5JIPA

Crystal structure of the clostridium perfringens spore cortex lytic enzyme slem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
GFAQDKNPLSTFGPDLNEFSRDVNFLTLAKNSDFIYLRASGSGTGKLRIDNKFLEFAKECRRLGIPCGAYHFAKPSKDLDSAVIQADQFIDVLQQGFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTDEGKLDGVGSPVDLNWGPNSIDSLMPPSAVTGLNAYISGNKIFVNWTANKEDDLNGYNVFVNDNYAGTLPRKATKIVIDKSRFYLPKGKPIKISIEAFDITGDFSKERTEYILDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cortical-lytic enzyme
publication title The crystal structure of Clostridium perfringens SleM, a muramidase involved in cortical hydrolysis during spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 95
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jipA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5jipA01
1R5VA 4HJJH 1GZJA 4F7PB 2YRZA 3TO4D 3B2VL 3PWVA 1VERA 3SE3A 3DVNA 4GMSH 4H8VA 4KMTL 4GAFB 4P23B 1BJ1J 4PJIA 3CZ8A 3C8KA 2DDQH 4L8DA 1OOAA 2YPVL 4I4WA 4JFDA 1N82A 2WAGA 3UP1A 3IFPA 1GZQB 3PN8A 3D2UA 4Z7NF 4YIQB 4KTDL 1HQ4B 2BVYA 2SEBA 2XSBA 4JJ5A 3V7MA 2OYMA 4YC2B 2EICA 3MRIA 2Z31C 2BNRB 3U2SB 1IGFL 4KRNA 1S7WA 4KDTC 4MSWA 1RK0A 1J9CT 5BJTA 3I6LD 4X6FB 2IMNA 5F1SA 1S5IH 2HMIC 1SVCP 2YR3A 5DJZA 3SCVA 4YEEA 1EEUA 2A77L 3U30B 2V7NB 2NSXA 3SCWA 1E0XA 5DQJA 5F72S 4HMDA 2C8NA 4LCCB 2BP3A 1MHCB 3P40A 1GOIA 1U58B 1FORL 2AXFB 2DQXA 2LE9A 2XZAH 5I1JH 1MH5B 1PYWA 5C07B 1EO5A 4EI5C 1XIWB 4RAUB 4IRSD 3Q1SL 4Z7VB 3ES6A 4PCTA 3VIHA 5TDOA 1GPFA 3L5XL 1U95B 4NRYA 5ID1B 5I3DA 4NN7B 4PUDA 4FXKA 1DWJM 5DJ8B 1BYAA 3MLVL 1X4YA 3GKWL 4HGWA 4CL7A 3HC0A 1P7KB 5EB8A 1N3NA 4X7EC 3TO4B 2JF6A 3MJ6A 5LBSL 3C5ZA 3CZFB 5H94A 5JIPA 1XF2A 1ZJAA 3RMEA 2KPNA 3H7BB 5SX4H 4RQQA 1S7UB 3BGFB 4F37K 4XAWH 2DQEL 3MMWA 1AGDB 2OXGA 3BQUC 3VWJC 4ZO6A 3RHWF 3OLIA 4Y5XB 2BVEA 5T33L 1WWBX 5I23A 4WW2C 2BV9A 2EC8A 3TCLB 5K9QI 5JPMB 2APVA 4NNYB 4Z7WA 2J7BA 3WDQA 2RBLA 2APTA 2EDXA 2J8OA 1VEPA 4U7MA 5I1HL 3OJDA 1AGEB 1WFOA 4D94A 3QUKA 4PP2B 2MKLC 4PJDB 3A47A 4WI2A 2AQ1A 3K2UH 1E0WA 4XI5C 3THDA 2FEDD 4EN3A 5A6KA 3BE1H 5HPMA 4NN5B 1WCBB 2DQCL 2Q3AA 3MV11 2DIBA 4IRSB 2WC4A 1QSZA 4OLYL 1ACZA 3UTTA 4M7ZB 3MLXL 3GSNH 1P4LA 2OR8A 3V4UH 4PJ8D 2XRAH 5D4QA 1ZHNA 1UT9A 3G5YB 4B41A 1DZBA 1FO0H 1JK8B 4CBPA 4BS0A 4EVNA 4ZXLA 2G3JA 4NWUL 1R3HB 3U79A 3WJLA 3CHEA 4KRUA 3DTXA 2VDQL 3UZVB 4PD4J 2OL3L 4YDVB 4W70A 5EC1A 1E73M 4XCNB 4JN2B 4CNIA 3T0EE 4WCYH 1JI1A 4PD4K 4M62L 4JKWA 1IL1B 4D6IA 2OMNA 4PJFA 1K4DA 3WUBA 2P7TB 1BECA 3JWOL 3WENA 3FQWB 4FTVD 5KSAD 3KPPB 2Y6SC 5DRNA 4F15B 2XOTA 3CO4A 1I7TA 1URLA 4HKJB 4JFED 3FOMB 3DX7B 4TUKH 5D2NE 3MUGB 1A9EA 3ZLQC 3V0WL 1T1XB 1TVHB 1SM3H 5MENE 4Y4KA 5B39B 1FFNA 1NMBL 1RMFL 2JTDA 3ZKMC 4UNVA 4JFPB 4JANB 4MTVA 1OTSD 5E4IA 1U8QA 4X9YA 3RNQA 5B21A 4FQCH 2Q76A 3PWNA 4Z7WF 3BN9C 3I02A 4IRJB 4KU1A 4D6DA 3W4RA 1JNLL 4PJ8B 1S7QB 4HULB 3ESUF 2F5BL 3FQXA 2ADGA 3GHBH 1LWJA 1ZBWA 1FFOA 3IF1B 5GGRA 1HSBB 3NACH 3WNOA 2CKNA 3DYMA 4FQHA 2HT4D 3S35H 3KLHD 4RE2A 2EDKA 4LIQL 3S96B 1H3VA 3VFSA 2A1WH 4XAKD 2ZSWB 4W6WB 3T3PE 4R4BA 5J13C 3P73B 4PLKD 5DHYA 4OIFA 1VB9A 3MA9H 3PV6B 3BH8B 1LHZA 5D6DC 1K6AA 1ULVA 1AY1H 1I3GL 2ZSVA 3V5DB 3TTYA 3L3GA 1UR2A 3EOAA 4KJPC 1TZGL 4J6RH 4XC1H 5D7IA 3L4XA 4P2RE 4OT1H 5JR1H 2D23A 4WKAA 5KS9A 1F4WH 3NIGF 5HVHB 4ENED 2A0LD 4FTVB 3SDXB 4LVNB 4D0DB 5KSAB 1UD4A 2V3GA 5LKNA 2APWA 2FX9H 4K9EL 3O4OB 3BAIA 3GSNB 3O2VL 4YJZL 4JFEB 2M2DA 2AJXL 1KJMA 3LMJL 5JUEH 1KGUA 2DEPA 3W0WE 4KMQA 3L1OH 3O8XA 4URTB 2HRLA 5EC2A 1FO0B 3CLEL 3ZDZE 4OF3A 2YZ1A 4H1LH 4WFHD 1WWWX 4F7EA 3TN0A 1Z9SA 3CDCA 4PJFF 2DLEA 3EDJA 3KG5A 2K7QA 2D7NA 3IJSB 3O6FC 2IPKA 4OZGE 5KVFL 2LQRA 1AGFB 1XGUA 3QDJE 2B4CH 1WZAA 4XCFH 4LK4A 5IR1B 1KBKA 1IGML 4U1LA 5D71L 4NJAH 1JNNH 5FYLD 5GJSH 3W9EB 4L4VE 1UA6H 5ERWA 4D9RE 