 2XSBA 1J86A 2B31A 4V2BA 1DWFM 3N1QC 4HKJA 5CWSB 5EZOL 1X1NA 3U7BA 4CJ1A 2Q8AL 1F11A 2V2TA 1Y18A 2BDNH 3UDWA 4MGXA 3CXDL 4JPVL 2IQ9H 3BI9X 1ORQB 2JCCA 2MPAH 3MLRH 2PCPB 2JJWA 1YYLL 5HHQA 1KTDA 5SWSD 5BRPA 1HJVA 3BIBX 3QIWC 2JIWA 3UG3A 1OL0A 5GNXA 3AAZB 1R3KA 4WHYH 3RWIA 1ZWIA 5AG9A 4I0CC 5KVDL 1YMMA 1Z32X 2GJXB 1GUVA 5AWNL 1NFIA 2YXMA 4MD4A 4JKMA 2A38A 3RZCD 1GGCH 3ULUF 5ITFB 1QNQA 3V5KA 1GJUA 3LKOA 1FSKB 3UTPE 4PJBF 3KL3A 1U8MA 4QYOB 5DMGC 2A77H 2E7LC 4TTDD 4RAHA 5IMLB 4O5LH 5L0QB 1CDCA 2EDDA 3RWJB 1CDJA 5CGYC 1BIIB 1FZOB 3QUML 4I48B 2Y7QA 1PKOA 1CG9A 4P7OA 1XGRB 5IP4A 3LEYL 4LCCC 3ULUD 1UB6B 3O2DH 1NJ9A 2CIIA 1KCVH 4K2UH 4AD3A 4HPYH 3ZE2E 3GB7B 3RVTD 1MCEA 2HT4C 4HMCA 1WF5A 5TGBB 4WTZA 1KLGB 5D7JB 1VDGA 2B4CL 4ELMA 2YRPA 5GS3A 4K8RL 5TQ2L 3OJ2C 3ELAT 3T08A 5DF0A 1I4FB 4AD5A 2VDNH 3EJJX 5A95A 1SJHA 1X4YA 2NCMA 1HK6A 5C0CE 4BSVA 3GBDA 2FHFA 4AZ8A 2D0GA 4PJFE 4JM2B 4UT9H 1T03H 3PQYD 4G8FA 3QRFM 3I2CH 3MRPB 4JHWL 4JL2A 1YEDA 4XNYL 2WC3A 2XFRA 2YL9A 3V2AR 3IJHA 1H3TA 5I75C 3EYUH 4KFZC 4D3CL 4M8VA 1ZJAA 1NOFA 2NXYB 2HA1A 4FFWD 4M62H 5BV7L 4PJ8D 1X3DA 5INDB 3BPOC 5CBAA 3O9WD 4IOIB 5C08A 3OAYK 1PDKA 2C8NA 5A8MA 3OKOB 4PRBA 3KPMB 4GG8A 4P49A 4UINH 3OLGA 2AVGA 3VI3E 3WN5B 1BQHB 2DLIA 4BJLA 2FL5A 4I1NB 3RX8A 2GK1A 4NWTH 5EU4B 4PLNC 3RNKB 1P7HL 1N59A 1XCTA 4HLZH 3IJSB 1YEEL 3H0TB 3TIDA 1I9EA 3O11A 2ENYA 3EYFB 2H32H 1JL8A 4LP4A 3S3JA 2R0LH 2IANB 4WKHA 4WIQA 5SX5H 5KJRH 1AO7B 1U8NA 5KW9L 5GRUH 5JBEA 5HY9B 1XGTB 2VIRA 3MV8B 5IIEA 3P4OB 4O4YL 4P8XA 1EVTC 1INQB 4PGBA 5KOMC 2DB8A 2JF6A 1V5JA 2NR6C 5GGUA 4TVDA 5HHMD 1ZT1B 1WNOA 2IALA 4OZFH 4HX1A 5BQ7B 2Q86B 4PP2A 3G5XB 1FIGH 5CJQH 2Q20A 3QIWB 4KMQA 5D1QD 1MWAH 4LP5A 5ILTH 3QDJD 3ETBF 1FDLL 1QVBA 1OPGH 3LKRA 2R8SL 3WSQL 4JRYB 1CCZA 4HGWB 3SCTA 2EXWD 2Z35A 2DYPB 4R96B 3BSHA 3ARZA 2E6QA 1QLRA 3S37X 2F74B 4PRIB 1E72M 4F9JA 4TVPD 4ZTPH 1WAAF 2ERJC 4TPRL 4HAGA 4UIKH 4M24A 3MNVA 3VPLA 2FLRT 3LB6D 2MKWA 3TESA 4OLUH 5DD3L 4FFYH 1WWCA 1FG9C 4LLDA 5EH1A 4XP9H 3U82B 1G1YA 1AD9B 2EH8H 1G0CA 1FLRH 4LEOB 1GQIA 4JVUA 5DJDB 5E1AB 3O0RH 3P40A 2DSUA 4NKMA 2YBRB 1OAUL 4MNQE 1U30A 2NTFB 4X9YA 4CMMA 