5JIPA

Crystal structure of the clostridium perfringens spore cortex lytic enzyme slem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
GFAQDKNPLSTFGPDLNEFSRDVNFLTLAKNSDFIYLRASGSGTGKLRIDNKFLEFAKECRRLGIPCGAYHFAKPSKDLDSAVIQADQFIDVLQQGFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTDEGKLDGVGSPVDLNWGPNSIDSLMPPSAVTGLNAYISGNKIFVNWTANKEDDLNGYNVFVNDNYAGTLPRKATKIVIDKSRFYLPKGKPIKISIEAFDITGDFSKERTEYILDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cortical-lytic enzyme
publication title The crystal structure of Clostridium perfringens SleM, a muramidase involved in cortical hydrolysis during spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 95
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jipA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5jipA01
4ZENA 3SGKC 4QRQB 1FO0L 3EOBB 1SJHB 3BWAB 3GK8H 4NN6C 3G6DL 1T3FA 5TF0A 1HHGA 1UZ6E 4NF7A 4MQXC 2VIRA 4PS4L 4KQ3L 3BGAA 5DHVH 2IANE 4TYUA 3CIVA 3PGDA 2XVPA 3MUY1 4OJYA 3ILPB 1HKIA 2P5WD 3MRIB 1D5ZB 1U3HD 4Z76A 4Y19A 2WUCH 3L3KA 5AD0B 3AIQA 1IGYB 5JBDA 3SQOL 4FP8H 4P7NA 2CIIA 4XXDB 4QOKB 1N6VA 2AGJL 5FA3B 5L9DH 1KB5A 1TPXC 2NW2A 2XZZA 5E5MB 5MEQA 1GJUA 1B3YA 3FQNA 1CL7I 3DO3A 4M82A 3GFUA 4CKVX 2AXGA 4DN3H 5FOBB 3RI5K 4JFHE 1DWIM 3O4LA 2NY4D 5EC2A 3PZMA 5INCB 1DDHB 3RWGB 4C56E 3IAPA 1OPGH 4JFWA 3EYFA 3DMMB 5BXSA 2FD6H 2NX5E 2ITCA 1QA9B 3O8XA 1OPGL 1QSFE 1UH3A 3H0TB 3CZJA 1NJ9B 1O6IA 3AZTA 1I1FB 1UWXH 2C9AA 2FD6L 3GRWL 1BGXH 5C0AD 3MV01 3BQUB 1PY4A 5KZ6A 4NQUA 3AHVA 1TJIH 3P73B 4P3DB 1FL3A 4Q2ZB 1KBKA 2VLRD 1BGXL 1CICB 1QPXA 4MGXA 1TJIL 4NOBA 5ABFB 1RFDH 2Q7YB 1X5YA 1XR9A 4NQED 3FN0L 2L4OA 4CD4A 3ESVF 4TVPL 4NPYB 3M1BA 1XCQA 4PY7B 3WKML 3CX2A 3PTQA 4JRXA 3RTQA 1OB1B 3DRQB 2VN7A 3MMWA 3VFVA 4NKMA 3DX7B 1U8HB 3MYJA 1AP2A 1XGPA 4NQVB 3SO3C 2WC7A 2AXJA 4Z2GA 4OOUA 2FB4H 2ZWLT 1F42A 3UR8A 4N90E 3MOAL 2JIXB 4GBXB 2FB4L 1N59A 2AKRB 4P57A 3KPOA 1WBYB 3H7BB 3MRNB 3QT2A 3QDMA 4H8VA 5A2JH 3UMTA 4OIFA 4POZC 4GRMB 2GK0B 4IOFC 4MAYA 3HMCA 4YQXH 1IZJA 2X4NB 4Y16A 5C09A 3RUGF 4G42A 4Y4FC 3HE7C 2NYYC 4WW2A 5DJDB 4JDZA 2JB6A 2V3FA 1RZGA 2Z8RA 3HI1A 3ROLB 2HRPL 3BN3B 4Y8AA 4ZQKB 1XR8B 1ISVA 3KE0A 4YHYB 2Q1EA 3MLUH 4GRWH 4DVRH 4D6GA 4QRPA 3CHEA 4ODWB 4F7CB 1OP5K 3VILA 2A74A 3MLUL 4YIQB 4N5EC 4DVRL 4N8CH 4K7PX 3MRQB 4JZNB 3DROA 1PAMA 2OP4H 1R5IA 1FH5H 3ZE1E 3U36B 4N8CL 3W28A 4I0PB 3ILQC 4RMUA 4CDHA 1B4RA 3GH4A 2JF6A 5CSZA 2OP4L 3VG0H 4YDIH 1HNYA 4X8JB 2X40A 3DVGB 3H9SE 2RJMA 1IEAA 3BH4A 3O2LA 5HYSB 3D5HA 3TO4A 3WIJA 4YDIL 4UDUB 3DYOA 4PV9A 3X3FH 3A6OA 3D18B 3OX8B 2XIIA 1R3HB 5ISZA 3IJHB 4PR5B 2Z8WC 4HCRH 4U05A 3X3FL 4NM4H 1XF4A 5HNNA 3TESA 1HL9A 4MJIB 4HCRL 1SY6H 4NM4L 1W9PA 1XGRA 4I2XB 5JBFA 1H9VA 1SY6L 2P24B 3LKRB 4XVUC 1QR1A 4HBQA 5JQ6L 3OKOA 5F7EL 3HG1E 1RZ7H 2ADGB 4GO8A 4K3EH 5I1AB 2J7DA 2APBA 1RZ7L 3IDMB 4P8XA 1PEZA 4K3EL 2HJKA 3BH8A 1UWEH 3X12B 3AYSA 4PUEA 2O5YH 1WKYA 4PJ5D 5T1LD 2G3IA 1A21A 4JG1H 2XZCH 4KZEH 2O5YL 3WXWL 3QWQB 5IB4B 3KL5A 5H2BB 3PZOA 2XZCL 5DJ6A 1P1ZA 1C16B 4V1DA 2F15A 3L3JB 4RDQF 5F1OB 3I3DA 4JGUA 3F6IA 2B5IB 3QIUD 4K94H 3NMEA 3SGJC 4N9GA 4HSQA 7TAAA 1GOWA 2QADC 4OCMC 4K94L 3MS8A 3QDGD 3QUZA 1FYTE 3SE3C 3BZEA 4JFUA 3MLZH 1G9NC 1IM9A 4PTMA 4UI2A 4XAKD 4TSBH 4DZBB 2HN7B 2XNAA 4KPHH 2AV7A 1G6VK 1GZPB 5KS9F 4UB0H 4TSBL 3PTMA 2G9HA 5L0QC 5MEOA 2DQDH 4KPHL 2P5WB 5MEND 3WQ6A 3KNBB 1H3GA 4WW1B 1A6WL 1NCTA 1QLRA 5I1DB 2DQDL 4MA7H 1OP9A 4Z78B 4PRIE 3NCOA 1KBBA 2X1OA 4LHUG 1AGDB 3VIOA 2E40A 4MA7L 1W1VA 3TBTA 1CR9H 1EHAA 4MVBC 1ND0B 4KJWC 3STZA 3QHNA 2BVEA 2A0LC 1I7TA 1UH4A 3GSUB 4DVBA 3O6AA 2X0HA 4NIKB 2ZNXA 3UTTD 5KS9B 2W65A 2DT0A 1LE5A 5BO1L 4Y5VB 4DTGH 3VFPB 2NY4B 4KRNA 4OLWH 5CAYB 2EPLX 3ULUH 2HTLD 1BFTA 1IEBB 1VFUA 4NQSA 3U7VA 3EOAB 5JPNA 4XCYB 2O92A 5B38B 3VOCA 3WEXB 4GUPA 3QFDA 5DMIH 2CKRA 3PZTA 2BP3A 5J3HC 1JAKA 2PF6A 4YHIB 2E9LA 4YAQA 5DMIL 3OTTA 1YJDL 2Z31C 2WWCA 1YQVH 2QSQA 1RV6X 2Z9TA 4NHCH 5CWSB 4LCIH 4YK4B 3CPUA 4NQEB 1UM6H 5L88L 1ZGLP 4X6DE 3GSWB 1VERA 4NHCL 1H1NA 2PTVA 1UM6L 3GSXA 5DEGA 4GAGH 4Z9KB 1HOCB 2UY6A 1DN0B 2D24A 2ZG3A 2UWEB 5FYLE 1ZEAH 4GAGL 4JHAH 1F6LL 3KYNB 2OQJA 1GOGA 2YBRA 3TVMC 4C55A 4CKQA 1ZEAL 3C9NA 3X3GH 3ULVH 1XH2A 2CXKA 2NY0D 1DQJB 3X3GL 1A3RH 2H2SD 5LJYH 2GCYA 1CXIA 2Y36H 1LG2A 4W5UA 5IMOA 1A3RL 1BHGA 4JDTH 1MFDL 3QXDA 3N9GL 2Y36L 2QSCL 1VGEH 1WFTA 1XEDA 5IWLC 4JDTL 4XAWH 1W1YA 2NW0A 1KLFA 1BVNP 1QSVA 4RA3A 1MHPH 2IPTL 3DIFB 4UIMB 5FL0A 4XAWL 5DHXB 4Q97A 2XTJD 1MHPL 4F3FA 1A1NA 2XN9E 1FP9A 4G8GA 1T21A 3MFFA 1EERB 1HE7A 2YPLE 3VD4A 2B2XH 2R0LH 1OTSC 3K8LA 3TN0A 3DYPA 3BUYB 3MLYH 5BRPA 2B2XL 5DO8A 1YN6B 2R0LL 1E28B 1CGWA 3MLYL 3D1MC 3PGCB 1TMQA 3C5JA 4ZFOL 5I66B 3DO7A 5A8PA 4OGAC 3JV4B 3GMOB 4W8LA 2NQCA 1UB6A 5A2FA 1W0YT 2CDEA 3QNYA 3MJ9H 4I18C 2FR4A 3MRBB 2O5ZL 5C0BE 1C5DA 1IQDA 1W32A 3C6LB 1RIVH 4N1HB 4JPKH 3BP4B 4LSQH 1RIVL 1A7BA 5B22A 4GS7B 4S1SL 4JPKL 1IGCH 1RJZA 4LSQL 3VXQA 3STLA 2DSUA 3V4VL 3T65B 1EAPB 2DQHL 1BTCA 1U0QA 4J12A 2J7CA 3CFEB 1EJ6A 4P59L 3DX8B 5K9KB 2XA3A 4RAUB 3CFCH 1CLCA 5GRJH 3O9NA 5C0EB 5GRJL 4HUNB 4GH7B 1T66D 1JGLH 4U0RC 4AEFA 4ZFZB 