5B3NA 2WKLA 2WVSA 4QHUB 2ZICA 5FO9B 4Y5VC 4MDJA 3QJFB 4OD2A 5L88L 4W4OC 3P4NB 4Q7NA 3AIUA 1QSFD 4XX6A 2XA8L 3QAZB 2Y23A 3L5JA 1BAGA 3GSUA 3F7VB 3MUHL 3RI5F 1B3XA 5EORL 3IXAB 1LDPH 4HWNA 1RZKH 4GBXC 5DT1L 3VH8A 1T2QH 1U8PA 5AWNL 4DGVH 1ZA3A 3GNOA 1IT0A 1YJDL 4NQXB 2YK1H 4B3LA 3X11A 1OQXA 2DKMA 4OQTH 1PD6A 4L8CB 4R97B 3TBYA 4UT9L 1GHFH 4MA1C 2YXMA 3ZYOA 1R24B 2ENYA 5FDWA 3IKCA 3P3YA 5DJ2A 3WFHA 3BKJH 5D7IF 5K93A 1GQKA 2J62A 1FP8A 4Z2HA 1J0KA 3RL2A 3PGDA 5KSUB 5KS9F 4P2QD 1C8PA 3QRGH 3TBVB 5IBUB 4HIHA 4NQVA 4Z6AT 5I9QB 1G7JA 4G9DB 5CD3A 4NNPH 1RUQH 4NZCA 1PY4A 1N5AB 4XPFH 2X4UA 4XRCA 1JPFB 5E8OA 1J1PL 3VFVA 3LIZL 2XVGA 5CINL 1NDGA 3MBEA 2O93L 3THML 5BROA 4MNQD 4GRWB 4RISH 3PNWB 4NQUA 1KXTB 4S1DC 1A2YA 4OJFH 5ITBH 3R0MA 4Z7UA 4QCEA 4W7UA 4GXUN 1QSFB 3MOAL 4GPNA 4H20L 1LK3H 2CKBL 2UUDH 5DEGA 5I19L 3RWHA 3MRMB 2J74A 3MLUH 4H1LB 1JPTL 1KIRA 1NGQL 4JHAL 4CU8A 3CTTA 1C12B 4JG1L 3GXMA 2H8PB 2J12B 4LIQE 3WLBA 3AJ7A 12E8L 5KN5A 2IH1A 2X89D 1NCAL 4U1HB 2E4TA 4H0HB 4YN5A 2BXYA 1IEBA 2DTML 4NKDB 1QLRA 4DAGL 1TXKA 3TJHC 3MYZA 25C8L 3KPOB 4LGXA 1ZEAL 4PP1C 4Q9RH 5I1LA 5CSBA 3S3JA 1MFDL 3MZGB 3OR6B 2V3EA 4QHLA 1X6NA 4K94L 1BIIA 4P2QB 4GKOA 4XNYL 3DETD 3ARFC 5BW7A 4KRTA 1KIUA 4Y16A 1VFOA 3B3IA 4G6MH 4NYLA 1P1ZB 2V5TA 4ZAKC 4KZEL 4DWSA 2X4RB 5DJCA 4AYSA 4JREC 3F5WB 4DZBA 3SBWA 4MNQB 2WMHA 5E7FA 32C2B 5FKYA 2H32H 1GC1L 4ZTPH 4Z18A 5KG9B 4NBZB 2ZXQA 4OIBA 5BVJA 1G0CA 5BRQA 1T20A 4X0VA 5FHAH 1R7AA 2WBJD 4P2OA 1QA9B 2E7LC 1NMCB 5EN2A 3O3BA 2VT0A 3W6LA 1TQCB 1DBJH 3HE6C 4XBPB 5JXED 5KSVB 1AGBA 5H2BB 5H8DA 1RFDH 2DH3A 4MDOA 4GSDH 2J88H 4LSSL 1H2JA 3VX1A 4PMDA 5C0JA 3RIFF 1UVQB 2Q8XA 3NZ8A 5IM7B 4Z8FH 3B43A 4KQ3L 3PGFH 5IGXL 2F9BT 1W9XA 3ZQ9A 1F4AA 4ZFGH 1FNGA 2PI6A 1RV6X 4WY7L 2V7HB 4Z7UF 4P23C 1G5AA 4PREB 4PRPA 2E27L 3NIYA 2VDOL 3WY1A 5KJRH 1LK2A 4YC2C 5DD6B 1S7SA 1UXWB 4X98A 3FRUB 1GOFA 3CBWA 4M82A 1AXSA 2XYCA 1DQDH 4LSVL 5DRXB 4QXTB 1GJIA 1V6YA 1MQKL 4HF5L 2HVKA 1IC7H 3U30C 4LLUA 4F7TB 3QJHA 2OZ4H 4N0UB 4RIRB 4UCFA 3T65A 4LCCC 2R0LL 1BPLB 4G6AC 3SY0A 4HS3B 2D7OA 1RHHB 3WUWA 4YHOL 3UTPD 2YSSA 3UTZB 3KE0A 3H9SD 4PJGB 4PB9L 2WYSA 2FECI 4DGYH 1XIWC 5EU6E 3I6GB 2W0FA 5HJ3B 1GAFH 1KCSL 2DLFH 2Q8BL 5CGMA 2HWZH 4ELME 3BVNA 5GS0D 4D9LL 1F4YL 1ZS8B 1UKPA 4NQDA 4RGOH 3VFMA 2CJUH 3UMTA 1DLFL 4Q74A 2WBJB 4AD2A 3G6AA 5E5UB 4Z0XB 1FH5L 4W5UA 2XWJA 3HHRB 3FW6A 3DUHA 2V2TB 1FHGA 1GGIH 4AD4A 3KPSD 2PO6A 3F65A 4HU0A 5BRPA 3TO4C 3O41A 4NO2B 1HXJA 5FF6B 3ET9F 3AFLA 1VKXB 2E9LA 2XZQH 3BGFC 1J0JA 5GGQH 1ZLSL 4JM2D 2G2RA 2PETA 1E43A 5SX4I 4WWKD 4Y5XC 2FX8H 2DWEB 2YBTA 2H32B 2VDNL 3CDGB 5I18H 2YLLA 3SDAA 1DE4B 2GK2A 5FA4A 1CLYL 2PNDA 4GUPA 4YE4H 3KJ6L 3RBSA 2F54D 1A3RL 5FIPA 1HINL 3QG6A 1M7IA 1RK1B 1H11A 3DOSA 3SHSA 1SJXA 4F3FB 3HR6A 5E2JA 5CLWA 3H9SB 3U7AA 1TETL 4O9HL 4X80H 2YDQA 4NN5C 2BVPA 2YN3A 4IRSC 4EE9A 1UJ3A 3GIVB 2Y25A 4U2YA 3EYSH 4LLAA 4MJIE 4M7ZC 5F96L 1PY9A 4QTIL 4QDMA 3KHQA 1X9QA 2RGSA 3MRCB 1OSPL 5B38A 2J5LB 1YN6B 5A2AA 3UYRL 3BLPX 5IMMB 3RILA 4G3YL 5CP3H 3WHE1 1OGGA 1LL7A 1OSZA 3FB7B 3KPSB 1LO0L 5EUOA 4EIGB 1MCSA 3A6OA 5HGAA 4U1SB 6TAAA 2P5EE 4FQQA 3MBXH 1I1AA 2Z91B 4XMPH 3JZ7A 1HKLH 2A9NL 4KTEL 4NC0B 3KL5A 4L8BA 4YFDB 2FEEI 4JM2B 4JGMA 4U3HA 1RZ7L 2BNUB 3STZB 3TH3T 4Z78A 3FO1B 1OSEA 1KR0A 3I2CL 1NWSA 1MHPL 2GT9A 1H0GA 3CUHA 4MD5A 3VM7A 3ZO9A 5GRWA 4IOSD 3FO9A 3QHTC 2OI9B 3I50L 2F53D 1G6VK 4F15C 3A4XA 1IGCL 3QNYB 2F54B 3GB7A 1KCUH 3OB0H 4PMYA 1HNGA 5AYUL 4HC1A 3V9FA 1QQDA 2DQDL 5JBEA 3QUXA 4DN3H 4F37F 4EXPX 4LNRB 2IPUK 1YMME 3GUTB 3WD3A 4MCZA 2FEDC 4JZJA 1EDQA 1JNHA 4JFHD 5I1AB 1EHLH 3KXFA 1JNDA 3OGCA 4J2XA 3BW9A 43C9A 1CF8L 4PJAB 4UZUA 3UPRB 3CLWA 1OAXL 2YPKA 3JSSA 1KEGL 1EAJA 5E6ID 4KDVA 3PHSA 1KNOB 2ZKHL 1VEOA 3MYJB 3IDMB 3KVQA 1NGPL 3GM0A 