2JEPA 1F4YH 4HCRH 4LCIL 4LCCB 2JIXA 3BZFA 1TDQA 1MHPH 3L3HB 5F7UA 3PZTA 1KC5H 5EU6B 2G75A 4Y4KD 3RKDC 4RFEB 4YK4C 1A14H 4FMKA 3VA6A 1VIWA 3NFNB 3EKCA 2WWMD 4X80H 5FM4A 3I9GH 3RWHA 2IFFL 3E8UL 4Q74A 1Q6DA 2ICEA 3CFKB 1S7RA 2VLJB 3U0TB 1CZ1A 3D85A 2Y24A 4LQFH 3CXHK 3LPOA 4EE9A 1G7PA 2AI0H 3ZKSD 4FNLL 3C5ZC 4FZEL 1ED3B 2BNQE 2W9LA 5I78A 5IK3A 4EN3D 3UP1A 4NN5B 4YQXL 4XCFH 4EI5C 2D7MA 4LAQH 1EZVY 1JK8B 2CHNA 5JTWA 1L4IA 4ZQKB 4LBEA 2CUMA 3WDIA 1MCPH 1FG2A 4OUUA 1FZMA 3LRSA 2WNGA 4B50A 5E2UL 3QISA 4I3RL 2WWKT 5TPWH 1AGDA 3SJVE 1ACYL 4G80B 3SUVA 5C7XH 2G2RB 4X7DC 4U1NA 1RU9L 5GGQL 3OR7B 1MIEL 3SUSA 2Z92B 1IGFL 2R0ZL 4K3GA 3CZEA 3QG7L 4FLSA 4QHKJ 5F44A 1LNUA 1FH5H 1WC7B 3RTQD 5JZ7D 1R87A 2IF7A 1B2WL 3TTYA 5E2VL 5ICZA 3Q2CA 4MA8H 3FQTA 4PUBH 3IDXL 3QCVL 4LSVL 3WH9A 4FG6C 3QUXA 1Y6KR 5I5RA 1MJJA 3LEXB 3BIAX 3JWOL 3MV7B 1OBAA 4ZFMA 1UACH 4HS3B 5FYKH 1BZ9B 3NAAL 4AG4H 4HWZB 1PZ3A 1EFXB 4UFKA 3RJYA 1KCRH 1MFCL 2FJHB 4JO2L 2ESVE 3EYSH 4EXKA 2ZX8A 1DUZA 3OF6D 4OB5L 4OGXH 1HHHA 1F58H 1IJ9A 1RSFA 2DQCL 3B9KA 1MVUB 3QI9D 5E56A 3UCQA 1DSFL 4RWYH 5C0IB 3WHXB 1I7RB 1OM0A 3TA3D 2D0FA 4EANA 5EZLB 4PJXB 4NJ9H 1V02A 3UETA 1FNSL 1H15A 1T83A 2R15A 5AUMB 1FO0A 1NUDA 4QF1B 3S98A 3VXUD 4A2LA 2VZUA 3EFDH 4PJ5D 1B0RB 1DWAM 3I75A 5C0DB 5J1AB 4XNXL 1GAFH 2QV4A 3VXMD 4DVBB 5I30L 2ERJB 4KVCH 5KANI 2EZ0C 4EK7A 5FDYA 1VESA 4RBPK 5IBUB 4D8PA 3N1FC 1MCHA 2QSCH 3WUGA 1XGTA 5A43C 5E8DH 1UD3A 1H3UA 3Q48A 3U4AA 3TONA 1MQKH 1CDIA 4K3HA 1G9NL 1A4KA 4HUUA 1P4IH 2Y06H 4PREA 2ICWB 2V7NA 3FRPA 3EDFA 1NEZB 5CILL 2N4IA 4H04A 1US3A 3DVFA 2ZIDA 3TWCH 4PG2C 3C5JA 4UUJB 4BFIA 4OFDA 4G9FE 4N9GB 3DURA 4QRPB 2R2EB 4KK6C 3FO2A 2AQ1A 3TO4D 5IR1B 5D70H 5GGVY 2CLZA 4AM0B 4YK4B 4MHHG 2HVMA 4DCQB 2FDBP 3GMOB 3PL6C 4JRYA 3WUBA 1RUAL 5KOVC 4JO4L 3S97C 2X9WA 4AT6B 4E5XB 2R2BA 1GVIA 2VXUL 4D94A 3U7YH 5JOPD 2CKBA 4TSCL 1KV3A 3C5ZB 4PY7B 3GBMH 2J8UB 5C0BB 3S6CA 3VFRA 3C8DA 2AK4D 4J3UA 3MJ9A 2VLRD 5HVFB 4Z7WA 4EXPX 2WBJD 1MFEL 2Y8VA 4QRUA 5DJDA 1A6WH 5JPMA 5D2LB 5FO9A 4HFUL 3WNLA 5A2CA 4PY8J 1HQ4A 2ZPKL 4PJGA 2R0KH 2PTUA 1LO3L 2UUDH 2WVTA 4LHQB 5KZ6A 1A7RL 1Z3GL 1F42A 2EE3A 1S9YA 