3W53A 1WAAF 3QI9A 5D1XD 5D9SB 2XWJA 4J1UB 1JGLL 1WICA 1YMMB 4QYOA 1QG3A 1J8HD 3AZSA 1Q9WA 2H1PH 3HRZB 4R3SA 5FYJD 1VA9A 2DYPA 1CQKA 3T1FA 1J86A 2H1PL 3TZVD 5I1GH 2N4IA 4NJ9L 2DSZA 1ACYL 4CMHB 5CIPB 5I1GL 3LQAC 4LSRH 2XFXB 3QDGB 3LN9A 1A6AA 4XPTL 2Z92B 2BXZA 4LSRL 1GGYA 2IALA 2GDVA 3QULB 2ZICA 1WBZB 1NEUA 4AENB 4RCAA 4UQ9A 1QPPA 3NSNA 3GMNA 3MREB 4OZHF 4W4OA 1ZKAA 4FQCH 3V4UH 1ZVYA 4WUKH 5HSFA 4PUDA 4DEPC 2DLIA 2HVKA 3BPCA 4G43B 1FZOB 4YC2C 1B3JA 2D31A 5CGYD 3V4UL 3C2AH 1T7WA 4WUKL 3PL6A 4IMKC 4PFEA 1HQRB 4KJYB 1KTLA 1PJ9A 1IC5H 4X0VA 3C2AL 3U9PL 1S7XB 5HI3C 2R2EB 5H37G 3SE8H 1IC5L 3ZO9A 1GOQA 3UC0H 1FVEB 1YEIH 1CFQB 4WHDA 3FAWA 4IM8A 1VFMA 1A9BA 1DFBL 1KTDA 3UC0L 4XNXH 1VPOL 1YEIL 3KXFA 1OP3H 1BVKA 4PJIA 1KN2H 5JHDB 3L3IA 2IJ0C 5I8OH 2AXFA 2IFFH 4Z7WF 2YRPA 1KN2L 3UTSB 2DI7A 1M6OB 4RQQA 1F13A 3FOLA 1T7XA 2IFFL 2G60H 2F9BT 1JWMA 2Q7NA 1W0VA 5E9DA 3UTZB 3WF3A 5IW6A 1TCRB 5BJTB 3UTQB 1FNAA 5GGRY 2H32A 2H26A 5GS2H 2XQYK 4OZGA 5F6HJ 5DEZA 4L3CB 2EDYA 3M46A 2EC9U 3IYLW 3TIDA 2BHZA 3UG5A 4BCEA 1MH5A 4L4TE 3GSNB 2GAZB 4EUPA 3DRTA 5F6IC 1RI8A 1RZ8A 5I0ZA 3JUYA 3WDIA 3C8DA 5DTFA 3EOBA 3BWAA 5AC4A 4S10A 3EO9H 2OTPA 2BC4B 1QOKA 3CDFA 1U36A 3HC3H 3EO9L 4QY8B 4HIXH 4HGMA 1MCEA 3HC3L 3B4NA 3OXSB 2XWEA 4HIXL 3QIBC 3T3PE 5BVPH 5IOPA 1AGFA 1JAEA 3L4WA 3QQ3B 3ILPA 1LNUA 4FQXA 2G3JA 3VVGA 5BVPL 4AW7A 2XKNB 3OAZH 4R96A 5I15L 4YJZL 3IDYC 3V5KA 4XGZB 5AD0A 3GSVB 2ZCKH 3N1MC 4XXDA 4PUBH 5FA3A 5E5MA 3DVNB 1EHLH 2V5MA 2XTJB 3L3GB 3IJSA 2ZCKL 2QJDA 4PUBL 3CSGA 3HE6B 1XYFA 3KEHA 1ULVA 3VW3L 4UFHA 1KIPB 2I24N 2J74A 5EU6E 4UUJB 5INCA 3QWRD 4EN3B 3WF4A 3V8CA 5D7JC 1UB5B 3Q3GB 3DX9A 1S7WB 1FV1A 4GOSA 4NRYB 1FL5A 4KDTC 4ZO9A 2OTUA 2GJRA 2PTUA 2YN3A 3RJQB 1LEIA 4XCEB 1KG0B 5C0ND 2K3TA 4URIA 4P3DA 3G04B 4X83A 2HJLA 5FGCE 1CICA 4P5KB 1RHHA 2EKSB 1DQQA 3U4BL 2FJFA 3H42H 5HDQH 1WEJH 4BFBD 4BH8B 4EI6A 5FKYA 1TVDA 3QHTC 4NPYA 3H42L 5HDQL 1WEJL 3WMSA 3WE6B 1XF2A 3GJEB 5B3JE 3SUTA 5F72S 2GKIA 4TTGA 4IIQB 1NBYB 3WLBB 1NCDH 2EIZA 5E2TH 5F97E 2A3AA 3G5YA 4GG8A 1KEMH 2A2QT 1GQLA 2EXOA 2VWEE 2Y5TB 1U8HA 1XH3B 4PJEE 5E2TL 4NQVA 2J6EA 4ZTOL 2PBGA 1KEML 5FM5O 1E6PA 4D0BA 2YZ8A 1WBXB 2WBKA 3POCA 5ILTH 4Y2DC 1WBYA 3H7BA 2B4CH 3LHPH 4UFJA 5ILTL 2GK0A 3DPBA 2H41A 3FCTB 2FYYB 3OJ2C 3D39E 1I7UB 2B4CL 4KTEH 2NYYD 4PG9B 3OKNA 1CXLA 1WC7B 4KTEL 4NRXA 4GAJH 1WTLA 4OZFG 2J75A 2ADFH 1XR8A 1HINL 5C70A 3NPSC 1BVLB 2ICEA 1T1YB 4GAJL 3UJIL 1ZMYA 2ADFL 4M9OA 2AJ3A 3F7YB 4LLYA 3UJTH 4PGZA 3LQZA 1R3JB 2DDQH 4ODWA 3QHFH 4JFXA 3HNSH 3ZKXC 4Q9RH 5F9JB 2DQCH 3UJTL 1JE6A 2DDQL 1A7QH 3MRQA 3QHFL 3HNSL 3OKYA 4Q9RL 1CLOH 2FEEL 2XY2A 5LBSL 1W72A 3E6HA 2DQCL 2V5YA 1PZ5B 2BY1A 4QHUB 4I0PA 4JKMA 2MQ3A 3U36A 4MD4B 1A7QL 3AIWA 2XTLA 2DL2A 3PTKA 4JVUA 3CMOL 4EI5A 2HFFA 3DVGA 1WITA 1KN4H 4NUJA 5HYSA 4TQEH 2HFEA 5IFAH 4LGRB 1KIQB 2WHKA 4AYSA 1KN4L 4JVWA 4TQEL 1LWJA 3VWKC 5IFAL 3IJHA 4M29A 5T3ZD 4BA0A 1JD9A 3KPMA 1OAXL 3GI9L 4MJIA 2OZ4A 3T0EC 5C08D 2LQRA 2WMPA 1JGUH 5JOPE 4JFEE 3ZKMC 2FGLA 2BDNH 4WIQA 1FC2D 4U1HA 2E9IA 1QSFB 3UPRA 3LKRA 4XVUD 3JTTB 1S7SB 3BIKB 2BDNL 5MI0B 3CD4A 1S8DA 3L3OB 2GJXB 2ADGA 1EPFA 4ZXBC 1I9IL 2LU4A 3PABA 3IDMA 4WWKD 3O3EA 1LGVA 1FO0A 5EC1B 5I5RA 3OB0K 4GAYB 3X12A 4EK7A 1JV5B 4WNQB 4U0QB 1B4JH 5I24A 5D1ZD 1PZ2A 5EMYA 2WZPD 4Q7DA 5H2BA 2YEZB 4ML4A 2PWEA 4P99A 3N04A 3EO1B 3BEVA 2J8OA 1OINA 3W9EB 1TDQA 1M7IB 2V3EA 3GMPB 4NN6B 4MHHI 3NYDA 4UOJA 4DOHB 5EU7C 5DMYA 5GGTA 4LCUA 4H0IA 5C0AE 1KXVC 2VISA 4D6EA 4K55A 2EH7H 4X6CE 5I18H 5D1QD 2VLRE 4X6EA 2EH7L 5I18L 3HPJA 5EFFA 3C5ZD 4LGXA 3O3AB 3KPNB 1F4YH 1MLCA 4ZPVB 4G9FD 3JV0A 1I1WA 4GI9A 2FJGA 4AD0A 1KXTB 1S7RB 4AIXA 2HT2C 2HLFC 5I1DA 1HN1A 2XUCA 1AKJD 2DIJA 4KROD 2GEEA 4OIIL 4GQ9H 3OR7A 1IKNC 1AGDA 1A4KB 1B1YA 3QFJA 1TPXB 4GQ9L 3BLKA 1PX8A 3WV0A 4HOWA 5KVFH 3FQXB 3GRWA 3U79A 2P46B 1IAOB 4OQ1A 5GZOD 5KVFL 3AGVA 4B3KA 2BVPB 4PTTB 3UG4A 1L0YA 4HX1B 3V6OE 3VFPA 4GW1B 5HI5C 4PMVA 2ZUWA 4AJ0A 1VFAB 3KPQA 2OLHA 4YHNA 1R24B 4YDVB 3T0EE 4K7PY 4QRTB 4IDJH 1CT8B 3WLWD 1RULH 3I6GA 1INQB 3QCVH 5B38A 1CQYA 2I9LB 4IDJL 5C0JB 3KLSA 4OZ4A 1RULL 3BP6A 3E6FB 3OR6B 3QCVL 5ESAB 4D6FA 4YHIA 4Z2HA 5L8JB 5ELIA 3MGAA 4WI2A 3MANA 1QNPA 3WUBA 1INEH 3TEUA 3MRGB 4OD3H 1UACH 4OD3L 5DURB 2P5EB 5HGBB 2OXHA 5GRYA 4FFYL 3AMKA 1PD6A 4R0LC 1DN0A 4X99B 3HPLB 3MV7E 3V0WL 1A6TA 2R2BA 5TE6H 2UWEA 4LSUH 2WMGA 1FNEB 2Z93A 3GNMH 5DGQA 4AYFA 1XH1A 2QTEA 4QHNB 4BJLA 5F3BB 3L6FB 5TE6L 3SO3B 1CDYA 4NQDD 3GNML 2WWKT 5HYEA 3DHMA 3HC0A 1DQJA 1EEUA 1LEKB 3CSPA 5I1KH 5EU7E 3S37H 3QPQD 3MV9E 1Q9OB 4KMQA 2R15A 2AW2A 1IM3A 1WIPA 5I1KL 3QOKA 4G6AC 1TFHA 4PPTA 3S37L 4D6CA 1FG2A 3RY5A 4F2MB 1DBBH 2ADIA 2VR4A 4Y4FB 3DUSA 3ZTNH 3HE7B 1ISYA 1W1TA 4TXEA 3SOBH 5CBEB 2BFGA 1DBBL 3DIFA 1CWVA 4LF3B 2BERA 3ZTNL 4MSWB 1OOAA 4M62L 1LO3H 1G0DA 3MMDA 3BCFA 1JRHI 2OYPA 5IW1B 5KG9B 2GUYA 1D5MB 3L2MA 1T5XA 5TGBA 3ECQA 1V3JA 4X5XB 1AR2A 3BUYA 4PJ5E 1UXSA 5F89A 2DIEA 4NC2B 3VMPA 3LRSB 3ARFC 1W2VA 2E0PA 1AHWA 4JFFE 1E72M 5ETUA 3OJMB 4QRRD 5IV2A 1XH0A 3H7LA 5I66A 3HZYA 1OF2A 3GKZA 3RX8A 1ESWA 15C8H 4PSPA 3VI4E 2VZVA 5BS0D 4KU1A 5FO8B 5DJZB 