5HYJA 1HZHL 1R3LB 1WE5A 5F9DC 5MI0B 1VBUA 4OZHE 1KF9B 2WIIA 3W39A 5IEKB 3VFNA 3MJGX 4KUZH 1XV8A 1GJWA 1MLBA 2X6MA 5J11B 2G9HB 1FAIH 4CVXB 3ALWA 1GIGL 2ADFH 1CFTA 2QL1A 1DWIM 5HVHC 3SCSA 1ZMYA 4LVNC 5KSAC 5EUOF 2AV1A 2F53B 3NCEB 4ODSL 1C7SA 3HS0B 1U8LB 3O4OC 4XXDA 3OA5A 3MUZ1 4ONGH 4XZWA 4B5EA 4N90E 4JPIB 1VACB 2FO1A 1JCKA 1ZOXA 3BKYL 5FCSH 3AVEA 1IKFH 2IPTH 3VU2A 5JOPD 5F1NB 1JG9A 3ESVF 1OTSC 3G5XB 2D7MA 3WEXA 1CGSL 4ZENA 1B2YA 2NY5L 3O81A 1N6UA 3QCUH 4Q6IA 2ITCB 4BZYA 1CTNA 5EZIL 5AUMB 4GQ9L 3C08H 1R5WB 3MJ9A 3O3DB 3OV6A 3LSOB 3TFKD 5C0RH 3F5JA 5L2KA 3O9WD 3WD0A 3ARGA 3HE7D 4LEXL 3KYKH 4QT5B 1W0VB 2C3XA 3KLHC 2HT4C 3F6LA 3KPNA 5E6IB 1N6QH 1OINA 3P2TA 1FV1B 3I3DA 4I48A 3EO9H 5MP6L 5IHBA 4UI2A 4ISVA 2VUYA 1LWRA 4PLKC 4LCUB 1V0MA 3BXWA 3VX0A 1P6AB 5KAQF 1WEJL 3C8HA 4Z2JA 1H41A 1MREH 1ZKAA 8FABA 4U1IB 1E6QM 5DO2D 1NLDL 3UCRA 3QAZC 5FO8A 3RJDA 2MJWA 3OKNA 2IANE 4KMLB 2IXUA 2Q86B 1IJ9A 1ZA6B 3VXSE 1MHHA 1O0VA 1NCBH 4XX1E 3OAYH 5IOPB 3HPLB 3VXTA 4ENEC 2A0LC 4PBWD 4ZYKA 3WF1A 2I26N 1JPGB 1FL3B 3G04A 1E4LA 4FQ2L 2J8UA 1NLBH 2CR3A 3VH8G 4XMLH 4JHZA 4DW2L 1KXHA 4R97C 3R4DA 4S1SL 4XUYA 3HTLX 1TQBB 5F9JA 5IHLB 5FOOA 2GI7A 5D7SL 4QCIB 5F71A 1PG7L 4AY0A 1IAOB 5IT2H 3RU8L 3B2VH 3G6JE 4L3EA 5I9QC 5I1DB 4JFYA 1QW9A 1UWIA 4F7CA 4KMTH 1ZGLB 3LKPA 3O9WB 3HE7B 3LOWA 4QRQA 5ANME 4I0PD 4HIIB 1AR2A 2XG4A 5EIIB 3V8CA 3CFJA 4BKLA 5C0GA 5TGBB 1IGFH 2OSLB 5GRXG 1GOGA 1PX8A 5CLTA 2BSTB 3T0ED 1DBKH 1EXUA 4LLDA 1M05B 1QHOA 2A77H 1MJ8L 1G0YR 1Q94B 4NQCE 1D5XB 5HHXH 3RZCA 4RFNB 3T4YB 5DUMH 1DQQA 3PDOA 1FORH 3MSDA 1V6VA 4WFED 3DV6A 4AIXA 2NMSA 1DVFD 3WXWH 2CESA 3FRPG 3DI3B 2Z4QA 5SX5H 2WLYA 4H8WL 5E2VL 3W82A 1E71M 4Y1AE 2A6DA 4O5LH 1FLRL 1W3KA 1G7IB 4MMXC 3S4SA 2YXFA 2B4CC 3GJEB 5MEND 2ICES 4P4KA 3WS3A 4WTZA 4HWZB 5IB2B 4OIIL 4PTUB 4X5XB 4X8XA 3V0VA 2MPAL 2H1PH 2F8QA 4Z2GA 1R5VB 4WEBL 2EIBA 3QQ4B 1IQWL 5LBSH 4MMZC 2V5DA 3T0AA 3DVNB 2YPLE 2M8XA 4PJXE 4PJIB 3PG2A 3IT8D 5GHWL 4L8DB 1JGIA 4W6YB 3U5UA 3IFPB 4OCSL 3S5LA 3SDYH 4M81A 3HUJA 3D2UB 4HK3J 3RIAK 2JJSC 4AMKL 5GNXA 5I78A 1MFBH 4I0PB 4JJ5B 3HZMA 1CGYA 2DKSA 5A8QA 1RZKC 2A73A 3IETB 3VFRA 1S7WB 5BRZE 1RK0B 3IB4A 2WCSA 1KTDB 5BJTB 5E9AA 3T0EB 3ZHLA 3TNMA 3CD4A 1F90H 1YQVH 5FGSA 1RZGA 4M5ZH 1CU4L 5ELIA 4XV0A 5DUPL 1T04B 1MQ8A 2BNQE 1NMCC 3CFBB 4I3SL 4EAMA 1TQCC 1SJEA 2VTFA 1DUZB 2G4FA 4PMOA 2DYPA 4YGVA 3KZSA 1PYWB 3SGJC 2DQCH 1DVFB 2J7FA 3C6LD 1T0NB 1JGLL 1BG4A 5DK0A 3ES6B 4M6NH 5D2NB 3W0WD 4BF7A 3UTTD 2WHLA 5MENB 5C0DB 4NRYB 4LSDA 5LWYH 1UEMA 3O6MH 2EIZA 4MD0A 3RWFB 3MJ7B 1HL9A 4YDIL 4I2XE 4NWUH 3HC0B 3GSQA 5IJVB 4N9OB 4DKFL 1N3NB 3A6CL 3DETC 2ESVE 1HXYA 1A3LL 1RZJL 2DWDA 1V3IA 2AMGA 4L1DA 5EU4A 5H94B 5I2IA 3U9PL 3D25A 4H5SB 5HGBB 2VLRE 3M8OL 4RQQB 3KL0A 1HNYA 3QQ9D 4X7TA 4L4VD 1NGXA 4GG6A 4R26L 4RAVB 1CZ1A 5CEZH 4M80A 2BCKA 1A7PL 3FCTA 5FYKE 2NNAA 4Z7WB 1NGWA 2MTPA 4CDHA 3U82B 3EMQA 2WBJC 1V7ML 4KKBD 3BH9B 4Z5RA 1JF1B 1ZVHA 3OJDB 3U9UB 2ZXAA 5GSRA 3V0WH 5JXEC 1JF5A 3QUKB 1XGRA 1JGEA 2W5FA 4Y4KD 5DTFB 2FZ3B 2HJFB 2YL5A 5HPMB 1IC5H 4M9OA 1HIML 3WIFA 3C6LB 1OM0A 5ESQA 3W11D 3NFSL 3W0WB 4RWYL 5ABFA 3UTTB 3BEVA 1TMCB 4GW5A 3MNVB 1QVOB 3WFBL 1EFXD 1MFCH 5FUCE 3KPMA 2F5BH 3RBGA 1ZHNB 2GJXB 4K8RC 5CCKL 3N13A 2ORBL 5HPCA 4Y0GA 1D9KD 4MQSB 4C83A 1Y6MR 3D1MC 1ISVA 1F3JA 2A3EA 4JZOA 4EVNB 4WFFD 5TF1H 3LPFA 3V7AE 3RTQA 4NKOA 5EC1B 4ZE5A 1I8LA 3PZQA 3IYLW 3THCA 2BX5A 1IARB 1I3GH 3WCYA 4CNIB 1S8DA 3KDMA 3N1AA 5DJAB 1JN6A 4D9QD 3TV3H 4L4VB 3FN0L 1TZGH 4LQ1A 4PJFB 2AJUH 1AO7E 2VQUA 3OIHA 4RMWA 1L8NA 1WBXA 4OV5B 3L3HA 5GS0C 3W28A 4XCYA 5J3HD 1BOYA 4K9EH 5DRNB 3B4NA 3VRLE 1RJYA 4ZOBA 3ZKXB 1TJHL 3LMJH 1I7TB 5FXCH 2CCRA 3M07A 1SEBA 2J5LC 3MS8A 2GAZA 1HQRA 2CERA 1IKNC 2C7UB 4AZBA 2DIEA 3CHDA 3CLEH 3B5TA 4Y4KB 5ILTL 