5JIPA

Crystal structure of the clostridium perfringens spore cortex lytic enzyme slem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
GFAQDKNPLSTFGPDLNEFSRDVNFLTLAKNSDFIYLRASGSGTGKLRIDNKFLEFAKECRRLGIPCGAYHFAKPSKDLDSAVIQADQFIDVLQQGFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTDEGKLDGVGSPVDLNWGPNSIDSLMPPSAVTGLNAYISGNKIFVNWTANKEDDLNGYNVFVNDNYAGTLPRKATKIVIDKSRFYLPKGKPIKISIEAFDITGDFSKERTEYILDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Clostridium perfringens SleM, a muramidase involved in cortical hydrolysis during spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords Cortical-lytic enzyme
total genus 95
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jipA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5jipA01
4YHPA 2VZVA 2VIRA 1JNHB 3RFZC 3MOQA 4JFEA 4U0RB 4OI9A 2QSVA 1X1NA 2NPLX 3C5ZB 5EN2A 4N42A 2A3AA 4OIFA 1I4FB 1FIEA 2P43B 4ZD3H 3ZTNH 3TBYB 1OAXL 5GGUA 3CFBA 1A8JH 1VA9A 3AXLA 2Y25A 4S1RH 1MCOH 3VFGH 3EKCA 5DEFB 3MV9D 4M3JA 2MPAH 5T5FL 4LP5A 4XNZC 4I0CC 2XVKA 1Z2KA 3BFOA 3O2DA 4FQHB 4HJJL 2W9EH 4YEEA 3RX8A 5DRZB 3OB0H 1AFVL 1UHVA 3T8XA 3CX2A 1GQJA 3P30H 4E0RB 1CFQB 1JHKH 1YY8A 1S3KH 1WT5A 2HG5B 4BA8A 4PB9L 4LYQA 1S7SA 3W24A 3RGVC 4BELD 4Z7UE 2XPGB 5TJWK 4QRQB 4UFLA 4LGXA 3GJFK 1V3HA 4LCYB 2GJ6E 3PG2A 3MLSH 2N7BA 5DYOA 5D8JH 4X4XA 1YUHA 1QVBA 4I2XA 4XPBH 1D9KD 3WUEA 1DBBL 1T2QH 1V3KA 5JUEL 5EU7C 3IDXH 4JRXE 4UQBA 1ISYA 2UZYB 5FF6A 1RSFA 5IFHL 4HOXA 4H1LG 4N0RA 3UG4A 1R5WA 3O6KH 1RZKC 4LCWE 4GXVL 3BKMH 3MA9L 1AGDB 2EIDA 4FRWA 1UACH 1WT5C 3T0EE 4EOWL 4GS7B 4NQED 5EORH 1I9JL 3SUWA 2R4SH 4X6FB 5EUOB 4F8TA 5EU5B 1OP5K 1TZGH 3VDHA 2Q8AH 4OZOA 4XVTL 5JHDE 1CLYL 4KGLA 5HNNA 2ZNXA 1JI2A 4P5KB 5TDPB 3KE0A 1J18A 4LSUH 4OD1L 2CXGA 2X4PB 2FH8A 5C09D 3F7VA 1B3WA 3TONA 4CBPA 1EERB 2ICCA 2IALA 5FA3A 1WO2A 4NRXB 4XPTL 4I5BB 1T5WB 5IQ9B 5J06A 2PNDA 4C7DA 5CINH 5DA4A 1DDHA 1KTDB 4PJGA 3WQ5A 1AD0B 4HZ6A 2ZPKL 3TIEB 1DR9A 2R2BA 3HI6H 4I18A 3DI2B 1IKFH 3BKJL 1BX2A 4MMZC 2OTWA 2QQNH 3CLFL 5GHWH 5HYQB 2ZJSH 2GK0B 2X44D 4U31A 1FNEB 4XC1H 1VGEH 4YDIL 5GIRA 4ACZB 3GFUA 4CDGC 1KOAA 3ZR5A 1E4KC 1WC7B 1Z32X 2FRGP 4ZDHB 3UEZA 2QLYA 4MS8C 1QFWM 4NRXA 3CXHJ 3CO4A 5AYIA 1WNOA 4HUWA 5C9JB 2C4FU 4DJMA 1IEAB 2NZIA 8CGTA 5DEGB 3IJ9A 3KPRD 3KL0A 2F58L 3RMEA 2OTWB 3LPFA 2E7LA 4JB9H 4LPXA 4TTDC 1ZSDB 1B0RA 1S9YB 4LDOB 5DRNB 1LWHA 3ZKND 4LLWB 1AI1L 4HXAL 5I1KH 1G7HA 4HUKB 4MNQE 1YDPB 4FFVC 4AEIH 2NXYB 1S9KC 1KPRB 3FFCA 2A3CA 2FO1A 2HKHL 4QXTB 1WZ1H 4RGNE 2VDPL 4TSBH 3UXFA 3GRWL 4F3FB 3N9KA 1MCEA 3IKCA 4CW1B 5E0FA 5K9JL 2W0FA 2UZIH 4Y4KC 3AJ7A 4XZBA 3NCCB 4PJIF 3AB0C 2EIBA 1D5ZB 5IM7B 5EZLB 1KJ2L 3M1BB 3MLWH 1QBML 3MRKA 4XI5C 1OF2B 5DMKA 4JZOA 2EE9A 2DKUA 4Z95L 2HRPH 4KRTA 2FSEB 1LK3L 2WUCH 4DUWA 1UWEL 2CK0L 4EQ2A 5C2BL 3O6AA 3FFCD 5T3XD 2Y9RT 1NC2D 4I48A 3UG3A 2QSQA 2FCBA 3HE6D 4Y5XB 2D7QA 4AL8H 5F9JA 1DFBL 4Z7NF 3KPSB 3KR3L 2A6JB 2EH8L 4N5ED 4TSCH 5D4QA 4TPRH 4D9RD 3GIZH 4CVUA 3TTOA 2IBBA 1GOQA 3VWJC 5DF0A 2IQ9H 1T7YA 1VGKA 4XC3H 5GGVH 4AD5A 1JGUH 4X6BA 4XPHH 5B8CA 1IRAY 2PYFB 3LEVH 5HVWA 3DGGB 3RPIB 5D7LD 4CUCA 4TQEH 3WYRA 4PGDB 4KKBC 4NOFA 3QHTC 4DKDC 3U9UB 5F9JB 3GSNL 5FO7A 3P9LB 3ALFA 5J9PA 2WIMA 3BZ4B 1TJIL 4OUUB 1I3VA 4FFVD 1C5BH 3V6OC 3MNWB 1FZJA 5F71A 5DMGC 4NO2B 4X0KA 3CFKA 4M5YL 5E08L 4MA3B 3HG1D 3D3VA 3FN0H 3DGGA 5HI4D 3OR7A 4UOJA 5I15L 5L0QC 5LBSL 3AVEA 3O81A 1TNNA 1RPKA 1T2QL 5J12C 5JMRA 4U1GB 3AFLA 4QO1A 4OQTH 1LG1A 2AJUH 1EZVX 3FCTB 5KTEH 5GS1C 5A2AA 3OMZA 3ZKQD 2LFGA 2GHWB 3QUZB 1I1AA 1AY1L 3MBEC 4HIEA 4PB0L 3ILPB 3WN5A 2YLLA 1HX0A 2O5YL 3C5JA 2EZ0D 3BD4A 1P6FA 1RZ7H 4JKMA 2F54D 2FEDD 3T2QA 3NCFB 1YN6A 1YEHL 4PJ7E 3DSFL 2AV7A 4LVOC 3PWPA 2WC3A 1DE4A 5DRXA 3L3IA 1ZSDA 4WW1B 3WXVL 2WAHA 1AGFB 4Q6IA 1FGVL 3ZE0E 3FKUS 3GM8A 2XWJA 2WNWA 3S37H 1SYTA 2QR0A 2OR9L 3MRDB 4NQCD 3IETA 1OQXA 1AP2B 1HOCA 3TBSA 3IDGB 3IFLL 4YHOH 1XSJA 1I7UA 4Z7UB 2PXYA 5TFSH 2Y07H 4JO3L 4NUJA 2EYSA 4MNLA 3BI9X 4WO4B 2JJWA 2WZIA 2R56H 4P2QA 1FORH 4KU1A 1PZ5A 1QFUL 1JCKA 3X3FH 1QSEA 2QQKL 3IF1B 5E6IC 3VFSB 4P4KD 4HWEL 1M03A 1XH3A 3LV3A 3KYNA 2OLHA 3UESA 1SJVA 3VG0L 1IBGL 1QLFB 2W65B 4JFZL 4OBSA 1PX4A 2DH3A 4LL9A 2VR4A 3O8XC 2WINB 4UFHA 4GXPA 4XUYA 3OXRA 3U2SB 3IU3A 4QRTB 4WI4A 2I60L 3MV7D 4P8WA 2DKSA 4X5XA 4IDJH 1OHQA 2AJZB 4Y7MA 1K9FA 3O3EA 4WV1C 4DEPC 3QO1B 1A47A 3GEWB 4Z6AT 4KQ3L 5KSUA 1NUGA 3BWUC 4GRWB 1NUDA 1MCKA 1ZK9A 1BJ1J 4Y4KD 4OCXH 1A02N 1E71M 3SCRA 5F7UA 1EPFA 1Y6NR 2YXFA 1BZ9A 3O11B 5CBAB 4HH8A 1T83C 2P5WA 5J0BA 2CKSA 4UFKA 1T0NA 5DJCB 2C3VA 1ZHNB 1GL4B 4O2CB 4X7SL 1FNLA 2VLKD 4L1HA 4PJAB 1WDSA 4GKZA 1MFEH 1EXUB 3FW6A 1E27B 4LSSL 4CVXB 3DECA 1PKQA 4FS0A 5I5RA 5MEQA 2Y5TA 3RO8A 2ZWZA 4RE2A 3NMEA 2ICWB 5TQ2L 4M43L 5CEZD 1K4CA 3OLIA 3TV3L 5IFAL 4HBCL 1CLCA 1B0GB 1JGEB 2CJUH 1TJGL 4J2XA 1TTGA 1J87A 3CDCA 5AYUL 1JRHL 4XNQB 4LXFA 3MTRA 1I1AB 4HS6B 4XMKH 2AW2A 3PDOB 4UU9A 5F89B 1Q6CA 4FXGB 3JV4B 1BIHA 4MHHI 3QNZB 5F7LB 1R5IB 5IMLA 2EDEA 3C6LA 1NGXB 5I66B 2VJXA 3ZKMD 4NKQB 2SEBB 4G9FB 4GZIA 4BA0A 1GGUA 5JHDA 4LLDA 2P8MB 3ECBA 2IALB 4LQFH 5DZLA 4L4TE 1FSKC 1WZLA 