1S5IH 4HH9B 2PWGA 15C8L 1CXHA 3JV5A 4J8RA 1BGGA 3MGTB 1QHOA 1S5IL 2WW8A 3IF1B 2WK2A 3UP1A 1EDTA 3LPPA 3NIGF 5AYQA 2VX5A 1E4WH 1RK1A 3WD1A 2XZQH 3ZT5A 4LSPH 5DMKB 2VLKB 4JE4B 4MAUH 1E4WL 3IFOB 2XZQL 4LSPL 3T65A 5MENE 4MAUL 4ELMF 4TN9A 3QZWB 4Q9CA 4MJ2A 3DX8A 5K9KA 2CKBH 3FO2B 5F1KC 2X4OA 5HGDA 3FFCB 3OGOE 4R5EA 4WI3A 3RMEA 3H9YA 4YBLC 2CKBL 2QMKA 2WCAA 3SDCC 3MR9B 1NFDE 4X6DB 3RDTD 3D0LB 2AJUH 4OZHE 3UTTE 4ZFZA 3W29A 2V5TA 3GZAA 4MWFA 4Q0XH 5D6CB 4J1UA 1YMMA 1DVFA 3VFUB 2EE9A 3GMQB 4IISA 5A16A 4X0KB 3PE9A 3IXTB 3IDJB 1F97A 4PLJC 3VXOA 4N0FB 5D72H 4LOUD 3BWUC 2QADB 1PVHA 2XFXA 5D72L 1RHFA 1UUQA 5ECUA 1P4IH 3AMLA 1MQ8A 2Z92A 5SWSA 3WN6A 4ISVB 5HPMB 1P4IL 1B3WA 4AENA 1EFXB 3BD4A 4X6BB 2XQBH 3WS3B 3B9VA 3CK0L 4OTXH 1F90H 4MXWH 1OWWA 4JFDA 3RHWK 5E8EB 2XQBL 5L0QB 4OTXL 1U91B 3BPOC 4PJDE 4MXWL 5E09A 2JJSA 5GSVB 1MY5A 2PI6A 3K2UH 3R0MA 4AEIH 2HTKD 1I3RA 2FNBA 3HS0B 3NZ8B 2YPLB 1OWRM 2EIEA 5F96L 3WF1A 1HQRA 4S1DC 4AEIL 4PY8I 3L5XL 2DKUA 2D9QB 2Y07H 2R2EA 4L3EB 5HI3D 4P5TC 3H6JA 1KGWA 3IETA 5T1MA 5DZOA 1RQ5A 1A6ZA 2Y06H 1KB9K 4GSDH 2EDLA 3MODH 3NZHH 3QG6B 1PG7W 3L7EA 2YUZA 4TUOA 4Y7MA 4BSWA 4LGPB 3LN5A 3MODL 3NZHL 5E2WH 1M6OA 4P46C 5C0BB 1X4ZA 4J3UA 4JN1H 2VURA 2X42A 3IB4A 2GHWB 2GITB 4JN1L 4H20H 5JW5A 4H8WC 4B7LA 5DR5H 3SBWA 4WEBL 2Z31B 3KDMB 3QEUA 4MD5B 1TZHA 3TOPA 5DR5L 1JZ6A 5J6HB 4KK8C 1ZWIA 4PGDB 2V5RA 1H3VA 4TULH 3OKEA 1TJHH 2VXTH 2GFTA 1JIBA 1WWBX 3HAEA 3BXWA 1IGFL 3KPRD 4TULL 1TG7A 4X7EC 5IJVA 3EMQA 1NBZA 2DSKA 1GGTA 1NUFA 1UQSB 4HMCA 2YL5A 3TVMB 2ZX5A 3ZDZF 1F3JB 3IKCA 4OQTH 2AI0H 3RJXA 1E27B 4MQ7B 2O9PA 5AZ2H 3VMOA 3CUHA 2FDMA 1CU4H 4OQTL 3BP5B 5FDWB 2GY5A 4ZUVA 3RM8A 5HHOD 4W7WA 4R7DB 1CU4L 2VDMH 3WKNA 1Z3GH 4R26H 1U93A 2BRRH 3GZKA 3K4DA 2VDML 1YQ2A 1BOGB 3KS0H 4R26L 4R2GC 4HKBA 5IVZA 4PRNB 2BRRL 1FCGA 4F9PA 4UFKA 4YR6A 4F9JA 4ZFOA 3DVNA 1ZBWA 5EWIH 4ZG1A 4XMLH 1SBSH 3W39B 5JORB 4OFDA 4Y5XA 1QTYT 1RD6A 5EWIL 1KIPA 4XMLL 1SBSL 4LRIC 2X41A 3MJ8A 3O11B 1YC8A 4ZPTB 3DV4B 1E1FA 4YGVA 4NSBA 4NWUH 3AY4C 3MV11 3WUWA 1J8HE 2OTWB 1S7WA 5FYJE 5JA8B 2OSLA 1JG9A 3LY6A 4PJBE 4JQVC 4MA1C 3BAKA 4RE4A 4UILH 5FOOA 4BK5A 1I1CA 2ZPKL 2GUOB 4PP2B 3LRHA 4W6WB 4I18B 4JG0L 5HYJE 2EKSA 5HHME 2ZOKB 2GTZB 4R4NC 5FGSA 3ARDC 43CAA 1OTTC 2ED8A 4XNZC 3FO1A 2BMKB 1PZUB 4NZJA 4XB7A 3GJEA 1FHLA 4WUUD 2XZAL 1J1OH 5A8OA 4EE9A 5BOZG 1JFHA 2X4SB 1AGBB 4RAHA 2G41A 3D6GA 2FZ3B 4XNUL 2Y5TA 5I76B 1V8HA 1XH3A 3C8KB 4KVNH 4XRCB 2CBVA 4P2YA 4FK9A 5C0CA 1RZJC 1VJSA 2E7LC 5L7XH 3WSUA 4KVNL 2B20A 1YEFH 1WBXA 4PRDB 5I71C 1FRGH 1M04A 4PJHE 5L2KA 4XP4H 5L7XL 3WELA 3SEPA 2AK4D 3VIMA 2VMFA 1FPTH 1FRGL 4U0RB 1HDMA 4UZSA 3MJ7A 1BJ1H 4JLRB 5SWQA 4MX7A 1FQ9C 2FYYA 1I7UA 5I19H 1OW0A 4PG9A 1VADB 3NGBC 3F7VB 1UD4A 5I19L 5ESVB 1CG9A 5CINL 3TIEA 3BAEH 1A3HA 2EH8L 4K7PL 4LLQB 3T3MF 1ZANL 1JYWA 4GKZB 2DI9A 3F7YA 1IL1A 1ES0B 3BAEL 4PMQA 1QRND 1Q6GA 1C12B 1CIUA 5KAQG 4HIHA 2IC2A 1WDQA 3W24A 2WB5A 4GIAA 2DQFA 1MCDA 1BLNB 1BQLH 2UYLA 2UVFA 1EEZB 4GXPA 1BQLL 1CGUA 1PQZA 3AROA 4NBXB 1IEHA 4N0UB 4NKDA 1JPST 4DEPB 3PWLB 4YC2B 3OV6A 1KJ3H 1KIQA 3HZKB 3K1DA 2CJUH 3P9MA 2PC8A 5CEXB 4MDJA 1KJ3L 3B9KD 2H2PD 1MPAH 5EU6B 2CJUL 4J4PA 4PJ8C 4PJ9D 3VWJA 1F11A 4JREC 5HVWA 3BGMA 4C56A 4HEME 2VDOL 1MPAL 5J1AB 4JAMB 4DGVL 4PRBB 4GG6E 1MCWM 1NMAH 2BSSB 2CLVB 3WFZA 2NX5A 1QSFA 5F1IA 4Q74A 4FLQA 2H3NB 2LE9A 4EXPX 1S7SA 4RMSA 1M53A 3RCNA 4V2BA 2GJXA 4D94A 2Q76A 3PJSA 1ISWA 4MNJA 2CERA 2FO4B 5FGCB 5I1EH 5EOCH 3OZPA 3THML 2YC1B 1FZMB 4ODBD 3QXTA 4X7TB 5DJCA 2BVUA 4NYLA 1GCYA 2JK5A 3LS5H 1MRCL 1JNNL 3BIBX 5EOCL 4AL8L 4BM7A 5I1EL 3G5XB 4GAYA 1WB0A 1JV5A 3LS5L 4J2XA 2XTKA 5E6YA 3ZR6A 4XCNB 1ETZB 5F1NA 2W66A 1UD2A 1EVUA 1IT0A 3EO1A 2YD8A 4FTVD 5F6IB 4CD6A 3F12A 4N0YH 5CLTA 3SGKA 3T09A 3VFTB 1MI5D 5FV1L 2VDKL 1Y7VA 5J0BA 3CDYA 1BZ7B 4N0YL 4OD1H 1MJ8H 1S3KH 32C2A 3D2UD 3WN5C 3RWDA 5AAMA 1AGCB 2JF7A 4OD1L 3AYRA 4OZIE 4Z2KA 4XX6A 4E8CA 4W4NA 1KWGA 3D39B 3MRFA 2GK1B 3FQRA 3QIBB 4ZPVA 1YEDA 1QFPA 5LAXA 2IEPA 1KXTA 2FECI 4AM0B 1G7QB 4UIKH 5IW3A 1U8NA 4P4RA 4OI8A 5MERB 5A40E 3IDYB 2EDBA 1TMCB 4UIKL 5HGHA 4M6OH 1BBDH 1MQKH 1NC4A 3OWEA 5FUZH 1A4KA 3RILA 4M6OL 4U1SA 3QCUH 4HWZB 5FK9B 5FUZL 3BPLC 2LAAA 3CTTA 1JGVH 2MWCA 3RY4A 3IAGC 3QCUL 5C0IB 5IBLD 2RGLA 1JGVL 4JQXA 1IAOA 3CZGA 3O9WC 4YX2H 1B6DA 5E0CA 1G5AA 3MX0A 4HX1A 3T2QA 5HI5D 2DLFH 2X4TA 5EU4A 5ALCL 4TTDD 3H9SA 4YX2L 3F7QA 4C7FA 1R24A 1JGEB 1VACB 3LD8C 1BD2B 4YDVA 5D7JB 4LQ1A 1SYTA 2DLFL 4QRTA 3POHA 4JO4H 1CT8A 3LN4A 2R0KH 1KJ2A 3FHAA 3MJ6A 3LKPB 3L4ZA 1SEBB 4JO4L 4U1NB 1OTUD 3OR6A 1TE1A 4P7LA 3VXTB 4D72A 5J6GA 1BQHG 4X9IA 1FFOB 4JFEB 3WFCH 5CIPH 4FHBD 5F9OH 3TPUB 3WFCL 4XZUB 3BMWA 3MNZB 3QIWD 5F9OL 2C3WA 3B8SA 1TITA 5D7LD 1C93A 2D7PA 5T5NG 2CIKA 2WBJD 4OD2B 1V02E 3T0DA 3GJFA 1FNEA 1WZKA 2NXYD 4KV5F 4R8WH 5A95A 1DN2A 1AFVH 2JEQA 5TF1L 1U8LB 1O7AA 4NO2B 3ZT7A 3MXVH 3P4MB 4R8WL 2H9GB 4NUGH 1AFVL 1HJXA 2BHYA 3TT1L 3MXVL 4IRJA 2ZX8A 1WCBB 1CD9B 5GGSA 4W6YB 5ACZB 2IGFH 2N1KA 2DGAA 3CUGA 1MRFH 4Y2DB 1KTRL 2EC9T 1ODAA 5C08E 2IGFL 4F2MA 1UEYA 1MRFL 3RJYA 3A6CH 3MRJA 4HDIA 5CBEA 2NY1D 1XZ0B 3I3EA 1W9XA 1HWHB 