4GG6F 1HILA 5A2KH 3QDGA 3TN0D 4XP9L 1W3LA 3IKKA 3RNQB 4Z7QF 3PWNB 2OL3B 1JDDA 3I02B 1H8NA 3RX8A 3I84A 1EFXB 2FB4H 4YLQT 1U92B 1ZWIA 4JFFA 4JM2C 5DVMA 4RE4A 4JY5L 5I66B 3CK0L 3FQXB 4ZUUA 1D9KB 4UT6H 4WWKC 1FFOB 1IGYA 1TVBB 5GGRB 4H2CA 4RL3A 4X8JA 1QI2A 4LRIC 5M5DA 1CFQA 3UEZA 3VFSB 1NP2A 3F7RA 5D72H 1VJZA 1ISWA 4R4BB 1X3DA 1MUJA 3UC0L 5DHYB 4HWEL 4D0BB 3MUIA 1HJUA 3HMWL 4P0DA 4FP8L 1VENA 1QNSA 2XA8H 5FL0A 1MCRA 1QFOA 2ZSVB 1A47A 3AS1A 3H3PL 3IRZA 5DMJB 1ZBVA 1DJSA 3L3GB 3P0YL 5D7IB 5KOVC 5AD0A 5BMFH 5CJOL 4OF6A 1GGBL 3FT2A 5DT1H 5KS9B 4N5EC 3GYCA 2WBGA 1YYLL 5AWNH 3K74B 3QIUD 1LD9A 3ZE2F 1BJ8A 3F7PC 3CVHA 1KJMB 5C8BB 1A6WL 2XTJD 4UT9H 1FPTH 4PJ5A 5F6IB 5CBEA 4E8DA 1RVFH 4HTYA 1XSKA 5AAWA 1E6RA 4F7EB 4XWOD 3TN0B 1QBBA 1LWHA 1LO2H 1ITBB 1BVKA 4FXLA 4BYHA 5E94A 5SV4A 1BZ7A 1U8OB 5MI0C 4MXVF 5E56A 6A3HA 5FOJA 1XGUB 3KLAA 3MV9A 1UZ1A 1UYWH 1J1PH 1UKQA 5KW9L 4O02L 5CINH 4U1LB 5C7XL 3E6FB 1HEZA 4TN9A 3THMH 5J11C 4PSPA 3FXYA 4ZD3L 1MPAH 4LPXA 3EYFB 4ZPTA 5EBLA 4GW1B 5FM5M 4BZ1H 3P0GB 4AQOA 3BHBA 5EOTB 1T0MB 4MDJB 3DIFA 5C0BA 4JFTA 3NCOA 4BQ5A 2ZX6A 1EFQA 1VDGA 4H20H 3TF7C 3OGSA 3GSRA 4AZ8A 2GSIA 4Y7MA 3BCFA 2H9GA 1L6ZA 4BSVA 5E99L 3O2WL 3GSUB 2EE6A 3CX2A 5J6HB 2EKSA 2VITA 3UAJD 3LEYL 1F11A 3EJJX 5IXEA 4TOYH 4NDMA 3LH2H 3FO2A 4JQVC 4U4BA 3QIUB 1FH8A 3EUUA 1ZA3B 4XNZB 3B6SB 1CWVA 2VRAA 1U30A 4D8PA 3X11B 5KANI 1B0IA 4Z7NE 3OR7A 2XTJB 1VRXA 2DTMH 5IKCA 1VF8A 3TBYB 2QMJA 1M1SA 1UACL 5E6IC 3IKCB 1ZEAH 5DJ2B 3WFHB 5C09A 1YEJL 4TYUA 4P3CL 1AQKH 1QRNA 4PJHA 1KTLB 1LO4L 2Q7NA 3RL2B 4K94H 4DUVA 3PGDB 4L29B 1E72M 3LPWA 3HMXL 4NQVB 2VZ3A 1G7JB 1LP9E 5CD3B 1CTOA 4JFQA 4LCIH 4Y16D 5L8LB 3MNWB 2UYLB 3CFDA 5GGSA 1NAKL 1SMAA 4U1GB 2X4UB 4XRCB 1XCWA 2GK1A 4DWSD 3VFVB 1A0QL 3L7EA 4IM4A 1NDGB 3GSXA 2NW2A 4ZG1A 4YHIA 4KAQH 4NJ9H 1FNFA 3PZVA 5JOEA 4E2OA 4LP4A 2P49B 4JFVA 2VZ1A 1Q8MA 5F88A 4LVHC 3VIGA 4OLVL 1REIA 2OK0L 4PJBA 4Z7UB 1JWSB 1SBSL 3SKMB 1I1XA 3TTOA 3H42L 1XGZA 4YX2L 3VXME 4P2OD 5EIQA 1VFAA 1NGZA 3HG1E 1VFMA 5BV7H 1QSEE 1X7QA 5DEGB 1FNSL 4PG2A 1OLLA 1A7QL 1PX4A 2DQFA 2V6HA 4L3AA 4QRUA 4NT6A 1YEDA 1IZKA 4LSSH 4YXKH 4QXUL 1TQBC 3RVUD 1KIRB 3PWLB 1D5IL 4POYA 4WHCA 4IS6A 4NKIH 1JIBA 1KLUA 3WLBB 5GISL 3HMXA 4WJ5A 3RY4A 2IH1B 5IWLA 5TDPA 4XB3A 3TFKC 3P4LA 1WFTA 3O9WC 3HE7C 2XG9A 4ORGB 1QLRB 3MR9A 3MV8E 1HNFA 2BSSA 5JBFA 2P5ED 5CIPA 2R29H 1SQ2N 5F7EL 1A5FL 5FEBA 2JK5A 4FFYL 3CUFA 2D24A 3VXQA 2DD8L 3GMPA 3HZYB 1PAMA 2WK2A 4OAWA 5EU5A 4EDWH 4HCRL 1XHGA 4YHNB 4Y16B 5DO2C 1HHIA 2CKBB 4RFNC 4NYLB 1KPRA 2R0LH 1O7VA 3EYVA 1F8TH 1NDMB 5DJCB 4DWSB 4YHOH 4GRLD 4DZBB 4M1DL 2WHMA 5KEZA 1S3KL 2R4SL 4RZCA 2DT2A 3G5VA 3U0TA 1J9YA 4YR6B 1E6XM 1KCSH 4KKNA 4MQTB 1RP8A 4F8TA 1E6PA 5BVJB 1JNEA 1T20B 3BCDA 5C0IA 4D9LH 3HB3C 1ZAGA 4NQDD 4B53A 5FOBB 4Z2IA 1CL7L 1BQHB 4P2OB 2FGZA 5EN2B 5DURD 4F2MA 2KKQA 3KGRA 4NZRH 3MLRL 2J8HA 1AGBB 1P84J 3S4SG 4G8EA 4U31A 3RVVD 5T3XH 5JNYA 3MUJA 3PXJA 5BXSA 4YHGA 2PO6D 4F58H 3C2AH 3NZ8B 1PKQE 4TVDA 4R8WL 4ORZC 5A2LH 3SE3C 2AXGA 1GZPB 1FNGB 5BOPA 4PJBF 1V05A 4PN2A 4JE4B 1A1OA 4J3XA 5C6PB 4OLXH 1U93A 1MELA 2AAAA 2LU3A 4ZPVA 3G6MA 4I0PC 2P5EB 4NFDA 5CKAA 1LK2B 5HYQA 1TPXB 1DL7L 2VDNH 2MOVA 3S5LG 1AXSB 1CLYH 1WWCA 3T0EC 4HSQA 1LO3L 4V2BA 1A3RH 4F9PA 5EBMB 1DQMH 1JFQH 1G9NH 1UR8A 3QJHB 2F61A 4MDIA 3BUYB 1PFCA 3T65B 3PUCA 5MEOA 1UZ6E 4Q2ZA 1DUYB 4GRLB 4OLEA 3EZJB 4OLZH 2YSSB 5C9JB 2OTUB 5TH2A 1NUNB 5T3XD 4N9GA 2QADD 4GS7B 4W8AA 4DJMA 1DVFC 1MFNA 2A6IA 2W0FB 5E5MA 5C08A 2Z92A 4APQD 5D2NC 4PGJA 3BVNB 5DJDB 5F96H 2W9DL 2XQYK 3DXAA 4LVOB 3NFNB 4NQDB 3TM6A 4QTIH 3VFMB 1YEHL 1IC4H 1OP9A 3FAXA 1W91A 4HC1H 2W1NA 1OSPH 5DURB 5E2TH 2H2PD 1RUKH 5CZVL 4M3JA 3AB0B 4G3YH 1QNQA 4K07A 3TH4T 2Y8KA 2UY4A 1LO0H 1LLOA 3GBML 4PMUA 2PO6B 2OWXA 3K0WA 1I1AD 4LHUD 