2OJEA 3AM8A 3F7YB 4W4NA 5FM5O 1NOFA 4BJLA 3S97C 1I4FA 3MFFB 5IROC 3UBXG 1C5BL 1MQQA 1N5AB 2PXYB 3V6ZA 4MNHA 4PJXB 2DJUA 2RFXA 5ABFB 5I3DA 3TCLA 3SN6N 5BS0A 3QHOA 1MQKL 2A6KB 1Y0LA 3O2DH 2CD0A 5JZ7D 3QQ9C 1Y6KR 3B9VA 1KGUA 3F65A 2BC4A 2HT4D 3NCYP 3V52H 4MQTB 1CFVL 4P3DB 4KUCD 2J2ZA 4QRUA 4H8VA 1UJ3B 1K9TA 2PTUA 5FKPA 4JAWA 1G7IB 4OQTL 4H8WL 1NBZB 4C56A 3QDMD 2WYSA 1JTTA 1F8TL 1D5BA 1YY8B 1I85A 3ZL4L 5HYSG 2ZX6A 2FO4A 5ABFA 5IHLB 1CG9A 2CKBL 3AY4A 3PNWB 5DR5L 1FH5H 1FZMB 3DNKA 3NACH 5H2BA 4IOFD 4JE4B 3CHEA 5I1GL 3EGSB 4A3YA 4S1RL 3VFGL 1CZ1A 3Q48A 4LLWA 4MAYD 2F5AL 3O2WH 4PUBL 5KW9H 4Y4HD 1I8MB 5HI5D 4X4XB 1E0OB 3RNKB 5EWIH 2APFA 4DGVL 2DLFL 5SWZE 4G3YH 2Q8AL 2YD7A 4HG4J 5ISZB 1OAKL 3VIPA 3VRLE 3EZJB 1FZMA 4GW5B 1KGXA 4PJHB 4P8VA 4M93C 3NVQA 4YUEL 3SCWA 3BP6B 4D3CH 1QQDB 4X6DA 4LSRL 4JHAH 2WWDA 1OWRM 1B4JH 1BJ8A 3LEXA 1OPGL 1P4BH 2V3EA 4TN9A 2A0LC 4GRMB 2DDXA 1NAMA 3X3FL 5C0CB 2NY6C 4PFEA 1M05A 3CGTA 3N9GL 1D5MB 3MMUA 2GUOB 3THCA 1MH5B 4NQDD 3S96B 5A40E 2BSRA 4HOWA 4RMQA 1E6ZA 3TGXA 2ICWA 1CK0H 5EZIH 1NLBL 3ZT5A 1A3HA 2A6DA 1IBGH 4PCSA 1T03H 2X4QB 4X99A 3DHJA 3HAEH 4PYGA 1KN2H 1MPAH 2XA8L 3FO1B 4CD6A 3LB6C 4RFNC 2GJPA 3BHBA 1EDGA 5BV7H 4LHUD 4PGBB 1TVDA 3F12B 4WUUA 4Y4FD 5A8OA 2V17H 4ONOA 5DURD 3PZGA 4PSPA 2XKSA 3CU7A 4O02H 4IMKC 4KQ3H 4Z7WB 3C60B 2Q3AA 5IMOB 1BX2B 1KBGH 4XCEB 1XH0A 5HYEA 4ZNEA 3NIYA 1F4WH 4MQ7B 4NN7B 4RE3A 3DURB 5DK2A 1JMZA 3W6LA 2P8MA 3ECBB 1HT6A 1CFSA 4YXLL 2YL9A 4YQXL 3F7YA 4JZNA 2JJTC 4NZDA 1PLGH 2B31A 3F7RA 4DW2L 1JWUA 4LSSH 1E28B 2JCCE 4RISH 5J3HD 1UM5L 1I1CA 4UQ2B 5FECB 4GRLB 1W91A 3RWIA 2DYPD 3VFPA 1HKMA 2IBZX 2XTKA 1J8HB 4MXQD 1AVAA 1MRDH 3QO0B 3SCMA 1KJ3L 3EMZA 3MLTB 1HJVA 2FJFB 4OM1H 1SR0A 1OARH 3R0NA 2GTWB 1EAPB 2MMXA 5EDXA 1JIBA 3AREA 4LSQH 4URIA 12E8H 3DMMD 2OR7A 5FDYA 4MXQC 5ESVB 1ZA6A 1SJHB 4WTZA 4G42B 4M6MH 1FV1B 1HNFA 4GXVH 4AL8L 5KSAB 4D94A 5JIWA 4JDZA 4JDVA 5GZOC 3ULVF 4TPRL 1AGFA 4X6CF 5A3IC 2DM3A 3R06A 1FFOB 5FDWA 1WC7A 3GMMA 5ACMA 3HI1A 3AMCA 2YZ1A 5I30L 2A9NL 4OQ1A 1EOMA 3X14B 3W9EB 4HS8L 2E9MA 4LNRA 4LCCC 4JFOB 5HHOB 1YMMA 1T2JA 4YHKL 4KKCD 2DGAA 1MVUB 4NM4H 1BG4A 1CGUA 4OCWL 1CFBA 4LEOA 3ROOB 3HE7D 3W2DH 4TSBL 3E6FB 3JV0A 1V6VA 3O3DA 2RAMA 4OKVB 4JFXA 5A6KA 3F5LA 1W8NA 5BQ7A 3FY1A 4EN3B 2WV3A 1BZQK 3NIFE 2ZUTA 1EHLH 2FZ3A 5ICZB 4YK4B 5BRQA 5HHPB 3CLEL 1YMHA 5KG9A 2OTPA 4NCC1 1OTUC 4FA8A 2N1KA 3G04A 3IGAB 2Z1KA 3EYOA 3PDGA 5DJ8A 2WINA 1X7QB 4MQXC 4MDOA 4ALAL 3IU3B 4QRTA 3RDTB 3RWJA 3HZMB 2QPSA 4NSKB 3L3KB 4QLKA 1BFTA 3O3DB 3GSRA 4WNQB 1BVLA 5I74B 2GW5A 5J9PB 1ZWIB 4U6TA 1ORQB 3ISWA 1KJVB 1NAKH 5GS2H 1LO3H 4B9YA 3C5ZA 5EN2B 3EOAA 5IEKB 3QZWG 3VXQA 4YDKH 1I7RA 5DFWH 3RI5K 1LK2B 1KEGH 5BXRA 4F9DA 4XC3L 1MI5E 1CENA 3QEQA 4LHUA 2UY3A 3U7VA 5J13C 3MO4A 1LE5B 2GIYA 5B39G 1EXPA 5HDQH 2HVKA 5D2LA 5E95B 4ZUUA 5LAXA 4FQ1H 1RJCA 3OBAA 4GKZB 4TVSa 1J05B 3RM9A 4ZPVA 4D9RE 3BRGC 4X7TB 3G6AA 1SMOA 4Y4HC 2VRKA 1IAKB 5B3NA 3ZDYE 4JZNB 3A67L 1BYBA 4F80A 4M5YH 2NYYD 3ALXA 2FEEI 4MWFB 1XYZA 3UTSD 1B3XA 3H9ZA 2XKNB 4HIXH 4EI5A 2JJVA 1MFNA 3BE1H 1HSAB 3QHZH 1NC4D 1ITBB 3BW9A 3GSOB 5J89A 3VW3H 5CEYB 1KB3A 1JFQH 4AZIA 3GMLA 5T33L 4NO0B 1ZA3B 4QYOA 1VFFA 4IRSC 1H5BA 2J7LA 1I8LA 4O58H 4N8CL 3VIMA 4BFIA 1IGCH 5IBLC 4HIIA 1PY9A 2B39A 5DJYB 5FF6B 5CIPA 4LASL 3RY6C 5JPMA 4PPTA 2Z4QB 1I7ZB 2VCAA 4MJ5A 4L4TA 3Q3GB 4RMTA 3VG9B 2YBTA 2C8NA 2E27H 2NNAA 4H20H 1XFPA 2BOBB 3K4DA 3LD8B 3JUGA 1L7TH 2AGJL 4TNVF 4FZ8H 4QLJA 3KYMA 1UWXH 2K9UA 3HI1B 4LCWD 4NO2A 4PJ9C 4WFFD 1NBVL 2V3FA 1F4WL 3PWVB 1E4XL 3WNNA 2OI9C 2PO6B 4Z77B 4C7GA 1DVFD 1TFHA 5DJYA 15C8H 1IAIH 3L3OA 2MWCA 2F54E 4H41A 3V4UL 2J7EA 4OIBA 1RIVL 4R9HA 2IEPA 4WW2C 2CMRH 3DVGA 3X11B 3RKDD 1VFOA 1XAUA 3BSZL 3SDAC 4ONFH 5DD0L 3T3ME 2GJZA 5DD6A 1YEJL 1OTSD 2J7CA 5DS8B 1UJ3A 1KC5L 4P2YA 1MAML 4I77L 3PHQA 4OCLC 4P4RA 4K8RD 3GNRA 4RX4D 3U4EB 5F1OB 1DWHM 3VIHA 5DFTA 1S7RA 5L8KB 4DWSA 2R2BB 4I18B 4QOKD 3OHXB 3B2UD 1EGJH 4M1DH 1AO7B 5EO0B 1H0GA 1KCKA 3SE4A 4MNGE 4R7NA 1UT9A 1A7OH 5D93B 1UKSA 1ZWIA 4S1QH 2XZZA 3L9RA 5FUOL 1D9KA 1P4LA 2P49B 4PRDA 3SDXF 1W2PA 2ZOKA 4U1NB 5EB9A 2WC7A 5MI0B 1LNUB 5I6SA 4PP1D 4J3TA 1I75A 2DD8H 3S8WA 1NLDH 4OUOA 2EZ0C 4HA4A 4IRJC 5GGRA 1FYTD 1A7BA 3QR2A 3U9PH 1MW1A 3BXNA 1G6VK 4NPYA 3ZYOA 5LVEA 4TUJB 2Q6WB 1JZ8A 3HUJF 1AC0A 1IGIL 2NQCA 4XGZA 3CC5A 2G60L 4H1LA 5GRUL 4UQAA 5BZDB 2H2PC 2HA1A 1BD2D 4ZO8A 3W39A 3QRGL 5TFSL 2ZICA 4KZDH 2KBGA 1BQCA 3X3GL 4D1JA 5J56B 1T21B 3QB7C 2NY2D 3WE6B 5JPNB 4MNKA 2B2XL 3E2HB 4Z8FH 4FNLL 3Q6FB 1B0WA 3MRQB 5DMGD 5GRVK 4Y7EA 2VAAA 3CCHA 3L5HA 3MJ8B 5D8JL 1HSAA 4HWEH 5IWLC 4LLMB 5GS3A 2NY1D 2FGWH 3VIGA 2AK1H 1XF2A 4XCFL 4YBQD 3B3IA 3NGBC 1KNOA 4JO4L 4P2QE 3MJ6A 1NMBL 3BMVA 3IFOB 2NX5B 4WJXA 3VFWA 4UIMA 1IZKA 3BKYH 3JWNC 1MVFA 3MFFA 4PLJD 2IFFL 3BYTA 4HFUH 1Q72L 5IGXL 5I1JH 1RZIB 4AZ5A 2YPKA 1FO0A 4P7LA 4L3CA 5IHZA 4RNRA 4ODXA 5HVHB 5CJ5A 1DUZA 4IM8A 3MRLA 4LLMA 1KPUA 4JDTL 4K3JL 3ILQC 2P46B 5JOFB 5J6GA 5I77A 1MUJA 4JHOA 3O4LE 4GMSH 4LDEB 4XB8A 1IAIM 1R3JB 2IH1B 3WS3A 2Y5TB 4X5WB 2X9XA 3ETBF 1KGCE 4W7UA 1NFDE 4NQXB 2IQAA 5TDOA 1VESA 3CUPB 2B0SL 