2R0WH 1FYTA 1T7VA 3A6CL 4X6CB 4MSWA 2A1WH 1D2KA 3NIGE 2PXYD 4O58H 3DV6B 1MCOH 4PRAB 2R0WL 3NPSB 4HFUH 1AQMA 2A1WL 2CD0A 4O58L 5AWNL 2OR9H 4L1HA 1MCOL 1QRNB 1GH7A 4HFUL 3OG6B 5CJXC 3O3DA 3ZKXB 3LH2L 3NIFF 1TZIB 1J0YA 4Z7VF 3VFMA 1Q1JH 5ALBH 1TJGH 1P5UA 4ELME 2VSDA 3LRSA 4NQCB 1Q1JL 4LPVA 1TJGL 4PRIA 2A73A 3L4YA 1YY9D 2X09A 1NSNL 3PIQB 5JUEL 5DJZA 1BM3L 3GSNH 4PMZA 4OBRA 3S3JA 4AZ7A 4HF5H 5CUSH 3MGTA 4AZCB 3VD3A 4Z7VB 3CHDA 4XWGH 5AUMA 3DSFH 4HF5L 5CUSL 3PQYE 4P5MB 3VWKB 7FABH 1WCGA 3CMJA 4TPRH 1NWTA 2GW5A 5CZXC 4Y1AD 3QOMA 4AZ6A 3I3BA 5IM7B 1WZAA 1JI2A 7FABL 4TPRL 3ZO0A 3T0EB 4B16A 4IHOB 4YHLH 1MWOA 5JXAH 3IFOA 2XG9A 1Y6MR 4P2RB 2A9ML 1URLA 1XIWD 3SCMC 4NHUA 1TVHB 5DLMH 2OI9C 5GS0D 4ZXBB 3QCTH 4QHKI 1DBMH 3CLWA 4C4KT 5HYIA 1FFQA 3QCTL 4X6DA 2XYLA 2Y23A 3FB7A 3D0LA 5I75C 5E6IC 2JFEX 2J7EA 3OKLA 3R06B 5D6CA 3ARVA 1P7QA 5LWYH 3MROA 4KK5D 3VFUA 3GMQA 3TTQA 3MV7B 1S9YB 3DURB 4WO4C 1HKLH 1K5NB 4IS6A 3IXTA 3OAYH 5IJKC 1RY7B 2IAMA 2W38A 1GC1H 3IDJA 1HKLL 5H35B 3RM9A 1OY3B 4J3XA 4PLJD 4XHQA 1K6QL 4N0FA 4XXCC 1E15A 2L7UA 3WFDL 2EXWC 1GHRA 1ZLWK 1CDJA 3TFKC 3RL2A 4XI5D 3D2UB 1MAKA 3SE3A 3ARPA 5A6JA 1N5YH 5HPMA 1A2YA 1K3ZA 1EFXA 2SEBA 5F7LB 1A3QA 2EYRB 1WF5A 3RWCA 1N5YL 3WS3A 1ITBB 4RISH 1P6AB 2R1YB 2UUDH 3TBWB 3PF2A 4IOIB 4PGCB 1M4KA 4RISL 1LL4A 3AFBA 1I9RL 3EJYC 4G6JH 5DVOA 1X6LA 4Z7UF 1ZA3B 2XN9A 4JZJA 4G6JL 1FZKA 4WFHD 5DRZB 2YPLA 2ZCHH 4CN1A 1XC6A 1UA6H 5T1DH 5KVDL 3T0AA 3U0PA 5JA9A 4FQQB 4K3HA 2ZCHL 4FLSA 5A2IH 1UA6L 3AREC 5T1DL 1E0OB 5SWZD 2EIBA 2V9RA 4DKEH 1ZLVK 1A6VH 5DA4A 3WL9B 4JFFB 5DUMH 4LCWD 4ALAH 4WY7L 1NBQA 4DKEL 5EBAA 4Z7UB 1A6VL 4ALAL 5KW9H 1T2JA 4OLXH 3MRKB 5ABEA 3IDGB 1QQDB 2WQRA 2KKQA 2OX5A 1HXYA 5KW9L 1G7LB 4U1IB 1GOOA 3EFDH 1CN4A 4OLXL 5C0BA 4L29A 4U31A 5AYBA 1T5WB 2FWOA 1CL7H 5FA4B 1CBVH 4GLRI 1CDHA 3QQNA 5GNYA 1CNVA 3MA7A 1WQVT 3WQWA 1SYVB 5FYJL 1CL7L 1CBVL 1IGTB 2XFYA 2CO7B 4LKXA 3RO8A 2DEPA 3MLTB 4KMTH 1BZ9A 4MNQE 3N12A 1DEEB 3S97C 3RKDC 4PLNC 5CP3A 1KLUA 4UQCA 4KMTL 1U95B 2BY2A 3DBXA 3DUHA 5EUOF 4QRRE 3S8WA 2M2DA 4R0LB 4PRPE 2I5YH 1UQSA 2XWBB 1S7UA 3QH3B 5E03A 5FO7B 2Q8BL 3O2WH 2EXYD 1UZ1A 2I5YL 1LEGB 3Q1SH 5I2UA 1F3JA 3O2WL 1E27A 3WBDA 4MQ7A 3LMJL 3UPAA 5F44A 1JZ4A 5C9JA 3ZE0E 5FDWA 3TBYB 5C2BH 2Q6WB 4R7DA 5I0DA 4APQD 2G75B 5C2BL 5CD5C 3GIVA 1U3ZA 2BOCA 3O8XC 1LO2L 1LL6A 5K93A 5CEZD 5CCKH 5IWLA 3U4EB 4HZ6A 5I74C 4PRNA 2E7HA 3D3VE 1T22A 1NC2B 5CCKL 4W85A 4EIZC 3QO1A 2EO9A 1QI4A 1GW1A 3SPVA 3QQ4B 2QLVB 1ZOXA 5MHSE 2BNRB 3N1QC 3DTXA 1KLGB 3PDOB 1LO0H 4U6HB 1OT2A 3UPCA 5C6WH 3O11A 1LO0L 3DV4A 3VRLF 4PJDB 3KYKL 4X7DC 1MVUA 1YPZF 3ARFB 2OTWA 4BQ5A 4E42B 4K2UH 2IWGA 1HK6A 1W3LA 4FFWC 3V52L 4P2QE 3UROR 4N0RA 2F19H 2GSGB 1E6OL 3P4NB 4WEMB 4CVZB 4K2UL 5F9WC 4CJ1A 1OSEA 2XXMB 2ID5A 2AV1A 1YEEL 3MRPA 2ZOXA 3W9DA 3UG3A 2F19L 4TUJB 3H3BC 4I18A 2J4GA 3MC0A 3MRRA 3RBGA 4U7MA 3G5ZB 4WFED 5E8DH 4BK4A 2ZOKA 2YKLL 5E8OA 2GTZA 1MXGA 2C3XA 3QP3A 2NT0A 3ARDD 1KPRB 4MAYC 3ZL4L 4Y16C 3MBEA 4YHPB 1EQPA 1R3LB 5DYOA 5BVJB 4NFCA 5I78A 3IFPB 1TA3A 3ZOAA 2X4SA 2W9EH 2PYFB 4CW1B 4WI4A 5EBMB 4CVXB 4ZUWB 1PYWA 4XRCA 4ZFFB 3MSGA 3VA6A 2W9EL 2IH1B 3MPCA 4JM2C 4YHOH 5LQBH 5DD3H 4YHOL 4JHWL 4YBLB 5C0DA 1UZ8B 4CBPA 4AIUA 3EDDA 3SDCB 5LQBL 1BYBA 1QFWI 5DD3L 4L4TA 2YDSA 4ACYA 4OF5A 4JLRA 2CDGA 4DKAA 2NXZC 1TTFA 3S3SA 3MBXH 1MREH 2D03H 1I1AA 2OYKA 4DWSA 3BI9X 5HXMA 3F7VA 2VZOA 4MCZB 3TO4C 5IFJA 3WUFA 4F7PB 3MBXL 2D03L 4HJGA 3K8KA 3RIAF 3AB0C 3L3DB 1B0IA 4HUWB 3ZHLA 1HHKB 5DRXA 2OYMA 3G08A 3SN6N 2A83B 3OKMB 5J4MA 3FKUS 1A1MB 1DHKA 5KSBE 3EFFB 2IMNA 1OD8A 5HHNB 1E0VA 4KFZC 3TC9A 5M03A 1CLXA 1U30A 3L4XA 2IH3B 1NM9A 1HKKA 4ZS6D 4KKAD 5BV7C 4WJXA 2V7HB 3F7RA 2OK0H 5TDPB 5DMGC 5DJAA 1D5IH 3U7BA 1AMYA 1MFAH 3BPOB 1EQCA 4PRHE 4AEHH 5F7HA 3KPRE 4H2CA 3CSYB 2BVYA 1MFAL 1LO4L 3MLWL 3R4DA 4AEHL 3HZKA 1V0KA 3DXAD 4CCDA 2K7PA 4PB0H 3MV8D 1SJXA 3SCUA 5EU6A 5IBTH 4MAZA 3HAEG 3E8UH 3HCVB 1P84K 4PB0L 1NPUA 4P5TB 5KVGH 5IBTL 3E8UL 1A64A 5HHOE 1HQ4A 1CVSC 1HX0A 4RFNC 1KGCD 1RZKC 5GGUB 5J8OA 3KWWB 2F53D 1YNTA 2EECA 4KI1A 3QUZC 4P46B 3L7FA 1I4FB 4NO0D 4OLZH 4I3GA 1LVEA 2Z4QA 2UY3A 1R8LA 2J7FA 2KBGA 1G0CA 4OLZL 1CD1B 5FUCC 1JN6B 5DEFB 1UD6A 3WEZA 2O9OA 3WQ4A 4XCNA 2NNAB 3ZQ9A 3HZMA 2CO6B 4YDJB 1ETZA 4LNRB 5FHAL 1G6RB 1ZBCA 4PJEA 4OCRH 2DDXA 2ZIDA 1RUQH 4O2EA 5L6YL 2IADB 2PO6A 4WTWA 2AJVH 3CMGA 3P0YL 3W25A 2XVKA 4OCRL 4HK0B 1IRAY 3VFTA 1RUQL 3QISA 4HKXB 4JQIH 4PJHB 2AJVL 1MVYA 1BZ7A 5IFPA 1XAUA 4PLKC 2NT1A 1F5WA 1AGCA 2V5DA 2EDDA 3LKNA 3TBSB 4DUXA 3GHBH 2ICWJ 1WLHA 1A47A 5EOCJ 3LV3A 3D39A 4HWBA 3GHBL 3EYPA 4NN5C 5IMKA 1G7QA 2C3GA 5T3ZH 3WJJA 1BPVA 4WUUE 1HZHH 3QRFM 3L5JA 1HEZA 1NH6A 2MOVA 5T3XD 1BFOB 1QVOB 5T3ZL 5T1KB 4LVNC 4R2GB 1QBAA 4BFIB 4S0SD 1AE6H 3I02A 4U7SA 3W26A 3CLFH 2E6QA 5FM5M 1E4JA 3V4PH 3CLFL 1FE8H 3QDAA 5ADPH 2R4SH 4LHUB 5IMMB 1OGBA 3ARGC 1D5BA 2AK4E 1TR1A 1QD0A 1C90A 3N18A 1FE8L 2IPKA 2B1AH 3VNYA 4QWWC 5ADPL 2R4SL 3GB7A 3U5UA 3H9HB 2B1AL 1WDSA 5D7JA 1H49A 3LVEA 4Y88A 4LARH 4Y4KD 2F8VA 4K3DL 4B7IA 5I6XC 4F9LC 1SEBA 4KDTA 3WSQH 3DGCR 4XBPB 3FT2B 4MA1B 2UZYB 3HUJE 3NCYS 2EDEA 3O3BB 