1G7MB 1OGAE 5IW1B 4ODUB 2X1XR 1T03L 2JALA 3VO0A 3KHOA 4PRDB 4FABL 3C60A 2G2RB 5TE7H 1ETZA 5DMKB 4OUOA 4CJ1A 4XC3H 1CN4A 1PIGA 4OD1L 2MCG1 1BD2A 3I50H 3MRRA 5FA4B 1T21B 2H45A 1WBZA 3CU7A 2IAND 43CAB 4N42A 4QHKI 4L9LA 1GGTA 3QG6B 1M7IB 4G7VL 1OTUD 5AYUH 2CHOA 4BH7A 4PTTB 4YDLB 3EDFA 4LEOB 1NFIA 1WVZA 4Q22A 4BJLA 4KTYA 5LXGL 1RIVL 4O58L 2G41A 2QADB 4ZSOA 3HC3H 3C6LC 4H25B 4W7VA 3NIDF 2KH2B 3ECBB 3KXFD 5C0NC 4BFIB 2BVDA 2EKJA 3VRJA 3MLYL 1BZQK 3A6BH 1OAXH 1KEGH 4NCC1 1TJIH 1UM4H 1AQHA 4YPGA 3EO1A 4R4FH 4AZ7A 1OSZB 2ZKHH 1ZJBA 5EUOB 2MQ3A 4HWBA 4XCCL 5HGAB 2BRRL 4Y7EA 4FQQB 5HYJD 1BEYL 1JTOA 1I1AB 4LHUB 1TLKA 1MVFA 2XXCB 3MRPB 4L8BB 1JP5A 3QQ9C 4Z78B 5ESVB 5K9OA 3QZWA 2GT9B 2RFXA 4M5YH 3QR3A 4OF7A 1BP3B 3L5IA 4LSQL 3FO9B 4AH2A 4G8FB 4NQCD 4TSBL 2PF6A 3IU4L 2IANB 1YY8A 4KKBC 3GB7B 3ZKXC 2QKIA 5T5NF 4PGZA 2W9EH 4IMKC 1QQDB 2IXVA 3MRDA 5ID0B 2EEBA 1Q0XL 4RGNE 3W26A 1WISA 3VGEA 3IXTB 4MCZB 2DQTH 1AJ7L 1RQ5A 1A6VL 5EO1A 4CN4A 1VESA 1CDBA 1BG9A 1CGSH 4Y1AD 1E5NA 4KDWA 3UJJL 4X6DE 5K9KA 5SWZE 1R0AL 3W11C 4HAGA 4ONFH 2BY2A 2VO5A 2DQJL 3KXFB 5DRZA 5GJTL 3UYPA 5DFTA 3WMSA 4UQ3B 3OGCB 1T7WA 3QXVA 4CADA 2VXVL 3PHOB 5HHNA 2CBUA 2GUYA 3BW9B 1AD9A 3NABH 3IDYB 3PZNA 5AYBA 5L2KD 3NCJL 1D9KC 2FWOA 3SUVA 4TPRL 2VL5B 2YPKB 4XNXH 1U8NB 4BQCA 3S36H 3JTTB 2I9LA 3C5JA 3HJEA 3G6JB 5HDLA 4E41A 5MP6H 3RA7H 3DNKA 2AV7A 3JWOC 4R96A 2YPLD 4CGTA 3MO4A 3FB5B 5HYJB 1B4JH 4D3CL 5T3ZL 5IBTH 5F3BA 4BSWA 3DO7A 3TO2B 1FG9C 4JG0H 1A6AB 4IIQB 2WIIB 1US3A 1NLDH 4RBPK 3W39B 3K8LA 2RCSL 3VFNB 4FHBD 3B83A 4F57L 4N0RA 4L3CA 1UB6B 4P5KA 1KBGL 3S37L 2PTTA 1MLBB 3TIDA 3CUIA 1E15A 3KS0H 3BKML 5L0QB 3BAWA 1CFTB 1BBDL 3ARBD 4OCWL 3AXIA 2HJKB 4POUB 4NC2B 4NQCB 2WIMA 5J3HC 1R5IA 4TVPL 4UIKL 1GHSA 4DW2H 1E1EA 2NXZD 1P6WA 2V9TA 5F6IC 1YEEH 1BYCA 1INDH 3QO1A 4GH7B 5TPWL 4QRPA 1IBGH 1FNEB 3D18A 3UX9B 3VGAB 2Q8AL 3TN0C 1OAKL 4D71A 3WFLA 3BZ4A 3TYFB 1JMZA 4Y1AB 5F7LB 1WWAX 3QEHA 3IFLL 4FFZH 3WEXB 2DT0A 1FA2A 2GJRA 1HH9A 3MROB 1JD9A 2NY2D 1DBAL 5DFAA 1VFUA 1J18A 5L2KB 4GKLA 2V2WA 1ECEA 5LQBH 2W91A 2UY5A 3D39D 2ESVD 1QFWM 1BFOA 2Z31A 3FFCA 1UZ4A 5I0ZA 3WJJC 5SWSE 4I48B 3DGCR 4KDTA 4OUEA 1A7NL 4U2ZA 2YPLB 3JTSA 4TVUA 4K9EC 2RQ8A 5C71A 2WCGA 2RGLA 5C0CA 5KSBA 4CD7A 2VB5A 2R0WL 2D3NA 2XZZA 3FKUS 3QXDB 3GH7A 4OM0L 3RZCD 5I8CA 3OKNB 2DKUA 4WV1C 4XH2A 3T8XA 3VMNA 4A2MA 2VLKE 5J0BA 1EEYB 4QRRE 2OYKA 1E70M 3ARBB 4EI5A 1PZ2A 1A1MA 1IEHA 5C6TH 1EQPA 1BX2B 4D6JA 3QIUC 3WH7A 3RAJH 3ZZ1A 2YD5A 5E2VH 4H8WH 4XNZC 2J8UB 4HZLA 3RWGB 1MCOH 1FIGH 2NXZB 1DSFL 4GG8B 4P4KD 1JRHL 4OIIH 2VVSA 1LNUA 1RZ8A 4XWOC 5F9JB 4LSUL 4BK5A 1FP9A 4A6YA 1A6ZA 1IQWH 2ZJSL 3QUMA 2BRQA 2NY2B 1RU9L 3JV4A 4JFYB 4F7CB 1VCAA 5I73B 2PF0A 2X9XA 4U1GC 1JFXA 5EZJA 3QIWA 1ZLUH 5IIEA 4E0RA 3WDRA 4OCSH 4I2XB 5T1MB 1TA3B 3BQUA 3VWJA 2DM4A 4UU9B 4AMKH 1G7QB 1ERNA 1YUHA 3D39B 1YEGH 2ESVB 3TVMA 2DQHL 1HKJA 1RZFH 3CFJB 4BKLB 4X7SL 5D1XA 1I9EA 3WFCL 1YJDC 1EXUB 5TE6L 4TNVF 2PWEA 1QLFA 4PRIA 3P9LA 4FQLH 4I3SH 4EI6A 5EOCL 1KT2A 4WIQA 1BPVA 3RZCB 3H8NA 2APXA 1DQQB 5F7KC 3PDOB 4UINH 2Y36L 4OFIA 5GQBA 3UAJC 4K68A 4NQEE 3SCUA 2E3VA 4YBHA 1ZHBA 2DYPD 3DV6B 4PGBB 4F9DA 3TT3L 3RJXA 1JGLH 1LEKA 3OX8A 4HEPG 4M6ML 5D70L 2Z4QB 1HN1A 1N0XH 2QTEA 2A6DB 1BFVL 3ROOA 5KSBF 5T3ZE 3S4SB 5KVDL 4O2CA 4P4KB 2CPCA 5F9OH 1V3MA 2A38A 2RIKA 3LVEA 1KN4H 3O6KL 5EA0H 4RMTA 1X5XA 4YDIH 5IFAH 2AQ2A 5DZOA 3SKOA 1IM9A 4EEEA 1OF2A 3UETA 3HN3A 1MXGA 3A6CH 3ARVA 5ETUB 3V8OA 4HU8A 2D31B 1AD0A 2HRPL 3U9PH 4Y16C 4H8UA 2WW8A 1UB5B 2NT0A 2B0SL 2X0YA 5ISZE 4AZCA 3KR3L 4U6HB 3RUGA 4DWSC 3B9VA 4TVPE 3WIHL 4R26H 3S5LB 3HUJB 2D9QB 2BFVL 2IC2A 2I07A 3RKPA 1A7PH 2C26A 2LU7A 3WNNA 3OAUL 2E8YA 2OWWA 2A73B 3QOKA 2VURA 3RWJB 3QXTA 2ZUXA 1DFBL 4OCNC 1CG9A 1RZGB 3PGCA 1ZHKA 4YFLF 5GRVK 