4TNWK 3MYZA 1PEWA 1A6UL 1A9EB 3WNMA 3QDME 1CG9B 3PNWA 5T1LB 4NQDA 5D5MB 2VLRE 4HV8A 1N6UA 4U1GC 3QQ3A 1HHIA 3PP3K 4DK3A 4JM2D 2CLZA 4MSWB 2PF0A 1ZJBA 4UUJA 4JZJB 3KPSD 1KB5L 3BZEB 4Y4KA 2D2OA 4RWYL 1IKFL 3D0VA 4HK0B 4OZ4A 1YEIH 4XPFH 5C2UB 2QPUA 3IDYC 4H2CA 1FBIH 2AEWA 3CLFH 4K9EC 3OTTA 2WMJA 1MCBA 1MI5B 3QCTH 1I85C 2NY7H 1QYGL 2OL3L 1HNGA 3UETA 4U6XB 3RY4A 2E6JA 3C09B 3MLZH 2X6MA 4WFFE 1S9XA 4KVNH 1OAUL 2FL5A 4WW2F 3NACL 3NZ8B 1KLUB 1JPFA 3JTTB 4CMMA 4LLDB 2XFRA 1QNZL 1XF3B 2X9YA 4WUKH 5ANMB 4X4YA 3ZSTA 1XCTB 5SV3A 1C08A 5J13B 4P2OA 5H2BB 1BVZA 1HEZA 3ARYA 3L95A 3NIGE 2CPCA 3C09C 4NQVB 3MRGA 4KUZH 3TJEL 3P4OA 4D6FA 5D5MF 4N0UB 1G7IA 4HFWA 5JXEC 3G5ZA 4GUPA 3WDIA 2J78A 3B5TA 2CUHA 4MJ4A 1F2XK 2HJFB 3LN4A 3OKOB 1FNSH 1MJ7L 3DRQB 1R0AH 3GMOB 2YXMA 2J8GA 2YN5A 1V6XA 4RRPA 1K4CB 4X98A 4BZ1H 1YEKL 3U5YA 3VDBA 3KPSE 1BJ1H 3FB5A 4ODSH 1HXMB 1EGJL 2EEXA 1B6UA 4DVRH 1GOHA 3DUSB 4PJDA 4L5FH 3G5ZB 5IHUH 3T04D 4H8WC 1L0XA 4EBQH 5FYJE 5ID1A 1KTRL 1OAYH 4HPYH 4UTBH 4X80L 1ECEA 4JM2A 1ZBVA 1A1OB 3TNNA 2IQ9L 4D6HA 4QRPD 5LAXB 3VFPB 4NO5A 4QRRA 2GQHA 3B9AA 3INUH 1W9BM 4QHNB 1S7VA 4HT1H 1WTGT 1Q6DA 5C86A 3EDJA 3T08A 2V7HB 4KVCL 4YXLH 4C58B 2GK1B 1BJMA 3CUPA 3WS6C 4F7MA 3QDAA 4X4ME 3RWDB 5ADPL 1DJSA 2I9TA 4R3SA 4ODTH 4X83A 1I8IA 2FDBP 3OZPA 2ESVD 4LPVA 1DZBA 3BO8A 4OZHF 3V6BR 1M1SA 5DA0B 2ADIA 1BAFL 4N8VA 5FYKU 3T1FA 5FHBL 2AXHA 2HH0L 1FA2A 1MWAB 5DRWB 2CCRA 2AKRA 4KY1H 3WD5L 4HGMA 4I13B 4MJ5B 5IFPA 5E9DD 2DLIA 1PD6A 2V5TA 4BQ2A 3PGFH 1NGPH 2UYLB 2R15A 1NAKL 3LN9A 1C5DB 1OD7A 3LSOB 4Z9KB 3A6BH 4XHJC 2CUMA 4Y16A 1SM3L 1QRND 5E2UL 2B4CL 2CRMA 2AOSA 2YD5A 5FOJA 5CLWA 1IGJA 5EH1A 4MCZB 3WFEL 3MLXH 1XF3A 1KN4L 3VINA 2BP3A 1A2YA 4P8XA 4KI1A 4Z2KA 1CT8A 3TIEA 1GGCH 5DD1L 1F90L 3KXFA 3C6LD 3FTGA 2XNAA 3CSPA 2W07A 4EXKA 4ZUTB 4KMTH 3MZTA 3GSVB 4NM4L 3G6DH 2GUYA 4PLKC 4QHMA 1S9WA 2GSGB 1G9ML 4WNQA 2EYRA 5EU6D 4HKJA 4V1DA 2XFFA 1FNHA 4HQQH 4F15C 5BRZE 3T0BA 3H8NA 1CDYA 2P8LB 4OF3A 4PJHE 1EEZB 1B90A 3ZOAA 4NZJA 3JUZA 4W85A 3K2UL 1WZAA 5I73C 3AMGA 3VKKA 4Y19A 3SDAB 4I2XE 4ZXLA 3FO9A 3L2MA 5DC9B 1ZT1B 2ARJB 4D0DB 4O9HH 1VSCA 1IGML 4KTEL 5GJTL 3GHEH 4OKVA 4UDTA 1M71B 1HHHA 1ES0A 3JBG7 2XTLA 1IM3A 2FZ3B 5ICZA 1TR1A 4HKXB 2OI9B 2IGFH 2PO6C 3V4PL 4CNIA 3EFFA 5D2NA 2APXA 2K1MA 3TO4A 1HXJA 2IUZA 4ORGB 1CIDA 2FLRT 4UT9H 3FAXA 2OSLB 4NPYB 1OB1B 4NYLA 4ETQA 2YD1A 3CDGA 2X4UA 5IESH 5FYLE 3DO3A 3ARFB 1U8QB 4NWTH 5A94A 4H26B 4M7LT 3V5KA 2J4GA 1P9MA 3EOAB 3FRUA 4HS8H 5E2VH 5MI0C 2P7TB 1BIIB 2TAAA 3OKMA 3IFNL 4I5BA 1HHGB 1JUFA 2HLFD 4YHNA 4HIIB 3NFNB 3MRIA 4E8CA 5A2CA 5IKCB 1YNLL 4P5MB 4KROB 4OUEA 4JRXD 3VRJA 2K3TA 3CAFA 5TGBB 1OLZA 4MD5A 4ZXBA 5HBBA 4OCRH 1CBVH 5E8EA 4WFGE 1MFVA 3UYRH 1UYWL 3CSGA 5JQ6H 4M7ZC 4JKPL 4YHML 1XGTA 2HVJA 3KLHC 4XVSH 2FD6L 3X12B 3ZO9A 3LKOB 3KXFE 3W0KA 5MHSE 1DQQA 2GUOA 4M7JL 1DTUA 3QI9B 5J11B 3LQAL 4MWFA 5KEZA 3HR5B 3P4LA 2Z1SA 3CSYA 4Y2DD 3HZKB 2DT3A 2G3MA 1WFUA 1AQMA 4ETYA 5JMOC 3ZHKA 3U1SH 4KV5E 5D1ZD 4HOZA 3VXPA 5CHNB 4J3WA 3QDJA 1LD9B 2HFTA 2PWGA 4NO0A 1HI6B 5CGTA 1BQHG 4NDMB 1C5CL 5A2IH 1HJQA 3MV7E 4F37K 5I1IL 4YDJA 3CXHK 4OZIA 1VIWA 2UY5A 3QWOB 4L8SB 4HDIB 4NM8H 4F57H 4NKIL 4NQDB 5FYKH 1QBAA 3VE0A 2XTJD 4YEFA 3P0VH 2O61A 5CHNA 4D1IA 2G60H 2MKWA 1KLFA 4PBGA 1LP9B 5EBLA 5GRXG 1L0YA 5MENB 1ZTXH 1CICA 2ZUVA 1RU9L 4XHQA 5DD0H 3MNZA 4M00A 4JANA 1T0PB 5L6YH 1AGEB 1U3HC 3DIFB 1CGSL 5EFIA 1PX8A 1OW0C 4S1SL 3PWJB 3PZMA 3BE1L 5EBAA 2J7FA 5IQ7L 2IJ0C 1PKQE 4WU7B 1T7ZA 5C0RH 5AY7A 1ZANH 2UWEE 4WRLA 2XN9A 2FGWL 3OGVA 4K3HA 3CH1A 4BQ8A 4LVHC 4GO8A 1XSKA 2V38A 3VA2C 4NKMA 3U46A 5KVFH 7TAAA 3MNZB 1DBMH 4KRUA 4NNPH 4WI3A 3R1GL 1J10A 3D1MC 2Z35A 3NCJL 2VUOA 4FFZH 3JWOL 1HOCB 2FNBA 3TBSB 2BSTB 1EOKA 1ETZA 3DOSA 4MA1C 3TN0D 1XV8A 2JF6A 3IDJB 5J1SC 2EPKX 4Y5VA 3WLWC 2DH2A 1I9RL 4ZTPH 3EO0B 4NQSB 4A6YL 2XV6B 3MO1A 4P2CG 2DQIH 3VXUD 3B83A 1N59B 4WCYL 2BNJA 3MUAA 1ROWA 3MRQA 4K3EL 2FDMA 4GPNA 1EEYB 4RAUA 1KENL 1R8LA 2IF7A 3JV6B 3O2LA 3QT2A 1FFOA 4DEPB 5F88A 4WV1B 3QQ9D 2DOCA 3VXNB 1D9KB 4PRDB 3AY4C 2VQ1A 3D9AL 5IHBA 3S4SG 4J6RL 1PBYA 1BIIA 3MYJA 3BD3A 3GBNL 4M02A 4QXUH 2FX9H 5HHOA 2CBVA 5E00A 1DANU 1I1RA 5D72L 4EVNB 3FNDA 1AGCB 4DWHA 4GRLC 2Q6WA 1XZ0B 3SCOA 4YNYB 3N9GH 2DTML 4GSDL 4F7EA 1MAMH 4M1CC 4RIRB 2PWDA 3MV7A 4BH8A 5D1ZC 4U1NA 4OD3H 3G5VB 1MQPA 1WEJL 4X0KB 1FGNH 3HCVA 3MYJB 1G1CA 4MAVA 1RY7B 4Y4FC 1T89C 5L8LB 4AQOA 3V4VL 4FXKA 1JN6B 5D1QA 3BQUA 5I8EB 5T1LA 4F7PB 4HGWA 1A4JB 4NQTA 5BV7L 2ADGB 1W2VA 2BMKB 2FLBT 2GVYA 5IBTL 2W92A 4ELMF 2I26N 1NJ9B 3K8KA 4D6EA 1F3DJ 3GKWH 2Y8VA 4OGZA 2CDGB 1PBGA 4QHLA 5L88H 3B3IB 1CZ8H 1OGAA 1HSBB 3O3UN 1E15A 3FMGL 3QCVH 3PABA 1BQLL 1F13A 3VXQB 4OM0H 4JY5H 2HLFC 5MERA 1I1YA 2R0LH 2JFEX 3S3SA 4W6XB 5SWQB 2X4OA 2ED8A 3W53A 4K94L 3P4MB 4RNRB 1A4JA 5GRUH 1NARA 4TVCA 5T1KA 3ES6A 5FO7B 3KDMA 1UA6H 1TA3B 4MDIA 4APQB 3N0PB 5GS1B 4WFGD 1QR1A 4XVJL 5KOMC 1ZB5A 2WKGA 2VVSA 3RJYA 4HCRA 1ND0B 1FNAA 3WHE1 1IGFL 5HYJB 4F9PA 1OSEA 1UYWH 3ULVH 2IXUA 4M24A 3U4EA 1UXWA 2EBNA 2VCCA 2VLJA 5T3XH 1MIEL 1H1NA 1E6RA 3WEXA 1B3JA 4L3CB 1FHLA 5DVKA 3V5DB 4W88A 3CZGA 4GAGH 