3N0PB 4OF6A 3VMOA 5GZNC 1K9EA 4WU5B 4YXKL 1A7PH 2FZ3A 1T22B 1BPVA 2BC4A 1X5YA 1UZ4A 1DQMH 2H45A 3WBAA 2O26U 1RZKC 1DQLH 5EC2B 3CC5B 4PIRF 2AGJL 3PGFH 1OD0A 4KRTA 2VLJA 4XVSL 3BVNA 3M17A 3ZYOA 1L0PA 3ZJ7A 4OQ1A 3D18A 5DT1L 4JVWA 4OQTH 5DS8B 4UOW0 4OJFL 5BV7C 4XMLH 5TJWK 4G42B 3VX1A 1KB5H 1SVZA 2FX8H 4WIWA 1IT9L 1U8KA 1ZK9A 1W9UA 5BVJA 1ONQA 1WBYB 1GORA 2EEBA 3ZO9A 1RPKA 1C5BL 1I8LC 2DT1A 4WHYG 3LPWA 3MPCA 3PWLA 1UWGL 3SDXA 5I8OL 5CSZB 3L7FB 5FO7B 4OKVB 5TH2B 4F3FA 3WV0A 2M2DA 3DTXA 1MCWW 2IBZY 1Q9LA 2RJMA 2YKLL 3BP6A 4OTXL 4R4FL 4K3DH 1W3HA 2QHRL 2VR9A 1U93B 3W27A 2DAVA 2CIKA 1N2RA 5DZLA 3TBWB 35C8L 3WUWB 1C8XA 2BNJA 5B38G 3TN0C 1KEGL 4L5FL 4JFPB 4EVNA 2O61A 1RFDH 1E6XM 2CXGA 3DYPA 1FHDA 5TF0A 4L8DA 4P4RA 4BH8A 4I9WE 4KTDL 8A3HA 4GRWB 4AL8H 5E6IB 1WTLA 4PJFA 1IZJA 3VNZA 4D9QD 2EDRA 3HJEA 4CN6A 4JRXA 2J25A 3FNDA 3CLWA 3MRQA 5BJTB 4HXAL 3FO9B 4KTYA 3KYAA 3T8XB 4F8XA 1QI0A 5EOCJ 1DBJL 1BFSA 2VNCA 3MLTB 4NQTA 3SKMB 5DK0B 1B4RA 3FT3B 2UWEE 5D1ZA 4KVNL 4GPNA 3PL6B 4AIZB 4UIMB 1RUPL 3BXWA 4WW2A 4D71A 2EYSA 3ZE1E 5AY7A 4F58L 4DTGH 4Y1AA 5T1MB 3BH9A 1ZHBA 2OXHA 2QQQA 3QUMB 1F4WL 3OZPA 3T4YA 3SCOA 4HJGA 1CK0L 3KXFE 4X7FC 4ZD3L 5I8EB 1QQDA 3P0GB 4HULB 4JFOA 2C7FA 4A3YA 1Q9WA 3Q6GH 4WV1C 5D7LD 4Z7NE 1BD2B 4J4PA 1MVYA 1VFBB 2YPLB 3BQUD 1EEYB 3OG4B 5FA3B 4IRSD 4JJHA 5A6AA 2ZUXA 4YUEL 3UAJD 1AC6A 3PZQA 1OIMA 1ZHKB 2PW1A 2G41A 1NBVH 5H2BB 5JUVA 4N8VG 3GMRA 2VDKH 2WIIB 4HUXA 2AK1H 2XXCB 1C08B 1RK1B 5J0BA 3G6JB 3FOLA 4HLZG 4PR5A 4B53A 3BH8B 2J88L 1YDPB 5F96H 2WK2A 5A6MA 4YPGB 4O2EB 2QSVA 4PRHE 1HH6A 4Y4HA 3HFML 1P9MC 1G9MC 2YD2A 3HNSH 1U9KA 3C5ZA 5KS9F 4JRWA 2AQ3A 4QP0A 3VW3L 4ZODA 4YXLL 1BSIA 2OSLB 5BV7B 3MRJB 4EI5A 1NCBL 3Q5OA 1QFPA 1A2YA 3VXPA 3V5DB 1EAPB 2PO6C 4OZFG 3TBSA 2DMKA 3KHQA 1OM3H 1TVNA 4H0GA 2QLVB 4FTVD 5FV1L 5FKPA 1AR1C 4X4YB 3FT4A 5IBLC 4XH2B 5F7WC 1G7QB 1AFVL 1BGXH 4PJCA 3E6HB 3MLUL 4MNQA 2AAVA 2YEZB 5ESQB 1WIPA 3LPFA 4N5EC 5IESH 2KQMA 3TEUA 3QNXA 3ET9F 4K7PH 1F4XH 1FORH 4FOMA 1I8KA 2OJZL 3QEGL 2H26B 1T2XA 3JWOC 4ZFOB 1ETZB 1ZLSH 5IB2A 3FOMA 2WCGA 3CMOL 1DE4B 4F80A 1R6VA 2LFGA 1RMFL 5KVEL 1UD4A 3OMZA 2I60H 3QXUA