2EXWD 4UILL 5IB1A 2RHEA 1HI6A 4Y89A 4HOZA 3GIZL 3VDCA 5F9WB 1SJEB 5DMGD 3MSPA 1ITXA 4XGZB 4JPVL 1XH0A 3RVUC 3GK8L 2DYPB 2YRPA 1HIMH 3MLTA 1G7HA 3HRPA 4K94C 4PRHA 5A2FA 1E4XL 2Z8SA 1F6FB 4RWYH 4YXLH 3NN8B 1DQLL 1IFHH 4JN1H 1AP2B 3MV7A 1MVUB 5CCKH 1EHXA 1JWMA 3RIKA 4MD0B 3DVIA 1TPXC 1GC1C 3W25A 1TUXA 1LL6A 3GSOB 1KJ3L 4BH8A 1IC1A 2DWDB 3MRNA 2VAAA 5EU4B 3BPNB 5I2IB 2FIKA 2Y9RT 3IDXH 4LCYA 4GKZA 1OCQA 4TRPL 4I8DA 5A40E 4GRLC 4X7TB 1BFSA 3FN0H 1NGXB 1IV8A 3Q6GL 1MAML 3BRFA 4GS7C 3P77A 1WF5A 1P5UA 3FCTB 1ZSDA 1HKIA 2NNAB 2G5RA 4OBRA 1RJLA 3KWWA 3S97C 4PBGA 3QQNA 3UZQA 4LVOC 4JJHA 2EJ1A 2FYYA 5TDNA 1HXMB 2K9UA 2A6KA 1MXDA 4A2LA 4UDUA 2WSPA 3LQMA 4HH9B 2XG5A 5C2BH 3TC9A 1PSKH 3AB0C 1D5MA 3RUGF 5D2LE 1JGEB 5ILTH 4OGXL 2DB8A 5I24A 3QDGD 2PO6C 4KROD 4J12A 4PR5B 1WAWA 1MRCH 3LZFH 5ESQB 3O6FA 2UY3A 1P4IL 2NR6D 2FJGB 5ABFB 3BEVB 2LV4A 5F1IB 4YDKH 3X12A 4GW5B 3ZR5A 3CVHH 5CHNB 4KK9D 1GH7A 3P4MA 1N64H 5I8OH 3KPMB 3BYTA 4JY5H 5T5NG 2UWEE 1WPCA 3CFKA 3UTSA 3K4DA 4M8QB 3ZKQD 3QH3A 5M17A 3OZ9L 2P8MB 1F3JB 3WO3B 2CEQA 4JZOB 4HZAA 1OGTB 1NAMA 4Y5VA 2X09A 4HWEH 3CXHJ 5C0AA 3VG0L 3LN9A 4L8SA 3HMWH 1F5WA 1F2QA 1S8DB 3DRTB 4YDLC 3H3PH 1JN6B 3CXDL 4F79A 5SWQB 2XTLA 2BVQB 1TVPA 3P0YH 1I4FA 3FY1A 4U6VH 4HIXH 2EC9T 5KVEH 4P7LA 2QADC 2FHBA 2D7TL 3E3QC 1GGBH 1KB5L 4GBXA 2XN9A 1BZ9A 2G5BA 5MEPA 1WBXB 5F6HI 5EUKA 4APQC 1YYLH 3L3HB 4RDQF 4U5KA 3HG1D 1NANH 3RKDD 3OKEA 4URIA 5L9DL 3WE6A 1A6WH 5EFIB 2H2PC 4M56A 1UH3A 1SEBB 5GS2D 2NY1D 2XFXB 3RNKA 4PJ5D 2VZUA 4MQ7A 5AZEL 4M7LL 3GMQA 3QDGB 1INQA 1EUUA 4KROB 1OT2A 2CBVA 1JPSL 1ORQA 5CILL 4PJCE 5CQ1A 1I1AC 3O4LA 1BQLH 2DPEA 1UWGH 3BESR 3MV8D 1G9ML 1WQVT 5F93C 1X4XA 2FBJL 4O02H 5C7XH 2I5YH 2OP4H 4ZUUB 3AUVA 3EBAA 1IGYB 2VSDA 2XM2A 2I9TA 3VFUA 3BXNA 4F8QA 5JW4N 4O4YL 1CFQB 2BJMH 2AK4A 1LP9B 3DI2B 3QZWG 3RL1A 2P5WA 2X44D 1ZLVH 1MUJB 5CJXC 4YZFF 2XV6B 5DC0A 1OTUC 2BSRA 2WINA 3GXDA 3VFTA 4UBDD 1T5WA 2WWDA 1A14L 2WANA 4M8VA 3O2WH 5E99H 3BPCA 3LEVL 1A7RH 2ZCKL 4TNWK 5BQ7A 5DVKA 3LEYH 5I15L 1KN2H 4LXFA 3LPOA 1ZT4A 1I1CA 3FT2B 4HXBL 3FZUD 5DHVB 4ZFFA 1JYWA 4FLRA 2ATKA 4KHTH 5I71C 3HG1B 2XQBL 4JQXC 5I1EL 1A4KB 4HZ7A 1Q9OA 3IDYC 4AG4L 3GXIA 5E0FA 4M7LT 4DKDC 2NY1B 1YA5A 2XY1A 3CFCL 1UACH 4PJ5B 5CBEB 3CFIC 1Q6CA 1MW1A 4PMRA 4G7YL 1JPST 4ZTOH 1OPGH 4GAJL 4G6FD 3GJFA 2R0ZL 4TUOB 4EOWL 5DZNA 3STBA 5E94B 1J05A 3ARFA 1BZ7B 4LLYA 3HMXH 4G8GA 3BO8A 2B5IB 4IIQC 4NO0A 5AG9A 3IRPX 4GXVL 4FZEL 2ZCLH 3KLAB 3F7YA 5IQ9A 5M94B 2JEPA 3LQAH 1HEZB 4OI9A 1QD0A 1D6EB 5CIPH 5D8JH 5JA8B 3GBNH 5L0QC 3EYQD 4ZPTB 5EBLB 4OD3H 4WDIA 5ABDE 3RO8A 3QXWA 2D9CA 1II4E 4OLVH 4XPBH 2OK0H 2DF3A 4HDIA 4PGCB 2JKXA 4LLMB 4KKLC 4NHUA 4YX2H 1N8ZB 4LARL 1CVRA 3GSRB 3KLSA 1KJVB 4HKXB 2Q6WA 1FNSH 3HE6A 1J87A 2H9GB 3PL6A 4BSVB 4N8CL 3EJZD 3WFZA 1JL8A 2EKSB 2R1XA 3AROA 1KLFA 4OGYL 1F11B 3X3FH 5HGDB 4GZIA 1AI1H 3QYCA 4WHYG 1V02A 4UIMB 4UV4H 4NDMB 3FO2B 1YECH 4HXAL 3HZKB 5GISH 1T1YB 3SJVE 2WC7A 5D7LE 2Y06H 3FQUB 4MB3A 1G7PB 5FDYA 4D8PB 4D1IA 1V3KA 5A6AA 3TPKA 3OR7B 4LAJH 1TCMA 4WF7A 4WGVB 3U1SL 1PKQB 2BNRA 4G6FB 5F7EH 3U2SA 2B2XH 1NOWA 1WK0A 2DD8H 4PJHB 1OGAD 1YPZE 2YC1A 4LPWA 3AREA 4HCRH 4WEUD 2V7NA 4YHKH 5DR5H 1ND0B 3CFDB 3VFGL 1H5BA 4LCCA 1MCCA 2UUDK 1U58A 2CH8A 2GK1B 4UFKA 3L7EB 5E08L 3GSXB 2NW2B 4JY4B 5CUSH 1MH5A 2R4SH 4QKXB 1G01A 1R6VA 3ARBC 3IDIA 1XIWA 4RAUA 4PY8I 1CR9H 2NY5C 4JM4H 1W72A 5F88B 1XCTA 2QQLL 4NQSA 4OUUB 2ADJB 3PXHA 2CO6B 3BFOA 5FIEA 5HHMD 3WL1A 2NXZC 1VFAB 1NGZB 1QEWA 5DJ8A 1NFDE 4MAUH 4NT6B 1YEDB 2CK0H 2R8SL 1P7KA 4OM1L 3SE9H 5HI4D 1NP0A 4ZO7A 1GOHA 2H2SD 1QBMH 3TO4A 4P9HL 1KLUB 1G94A 3HLAA 2NY2C 3CZFA 5I1IH 2O9PA 3ZHDA 3H7BA 3RX7A 4HPGA 2IQ9H 5I73C 1S7UA 4JHOA 1CXIA 4GIAA 1S9VB 4DM1A 1MF2H 1MCWW 2VCAA 4MS8D 3MR9B 4JRYE 1J1XL 1F3RB 5FCUL 