5C07B 1O7SA 4MAYC 1N2RB 3VWKB 4IOFC 5D2NE 5JW3H 1P2CA 2HFGL 5CPTA 2NR6D 2X0HA 2IH1A 5C0AE 2E7LC 1MRFH 1BP3B 5A43C 5TDOB 4N68A 2YEZB 4GJTB 4MLIA 1E0WA 4LDLB 2DI7A 1ZT7A 1WSST 1F58L 2BFVL 4TVPL 3FZUD 4WHYG 3WIFB 3PUCA 3C60C 2AJSL 1R5VA 3I6GA 4BQBA 1JK8B 4YDVA 1AFVH 4X5XB 3PL6D 5JZ7C 3K80A 4PTMA 3RUGA 1NPUA 5JXEA 1KWGA 1RULH 4V1DE 5D7LA 2P24B 1D5BB 1IKNA 5DK0B 3UJTL 2J7BA 1MFBL 5EO1B 3B2VH 4JHWL 1V8HA 2FX8H 3SCVA 1R0AL 1UZ4A 3UPRB 4J23A 4MA7H 4B15A 3CCHB 3MJ8A 4Z78B 4XHJD 2WVTA 5JOEA 3SO3B 1G1YA 3QWRD 1HN1A 1R3HB 4M82A 3QZWB 3JWDH 1ZANL 2CNCA 2CKRA 1JZ5A 2PWFA 2FB4L 3VXTB 1N7ML 2V7NA 4R0LB 5D7LB 4NBYB 1AXTL 2F2HA 1FVDA 5SWSE 3T3PF 1AY1H 5D7IF 1MJ8H 5DI8A 4WWKA 2PWHA 5ITFB 1XMWA 5C3LD 5A8QA 4UTBL 3BIAX 2HAZA 3CDGB 1GPOL 1JHTA 1A3RL 2SEBA 3CH8A 4G9FA 2NSXA 1W3HA 4GZEA 5AEAA 3HNTH 1FVEA 4POZD 3MLXL 2XICA 4NC1E 4OZGE 3FT4B 7A3HA 5GRYA 4Z76A 3OB0K 5DDHB 1CU4H 4MA3A 1AHWA 3CIVA 3MRIB 3OF6D 4U1LA 3FONA 3PHSA 3Q1SL 4WWKB 2YK1L 1SY6A 3LIZH 4QRRD 2QQLH 1T1XB 5K93A 4X99B 3I3BA 1US3A 5JORB 2UYLA 4GKSB 4H1LB 3F58H 3TF7C 1GJWA 4KRPD 1CXLA 3OG6B 4WIQA 4QHNA 4PRWA 3MX0A 2C1PB 3CMGA 3QIUD 3ZKXB 3K1KC 3D0VB 3OPZH 4HEME 1MWOA 1UWUA 2NCMA 3WY1A 1ACYL 1UJ3C 2VLRD 5I1LA 3B9KD 4I0PC 3DX7A 2GJRA 1PAMA 1CE6B 1UVQA 2MQCA 3HE7A 3HPJA 3RNQB 3IDYB 1FGNL 2WKLA 1MQRA 2XZQL 1IT0A 1RZKL 2YPLA 2B5IB 2C1OA 3OKDA 1KTKE 2VXUH 1BQSA 1EBPA 1RZFL 4XNQA 2JEQA 4OCYL 4EI5C 2WANA 2LVCA 2X4PA 5JW4M 1KB9J 1ZHLA 5IG7B 5EBWB 4PY8I 2NX5A 2BSED 2XJ7A 1FSKB 2W67A 4D6DA 1MW2A 1U58A 1NWRA 4WO4D 4PD4J 3II1A 5KJRL 1JAKA 1YA5A 4GQPH 5JO5B 1G7MB 4ZSOA 2B7DT 4D71A 2GY7B 1MWAH 2Z92A 4K07A 5CAYB 3RGHA 1QRNE 3DHUA 4ACPA 3V4UH 2IH3A 4FQLL 5E0QA 1F5WA 1UA6L 5INCB 2NXZB 4DKEL 5CKAA 5AAWA 1KBBA 4N1HB 2E8YA 5EC2A 4U2YA 1DQTA 4ODTL 2A3HA 1FL5A 5DSCB 1DLFL 5D6CA 5CJXA 4JRYD 2BSRB 3AIBA 2VLMD 2BRRH 5HHME 1UG6A 1AGBA 4S1DC 1E1EA 4WDIA 1WDRA 4KJWD 2DJ4A 4XBPA 1KXTA 2PBGA 1XCWA 2YPVH 5D2LE 3FO0H 3EJYC 4W87A 5CGMA 1ZT4B 2UVFA 4HS3A 1VEMA 1BGXH 5DUBB 1CE1L 1YN7A 1LF1A 5K59F 3WHE0 3HG1B 4JY6A 4LCCA 4LCIL 1DN0B 2EDQA 3WFHA 4ELKA 3GSVA 3DPBA 3DV6A 5C6WH 3OJDA 2XWTA 1V0MA 5I1DB 4XNMA 3VU2A 2ZXBA 3G6MA 5D8ZA 2X4QA 5IFJB 2XY2A 1M71A 3BSHA 3W9DA 4YDLC 3D6GA 3OGCB 3RHWF 3QUMB 1KN4H 3MRKB 3PQYB 4BFEA 1H3WM 4U6VL 3BYYA 2BDNL 1U8OA 4J1UB 1MOEA 3HTLX 1W0YT 3S88L 3OB8A 4X4YB 3IAPA 3WFDH 4K8RL 1RUKH 2YMXL 4FLQA 4HZLB 3WH9A 2D03L 3ULUE 5E00B 3BIKB 1YJDC 2EIZA 1R3IH 4S1DD 5F70A 3I2CH 4LBEA 2FR4B 2F54B 1W1YA 3HZMA 2YL8A 1JGEA 1HIZA 3TZVB 1NFDA 4RAHA 4UT6H 3ZTJG 3GSNA 4JQXA 2QJDA 3CFEB 4WKFA 4YPGB 3BWAB 5HGBA 4HWBH 3QUMH 4UNVA 5HYSA 2ZX8A 2FECL 4MD4A 4FN0A 2JIXD 5DHVA 4JFTA 2OTUA 4GFTB 4I18C 4KK5C 4BH7B 2HWZL 3B4NA 3QULB 3I6KB 1CD1B 4YDIH 1VFAA 3HHRB 2ZUXA 2AK1L 4XCFH 2FB4H 2G2RB 2XFYA 5KSAA 3MA7A 4JPKH 5IMKB 1I7TB 3V6OA 3G9AB 1ZEAL 4NCC2 3WDJA 5F7YC 5ABEA 2A38A 5C09E 2AABL 5B3JF 3NCJH 3GXIA 4H26A 4UINL 3B9DA 3DUSA 1HIML 3BDYH 1WCQA 3WF3A 5IF0B 2J3SA 2I9LB 1G7PA 1SEQL 1YEEH 4XPGL 2ERJC 3VFVB 1M7DA 3P73A 1CT8B 4BQ6A 3SCNA 4FQXD 2F5BH 5IMOA 4ZUWB 2EYTA 4M1GH 4PJ9B 1A1MA 5EZOH 5AUMB 2RIKA 1S7QA 4XCNB 3ARDD 1NOWA 1PVHA 5DD3L 4WJ5A 1KXVA 4ZE5A 1GOOA 1QR1B 1WZ1L 5E6ZA 1RU9H 2NW2A 4OZFA 3HMXA 5IVXA 3GRWH 3MBEB 1ZKAA 2JCCA 5FO8A 4HH9B 3FN9A 5DQ9A 2QTEA 4OIIH 4RZCA 3UTSE 3OAUH 4PTUA 3SQOL 4WDIB 3RTQA 1ZS8A 4ZE4A 3SCMB 4I3RL 3CVIH 2VXTL 4IUGA 1OM3H 1FO0L 4OF7A 4Y1AD 5C2BH 3VIIA 3IT8D 4NDMA 1QYGH 1FL3A 3K8MA 2DLHA 4PRNB 3BP7B 3MLZL 5D2NB 3GXMA 4Q97A 2R69H 4RCAA 2G41A 3VFNA 1B31A 3RZCB 3GSUB 1XF4B 4KJQC 2XYLA 4E0RA 4K8RC 4P5TA 4RQQA 3T77B 3HC3L 3JXAA 3IVKA 3ZZ1A 2D23A 1HCFX 1FP9A 4GW4B 3HC4L 3DVIA 4MJ6B 1TG7A 3FB8B 1CFNA 1W72B 5EUOF 4K2UH 3H42L 3PZQA 2VRQA 3WFBH 1S8DB 4DGYL 2A83A 1AXSA 4F7EB 1YEDB 1E72M 3ZE0F 2COQA 4OOUA 1CBGA 3ARTA 1D6EB 4GRMA 1VGKB 1AQKL 3DX8A 4JG0H 2A1WL 3I3DA 4F57L 3GSUA 2GCYB 4KUCF 1MCLA 1KV3A 4XZUA 5K9OB 3N1FC 3QJHA 3AUVA 2NY0B 3HZYB 1I1XA 1VFUA 2C3WA 1D6VL 4Q9QL 3AIUA 1RZGB 5JOPE 5I19L 4R7NB 3UCRA 4WV1A 4AZBA 4HZ7A 4ODWB 1CLZH 3N06B 4W6WB 3HNSL 4JFQB 5HGBB 4N9GA 4KDTC 2D3NA 5KSBF 2Y06L 4RSVA 1GOMA 5T3XL 3V6OE 3SGKC 1WEJH 2Q3ZA 2VAJA 4NZUL 3QFJA 43C9B 1MHCB 5IR1A 1CR9L 4HLJA 5KTEL 4LAJH 1JRHH 1KPVA 4EUPG 5IHUL 2XVNA 3CHDA 3FRPG 4XGZB 3SKMA 3PZOA 4P5KA 1A3LH 4ONGH 5DK2B 3UAJD 3BPOC 3KJ4B 5A2FA 5F3HA 1OB0A 3N1PC 2ZXDA 2FIRT 1A6WH 2HJKA 4X6BB 3TH3T 2PN5A 3C5SB 2WCAA 1BQLH 5F3BA 5BJTA 1ZHKB 1DDHB 4C56E 3WXVH 1F6AA 4Z7WF 1TXKA 2R9HC 4F7PA 1M7XA 5SWSD 5EMYA 1G0XA 4TVPE 3HKFA 1CL7I 4AZHA 5DLML 1OLLA 4U1IA 4JGUA 4IRZH 2NNAB 3D9AH 1IQDA 4ODVH 2OXGA 1T04B 3G6AB 4JANB 2O5ZL 4NCDA 3GNMH 1G0YR 4M8VA 4OGYL 5JW5A 3MJ7A 1YC8A 3MREB 3QJFA 4DGIH 3U0WH 3IDGA 3STZB 5GXBB 1LEKB 1QFUH 2R29L 3MGOB 4AC1X 4AY1A 4F7TA 1UG9A 2LV4A 2VDNH 3PZVA 4HWBL 3AYSA 1G5AA 2CIPA 3QFDB 3GMRB 3RPKA 5ISZD 3CPLB 3MACH 3FQRA 4M6OH 3S35H 5A6BA 3IDXL 2J6EH 1NCBH 1DQDH 3H9SB 1OTTD 5LXGL 3QG6A 2UWFA 3AMDA 3BN9D 2A2QT 4YWGH 1WIPA 5JBFA 3NH7H 1QBBA 1HKLL 2CKBH 4NQCB 2EDLA 5C0CD 1LE9B 2V6HA 2DB8A 2AEIT 2I5YL 4HUNB 4LNRB 3HZKA 4ZAKD 5E8NB 2H2SC 3T09A 1I9JH 5LQBH 1Z0MA 2IAMC 