5DJYA 3X11B 3TO2B 3TYFB 5F7MC 3WSQL 4EIGB 5M95B 4OCWL 4W86A 1ZS8B 4JFEA 1AD0A 2C3VB 3KZSA 1MRDH 4BSJA 4N5UA 3GBMH 1R87A 5DRWA 3ARDB 3PWJB 4KTYA 5HHPA 4XNZB 1Z9SA 3MNZA 1MRDL 4KRPD 3GBML 5FUCE 2WMHA 3Q6GH 2UWFA 4NO5B 5D7KD 3Q6GL 4Y4HC 4ZNEE 4LEOB 1I9JH 5C8BB 2DS4A 2MSPA 4OGYH 4PJXF 4AEEA 4C83A 4E5XA 4RGMC 2YSSB 3P4MA 3O2VH 4OGYL 2DBJA 3MQIA 1WK0A 4P0DA 1W9BM 1HHHB 1ZT7B 3TN0C 3O2VL 3EYVA 5I71B 5FHBH 4I4WB 1WCBA 4OAWB 1QP1A 4LAJH 4XNYH 5D2NC 3SDAC 3CHCA 3RIKA 1E71M 1MWAH 2J77A 5FHBL 4Y2DA 4XNYL 4YDKL 1N2RB 5I1JH 3S2CA 1MWAL 5SX4I 2ZE0A 1N3NB 3GBDA 1UH2A 1XZ0A 3NGBB 5C0AA 3MUHL 3QA3A 4LHJB 4X6CA 2YWZA 2RGSA 2VLRA 3CZLA 4PRAA 5I79A 4OZIB 4MMXC 3FT4B 3MNVB 3RQ3A 4DCQB 4X4ME 4XVSH 4LVHC 3WDJA 1PG7X 2PKDA 2E7CA 4JO2H 5J9PB 4KY1H 4LMQE 1TZIA 3UZVB 1J0JA 1ZVHA 1ISXA 4G5ZL 1KUMA 4OKVB 4AQOA 4KQ4H 4BUHA 4AMKL 2ARJB 4MJ6B 1MW1A 5BWFA 4WTZA 2KH2B 1JHTB 3CVHH 2OWCA 3RU8L 3PIQA 4GKSA 4X7SH 1UKTA 4FTVE 3UBXA 3L3HA 3CVHL 3VXSB 1JGDA 4X7SL 3KPLA 1T80A 5DT1H 1DQLH 1MI5E 5ID0B 2JCCF 3ULUD 4P5MA 2BNQE 3MV8B 4ORGB 4IOSD 2VLJD 4YHKH 5DT1L 5GHWH 2OMNA 5CZXD 1L0PA 3V6OA 2EEXA 3KPSD 4WSKA 4DKFH 4PJ8B 4M1RA 2ICWA 2OWXA 2PNDA 4JREB 3CUFA 1OSZA 5GHWL 3T0EA 3GSRA 4FQJH 5DUPH 4DKFL 4IHOA 3SJVD 3ALXA 3U6RB 5IMLA 4V2CB 2O5XH 4N1CA 4NI3A 4JO3H 5DUPL 2GTWA 3GDBA 4P2RA 1ZT1B 2XYCA 3UESA 2P8LB 4KI5D 2O5XL 4D71A 5JOFA 1Q9LA 2VX6A 2JCCB 4JO3L 4YXHH 1YUHB 5HY9A 2F53B 5A2CA 1Q38A 3QBTB 3CXHK 3RWIA 4YXHL 2YD2A 1E0XA 2VC9A 1UWXK 1K8DB 4KRTA 1HH9B 4FQ1H 5E6ID 3IJYB 3HKFA 3VCLA 4PV8A 4W4OC 3MV7A 4HW6A 1S9YA 5D2NE 4WO4D 5EO1B 1K5NA 4E41B 1IARB 3ULVD 2CK0L 1IVLA 1DUYB 3RVTD 1XGTB 2A77H 3G9AB 2H6PA 4ZFMA 5H35A 1R7OA 1S7TA 2IXUA 1UVQA 2UY4A 2ZX9A 3BMVA 3PL6C 4BA8A 2A77L 2ZUQC 2XGIA 1FAKT 2VN4A 5EU5B 1NEZA 3MV9A 4Z77B 2EEDA 2CK2A 1IC7H 3WN5B 1KXVA 3LKQB 4Z7NE 3N17A 2EPMX 3L95A 4LQFH 4WHYG 4QGTA 1IC7L 5CILH 2EYRA 5CQ1A 3ORJA 3CUIA 1NWSA 1DBJH 1UXWB 4JKWA 5CILL 2R1YA 3GSOB 1HVQA 4IOIA 1DBJL 5D7LE 3EJYD 5I17A 4JIEA 3NTCL 2VRJA 3ZKND 5DRZA 5I1LB 1ZHKB 1M71B 4F58H 2O61A 3BKCH 5ICXB 3RAJH 1HCFX 3BPLB 4PJCF 4FQQA 3SURA 1MQQA 4IUGA 3S98A 4F58L 4FQIL 5E2UH 1NGPH 3B3IB 5JW4N 2NLJB 2X5PA 2G4FA 3RAJL 3T77B 4MJ4A 4JFFA 1GJWA 4PJ7E 1NGPL 2J8UF 5E2UL 3O9WB 3C60C 4KKBD 1E4XI 2XV6B 5C3LD 2G8ZA 2BK8A 5I8EB 3VXME 2E9WA 4QRUB 1KPUB 3T0XA 3UCRA 2X6MA 3EYOB 4RIRA 4HIEB 3MRKA 3QIUA 3LD8B 3IDGA 2HMID 1EH9A 3T8XB 5L8KB 3B2VH 4NC1E 4PJCB 4WV1C 2HT4C 3PQYB 3V5DA 1YN7B 3B2VL 3FOMB 1AY1H 1L9NA 1F8TL 1G7HA 5MP6H 5F88A 4EDXB 1RUML 3A4XA 4PJFE 2R69L 1E5JA 1SYVA 2J8UB 2XKUA 4OLYL 1FFNB 4MNGE 1AY1L 5MP6L 5A2LH 1ADQH 3KLHC 4E2OA 3OJVC 4ZMAT 4FQXC 4UINH 1GGCH 3LQAH 2ITDA 3PUCA 3MLTA 3N1FC 3QUMB 4KK6C 4ODTH 2I07A 2WV3A 2B0SH 4UINL 5HDBE 3CZ8A 3NDZA 1DEEA 1JYVA 3L4TA 1GGCL 4Y19D 2K9UA 3LQAL 5J1TC 5D2LF 4ENED 4ODTL 4F8TA 1DE4B 1A9EB 4R0LA 1R3KA 2MKLC 3TNMA 3WIIL 3EOTH 4U5KA 1Q0XH 3O81A 3CFJA 4TUKH 5DQDH 5F8RC 4MXQC 1LEGA 3W27A 2ILLA 1IAKB 4BQ4A 1EEQA 3EOTL 3PWVA 4AISA 4TUKL 5DQDL 2X70B 1E6JH 4QCEA 3Q6FB 2BVTA 5D2LB 4Y1AE 3WNNA 5B39G 1AO7E 2Y4SA 2Q6WA 3PHOB 1E6JL 5EA0H 3GIZL 2FO1A 5ECJE 5IKCB 1UG9A 5FGBC 1HI6A 1T4KB 1PIFA 5EA0L 3RWEA 1NWRA 3WNPA 3U4EA 3GNPA 5J06A 1OT1A 4YN5A 3MZGB 2J12B 2NZ9D 3OKKB 3REWB 1CICC 1UADC 3L5WB 5BXPA 2AEWA 1EGJH 1ONQA 4WCYH 1LL7A 4X7CC 2XVNA 4OFIA 1QLFA 4MNHA 5IB5B 1EGJL 4WCYL 2WP3T 4LLDB 4WI7A 4XVTL 4U3CA 3F5LA 4PJDA 4FF5A 4YXKH 4JRXD 3I6LD 3RTQD 3ARFA 3VMNA 1S9KC 4YXKL 1PDKA 4O00A 4DGYH 1UJ3A 3P4NA 2GSGA 4MA8H 3QHOA 1ZA6B 4H1LB 3BDBA 1GVYA 1V6XA 3KPPB 1WP6A 4MA8L 5ABHA 3TYGH 4CUCA 1A7OH 1HJSA 3G5ZA 5J7CC 1CEOA 1EOKA 4GMSH 2XVLA 1YEJL 1KPRA 2VLLB 4PIRF 3TYGL 1A7OL 4L8SB 4MAYD 5JO5B 4GMSL 1UT9A 5C09D 1I85A 5FECB 2ZUVA 5AG8A 1JNDA 3SJVB 5DS8B 2BRQA 3IFPA 2C5DC 3V2AR 3PP3H 5GS2D 3BZFB 3PWPE 4CVXA 1VESA 2IQ9L 4IRSD 2AQ2A 2OL3B 3SCMB 1QHPA 4QRPD 3IU4H 3TJHC 3SKOA 4QTHA 2OI9B 2CKNA 5HD8D 4K07A 3SDCA 4X98A 5SWZE 5I75B 5E6IB 1LLOA 2WMFA 3W0WE 3CCHB 3VXUB 2WWKO 3EO0B 3GTNA 5HPCA 4JFTA 4EI5C 4WO4B 4G8FB 3V7MA 5DJ0B 1XCWA 4F7PA 3BKJH 1QBML 4BQBA 2V2WB 5D7SH 2COQA 4YHMH 5DVMA 3KVQA 1HHKA 3VFOA 5TQ2H 1DQMH 4CN6A 5D7SL 1A1MA 5ISZD 5EBGA 4ZS7L 4YHML 3EFFA 5TQ2L 1JD7A 1BG9A 5ERWB 1IKFH 1DQML 4PBGA 4OZFB 4Z0BH 5IQ9B 5LA2A 4WFFE 1IKFL 1MLBB 1QZ1A 3OIHA 4B3LA 4QXUH 3QNZB 2VKXA 1KBGH 1MUJB 1MHHB 2V7HA 4EQ3A 3G6JE 3D3VB 3B5GA 4QXUL 3AICA 1KBGL 3IK2A 2ESCA 3WIFB 2VDPH 3CSYA 1T89C 1CZ1A 3KLAA 2VDPL 1DR9A 4Y5YC 4NZCA 1SFSA 4PJAE 3T0BA 4F33A 4ACZA 1FAIH 4EKXA 3HCVA 4IMLB 4LXFA 3AREB 4HHAB 3O2DA 2HT3C 3SDDD 4G7YH 1J8HA 1OSPH 1FAIL 4AXNA 4NM8H 4V1DD 2ATPB 3QDJE 4PJBA 2V7NA 4P2QB 3TZVA 3W6LA 1FLRL 4K9EH 12E8H 4RZCA 1T0MB 2H45A 3UYRL 5GGUA 3KWWA 2PYEE 5CEZE 1QNRA 1HHGB 4K9EL 2YPKA 2VQTA 12E8L 5HYJA 4YWGH 2VIRB 2W9DH 3ZE2E 4LGSB 4MNLA 4Y2OA 5GSRA 1EO5A 2YDRA 1MCKA 4YWGL 4QNPF 3PDGA 4AD2A 3OF6A 3PGDB 4LP5A 4ACPA 4LYRA 3RVUC 1EO7A 3LQMA 4LSVH 1JN6A 3PZUA 5DK3A 5J56B 1AGEA 3BD3A 4N68A 2I9TA 3WD0A 3CSBA 4LSVL 4YDJA 3U46A 4OM0H 2I25N 4XHJC 3ALPA 4LNRA 2DWEA 3BZDA 1MCFA 3L3KB 4OM0L 5JPMA 5I8KL 2IXVA 5IXEA 3P2TA 2IADA 3ZHKA 2C4FU 4JJ5A 2CIIB 1RUKH 