5I1CH 5J06A 2QQKL 3CSGA 3VI3F 4LNVA 1MCDA 5CIPB 4E4PA 4JKLA 4O2EA 2JK5B 1OGAB 4I9WE 3TCLA 5JPMA 3VXQB 1MCHA 3CSBA 3GMPB 1PVHA 2G8ZA 4MNJA 1S7TA 4LQFL 3INUL 3VDHA 1LO3H 4P49A 4OAWB 1SEQH 2FX7L 4HFUL 2XWDA 3D3VA 1K85A 1NC4A 1AGEA 4CD4A 2J79A 3RZCC 1HHIB 1KPVA 4NM4L 1KPRB 2VLLB 1VSCA 2E6QA 4PJDA 4PP2A 3EYVB 3ZO0A 1H3UA 1KGCE 4RX4D 1DANT 3NH7H 3MPCA 1B0WA 3VA2C 4GAYB 1JHLL 4HUUB 4R5EA 4LCWE 2BHZA 4RZCB 3U0TB 3N15A 2H26B 4IRSA 5DMIH 3PBGA 4XVTH 5C08D 3NIFE 5TQ2L 2HFEA 5C0IB 4LFHD 2W9DH 4TTDD 5JDSB 1YEHH 3DXAD 5HHMB 3U46B 2W60B 2VDPL 4W8LA 1O5DT 3ZMRA 4P4KC 4AM0A 4LMQE 2M26A 3C5SA 4WHTA 5LGJA 4OBSA 4G8EB 1T1ZA 7FABH 3P30H 4ETQA 3O6AA 2DI7A 1R3HA 5EWIL 4Y88A 1HOCB 3GBMH 5JNYB 1MNUL 3ZTNH 5C1MB 1AXTH 5FUCC 1HT6A 4YDVA 3VW3L 3MGTB 4XCNA 1YHTA 4JN2A 3PP4H 1CXEA 2GHWB 4MVBD 2ICEB 1QFUH 4TQEH 3AAZA 4FABH 2NYYD 3C60D 5I8KL 3L4WA 3U4EA 3GMRA 4ZPVB 3WUFA 5HYQB 3UERA 1FCGA 1NH6A 1BD2D 4RNRB 2UVEA 3BMVA 2EDJA 4KKCD 4HWBH 3U0WH 4CCCA 5T1KD 3B9KC 1WIOA 4H8WC 3PWJB 1QACA 4W93A 3DGGA 4NRRA 1CDIA 4HKJA 3UJTL 3MUGA 5HSFA 1T1WA 4MDIB 1C5BH 5F9WC 1GCFA 5MEOB 4Q2ZB 3U7WL 5B39A 1CGWA 5GNYA 4UNUA 4O58H 3I3BA 4JANA 1KULA 2A6IB 3JUYA 4AEFA 5E5MB 5C08B 4ZFMA 4UQ2B 1FNLA 1MCIA 4WI9A 3GH5A 1H15A 3DXAB 1S7QA 2P4AB 4U5IA 4AIUA 3DSFH 2ARJA 3F8UB 1N7ML 1CQKA 2EH7L 4KPHH 3AOFA 3HI1A 4PJDF 3QO0A 1MQPA 3RY6C 1X5ZA 3PQYE 4JO4H 5JQ6L 2OR9H 1QNOA 4XCCH 15C8L 1YZZA 2BRRH 3BH4A 1SYSB 2I60H 4ZOEA 3PV6A 1BEYH 4BFBD 1B2WH 2EO9A 2DBLH 1AMYA 1U8HB 4J4PD 3BPNC 5CSGA 1MEXH 5GIRB 1KSRA 4AD1A 3FO0H 1GL4B 2V5RA 1VFFA 4H26A 2ZIDA 2CRYA 3C60B 3D85A 4NUJA 1YEIL 3FJTA 3OG4B 5K9JH 3G9AB 1BYBA 4MWFA 2VWEE 2BHYA 4M7KL 4S1RL 2YA1A 1BD2B 3PWPA 3ALGA 4FTVA 4ALAL 3SDXA 4D0DA 4JDVB 3MRRB 5T1KB 4TSBH 2DDXA 5DD0H 2X8RA 4ZXBD 3WSQL 1WBZB 1KXQA 3FT3B 3MUAA 2PYEE 3P11H 4L9LB 4QOKE 2EXWC 3BSGA 4PS4H 4NZTL 1LEGA 1Q0XH 1NFIB 2ZX7A 5DMGC 2XM1A 4R2GB 4OFDA 1AIFA 5JA9A 1AJ7H 4NGHH 3D3AA 1UUQA 1A6VH 4ZSOB 3AXLB 5TJWK 1X1NA 4JAWA 5GJTH 1RZJC 4HA1A 2UVFA 1F00I 5E2WL 3VMOA 1ZANL 2VXVH 4JFZL 1C92A 3PZGA 5EIVA 2DOCA 2CLVA 4ACZA 5JO5B 3AHXA 3AMDA 3VRJB 1L7TL 2GVYA 3W5NA 3NCJH 5TE4H 1HJVA 4N8VB 4TPRH 1T22A 4GT7A 4WIWA 5J57B 2VAJA 3W9EA 3MXWL 4YPGB 3EO1B 4QHUA 1YY9D 4HBCH 2XWBA 1H8OA 3QJFA 1Q1JL 4P9ML 1UOKA 3EMCA 4QO1A 4X6CB 3P4NA 4WUUE 3D0VA 3ULUL 3OB0K 2R56L 5L8JB 2GCYB 2IBBA 3WNKA 2IUZA 2BZDA 1Q0YL 4ESKA 2DM7A 1N6VA 3QZWB 3GRWL 2RFXB 1X5KA 4OCWH 4AH2B 1IQDA 2WP3T 4XP5L 4HT1H 5BS0E 4ZXBB 4L4TA 3SE4A 4P3DA 1YY8B 4XCEB 2EPNA 4X4YA 2QKIB 1U33A 2TAAA 2X40A 4L8CA 4QLJA 1NANI 3NDZA 1CDCA 2O92A 4PV8B 1R3IL 1EEZB 4AL8L 2FIRT 1EBPA 2W59A 1BWWA 4QRPD 4FRWA 2Q8AH 3ZE0F 3WUGA 1H3WM 3VXUE 4KROC 5EO1B 3K80A 5KSUA 1S9YB 2QHAA 4BUHA 3SDXF 2NR6C 2QPUA 5DRZB 2J4WL 4X7FC 1RUMH 1JZ2A 4CADB 4KK9C 4MGXA 1UQZA 5HHNB 1N5AA 3H9ZA 1AD9B 2ADIA 3KPQA 1CI5A 3HPJA 3GRWA 2FWOB 4HJGA 1TMQA 2GK0B 1WITA 1NJ9B 1OARL 2FSEA 35C8H 4PGEA 2I9LB 3C5JB 4LLQA 4ODXA 2Z31D 2FL5A 1NL0L 3O2DA 1A7NH 2VC9A 3CUPB 4R96B 5GGTL 3X14A 4XNMA 4A6YH 5F7HA 4XP4L 2C3VA 1UWUA 2W67A 5HDQL 4BSWB 3DO7B 4DEPC 1Z2KA 1QSFA 4LX4A 2Z1KA 5FB8B 3MLZL 4L3CB 4P5KB 2PTTB 3T08A 4HKBB 3TIDB 4QYOB 1C12A 3VXRE 2X0HA 3SDDD 1HWGB 1H1NA 1BVNP 2H8PA 3MMDA 5HYEA 4UT7H 3UO1H 1MRFH 3RKDC 1R5IB 4U1HA 3PZIA 3CSPA 1TIUA 2KZ1B 2XIIA 1DSFH 1JRHH 2EYRA 2NY1C 3NCYS 5DZLA 3RHWK 1JGUL 3NPZB 1C16B 1H3PH 4QRPB 1KIPA 3LKOB 4Q7DA 2IBZY 5GGTA 4LSUH 1I7UB 2DLGA 3QEHB 4P2QA 1PG7X 2ZJSH 5IB5A 5ACZB 1RU9H 1HH9B 3KYMA 2B5IC 4AEIL 2V5CA 3MXVH 4LSPH 5AC5A 4J3TA 1JGDA 3V6ZB 3QIWD 3QEGL 2AJSH 2V2WB 5DI8A 3ZM8A 2JJSA 32C2A 3PP3H 4JDTL 3TVMD 5AZ2H 1QRNE 1BFOB 1ACYH 2Z31B 3OAYK 4X7SH 1MI5E 5KG9A 3HI6L 5EZLB 5E9DD 5D1XD 1E3XA 4G9FA 1SR0A 5CZXD 4P59L 2X2YA 2BY3A 5D9MA 4PRID 5GS3A 4TVSa 3WKNA 3MJ8A 5CJ8A 4XBPA 