3CPLA 1A3RH 2Y8KA 1F58H 4TVPH 4OGXL 1UXSB 5K9KB 2BOBA 3R4DA 4PJBA 1L9NA 3VD9A 5I1AA 1JZ7A 5D6DA 2VDKL 4R4ND 4DGVH 5ESAB 1UR4A 3IJYB 2ZX5A 3BGMB 4HP5A 5IB2B 1T2XA 4YH6A 5K33A 3I75B 3L5WB 4K94H 1YYLH 1B0IA 1T21A 3L3OB 2DT0A 2FO4B 3V0WH 1QO3B 1M01A 1UCBH 3WQVA 4MVBD 3C9NB 3WFCL 3UJTH 5CJ8A 3SKNB 3I3EA 1MHPH 1WV7T 4N0CC 2X4SB 4AENA 3H9HB 2VDOL 4P3CH 1E56A 4QLLA 3S36H 3IRZA 5HGDA 1SJXA 5CILL 3MV7B 4Z2IA 4DTGH 4I3GA 1XR8B 4LSVL 1FVEB 5F9AC 3LV3B 5EFIB 2AK4A 4GO9A 4CVXA 4GG6B 3R8BB 2BV9A 3VXMA 3VIJA 4I4WA 4N8CH 4LPTA 5T5NF 5D7JA 2NY5H 2G4FA 5DJAB 1WKYA 3U48A 2IGFL 3V4PH 2J88H 3VA6A 3VNZA 4G8GE 2MNUA 3NPSC 4BS0A 1NGZA 5IJVA 2KUTA 3AS3A 3F7PC 5D7IB 2HVKB 3HC3H 4PRHD 1TIUA 3BJLA 1J8HD 1CCZA 1MUJB 2G8ZA 4GZJA 3SBWA 3HLAB 2UWEA 1TETL 1QFHA 1I1FB 4ORZC 2OQJA 1HCVA 1KLGB 4PIRF 2XYCA 3BISA 3P11H 5I8CB 2OWWA 2GSIA 2XWBB 3T0AA 1AI1H 3U4BL 5GGRB 1W0VA 1HNYA 1XD0A 2BZDA 4NQSA 5CQ1A 1ZHKA 1WWBX 1U2YA 3LY6A 4NWTL 4PJXE 5JDSA 3L4TA 5HI3C 2JK5A 1GOKA 3Q1SH 1AXIB 1Q9OB 3GSNB 3HFMH 3RIKA 4PJAA 4CU7A 1TQCC 2NY3D 1XH2A 2DSWA 3DYPA 3ARGA 4DKEH 1W3KA 1PFCA 3QUZA 1IC7H 2VSDA 3L5JA 1R3JA 3CX5K 1FVCB 4C7FA 1FYHB 5I8CA 3BIBX 3QEGH 2ADJA 3LRSB 3E0GA 3HNSH 4F7CB 2CBUA 3IAGC 2VLJB 3T0XA 3BAIA 4P2RA 1E70M 2XZCL 4JKPH 2JB5L 4AH2A 4JLRB 4NZUH 4RA0C 3VXUB 4GKSA 5LCVH 1S9VB 2X70A 2O9OA 1FL6A 4M1DL 1P5VA 4BK5A 4HU8A 3QDJE 4H0GA 4HUUB 1D3CA 1JNDA 1P2CB 4BSVB 2OSYA 2IH3B 1RH9A 5JLZA 5FM5M 3FQXB 1A7OL 4HK3J 3GTNA 4Z7UF 1H11A 3BH8B 3UYOD 4WEBH 1CTNA 3O9WB 3ALGA 2D31A 5EUKB 5M7QA 4P46B 1LHZA 4KK6C 2Z8WC 1WFOA 4PJ9A 5FGRA 1WAAA 1ZLWH 1IGYB 2BY3A 1KPUB 3NCEB 4JJHA 1T1ZA 5K9KA 1X5ZA 3RVXD 3POCA 1ZLVK 1AD9B 1LO2L 1P7KA 2APVA 4N0YL 2ADIB 1UD4A 5KVGH 4K9EH 4GXUM 3H3PL 2VLLA 3MBEA 2B20A 2ZE0A 1DP0A 4GKNB 3WO4C 2IG2H 3QPXH 4ODVL 4BUGA 4LQ1A 3OKLB 3CZFA 3KS0H 1G01A 3FXYA 4PGEB 5EO0A 5C8BB 1KIPB 4S3JA 3FN0L 1KSRA 3E8UH 3GH4A 35C8L 3GMMB 3OJVC 3PZ9A 1UZ6F 3KYOA 4CVZB 4G8FA 5DFAA 4F8XA 3IXTA 1I3GH 5J1AA 4ISVB 4JFPB 1RUAL 1D5MA 3WIIH 4HF5L 5C7XH 1FL5B 1RZKH 5DSCA 3N15A 3GSWA 5CZVH 1GOIA 2LU4A 3WQ8A 4BQ4A 3MV8D 3WO4B 4FQ2L 5M03A 1E6NA 1WJ3A 4LEOB 3ZJ8A 1GQIA 2BS9A 1T0NB 1TJHH 3WENA 4BF7A 1N2RA 2ID5A 3VWKA 5E6IA 5DEZA 2R0ZH 4NZRL 1F4HA 4E5XA 5EU3A 5AC4A 4NHCL 2UWEB 4D0BA 1PKQB 3HMWL 2IMMA 4XWGH 5MEQB 3ZJ7A 4JRYA 1WAAE 2CIKB 4HUVB 1T4KA 4DZ8B 1HHJA 3S37L 2CDFA 4GG6F 2R0KL 5CP3A 3PWLA 2IWGA 1V0KA 4WTXA 2DRUA 5EB8A 4J6RH 4P7NA 4WI5A 5JORA 1ORQA 5F7FA 1IM3B 1XGRB 3GBNH 4FQIL 2GDUA 3SPVA 4GKLA 4MAZA 3GBMH 4U33A 2NW3B 4HHAA 1P7QD 3F5WB 1H2JA 3NIDE 5L2JB 5CMAA 5DUBA 4PCTA 1EFXD 1ZLUH 2Q76A 3QUYA 4G8GD 3O8XB 1IM9D 4MD0A 5DJZB 4HA3A 4PV8B 4EUPH 7FABL 2EXWD 2VDQL 4LHUB 1KT2A 2ADJB 1UZ6E 3LRSA 3DETD 3V8CA 3P73B 4PJ7B 2D4DA 1DVFB 4P2RE 3RWDA 4ZAKC 2I9TB 4ERSH 1FE8L 4BSJA 1A1NB 3P9WB 2WK2A 3QXTA 2J7GA 1RP9A 4X7TA 4O51A 1AHWC 1JXKA 2DSZA 3G08B 1JHLL 5JLZB 3RIFF 3OKMB 4TVPD 4KTDL 5CSZA 4Q7NA 1E6OH 4YHEA 4JCMA 1KXQE 2YD8A 1AR1D 4O00A 2GITB 5DRWA 1VFAB 1CQKA 1JPGB 3V6FB 4UNTA 3CHFA 5E99L 3LS4H 4IBLT 4PEEA 2BSSB 5JA9A 3QHFH 1O7AA 2AGJH 3N13A 4OBRA 4NQEE 4S2SA 3LKPA 4PRIA 3VXRA 1ZS8B 2R23A 1T1WA 3VVGA 3GDBA 4UIKH 1FFNA 3BWAA 4ZS7H 4Y16B 1JTOA 1EUTA 5HY9A 4JZJA 2WQRA 5F6HI 2JIXA 4JFED 2P8LA 3RKPA 3UERA 1EVTC 2WBJB 4NN5C 4Q7DA 3DO7A 3W2DL 5DUML 2CMRL 4W7WA 2DAVA 4JFUA 5J4MA 2G2RA 4ONFL 2O9RA 1CECA 4OLYL 4XVUC 3LKPB 2ARJA 4D0DA 1S7QB 5F72S 1ZBCA 5EIIA 3APGA 1FCCA 4X7CC 4JREB 4NQEB 5E2TL 1HI6A 4NNXA 3CVIL 4I3RH 3UBXA 5DMIH 4EN3A 3KYOB 4LRIA 4ZMAT 2HFFB 1UH4A 5FA3B 1BD2B 5BRPA 5A6JA 3LKQB 4PJEE 3W27A 1SJHA 3LPPA 3WFZA 4MZ2A 2O9TA 1HVXA 3FL7A 2QHRH 4ZD3L 1HP4A 3M7SA 1DN0A 3AS1A 3VE0B 3HZYA 1GGIL 2AEPH 2OZ4A 3GH5A 3RDTA 3RWJB 1LP9A 1GUVA 2R4RH 4P4KB 4EOWH 3T0EA 3DTXB 3LH2H 4JFYA 5I1AB 1E3ZA 1Q9LA 4GQQA 3WFBL 2UUDH 2H41A 2HFFA 4D9QD 3VM7A 3VH8B 5MEPA 3CDFA 1LL6A 2ADFL 4V2BA 3MJ9L 3CPUA 4L3ED 1B30A 1G9NH 3T2NH 2LVEA 4GOSA 1R5WB 4KH2A 1M4KA 1UGNA 2CSPA 1NFDB 4N8VG 4L9DA 4JQVC 4L4VD 3H2WA 3D69A 3G5YB 3BPLC 2O5XH 2Q8XA 5HDLA 3ULUH 3NUKA 4JHWH 4PTXA 4M62L 3PGCB 4NF7A 1GCYA 4GBXD 4YXHL 2ESCA 5A2KH 5D9MA 4MD4B 1H5BC 3GJFA 3PTKA 3V52L 1CD0A 4LEXL 5EOQH 5HGAB 2Q20A 4LPYA 2WM0A 4X6FA 5EUOA 5D7JC 3FQUA 5GPRA 1IFHH 3PV6B 1WFTA 5DHYB 5JXAL 4PJ7A 1S7XB 3EMQA 1JFQL 2DKMA 3KWWB 5E2JA 2HLAB 1EUUA 1V3MA 3TNNB 3WIIL 2FYYB 5HHQB 2BNQA 4HKZA 5KZCB 1Y6MR 4ZXBB 4FMVA 5C0DB 4W93A 1EDQA 3D39E 3MA9H 2AAAA 1X5LA 1JNLH 1E4IA 5I1GH 4FMKA 2B4CH 1CFQA 1A6WL 2BXYA 3QI9A 3PP4H 4AY0A 1IC1A 2VXVL 3K81A 2DF3A 2P8PB 2X89D 2JLLA 4L8CA 5HPCA 4U1MA 1QA9B 4YBHA 2VDKH 5DRXB 1LD9A 2CKNA 4RMWA 4WHCA 4NZTH 3U7WH 1EX0A 5F21B 4YUEH 2I25N 4UZUA 3GNML 3VRIA 4JHAL 2VISA 3ARDC 4HZLA 1D5IL 1MHCA 1BVKA 4P48A 3RDKA 3MNVA 4FTVE 2ENSA 1TUXA 5EUOE 3SY0B 4Z5RA 3BUYB 1PG7H 4KHXH 1OWQA 2Z31C 1NC2A 3DXAB 5D8WA 1MHHA 4GI9A 3HE6C 4PY8J 1CK0L 1QOXA 2HRPL 4I0KA 5TE4L 2HJKB 2EXYC 1PX3A 4G7VH 4AG4H 3BH8A 1EK3A 4LCWB 4MNGB 1W3JA 2Z31D 3EUUA 1FJ1A 1QLEH 1KTLB 1D7FA 4JFOA 1XHGA 3C9NA 5EZJB 3P0GB 4XI5D 1RUPH 2XNAB 5INDA 1A3LL 3EDEA 1MREL 4I0PD 4KK5D 4OCNC 1AD9A 4R4FH 1G9NC 1AXSB 1ZU8A 4HGKC 4NKDB 3BJ91 