1QOXA 1KB5B 4HK0A 1G7MB 2NY6C 5MEQB 4RAVA 4HKXA 1JPGB 4PJHA 3FQNB 3T0WA 2NY3D 1LO5A 3RFZC 1ZK9A 4UBDD 3O4LB 3TH2T 1V08A 3BN9C 5A8NA 2YD9A 4UU9B 1O0VA 3EYFB 1QHZA 5F6HI 3B83A 3O8XB 1BFOA 2X4QA 2ESVE 4FQLH 4MLIA 4L5FH 3EDEA 5I74B 2P49B 4BFIA 5JMRA 3ULSA 4NC0B 1SJVA 2DLEA 1FL3B 4HKZA 3ARZA 4FQLL 3NJ3A 4L5FL 3TH4T 1HT6A 3TGXA 4OF3A 3GI8H 1T04B 3OAUH 4LPTA 3N15A 4P2OD 3IU3A 3S5LG 2DQIL 4UOQA 1XR9B 4IRZH 4FABL 3OAUL 4LHUA 5IMMA 1P5VA 1ZB5A 1QRKA 4IRZL 4JCMA 3RL1A 5I16A 4PRHB 3R0NA 4MLSA 1MNUH 3AY4A 6TAAA 3A3HA 4M1CD 4OFYA 1KELH 4OT1H 4QCIB 5DZLA 2HVMA 1MNUL 5E95B 4Z5RB 3MYJB 4WW2F 4WVRA 3CPLA 3EW3B 4JQVA 1KELL 4OT1L 4XBPA 5F9WB 1JRHH 1DLHA 1WTGT 3M7SA 1JCKA 4H26A 4GG6A 4P57B 2Y6SC 2C3VA 3AXLA 3MU7A 3QDMB 4WK9A 4PCTA 3RWHA 1UR8A 1X5HA 3GO1H 5KANI 1FVCA 4MAYB 2ZWZA 4Y16B 2CESA 3BSZH 4JDZB 2JB6B 3S96A 5E00A 1OP3K 2B39A 2JJUA 5LVEA 2DQTH 5BRZD 3BSZL 4LEOA 1S7QA 3I9GH 1NCBH 5DF0A 4EKJA 4JM2B 3I9GL 1E4KC 1PKQE 1NCBL 1ZXQA 4LCYA 4LSTH 2A74B 3T2NH 3DROB 4M5YH 4S1QH 3QWRA 1R5IB 2F54D 1GAFH 1AHWC 1QI0A 1N2RA 3L5IA 4M5YL 4S1QL 5CSZB 5AC5A 2NXZB 3PP4L 1GAFL 2YBUA 1IEAB 4S2SA 4WI5A 4ODVH 1KGCE 3TO4B 5ENWA 3BXNB 5FM8A 1AIFA 3AB0B 2QV2A 2Q8XA 5DXWA 4GQPH 2XIDA 4OZIA 4LEXL 5ISZB 4DCQA 1JNHB 1XF4B 4WTXA 4MDOA 3HC4H 5J9PA 5DQJA 1RP8A 3V6FB 1CDUA 3HC4L 4OSUH 1W2KT 4XPHL 5BV7B 1OAZL 3SCVA 3JZ7A 1EX0A 1MF2L 4OSUL 3MRHA 4PBWD 2CHOA 3OAZK 1JHTA 1KB9J 2AJYH 3RWJA 5I1IH 2QMJA 4TNWF 3BJ91 5GQBA 2L0DA 4HWNA 2AJYL 5I1IL 3CXDH 5E2JA 4W8BA 2VXQH 1G9EA 2BNUA 2HJKB 4LYQA 5ID0A 3MUAA 2D3VA 4K94C 3CXDL 4ORGA 3N1AA 2VXQL 3QI9D 4HGWA 1ISZA 4LFHG 1RURH 1DVFC 3KYOA 4PJ8A 3OLGA 3SDYL 3QUYD 2VT0A 3I2CH 1JWUA 1R5WB 1IQWH 2ZCLH 1RURL 5DJ6B 2DYPD 4UTAH 2DI8A 4XC3L 3I2CL 3V6BR 1IQWL 1BX2B 2ZCLL 4JPVH 2OWWA 2F74B 1ZT1A 4K23L 4GRWE 1G7IA 4RFNB 1XGQA 3ZLQC 4N9GB 1US3A 4JPVL 5CKAA 5T3XE 4RGND 2VLME 3QUZB 2P8MA 3BZEB 2YHGA 3VUPA 2VE6A 3KR3H 1IM9B 3ROOA 3D25A 4TSAH 4MA3A 3V6ZA 3KR3L 5BRQA 1HVXA 4NN7C 2XNAB 3IJYA 4M43H 2EDFA 3CO4A 4TSAL 4XBEH 2G9HB 4JRYD 3T4YA 5MEOB 1V02A 4MAVA 1HHJB 1L9MA 1U8PB 4M43L 4OCSH 5DD0H 5HYFA 5EO1A 2JJSC 4XPFL 4FMKA 1M03A 4XBEL 1R3IH 1EVTC 4OCSL 5DD0L 4HJ0C 4HS3A 5CFHA 1R3IL 3RGVD 2VZSA 3BGFC 3TBTB 1JK8A 3EGSA 3QG7H 3D0VA 4ZTPL 3NCJL 4RGOH 4S0TD 3HN3A 1I7TB 1GHSA 4Z77A 3TT3H 3ALFA 3WN5A 2W65B 3I50H 4RGOL 2DQUH 4DGIH 5C8JB 2WVTA 5C08A 3TT3L 4A6YH 1YJDC 4HG4K 4DGIL 2DQUL 3KXFD 2GJ6E 3UR7A 3VIJA 1UXWA 4A6YL 4NN5B 4LU5H 1ERNA 4NQSB 1BYCA 4C7DA 4ATLA 4LU5L 5JPNB 1BF8A 1NGYB 4P23D 2BSED 1QFHA 4LVNB 4GUPB 5E9DD 4WWKA 5I1LA 3QFDB 1ODUA 3WO3B 3WIHA 4N0CD 4GRLC 4YAQB 1WVZA 3W2DL 3SBWC 3HFMH 3OJDA 5FEBA 3O6FC 3AJ7A 4PGBA 1KFAL 1NDGB 2P43B 5D1ZA 3HFML 2XRAH 2X4UA 2GJZA 3EHBC 5GS0H 4HPGA 1KIRA 1BOYA 3ARGB 1MCWW 3CHFA 2XRAL 2XPGB 2NTFA 2FX8H 4QRUA 5E7FA 5GS0L 3GSXB 3EYOA 1MHCB 5E8PB 3S4SA 1NFIA 3SGDI 2OLDA 2FX8L 2X1XR 4Z7OE 3D69B 2ZXQA 1RJYA 5I6XB 1QFUH 1LK2A 5KZCB 3PQYA 2BNQB 3C9NB 2N7BA 1C08B 1EO8L 1MCSA 2YA2A 4LIQH 4ZAKC 3CFBA 2ENYA 3NCCB 4LIQL 4CGTA 4NZDA 1JF1A 2GCYB 4TNVF 5JXEC 2QQKH 1SJEA 4L4VE 4FQXD 2IPUG 4PTWA 4F57L 3VGAC 43C9A 2G3NA 3QXDB 5GISL 2HKHL 2QQKL 3SGEI 2MJWA 2DL9A 5JW3L 4I0CC 1AKJA 1UWRA 1TVPA 1N26A 2AEPH 2FHFA 4MD0A 4F9PC 3S37X 1A9EA 3FB5B 2CUMA 3OLIA 1AJ7H 3FW6A 2F2HA 1FIGH 2XICA 2AEPL 1ZLUH 3UXFA 4Y4HB 4F3FB 1A1NB 3FFDB 1F4HA 1FIGL 4MXQD 4G8GB 3F6LA 4PCSA 4Y5XC 1T21B 4RGMB 3MFFB 1UWGH 4W93A 4QXTA 3NACH 2ZOLB 3ULUE 4C58B 5IESH 1UWGL 3Q6FA 3TN0B 2NY5H 1ZV5A 5D2NB 3SDAB 3KPSE 5A8MA 4BQ2A 5TQ0H 3PHOA 2FLBT 5IESL 2HLAA 3K8MA 2NY5L 3GM0A 5IKCA 2O26U 3DMMD 3C5JB 1C8XA 1CK0L 1WE5A 3H2WA 1UM5L 4OCYH 3DO7B 4JPWH 3QQ9C 1TNNA 3QPXH 2VB5A 4XP9H 5D70H 1UB6B 5B21A 4KI5E 3BQUD 4OCYL 3QNYB 3JXAA 4JPWL 3QPXL 3WUEA 4YUEL 5D70L 1C5DB 1CICD 1IQDB 1KXQE 3L5WA 4C57C 1JFQH 4Q6YA 3LEVH 3BH9A 3NIDF 1U8IA 4LVHB 4PBXA 1BAGA 3LEVL 2PR4L 3STLB 4MS8C 2YL9A 4H8WH 5FYKD 1BJ8A 4JFQA 2KQNA 3Q5OA 4ZFGH 2BFVH 3ULVE 1CVRA 2F58H 5EIQA 4NDMA 1L0XA 1RZFL 5GGQH 4KZDH 1MEXL 1ZA6A 3LEYH 4ZFGL 2BFVL 2XFRA 3RDKA 1OGAE 1G6RH 3KPPA 5GGQL 2C1OA 4KZDL 3TCXA 5BOPA 2JIXD 5FF6A 4GBXD 5GS3A 1G6RL 4GXVL 1KQYA 5F7DB 2VLLA 3VXMB 1RP9A 4L8SA 5JO5A 1PIGA 2HFGL 1B0WA 1LF1A 4WWID 5FECA 5EIIB 4R3SB 1OW0C 1NEZG 2VH5H 4I3RL 4M1DL 3T1FB 4DK6A 3TWCH 2VH5L 3PG2A 3BZFA 4KKLC 1I1YA 1YHTA 4XCFL 2RR3A 4PREA 3S36H 4R9HA 4X5WA 1N82A 2UY7A 4NZTH 3TWCL 5HBBA 3SCMA 3S36L 2WWMC 4NZTL 3O6LH 2IALB 4CAGA 2OJEA 4OZOA 5CEZL 5AEAA 4MNQA 3O6LL 4JM4H 3GMNB 4I0PD 4HUMB 1G0XA 3BKYH 4Z2JA 3VXUA 3EO0A 4QRRA 2NR6C 5AYUH 4PN2A 3PHAA 4PRPA 4D6DA 3BKYL 4F80A 4G8FA 3K2MC 1NMCC 2A3CA 5AYUL 1NCNA 3RVVD 1FFPA 3SUUA 4PJIF 2D31B 2V2WA 3DOSA 3EZJB 3PL6B 5KAQF 1KTLB 2ZUQB 1LP9E 2VDLH 3VWJC 3VU2A 4J4PC 1B2WH 2PW2A 4M56A 1AO7B 4MJID 2VDLL 5IQ9A 1B2WL 3P30H 1A9BB 1MLBA 1V7NL 1KGUA 5HI4D 1I7ZB 4OZGF 3KXFB 1BVKB 4PJIB 3QNZA 1H3PH 1HJUA 1MHHA 3JWDC 4BQ3A 3D3VA 2AXFB 4B41A 3DETD 4CN4A 1QFOA 5E99H 3UYPA 4RQQB 2A6IA 4RMWA 4UFIA 4KUCD 3VIKA 1JWMB 4ZOEA 4YGAB 5FCUH 1W0VB 3IANA 1W91A 4IEFB 5IW6B 5EPMA 2G2RB 3ZYIA 5C9KA 2H32B 2H26B 4OZGB 1H3UA 2X89A 4HHAA 1BWMA 1XSIA 5B4MC 2P4AB 