4JPWL 1JGUL 3OX8B 5EZLA 5BCAA 4ZXOA 5HVGB 2ZOKB 2EKSB 3AREC 1MF2L 3QO1A 3VH8A 5IQ9A 3VO0A 1KR0A 1KEMH 3AM8C 3BQUC 5GRZA 3QIBD 1M7IB 3W38A 3CFJA 3QJHB 3SKJL 3RZCC 1IARB 1CWYA 1K6QH 5KVEL 2DQGH 3BPCB 4B5EA 3L3KA 4PR5A 5MENA 5JR1H 3GHBH 1UUQA 3F6IA 1CXHA 3MUY1 4G80A 1GGTA 5C0JA 5ESAA 3L4WA 3OGRA 3UG5A 2QR0B 3MRDA 4X6EB 1KJ2H 2YLAA 2O93L 1QNSA 2BHUA 4FTVD 2FD6H 3BSGA 4ORGA 3K4ZA 3KNBB 1LO4L 2HTKD 3PXJA 2R8SL 4M80A 2W63A 1Q0XH 1XGPA 2GTZA 4XP9L 4LSQL 4WY7H 3SO3C 3AIRA 3TA3A 1QNRA 3CVHB 5F1NB 4DVRL 3QCUL 1X44A 4PP1C 1L9MA 3ARBD 3QA3B 1GGIH 3CD4A 4OFYA 4MA8H 1JI1A 2I5YH 3OV6A 4CJ1A 3FT3A 3TC9A 2XVLA 2ENYA 3KGRA 4HWZB 3NZHL 3QPQD 4LVEA 5CSBA 2ZOXA 1OAZL 3OJ2C 2JB6A 5SWQA 1LO0H 4GO6B 3B8SA 2V9QA 1ZLSH 4Y5VC 4POYA 5JIHA 3UZVB 1T0MB 4G9DA 4U6VH 4PJGE 2ADFH 3BCDA 4AD4A 1U8NA 2BMKA 3TPUA 5KS9E 2W9DH 5E8EB 2CDGA 3SCMD 1YYLL 3PGDB 3MRRA 1MLCB 1GAFH 3SE3C 3TTQA 1ZTXL 4WSKA 5D5ME 1ODAA 2OJEB 3DETC 4RGNB 4AWEA 5A2JH 3EFDH 5M3WA 4MYWB 3VCLA 5K9OA 1I8KA 5EBGA 2X4OB 1DN2A 4AD0A 5CJQH 4NGHL 3FO2A 2D9CA 4JVPA 3CU1A 2IPKA 3AGVA 4MQSB 3FQRB 1JHTB 1JYXA 4PRAA 2XFXA 3ARWA 2A6JA 3REWB 3TWCH 4BH8B 3WDQA 4J4PD 5CEXB 3G5XA 4PMRA 2OQJB 4CCEA 4D72A 5IK3B 4P9ML 2W60A 4OAWB 2V7HA 4LCWA 2X41A 5ABHA 3FONB 2WQ8A 4JHZA 4FXKB 3BGAA 4HC1H 1CIUA 1K2DB 4U6XA 1K9DA 5B22A 4S2SB 2Q7YA 5FGBA 5FHAH 2VLKB 3DSFH 5T1LD 1C8XA 1CQYA 4XTRC 4QGYA 4OLUH 3ZLQC 5TF0A 1HSBA 5DK3A 5D93C 2ITDB 1XH1A 4OCXL 3Q6GL 2FJGB 1Q4NX 1WP6A 3QUZD 3OR7B 1RURH 2P24A 3GNOA 1FYTE 3JV4A 1I7UB 4Z7UA 3U83A 3WNPA 2WZHA 3WBEA 1E6QM 4L8DB 4YHOL 3AAZB 3VGAC 4KJPD 3RWEB 1MI5D 1PW3A 3FB6A 1XCQA 4OF0A 4U1IB 3C08L 2HT2D 3MSGA 4HKBB 4UV4H 2WCSA 1JK8A 4YDVB 4NKMB 4N9OB 5TDNB 35C8H 3GIVA 3K7UA 4OIIL 2AI0H 2WWMC 4EDXB 2VX6A 3OAUL 5AG8A 4DKAA 1KACB 5KSUB 2YR3A 1HHKA 4MCYA 2R1YA 1U3HB 3MOAL 3VG0H 4ODHL 3NIFF 1G7LA 5LCVL 1IGCL 1BFNA 2NXZC 3FOLA 3OKKB 3RGVA 3ZTJH 2KZ1B 4FQ2H 3EDKA 1JDCA 3NZ8A 3W29A 5D9PA 4BCEA 4JO2L 2AJYH 1EHXA 2FHCA 5FKPB 2V2XA 2XSAA 1AO7E 3LD8C 4PRPD 4M7LH 5HGHB 5ANMA 4NJAL 3MRMA 3FMGH 3QCVL 1INEH 2ATPB 3QHFL 2J8UE 4OM0L 3T1WA 2CYGA 5F7NC 5J6HB 1HZHH 3QISA 3RM8A 1QSEB 4J4PA 3N18A 1G9MC 1S78D 2AXJA 4JG0L 5CWSA 1LEIA 1QI3A 4YNYA 4PBXA 3LEXB 3SDDC 4XV0A 5E2VL 4Y5YB 3S34H 4IRSB 3NA9L 4FQCH 1NDGB 1IT9H 4QHUB 3VXOB 4O51B 3RUGF 5IB3A 3OIHA 2OYMA 4PB9H 5DUMH 2P1YA 5K9JH 1HHJB 1S7UB 1ONQA 4HSQA 3VNYA 1K5NB 3QNZA 3CFDA 3UYRL 4UQ2A 4MDJB 5IVOA 4MZ3A 1N5YH 3C6SA 1BAFH 5I1CL 4HG4K 2R8SH 5HGDB 2Z0BA 2NW0A 3VFOA 2FATH 4KROC 5MEND 1YPZB 5C0CA 4X9YA 1CDCA 5L2KB 4ZPTB 4QCEA 2CXKA 2APWA 2OZ4L 5C70A 4NRYA 2AJVL 1H15A 1ED3B 2EIZB 4KTYA 1CE6A 3N1GC 3AHTA 4WFEE 3L3HA 3D2UD 3QXAB 1R6VA 2V9TA 4KDVA 3LZFH 4YO0B 4MNMA 5GS0D 5F1SA 1OAZH 3ARVA 1T1YB 1A1NA 4LGPB 4KJYA 4OFPA 3HNVH 5CJOH 4XPHL 2J7HA 3U9PL 4L8SC 4RFEA 4V27A 5C0BA 1E27A 3SO5A 3UTTD 1MNUL 2H1PH 3MV9E 4NM8L 4EJ1C 2H32H 1TCRA 3OXSA 3BCFA 3DX6A 2VURA 3AHVA 1G9MH 2EIEA 3CZFB 3L3HB 4KK6D 1GOFA 4OSUL 5IVZA 4OTXH 1MFUA 4KPHL 2YDRA 2YUWA 1HL9A 3ROOA 3LKNB 4IIQA 2R23B 4XPTH 5SWSA 5CEZH 5TDPA 5IMMA 3SDDD 2H32A 4OZGB 1HDMB 4YK4C 5CKGA 2AK4E 1MY5A 4K7FB 3QP3A 2QADC 1YC7A 3DRTA 2YA0A 5DGRA 4NHUB 5ALCL 1UZ8B 4RMUA 2QKIA 4LCCB 5GGUB 3ZL4H 4JDVB 1EJ6A 3UO1L 4L4JA 3CTTA 4NQCE 4HFUL 1GORA 1XSIA 4HUUA 5LA0A 1GZJA 5B39B 5KBNC 2WW8A 4LIQH 3KLHD 1ZE3C 3V7AG 4PUBH 5KW9L 2EPMX 2DQIL 4NO3A 1N3NB 4IM4A 3GGWA 5FYKD 3LS5L 3PHAA 2L0DA 2HISA 5HGAA 2JALA 4GRLD 5I79A 2V2TB 1LWJA 3UPRA 3E6FA 2OR9H 3MR9A 4XNMB 3TZVA 1FPTL 3H6JA 1KELH 3U46B 4HXBL 2VN7A 5C0AA 4X6DE 3MRCB 1N0LA 5ESQA 4ZPVB 1P4BL 4QXUL 2YRPA 1MHEA 2B1HL 5H37G 4AZCB 3WIHH 5T3XE 4GRWF 4XT1C 5M5DA 4LRNL 2AXFB 1KB5H 4RDQG 3SDAA 1UJTA 1ACYH 1YYML 4QY8A 3CFDB 1MRDL 1NGYA 2DL9A 4AMKH 4YHMH 2MTPA 1BFOB 4Q0XL 3K74B 3MOAH 3WLWD 4B16A 2OL3B 1Q9LB 3RA7H 1AGDA 1V5JA 3TN0C 2H9GB 2XA3A 5TQ0L 4G7VL 4AG4L 3QYCA 3REVA 1QFWH 4JAMA 1OAUH 2MCPL 4LLUA 4R27A 4U5IA 2EO9A 5E8OB 4D8PB 2NY1B 4N90E 1FN4B 1TPXC 3MROA 4KROD 3UTTE 2CRYA 2KH2B 1VADA 3BP5A 4KRPB 2IANE 4OJFL 3SEPA 5KSVA 3MODL 3O6FC 3D39D 1J8HE 3QIUB 5TPWL 4U6HA 4X7EC 4OI8A 2NW2B 1J1XL 5L8JB 4B3KA 3OR6A 1HHGA 2PWEA 1II4E 1FG9C 3TYFA 4YHNB 1D2KA 4KHTL 1ZGLP 3WIJA 5BXTA 4Y4FB 4G42A 2IAMD 4PGJA 3NSNA 4TNVK 3PWLB 4P57B 3QEQE 1UM5H 2JJTA 4YGAB 4AZGA 2C1OB 1HYSC 2NY6B 4H04A 5D1ZB 1K6AA 4P0DA 5B4MC 2FJFA 4KRMB 3W6MA 2HVJB 4CVWA 1DQLL 1RUQL 1L7IL 2EE3A 3DIFA 1XF5A 4JCLA 5ITBH 5IFAH 3THDA 2ZX7A 3D3VB 1DWFM 1FQ9C 3QPQC 5LG1A 3O6FA 5B38G 5FL0A 3ZKMC 2XQBL 2AP2A 4QRPA 3UDWA 1E40A 3ZR6A 1KCRL 4HC1A 5EU4A 3TBWA 2O5YH 4IEFB 5CEYA 3IFPB 1J9CT 4L8BA 5JIIA 5AWNL 2NXZD 1HJSA 1J0HA 1I9RH 4ZTOL 2HTLC 1HH9A 4OZHB 5EIQA 4WGVB 1FIGL 1FAIL 1F11A 1J9YA 1VPOH 4KFZC 4R6UA 3WJLC 2KQNA 3LQZB 4JFFE 1IM9B 5E56A 4UBDC 1CFTA 1HQ4A 3PWPB 4KI5F 5F44A 5D96C 4FQXA 1H0IA 2WC4A 1FRGL 2RGLA 5HJ3A 3RWCB 1K6QL 1RK0B 2VB5A 3CIQA 2A74B 3MGTB 4KMQA 4ZDHA 2ICEB 2YN3A 2V3DA 3QG6B 4YHYC 3KPLB 2ZIDA 2JIWA 3ULVD 2CDEA 1E6JH 5D2NC 1BF2A 1QNPA 4ZQKA 2FX8L 3MCKB 1L8NA 4UCFA 5FUZL 2XN9E 5KZ6A 3FQWB 3GMPA 4R7DB 1ODZA 2BVDA 3QFJD 3PV6A 5DHYA 1EBAA 1J88A 4P7QA 4PJDE 2YJQA 3T0DA 2CRZA 1U6AH 1RZGA 3D5HA 5I8KH 2W0KA 4XAKD 5T33H 3BGFB 5KAQG 2OYKA 4NT6B 4HF5H 5C7XL 1C93A 2ITCB 3W11D 4CKVX 3QWQB 3WSUA 3RU8H 1B3ZA 3MV01 4FQXC 3QHMA 1JNEA 3D18A 4NKOB 4XNYH 4Z2GA 3ZE2E 5BVJA 2AJ3A 1QLFA 4AEEA 3MS8A 2VMFA 1KQYA 4LYRA 4JGJA 3MSDA 2DWEA 3FB8A 1L7TL 5A8PA 5IV2A 4ENED 3MGAA 3MRLB 1F00I 4KAQL 4XWGL 5B3JE 2R1XA 3O3EB 1KJ2A 4I9WD 5JOFA 2QHAA 2HMID 5B38A 3LN5B 1VKXB 3D18B 4NKOA 1LNUA 1RURL 1H41A 5D7KE 1LILA 3QJFB 2BY2A 3VRIB 3STZA 1P6AB 4ZNEE 3AS0A 4JQIH 1LWRA 3FQNA 2R39A 1RIVH 3IJSA 3BAJA 1NOUA 1B4JL 1IGTB 3FJTA 4FTVA 5J11C 3UC0H 3TA3B 4CN1A 1UWGH 3C6LC 2H26A 3QUXC 1ZHNA 5CINL 3L5IA 4ZOEA 4JFSA 1Z3GL 3QH3A 2YKLL 4YFEA 4LRNH 3V9FA 5CSUA 1RFDL 1KJ2B 1U91B 4LPCA 2X7LB 2ESVE 3CK0L 1KLGA 4M61B 1OM3L 1U8LA 1RV6X 3SUUA 1IGMH 4KTEH 5C0FB 4LOUC 1NKOA 1T03L 1UH2A 2YPKB 4RWHA 2PB1A 2OS7A 3TZVC 3R8QA 1AKJB 1MCDA 5INDB 3CMOH 1UCTA 3ZE2F 5C07A 3SUVA 4ZS6C 1PPIA 5I17B 1NC4B 2Z91A 4HUXB 4OLXH 3H42H 3ARDA 2VLRA 3E1F1 1TVHB 3ZYZA 4OZHA 1C12A 4JM2C 4UIKL 2DICA 1HL8A 5DQ9B 3W5MA 1FO0B 2WBKA 4ZO6A 3SGDI 5E8NA 4MJIE 5HHMB 1ZV5A 4JY4B 1XGUA 2FIKA 3DVGB 4HW6A 1F97A 2PW1A 5GZND 1TA3A 3O3BA 3SJVB 4NQVA 4YQXH 4KJWC 1CXKA 3MRGB 1MCQA 3T4YA 2IPTH 5CEXA 4AD1A 1Q8MA 3K0WA 1A0QL 4XNUH 4KZDL 2GT9B 2P47B 3SDXB 3RZCD 1S7TA 5IB2A 1QNQA 2WWKO 2MANA 3RJQB 2K7PA 2BRRL 3DUUB 2XPKA 1YNKL 1P1ZB 2G5RA 1JZ3A 1J86A 1A14H 1QBMH 1S7RB 1KJMA 4JPVL 3EO0A 4YJZL 5I73B 4OM1L 4F3FA 5CFHA 5L9DL 5DO2C 3SKOB 3U2SA 4YLQT 1GZQA 2VZTA 4DWSC 1AXTH 3KPNB 1PGRB 1NDGA 2UY7A 4YFLI 1QRNA 2XHYA 4NSBA 4NRSA 5GS0H 3W25A 3FQTB 1A6TB 1QEWA 2EH8H 1R24B 4TSCL 2GCYA 4A6YB 4TULH 3LZFL 4CU6A 5BS0E 2EXYD 1CF8L 5EPMA 1GRWA 4D6GA 2XKUA 4NI3A 4JM2B 4JDTH 3MLRL 2DWEB 4QKXB 3WSQL 2E9BA 3C6SB 2V9RA 2NY2C 2R0WH 1HP5A 2PR4L 3WFDL 1FRGH 2X9WA 2LQRA 1CLOL 5GRJH 5DJDB 5ADOL 4L9LB 1HJWA 1P5UA 3TYGH 2VL4A 4UIMB 3WJJC 2EKJA 2CR3A 3VWJA 3MUZ1 1M7IA 2M1KA 1QO3A 4JFDD 2AMGA 4UQDA 1BOGA 5J6HA 1RZJC 1FYTB 3SGDH 1X5XA 2Y1VA 4H88L 5IW6B 3QIWB 4PJIE 1R3HA 3OPZL 2GJ6D 5EOCL 3HRZA 1V05A 5EOQL 4I0PB 2PYED 1UM6L 2YSSB 4YN5A 1NCBL 4AIXA 4QCFA 2J62A 5GGQH 4G6KH 3ZKNC 2JJSC 2WIIB 4LLUB 3D0LB 4YWGL 5DI8B 2OZ4H 4F8QA 4ZFFB 5HXMA 1MLBB 4OCYH 2Z8RA 3P4MA 3LVEA 5HGGS 4X0VA 2AV1A 1RHFA 3B8YA 4OV5A 3IKKA 4O2CA 4IHOB 4QHKJ 3RVWD 1HIMH 3BDYL 2YHGA 1U8IA 1UWQA 3TO2A 4OGXH 4NJAH 2CLRA 4F9JA 5CJOL 4K7FA 4GMTL 4XP1L 4Z76B 5HPOA 5DHVB 4U1JA 3QGVA 3IDNA 2Z8SA 1MNUH 4M1GL 3VFTA 4F7TB 3RKDC 3S6TA 5GGTH 2HKFH 1Q9OA 4KI5C 3CX5J 3HPLB 3RILA 3BPNC 4TX8A 3AMLA 4HKJB 4UV7L 4V1DB 3NPZB 1KNOB 1F4YH 3MMEA 3MUGA 3UMTA 3BRDA 4Y4KB 3QRFM 3AHYA 2DSKA 5KS9B 5J1AB 4KGJA 1AE6L 3E6HB 4ZNCD 5I6XB 5I1CH 2YC1A 4KKAC 1PEZA 2ZWLT 4POUB 3QCTL 1QHZA 3NFPB 3MPCA 3RWIB 5EU4B 4JL2A 1PQZA 4IDLA 2OJZH 4Z7VF 2NXYC 1AMYA 3VGDA 5C0AB 1NEUA 2VR9A 1QKZH 1EIBA 4OAWA 1MCIA 5JOPD 1ODUA 3OKEA 1QUNA 3LKRB 2OLDA 4JN1L 1H3GA 5GJSH 1GHSA 4JKLA 1JNNL 1NANH 1TVBA 1Z9SA 4WUKL 2VH5H 5DJ2A 1VBRA 2CDFB 4BM7A 1B9ZA 3GO1L 3ULVC 3U4BH 1Y0LB 4X0NA 5I30H 1NGYB 2W9EL 5DHXB 4AENB 4D9QE 2H32B 2F9BT 4HT1L 1UR2A 1Q94A 1RUKL 2FGZA 1OP3K 1NQBA 3TJEH 1AIFA 4HHAB 4U7KA 3LHPL 3S3JA 4KV5F 4OSUH 3THMH 5FA4B 1LDPL 4M9PA 2QKIB 1YMMB 1C91A 5J7CC 3TO4D 5IWLA 3BZFA 3QIWC 1ZLWK 3WUWB 1QI4A 3O6MH 1IQWL 5I74C 3DROA 1EQPA 3MR9B 4N5UA 4MDJA 4Q9CA 1KC5H 2A6DB 2WVSA 4JZJC 4AMKL 1JF6A 1MIMH 3TV3H 1AQ0A 5E94B 4IPLA 5ITBL 3VJ6A 5DT1L 3GUTA 5IIEB 2IFGA 3F5WA 5AYUH 1FZOA 3NN8B 2E6PA 4AIZA 4ZFZB 3STLB 3SCQA 3LAFA 1GVIA 1Q6GA 1MXDA 3QDMA 3GZAA 4MQXD 4S1QL 3RWGA 3MA7B 2L7JA 1BFOA 1JD7A 4UDTB 1ZJAA 1H3TA 3TLRA 3L3GA 4ZTOH 2VUYA 2ICWI 2CHOA 3V5KB 3U7YH 4PS4H 5CG0A 1DBAL 3O4LA 5H35A 3INUL 3BH9A 4AEHH 1JF5A 3PE9A 2AJSH 1YMME 5IFTA 2EXWC 3HC0B 3SDAD 4X6CE 3C2AL 4Q22A 3WQ6A 3AS2A 4NJ9L 3QXDB 3FZUC 3AIQA 5GRWA 2BNQB 4HKZB 3TBWB 3MANA 1NGWA 4LGRB 1FL6B 3B5GA 1XR9B 3MRJA 4LVNC 4DM1A 5A8NA 3HAEG 4U6HB 3O4LB 4HIXL 5H35B 3MC0A 1W32A 1Z9LA 3H7BA 1KT2B 5CEZE 1NM9A 1I3UA 1U93A 3TWCL 5GZOD 1JV5B 3E6HA 2VXTH 4D8PA 2XSBA 4EI6A 3HZVB 5DEGA 4P46A 3JTSA 1H0DA 3RA7L 3VXPB 3WUFA 3C87A 5TQ0H 3RWCA 2CKBB 5IDIA 3FCTA 4R8WL 4C55A 1F3JB 1QSED 3O41B 4RAVB 5E4EB 1IZJA 1TJHL 1S7VB 3L3JA 4QCIA 4HZ8A 4IRSD 5I1JL 5C0ND 1VRXA 2AEQH 5HD8C 5MEPB 3MOBH 5D1QC 5JW4N 2LU3A 4JRXB 1IAMA 3SE8L 1DSFH 1IC4H 1N26A 2F8OA 2ZSWB 1P69B 3P3YA 3GSQB 5EWIL 1GGCL 4EKJA 1CLVA 5C0IB 5A95A 4RAUB 1CU4L 5I1KL 4RA3A 5DEFA 5LKNA 4CMHB 3T4YB 4Q6IC 1UH3A 2DQHL 3DHPA 3SUTA 4Z7VB 4UDUA 5LA2A 2HKFL 2IMNA 2Z93A 2ZCHH 2G75A 3OXSB 1TCRB 3V7AE 1PSKH 4G6MH 1V6YA 3C08H 5C71A 3MV8B 5FUCE 3LQZA 4ONHA 2V5CA 5D2LF 4XZUB 5BWFA 5FGCB 3FQUB 1HQ4B 5ISZA 4MAUH 5MHSD 1YJDL 2VDQH 3NFSH 1F2QA 1AGCA 5T3ZL 3ARGD 3R06B 1KG0B 4XPFL 1U6AL 5FOOA 4XVSL 3FFDA 1CWVA 3OX8A 4ODHH 4XP4L 4YHIA 2XZAL 2H2SD 3FQTA 3UR8A 3DVNB 1RJLB 5FOBA 1RZ8A 2DTSA 2N4IA 4U7MA 5I2IB 4W8LA 3NN8A 4P5TB 3T77A 2OBGA 1DBKL 4M03A 3VFUB 1T4KB 4DZ8A 5CSYA 2QADD 1E6OL 3VXSD 1S7XA 4IMLB 1H8NA 2VLJD 3MRFA 4JPIA 5GSRB 2FYYA 5HHQA 1V3LA 5IB5B 5DZOA 4JQXC 3SDCB 2YL5A 1HE7A 1KBGL 5AZEL 4GQ9H 4NFCA 4EIGB 1BGAA 4TQEL 2BY0A 3EO9H 4LKCA 3MCKA 4N90D 1OM0A 2QQQA 4QXTA 1N8ZB 4HMEA 