1E4IA 2HT3D 4KJPC 4KVCL 2ATPA 3C60B 4P2QA 1U8MB 3DRTB 5E94A 1F3DH 1OBAA 1N8ZB 1H8SA 1RZ8B 2FECL 4D1JA 5DTFB 4D2NA 1T0MA 4TSCL 3FT3A 4ELKA 5HHVL 3RVXC 3WENA 1KCUH 4QP0A 3LPWA 3GK8L 4WV1B 1YYMH 2XQYG 4MADA 4R4BA 3QEQB 1D9KC 1KCUL 4KK9D 1YYML 4O9HH 2DAVA 3ZT6A 4HAFA 5IOPB 1BQUA 1AGFB 1KXHA 4D8PB 4O9HL 4X9FA 1LNUB 4FQXB 2Z35A 4LDLB 4R96B 3PWPB 3V5KB 1WDRA 5IVXE 3I6LE 5HHQB 3WMCA 4U1JA 4S11A 2WUCL 1G7MA 3SDXE 1NAMH 2NY6D 1JPGA 4U49A 1CE6A 3IJSB 4FP8L 1F4XH 1CBGA 2DSWA 5L9DL 2XVGA 1NAML 5HGGS 3DI2B 4PYHA 1CI5A 4M7KH 2LAGB 4JQXC 1BP3B 3C08H 4OF0A 3W0WB 4B9YA 1KCSH 4KC3B 3RNKA 4M7KL 1XGZA 4DN3L 3WHXB 5J1SC 1HYSC 2C1PA 4O02H 5GS1A 1EGZA 3BSHA 1KCSL 4XTRD 5EUKA 4UU9A 5E70A 1H3TA 3DX9B 4NCC2 1FV1B 3ECBB 4O02L 3JUGA 1GZQA 5HVGB 1FL5B 2Q3ZA 3S7GA 2OTUB 4GKLA 4M93C 3JWOC 1QSEE 4RFEA 4HUUB 5KSBA 1LEIB 1SYSB 4ODXB 4R97C 4LRNH 1K9FA 2HJLB 3DC0A 3HHRB 4FG6D 3OGRA 1RHHB 1DQQB 1T04A 1Y6KR 2FJFB 3BISA 5CJ8A 4HULB 3S34H 2EDQA 4LRNL 4EI6B 5JIHA 2X9YA 3S34L 4BF7A 1RFDL 4YFEA 1CXFA 3EJJX 3Q5YA 1XF2B 2EC8A 4L9LA 3BYYA 4PRHA 3SCPA 1UKSA 2DKSA 4H25B 2EIZB 3ALWA 3KPRA 3G5YB 4GG8B 3T0VA 4X4XB 3JSSA 4QCIA 1XF5B 4OM1H 4G6KH 4R4FH 4Z5RA 2WPGA 3HMXA 2QPUA 4OM1L 3P40A 4R4FL 4D0BB 4QF1A 4AK1A 4IRJC 2HFTA 4Q9QH 1T6VN 5HHOA 4Q9QL 1QI3A 3QDJB 4JY5H 5T5NF 1RUPH 4JY5L 4F7MB 3R1GH 2WINA 2DQXA 1C91A 1RUPL 4BZYA 3W38A 4YQXL 3OKNB 3R1GL 4NRXB 1WFNA 2J2ZA 4HA4A 1FNLA 4AIEA 1XGUB 2FIKA 4ZO8A 2ICEB 5IEHB 4CNIB 2VXVH 2AJ3B 4JM2A 4LLYB 4NNXA 3LQZB 1V05A 1EDQA 4PRWA 4JFXB 5T3XH 5E5RB 4NCDA 2VXVL 2YS4A 1WFUA 5DO2D 2VABA 5T3XL 2X4RA 1UFUA 1W72B 3E6HB 1JBJA 1B30A 1BBJB 3PWNA 1XF3B 2D7TH 1FH5L 4Z0XA 4D0DA 4EI5B 4OBSA 1F4AA 1FC1A 1PG7H 4FN0A 2HFFB 1KQZA 2D7TL 3C5SA 4NUJB 5CMAB 2DT3A 3VG0L 2HFEB 3BXNA 1PG7L 3PV6A 5FCSH 3C6LD 3NSMA 1JPFA 1JNHA 3MMUA 1T83A 2W0LA 3N9KA 5TPWH 3U7YH 4KRUA 3CIQA 4KUCF 3VRJB 2QQLH 3KPMB 1PGRB 2CR6A 3LB6C 4P2CG 3V6FA 2XPKA 5TPWL 3U7YL 4WUUA 3QXUA 2QQLL 2YA0A 4U1HB 5F3HA 1V5JA 1UC6A 4DN4H 3UPRB 3O0RH 2CYGA 2LTQC 1S8DB 1MIEH 4DN4L 3QUMH 3RIFF 3O0RL 1YC7A 3N50A 2Q87A 3QUML 4HIIA 5IF0A 3PABB 5DSCA 3O3EB 1FO0B 2Y2WA 2W91A 1ZSDB 4ETYA 4Y5YB 3FNDA 2V3DA 4L4PA 3S35H 1GPOH 3LKOA 4JR9H 4U1GC 5F71A 1Y0LB 1DVFD 1UWEL 1YMMD 1W8NA 3CGTA 4UOW0 1LJYA 4YZFF 1R5WA 2A38A 3S35L 1DWAM 4JG1L 4JR9L 4P9HH 4KZEL 2IAMC 3EJZC 3GH5A 3BEVB 1BX2A 1GQJA 4P9HL 2F74A 3HUJA 2DM3A 1G0YR 1NGQH 1C5BH 1TNMA 4Q6IC 4LCUB 1FZJA 2VISB 1NGQL 1C5BL 1X9QA 2Y72A 2IUZA 2EDOA 2QQNH 4X6EB 3MLZL 2R56H 3HPJB 5DRNB 4HK3J 4AWEA 1MLCB 2QQNL 3FO9B 2M1KA 2FJGB 2V9TA 3RJDA 2R56L 1AXTH 1CFSB 1HHJA 2C4XA 1U8PA 2DF3A 4QLRA 4EEEA 4ZNEA 4UB0L 3H3KA 1AXTL 4JZJC 5EFDA 4MXVF 3OR7B 3IRPX 3SE9H 1T6WA 1PKQB 3QFJB 1QO3A 1H15A 2PUQT 1WISA 2NY6B 4GLRH 3SE9L 3IAQA 4N8PA 5JZ7C 3LOWA 2X05A 1CR9L 4PJ9A 4YPGA 1FGNH 4H1LH 4UQEA 3L1OH 5C8JA 3VXRE 2QKIB 5A3IC 2X7LB 3QEHA 5D5ME 1V6VA 3L1OL 1REIA 4UNIA 1Z2KA 1RH9A 4PY8J 5JHDD 3KPQB 1JZ7A 4YHNB 4KJQC 3GMRA 4DTGL 4GI6A 3LPFA 4OLWL 4POYA 5AG9A 4L8BA 3UTSD 3ULUL 2VZ1A 3I6GB 3AIBA 1NGYA 4OZ4B 4G80B 5KOVC 1MELA 2HP4A 3BP6B 4HC1H 3IT8D 5BRZE 1W9VA 2QV4A 2P8PB 4X4MA 5EBWB 2W62A 1BIIB 4HV8A 3REVA 1AQDA 2UWEF 4JZ5A 4A4AA 2WMIA 1YEKH 4LKCB 4U2YA 1QBLH 2WAHA 4RMVA 1NDGA 2OL3H 1YEKL 5EO9A 2QSTA 1QBLL 3EHBD 1YQVL 3AFLA 3ARGA 1CFNA 2YUXA 2F54E 4LCIL 2IPUK 2XPGA 3T04D 4FTVA 4L4OA 2DJUA 3IDIA 1MHCA 5E8PA 4GZIA 1J05B 4KDWA 4ZSOE 1A6TB 2R2BB 4HFWA 2Z93B 5IHBA 1MI5A 5DVKA 3D69A 1CGTA 3AMCA 1VIWA 1W3HA 4F9LA 5JDSB 3VNZA 2BNQA 3NCMA 1C08A 1HXMA 3IKKA 3PDDA 4JHAL 1YEGH 3HC0B 3GGWA 2J25A 5GPRA 3ULVL 4MDIA 4AD1A 1IM3B 2GI7A 4UV7H 4XP6H 4R6UA 3B2UD 1XT5A 2VC2H 1FG2B 2HJFA 3EYQC 1OQXA 2APVA 2ADIB 4PP1D 4UV7L 4XP6L 4OZFH 4XWOD 1U6AH 3DUSB 1VGEL 3WFLA 3FB5A 1NKRA 1C3FA 1U6AL 1J10A 4Y4HA 3VI3E 4U4BA 4XNQA 3FFDA 2ZXBA 2DLTA 3HE6D 5BZDB 1T5XB 2ZOLA 4U6TA 4OF8A 5TGBB 2AS5M 1K4DA 2BX5A 1UXSB 5F89B 5D2NA 3SDAA 1EXUB 4EN3D 3TLRA 1AHWB 1MQPA 1J87A 5ETUB 1J0IA 5IV2B 3LIZH 3HZYB 1OF2B 2KUTA 2AQ1A 4J3TA 3P11H 4P8VA 4TX8A 4DM1A 2F8OA 2QR0B 3LIZL 1VEPA 3QYCA 3A67H 4J3WA 3P11L 3UTOA 2C4FT 4J8RB 4H5SB 4JFYB 2AJXH 5FIEA 4RGNE 1DQDH 3A67L 4RWYH 3MJ9L 3UAJD 3P0GB 2NTSP 1QNZH 2AJXL 1QFWH 4UAOC 1RK1B 3MBEC 5DFVD 4TVCA 3GBEA 1NUDA 4OJFH 5D7LA 4KGJA 2AJSH 1P84J 1XCTA 4JRYE 2WBJA 1IGCL 4OJFL 1DBAH 1X7QB 2AJSL 4LSSH 2IQAA 3RNQA 4NNYB 5HGDB 2X4OB 3UX9B 4LSSL 5C0GB 3CFCL 2W92A 2PTTA 2MHAA 3QUXC 4PJ7A 1KB5H 1X6NA 4CD5A 4Q9BA 3RKPA 4MWFB 4OLVH 3VDCA 5F7DA 3VXMA 2RCSH 1DVFB 1KB5L 4XZWA 5IFHH 5FM4A 2J78A 2R2HA 5A16B 4OLVL 5CP7A 4CU6A 5EIIA 2ICCA 1I1AC 2RCSL 4DWSC 3SIMA 5IFHL 2UZIH 3AVEA 3NH7H 4OIBA 1B0GB 3VXOB 3D87B 1S78D 4UQ2B 5TE7H 2PXYA 2XOTA 3NH7L 4PJFA 4Y0GA 5D7IE 3U83A 4MNGA 1JHKH 4M9PA 2H8PA 4OUOA 5TE7L 1UWTA 5JMOC 3QZWG 5SWSB 1JHKL 5ITBH 1Z0MA 4MCYA 4MB4A 3K80A 4BQCA 1ROWA 1H8NA 3WUZA 5ITBL 1P6WA 4NN7B 1BYAA 1HIMH 1OCWH 3NFSH 4JFDB 3ZDXE 1BJMA 4WGWB 5BXTA 5ICZA 2J79A 3VH8G 3NFSL 4D1IA 4TTUA 4XT1C 3NFPA 4FQCL 1I3RB 4HBCH 2R0ZH 3BESR 3BGFB 4HWUA 4JFHD 1X5JA 4HBCL 2R0ZL 1CTOA 4Y1AA 1AO7A 3S4SG 4JL2A 3IETB 5T1MB 4C56D 2DLHA 4RMTA 5EO0A 1A6ZB 1FL6B 3SE8L 2BCKB 4DM2A 1I7ZA 5K59F 3FZUC 1QSFD 1QSZA 4XH2A 3JTSA 1MAMH 3RWFB 1EIBA 3L7EB 4TUOB 4XNXL 2V38A 4BSWB 1MAML 4JGJA 1IBGH 1XIWA 3LN5B 4Z7QF 3VFWB 4MB5A 5I8OL 1J01A 4DUVA 4QOKE 1IBGL 2ZUYA 3M17A 4M1GH 2DH2A 4RL3A 4YBQC 1FSKC 5F93C 2C7UB 2G2RA 2G60L 4JHBA 1OIMA 5JW5B 4GRLB 1FHDA 4NO3B 5D9OA 3CC5B 1UWQA 4ODUA 4NZUH 3WFEH 3O6FB 3QEUB 1TZHB 1SM3H 2DB8A 4AY1A 4PJGB 1MSPA 5B4MD 1ZWIB 3WFEL 3WFHA 4KJPD 1UGNA 3C87A 3QGVA 2ATKA 1SM3L 2VWEC 3C60A 3OKEB 1QR4A 1U8MA 1MQRA 2PO6C 1N8ZA 3HAEB 1A3LH 3LPOA 5IJVB 4M8VA 1NBZB 4YEEA 3WEOA 3MO4A 3MXWH 2XXCB 1A3LL 4MQXD 4P4KA 3EYUH 4WV1A 1JXJA 3MXWL 3BKMH 1CZ8H 3QEQA 4UNUA 1F6AB 3IKCB 5EOTA 4ZAKB 4ZUUA 3QO0A 3WD4A 4ZOAA 3EYUL 1EDGA 2J4WH 3BKML 1CZ8L 2EZ0C 2VO5A 1KTKE 4ZUVB 3GBNH 1AXSB 4KXZI 4D8PA 2YL8A 2J4WL 5KSAC 3WJJC 3VGAB 2BSTA 1U93B 2GSJA 1JUFA 3PWPA 4EOWH 3HB3C 5B8CA 3U0WH 5HHQA 3L2LA 4HKBB 1NC4D 3DNKA 5IVZB 2C8NA 2I27N 3T4AA 4EOWL 3NSXA 3U0WL 4YR6B 4DZ8B 1BMGA 1H5BA 4ZFOB 5KOMC 1X4XA 1BEYH 5CJQH 3TA3C 1EHLL 2P42B 5SWZA 2CGRH 4Y5XB 3ZHDA 2W4XA 4ZO6A 3W0WA 1BEYL 4O5LH 5CJQL 2NW3A 5E0FA 4WKFA 3MJ8B 2CGRL 4P9MH 3WHXA 1D5XB 4YGVB 3AAZB 3AM8A 3WUWB 3ECBA 2EPOA 2OSLB 5FGBA 5HDOA 2DICA 3OAYK 5C92A 1GXEA 2A3BA 1QW8A 1ZU8A 4HUUA 5C07B 5I6SA 1O7SA 1SYSA 3AIVA 4ODXA 4JVPA 1T1XA 4GW4B 1MCNA 4Y89A 1HJWA 4D6JA 1BF2A 1RZKH 1OGSA 4J3VA 43CAB 1I8MA 3RUGE 4BYHA 1A7RH 3FO1B 4OF6A 1N6QH 5DURD 2P5ED 3G6JA 5AZEH 2V2TA 4FQHB 1A7RL 4ODSH 1YNLH 5SX4H 1A5FH 2UY2A 5F7WC 1E0WA 1K2DA 4H25A 4LLWA 4ODSL 1WWWX 1YNLL 2UUDK 1ZE3C 1A5FL 2EDXA 3BAIA 4X4XA 1XF5A 1NCDL 3F58H 3SE4A 1SVZA 5C0CB 1UZ6F 3ARTA 3OQ3B 4PJAA 1IFHH 5ABDE 2MPAH 4IRJD 3VGBA 3AS1A 5L2KB 1KSRA 4WGVB 3CXHJ 3CU7A 2MPAL 1K4CB 4M7LT 5TH2A 1HDMB 3MJ7B 5CSUA 3QDJA 5SWQB 4I2XE 1T2QH 4POZD 2DQJH 4IOFD 4MX7B 1FNGB 2W0FB 2WCGA 4F7MA 4Y4FD 3LHPL 2KPNA 3HE7D 1T2QL 1BQHA 2DQJL 1YEHH 2ICES 2J88H 2PYEA 4C59B 1FYTD 2J88L 1CG9B 1YEHL 2DPEA 4OLEA 3TIEB 2IANB 1KPVB 1XGUA 2VZTA 5IEHA 4CNIA 2DM2A 3KG5A 1S9WB 25C8H 4JDVA 1I75A 1IL1B 4JHZA 4UNVA 1CTNA 2DOCA 1B6UA 4RBPH 25C8L 1E4LA 4HIHB 4N5ED 3MACH 2HH0H 2DQFB 5IIEB 5IVXB 4R7NA 4M4RA 3ILQD 4PRID 2D0HA 2UYLB 1BBJA 1CLOL 2HH0L 1XF3A 1NANI 1XHGA 3NCBB 5IROC 1PQZB 3CUJA 4ATDA 1NMCB 5CSYA 1QEWA 3CDCA 4NKDB 3LKSA 2CQVA 4LHQB 5CMAA 1X5ZA 2ZXAA 3P9MB 4AQ1B 3MFGB 2AXHA 4XCCH 4MDJB 3V6OC 5DJ2A 2EE6A 3WNOA 3VWJB 1F11B 3VRJA 3VJ6B 4XCCL 3BGMB 4C56B 3CVIH 4P3CH 2VLKD 2VZ3A 2NX5B 1JNEA 1CENA 3B6SB 3CVIL 4P3CL 1JGUL 2HVJB 2P5WE 5F1IB 3SKUD 5C0FA 1PPIA 1C5CH 2ESVA 4PLOB 1QSEB 1TUXA 5BCAA 4XC1H 2W0PA 4NNPH 4HUVB 1C5CL 2Q76B 3PJSB 4WLCA 3FFCD 2WC4A 4J3SA 5DJCB 1HWGB 4NYLB 4TRPH 4OCXH 1T89A 2JK5B 4NJAH 1ZSDA 5A6SA 2MCG1 5KS9E 1CGYA 4TRPL 4Y5YA 5EBLA 4M00A 4OCXL 4CADB 5CEYA 4NJAL 1H41A 1NOWA 1TXKA 1U33A 4S1RH 1Y0LA 3SO5A 1EBPA 1OD0A 5F1NB 4S1RL 5FYLD 1B4JL 5E4EC 4LBEA 5DHVA 3IGAB 5C1MB 3F12B 1B0RB 4D9LH 2VL5B 1U8KB 5JLZA 1E1EA 2QADD 4ZOCA 4XMKH 1ECEA 4D9LL 4V2XA 32C2B 3RWDB 5IB3A 2J3SA 3TCLA 4O51A 1I8KB 4XMKL 2JKXA 1D9KB 2AEIT 4RE2A 1TTGA 1EFXD 3ZMRA 4JANA 5DRNA 3MSPA 3MRFB 4HKJA 3FQRB 4NQEE 3FO9A 2EDWA 1YEDB 1E4XH 5LAXB 4I0KA 3QDHA 3SQBA 5SV3A 3WHE0 3ZE1F 3GEWB 1CFSA 4J28A 1F4YL 1U8NB 4P4RB 3TTOA 1J0KA 1E4XL 5FDYA 3E0GA 5ACLA 2OYLA 4H0GA 1FNHA 1NBVH 2XN9D 5HGHB 1NC4B 1Q94A 3MCLH 4TOYH 4L1DA 2YPLD 3L9RA 4JKPH 4OGZA 1ODZA 2L7JA 1W9UA 1NBVL 1PKQA 4MVBD 4U1SB 3MCLL 4KJWD 2A0LD 2OMBA 4JKPL 4LLAA 5JIKA 5JZ7D 4PMUA 4L3ED 1OVZA 3CDGA 1M05A 4LLMA 3VTRA 1W0WB 4A3YA 2NY2C 3QUKB 2QKIA 2X7LA 5DHYB 1UKQA 1V6UA 5LYRA 4W88A 5DVNA 4X0NA 4DKDC 3C6SA 2X4TB 5EU4B 2PCPB 3H9SB 3QIUC 4Q58C 4X4YB 4HH8A 4KJQD 5TE4H 2X8RA 4OF7A 3LN4B 1JXKA 1KJ2B 1I8IA 3GYCA 4O2CB 5C0BD 5LG1A 5CJBA 1AQHA 5TE4L 3PWUA 1Q9KA 4NO0A 4G80A 5ACMA 4M93B 2P8PA 2X2YA 5EBWA 1PX4A 1BIIA 3VXPA 1OM0A 2A3EA 5J3HD 1NP2A 3QSKB 4R97B 5J6GB 4LKCA 2DD8H 3UBXI 2Z31D 1OB0A 1W3KA 1VBUA 2DD8L 3KJ6H 1INEL 4G8EA 1BG4A 2YPVH 1GOFA 4QCFA 3HG1B 3KJ6L 5F8QC 1UACL 2YPVL 4OV5B 4MDPA 2ICWI 1MFBH 2CIKB 1ZGLA 1J05A 1E6ZA 2YXFA 1X5XA 1UR1A 2YA1A 3K4ZA 5A2BA 3GJFB 1MFBL 4M5ZH 1VJZA 1EEYA 3TVMD 4BFEA 2FBJH 4LSUL 5JDSA 3VFSA 1FYHB 2CUIA 4M5ZL 1RU9H 2FBJL 4HS6A 4IRJB 5GGSB 2HTLC 1WIOA 3NN8A 8A3HA 4MNKA 5HDLA 5BYWA 2CSPA 3S6CA 1JI1A 1VFBA 1E55A 1U3JA 3V95A 3MRJB 4HDIB 1DP0A 2X0YA 1FYTB 1YZZA 1P9MA 3SOBL 1IT9H 1E6XM 3U30C 3AHZA 1CD8A 5BZDA 2YR3A 1IT9L 3VXNB 1LO3L 4F37F 5MEPB 6A3HA 1E4KA 3O3DB 2BXYA 1A22B 2MANA 1OTSD 3VFMB 1KV3A 4KWUA 1EXUA 2EICA 2H32H 1EMTH 2P44B 1LQ0A 3MRMB 1N5AA 4I77H 4PRIB 1OM3H 2A73B 3U2SB 1EMTL 4HCRA 1UJ3C 4AH2A 1KJMB 4I77L 4OGAD 2YD4A 5B39B 2QR0A 1SY6A 2XY1A 3P4OB 5T5FH 2NY0C 3N11A 1IGIH 4EUPH 1VKXA 1FG9C 3UYOD 4H5SA 1VGKA 4JFYA 1WAAE 1EV2E 3QDGE 5AUMB 4HMDA 4V28A 3LEXB 3OZ9H 2GJ6A 1K8IB 1G7JA 1BSIA 2BVOB 1VCAA 4PSRA 3MBED 1I85C 4XAKE 1I3UA 5J12C 4X6DF 3AIEA 5L2JA 2XM1A 1J0HA 1QPKA 1MIMH 3F7PC 3GBLA 1RAMA 1X7QA 1R6VA 1MFVA 2CITA 2LTQB 4NNYA 5C3TA 1FGVH 3UCQA 4NHUB 4BKLA 1RPQA 5BZWA 5C0GA 3VFRB 1FDLH 1FGVL 4M6NH 3UERA 4XP1H 1DWGM 3FB7B 2Y5EA 3SCOA 3OKLB 1ITCA 4YLQT 1P7QB 2JF1A 4U1GB 3MROB 3ZR5A 2AJUL 2D4DA 3OZOA 2GYSA 4ZSOB 4Q0XL 4IS6B 4QRSA 5JHDE