3VFUA 3L4UA 4IRZL 4U1SA 4KUZL 5BO1H 4N0UE 4JG1L 1KIQB 5EBMA 4OZGF 4OGYH 5T1KB 3KEHA 5DD5H 1HHHB 1X5YA 3RJXA 2F19H 2RCSH 3EYUH 4IISA 1TZIB 4P9HC 1EO8H 4OF5A 5LBSH 1QSFB 5IF0A 5IB4B 1T5WA 4YHYB 2CBIA 5T1MA 2XGIA 1DANT 3NOIA 3UJIH 1A5FH 1TVPA 4Y0GA 5F7EL 2FATL 1OGTA 4E42A 1P84K 1KIRB 2VX7A 5EFDA 3L7FB 4M7KH 4WHYH 5IHSA 3NTCL 3I50L 2B1AL 2J74A 2CKBA 4G7YH 2E7CA 3SGJC 1H9VA 3EOTH 1CICD 4OI7A 5EOCJ 5HTSA 5IBUG 4UB0H 1OAYL 4HPYL 5I16B 4X80H 5HHVH 1BM3H 2P7TA 1QSFA 2EKSA 1FNFA 5CUSL 3UP1A 3IDNB 4A6YH 1I1YB 4MX7A 5F3BB 3X13B 3ARFC 3O6LL 3EOBB 3HNVL 1BSIA 5EFFA 2XKNA 1MCPL 4N8PA 4HJJH 4R96B 3EMCA 3SDXE 1X5JA 2IPKB 4R90H 5FYKL 3MKKA 1WBXA 1A7RL 5HOSA 2B0SH 4O5LH 4N0CD 2WZEA 1U33A 2CIIB 4QRSA 4HWUA 1R3IL 1BECA 2PW2A 2EEBA 4IS6B 1VAHA 4EE9A 4MJIB 3RUGB 2W5FA 3WFCH 3N1AA 1SJEB 2Z9TA 5MERB 2IQAB 5E9DE 43CAB 1MHPL 5DXWA 1UWGL 4DCQB 3DV4A 2MHAB 1WPCA 1NCAH 4P5TC 5IUSA 4X8JA 3WKMH 3B9KA 1Z3GH 4DWSB 4H88H 1SEBA 4Y19E 1UOKA 4LEXH 2JTDA 4RWYH 1FC1A 4QFUA 3G6JA 5A6LA 1O7VA 3ZYJA 2BNRB 1JPTH 1W72A 4G6JL 3JV6A 3T2OA 2HH0H 5L9DH 4ELME 5FCSH 5C0BD 1A7QH 1G6RA 1LGVA 4LVNB 4OD3L 2BERA 2AJZA 2AK4D 4W89A 1X5FA 1NSNL 3L9RB 5GISH 4FABL 1JE6A 4PTTB 4LHQB 2YUXA 3TESA 5I23A 1KTLA 3UR7A 4HMDA 2YZ8A 5SWZD 5DFVD 1G7QB 1SM3H 1W1VA 2CESA 3V5DA 3S3PA 1W72L 1T0MA 4G9DB 4L4VB 3L3IB 1SEQH 1YEEL 3T0VA 3WFEH 5I18H 4FQPA 2W66A 3LS5H 4GRWH 2XQYG 1E4JA 4O2EB 1WF5A 5HYIA 1I8MA 4JM2F 25C8L 4XAWH 3IDIB 5ID0B 2P5WE 3BMWA 4OLZL 3PWJA 3CH9A 2YEZA 5DD3H 5FD0A 2R2HB 3TN0B 4D6CA 1SYVA 4X7SH 3MXVH 5KZCD 3MCLL 5C07D 5D1QB 3ZJKA 1MLBA 5FYJD 3U7AA 3WELA 3QZWA 3S5LB 3EHBC 3ULUF 3K3QA 1SBBA 1XF2B 3GH7A 2PO6D 5C0BE 5BOZG 1OGAB 3PTQA 5I75B 3GKZA 4X6EA 2C1PA 4M43H 5I1EH 2JEPA 4Y19D 2GK2A 6CGTA 4PMUA 3GHEL 1I8KB 3O3AB 5EPMB 5CSGA 1C8PA 1RMFL 2P5EB 1BHGA 3BQUB 1MFDH 3CVHA 5E1AB 5IJVB 1GHRA 2E9IA 5ACZB 2DQXA 3OKDB 5CGYD 5JBDA 3PJSB 3TA3C 2GEEA 3L3DB 3ARBA 4XMPL 4N0FB 4KI5E 4WKHA 3HC4H 3RCNA 1KCLA 3DJ9A 2PKDA 2IADB 4QRRE 4JPWH 1C12B 4DFIA 4XP1H 4PLKD 4XBGA 1LDSA 1OSZA 1C7TA 1UXWB 1QLRA 4M8UA 2FJHA 1DVFA 1TMCB 4K3DL 1K5NA 4U1HB 1YN6B 1I7ZA 1K4DB 3TCLB 1C1EL 1V3JA 4U7SA 4HA1A 3BUYA 2PR4H 3P30L 2F61A 2FH6A 2ZUYA 1XGZA 2EEDA 3L3DA 1M53A 3RM4A 2HKHH 1F45A 4WGWB 1NGQH 5TE6H 1MLCA 3HMXH 1VKXA 1A3QA 3VUPA 3PWPE 1T20A 2XM2A 5B21A 1LL4A 3M45A 4RBPH 3WHXB 3CZ8A 1YQVL 1F4YL 1UQZA 2PO6A 4Z77A 3SE3A 2X40A 4HJGB 3ULSB 1MYRA 3PZIA 3RNQA 3QIBA 1EZVY 3ZHLA 1J0ZA 1QHPA 3KJ6H 3PL6A 2OSXA 3VGHA 3ZSSA 5ANME 4HKBA 2XGBA 2GJZB 4XP9H 5DD6B 4XCYA 3LQAH 5E8DH 4BZ2L 4AXNA 4XB7A 3LEYH 4Q9RH 4APQD 3WD1A 2H3NA 2VE6B 3NTCH 4PTTA 4UQ3A 2HP4A 4PJAF 1HXYB 3LKSB 2AEPL 5CZXD 4B53A 3K4AA 3SGEI 3GBEA 3FHAA 3BRFA 5E2UH 3GIZL 3GSQA 3SDYH 1UD3A 1UR0A 3PZNA 1C5CH 3ZDZF 2Z92B 1XGYH 4FFYH 5HDBE 5SWZA 2VC2H 3N11A 5F1IB 1RZJH 4CD4A 2G5BB 3MLYL 5DHVH 1UQYA 2C7UB 2NX5D 3QUMA 1IAOA 1BMGA 4PRHE 1QTYT 1RJYB 4WU5A 3W0WB 3GSNH 1UM4H 1UKTA 1X4YA 1TENA 1RULL 3VWJB 5EOTA 5DK0A 4KKBD 5D7JB 4HQQL 3EO1A 3BIKA 4CD7A 4LBEB 3I84A 2X05A 4OFVA 3MFGB 5IOPB 1A7NL 1KXTB 4M48L 4LKXA 4XBPB 1A6PA 2C7UA 3G6JF 4P59L 1WAWA 5D6DC 3A47A 1TQBC 4G8FB 1S7TB 2WWCA 1AE6H 1G9HA 4XC1L 3ZO0A 1DEEA 3WE6A 3C8KA 5EC1B 4BYHA 3TIDB 3EO1B 4ELKB 2NTFA 3OQ3B 3DV6B 1VHPA 1KCUL 4FMFA 4M6NL 4EDWH 1BVLB 1U8NB 3MQIA 2XIBA 2J4WH 2NX5E 3MV11 3WV0A 2BNRE 2BVEA 1PY4A 3GJEA 1ZT4A 1JF1B 3KHQA 1NFKA 2ZP0T 4HIJB 4PV9B 4UT9L 3VM5A 3TVMB 1LEGA 4NIKB 4FG6D 2CLVA 4ATDA 4JRYB 1IC4L 1KENH 5DDHA 5F7MC 2KKQA 5F89A 5IESL 4XBGB 4S3KA 3QIUC 4UQEA 1E28A 2XG4A 4J8RB 4MXWL 1MQ8A 2XWTB 4NZTL 4MNQA 4YO0A 1I1AC 3MSPA 4OOZA 4KRPC 3LIZL 1WFNA 4PMVA 3U7WL 3IFLH 3JV5A 3UJJH 2NY1C 5E9AA 3ECQA 1B2WL 4WJ5B 4BQ3A 3VJ6B 3VDAA 5JBEA 4XP6H 2WAGA 4R5EA 2DQJH 3NGBB 3D87B 4XXDA 3QULA 1MWAA 1N6QH 2BVOB 5GZNC 3PP3H 1ONQB 2QMJA 1J5OL 1YEIL 3QIBB 5DWUH 1G7MA 4S11A 3WH8A 4FF5A 3WFLA 1HINL 4O4YL 4WWID 4QRRB 3HI5H 5I2UA 4L4TD 1P4IL 2C7FA 1QG3A 1S5IH 2XZAH 4OZGA 1N4XL 2OXHA 3WH7A 3ZM8A 5MP6H 1E4WL 4BFIB 5IG7A 4JO2H 4WI6A 2WNGA 3O2VL 3KWXA 2VISB 1MRCH 2VOTA 1U93B 3W9EA 3TNMB 3BZDA 3ME0A 4S0SD 3C60A 3TZVD 3FTGB 5GGVL 1AGBB 1IILE 3JUYA 3BP4B 5KSBE 4PS4L 4TNWF 3QO0A 1XR9A 3MRJB 1YECH 1HZHL 3VFMA 5IHRA 4JO1L 1AH1A 4I9WE 1YZZA 5SX4H 4UZSA 2GAZB 2YMXH 2PYEB 2JCCB 4R26L 3SKJH 4Y89A 4MNGA 3ILQD 3RAJL 3SOBH 4WU5B 1NGQL 3W0WA 1KXHA 3CZLA 5F6IB 4HDIA 2BY1A 2VNCA 5L6YL 1MFEL 3JTSB 1U3ZA 4FHBD 4QRPB 5FKAB 5HDRA 2YPLB 1Q9WA 4NFBA 5C0IA 1SY6H 3OKKA 1XC6A 4PTUB 4XVJH 3PQYE 2BNRA 1NEZA 4HK3N 1EHLL 4PLJC 2YRLA 4S1SH 1IGFH 3KYKH 3WDHA 1YNKH 4PSRA 4NNXB 2UVEA 2GTWA 3MMEB 3MUGB 3IS1X 4MCZA 1RHHB 5HHNA 4JR9H 5CPSA 2Q87A 5HGHA 1QOKA 1RK1B 1A5FL 1GH7A 4JRXA 4PJCA 2R2CA 4WO4C 5C9JA 3TJHC 1BGXL 3DI3B 2DQTL 4L5FL 1QW8A 4NNPL 4PJ9D 1BYDA 5JW3L 2AJVH 1E5JA 2F54A 1A6AA 4FFZL 5HPMB 3VIOA 2GJ6A 5C08E 2O26U 1OY3B 2X4UB 3SDYL 1JZ4A 1YEHH 3W9DB 2DJSA 1QW9A 1V6WA 5HHNB 4JHBA 3W11C 2GFTA 4Y2DA 4YHGA 4B0MM 5FGCE 1LL7A 2Q76B 3QUYB 1LO2H 3IVKB 4X4ZA 5KVGL 4F66A 3RGVD 5E5RB 3OG4B 1CLOH 1UM4L 2FGLA 2DQUH 4R4BA 4K7PX 2ZCHL 2Y07L 3T2PA 2Z8VC 2ITCA 4ZXBD 3U57A 2V2WA 4DZBA 4QTIL 1OF2A 3P9MB 5DMKB 4K7PH