2X4QA 2CHNA 4JZNB 4XH2B 4KI5E 1QI5A 4ML4A 1ZBKA 4KK5D 2GJ6E 5CJBA 1NUDA 1MCBA 3TESA 2FHCA 2V5SA 2WVVB 4G80A 3I9GL 3SGJA 1UADC 1UVQA 3ZE1F 3SDDB 3OGVA 1EGJL 3FZUC 4GRWF 3FHQA 3L6FB 5DLMH 5LCVL 5IM7A 2VRJA 1F6AB 4K3DH 5D70H 4WLCA 1AQ0A 1Z32X 5HXMA 1UJTA 2X89A 4OCXH 1LEIA 1B3VA 4LPTA 2Y7QB 4HZLB 1CXKA 4PREA 3NCBB 2OJZL 2IF7A 4IRZL 3V6FB 2BOCA 1D5BA 3GM8A 5C3LD 3ULUE 4AEEA 1LNUB 3O6KH 2VMFA 5DD6A 3AIBA 5DK3A 1UXWA 3GSVA 3FRUA 4NHCL 5HI3C 4RAHA 1R8LA 2L0DA 1IM9D 4QXTA 3TYGL 2AEQH 4JO2L 4A6YB 2BDNL 5D5MA 5ICXA 2HRPH 3K1DA 2VDKL 4HGMA 4DTGH 3TTQA 3JV4B 1VIWA 1GGUA 3M45A 4RIRA 4WWID 3KR3H 4HS3A 4FXGA 5EZJB 3QIWB 1FBIH 4TUJA 1ONQA 3VWJB 2B8OT 3KPTA 4Y19A 2P8PA 4PJGA 3TVMB 3EYQC 3I6GA 5HJ3A 1EJOH 1HDMB 5D1XB 5E9DB 1XD0A 1YNKH 1FQ9C 4PJ7E 3QUZA 1ZS8A 4RA3A 3EKCA 4X0NA 5SX5K 2WBJA 1X5JA 3UJIL 1T6WA 4PRIB 3P9LB 4L5FH 1KT2B 3UCQA 4C7GA 3ZHKA 5JXEA 4X6EA 4AMCA 3VG9B 3U4BL 1CL7I 1IGJA 1KQYA 3EJZC 2DMKA 2J25A 4JO3H 3BDYL 5IQ7H 5SV3A 3MOBH 2NX5E 4PRHD 1WZ1L 1LEKB 2Y5EA 3OX8B 4HS8H 4NO2A 1R7OA 5FF6A 4V1DE 5I79A 1DQLH 4E5XA 3VJ6A 3RJYA 1GVIA 3ROOB 4F9JA 3MV7D 4N1HB 4O2CB 1JJUA 5LVEA 3TBSA 1UR9A 3LQAC 3ZDXE 2BHUA 3KNBB 4CU7A 4GINA 2XNAB 2DWEA 2H32A 2XVPA 2DRUA 2DM2A 2WMPA 1DE4A 5A2CA 4HUWB 1IM9B 1FGVL 2MQCA 3SOBL 4AD0A 1R86A 4KK6D 2R2EA 4XVJH 5T5FL 1ADQL 5IFTA 1AD0B 1CGVA 1BF2A 3EIFA 1RK1A 3N9GL 3QEQE 5F7NC 1L9MA 1D3CA 5FYJL 1SYTA 4TRPH 1JGVH 3WN5A 1HHHA 3RUGB 3OMZA 2CPUA 3H9SA 2Z93B 2EIEA 3AHZA 4PJ9A 4KJPD 3Q6GH 2YD4A 1MAMH 2HKFL 2I07B 3UBXA 3O11A 1GOWA 1XSJA 2YIHA 4JGUA 3FQRB 3GIVA 1NAMH 3V6OE 2MANA 1O6IA 3SCMD 1CG9B 1EBAA 3PZMA 5D5MF 1A3QA 3BP7B 2VNCA 1ZHKB 3OLGA 1W8NA 5IB1B 3VPLA 1HI6B 1IKNA 5DUBB 1G7LA 2HVMA 2CLZA 2FCBA 3F58L 4GXPA 3UDWA 3FB7A 2DBJA 1KC5H 4OGXH 5JHDE 3KPSA 5ABHA 4PJGF 2H2SC 1PBGA 1G7HB 3RPMA 4PRHB 3D69B 3HKFA 1ADQA 3KJ4B 2Z91A 1M01A 1GSMA 2OZ4A 2YDSA 4JM2A 2BNUA 3STZA 3MV7B 5HHOD 2LFGA 3FO1A 1MAJA 5I8EB 2UY6A 1UD8A 4GMTH 4MS8C 3NBNA 4WWKA 1P4BH 2FGWH 3OZ9H 4NOFA 1E6JL 4LRIA 5HOSA 3BP5B 3QG7H 4XTRC 5F7MC 4UFMA 4N8PA 5EZOL 4C56A 2VXSH 4MXWH 1K2DA 4BH8B 5JXAH 5F1OB 5C0AD 4F9PC 3MRNB 4ZUSA 2J7HA 3KYNA 1EO8L 3MCG1 3T3MF 4LCYB 4GKZB 3TIEA 3WNMA 5D7KD 1AHWB 1QUNA 4LNRA 2YWZA 2PYFA 1L7IL 3B9AA 4HW6A 3P77B 5B39G 1ZSDB 5I1AA 3WFEL 3DSNA 3DYPA 1RJLB 3KWWB 3CLFH 4TTDC 3SCMB 1C90A 3ZT5A 3ARDA 1ODAA 2A6KB 2VLJA 5L9DH 1B6UA 1QZ1A 4UDUB 1GVYA 5F9AC 3P9MA 1DCLA 4OLWL 1I9IH 1D5MB 1UD6A 1A8JH 2R69L 1EAPA 2FO4A 2VDRH 4ERSH 3MYJA 3QP3A 3RDTA 1LQ0A 3H9YA 1HJSA 3OG2A 1WTGT 4IOFD 5CILH 3L4VA 2YZ8A 4OSUH 1E55A 4MVBC 3V95A 5IEKA 3X12B 1B0RA 1G9MH 1TTGA 4J1UB 4LBEA 3P4MB 5HHOB 2NYYC 1BREA 3C60C 2FBJH 4BQBA 3CJJA 3LV3A 3CFKB 1CICD 2AI0L 3ARTA 3TONA 4W84A 1GRWA 4WO4A 4O4YH 3GJFH 1M71B 5INDA 3NMEA 1E6OL 4U33A 2YEZA 2AK4D 2F53A 4Y5VB 4FN0A 6FABL 4NZUL 2P5WD 1U8LA 2AXHA 1YEFH 2Y07L 4Y8AA 2EYTA 5C0AB 4Z2LA 5M7QA 3VUPA 1VACA 4L8SB 1T3FB 4L9LC 4PTWA 1KENH 4B9ZA 2J6EL 3EFDL 1ZT1B 3I6KA 4JM2F 3IJ8A 1A14H 3BAXA 1IAMA 3QCVL 5I15H 3G5XA 1YN7A 4U1NA 2Z8WC 4H41A 1MCJA 2UZYB 1BZ9B 5HDBF 4JQVA 1I8MA 5EUKB 1KXVA 2FH8A 2XQBH 1R5WA 3OKEB 1OAQL 3B8YA 1CK0L 4NM8H 3WE6B 4Q0XL 4XPAH 4FF5A 1FZOA 3L7FA 2YD8A 2JFEX 3CFCH 3WIIH 2EPLX 1UKSA 5FYJE 1U8MB 4G7YH 4MQ7B 1FV1A 4GFTB 3GMQB 2R0ZH 4XWGL 3ZT6A 5HVFB 1NBVH 5BVPH 2D3VA 4EOWH 1ORQB 4HIEA 3SCQA 4N5UA 1WDRA 1JUFA 4J4PC 1QOKA 5GGUA 4U1IA 2VXQL 1FYTE 4JRYD 4NO0D 2ZWLT 4EUPA 5I0DA 3ULVL 2Q86A 4GJTB 1ZA6A 4JQIL 3T2NH 3TJEL 4MNMA 1CICB 4J3SA 2XWTA 1YPZB 3D6GA 1ZHLA 3WKZA 4LRNH 3QHFL 1S7XA 3RIFK 4O51A 2I9TB 4E41E 3VFUB 1KB5B 5FKPA 1IZJA 2AK4B 1JPGA 1FL3A 3MLWL 4ZXBC 2P5WB 4ODVL 1BWMA 5BXRA 1HL8A 1IAIL 1DWAM 2HT2D 5IFHL 5DA0B 3TEUA 5HYIA 2BSRB 2AGJL 2MCPH 2B1AH 4FQPA 2CYGA 4LCWD 3VGHA 4BZ2H 1E56A 1NWTA 1T5WB 3PL6D 3BPCB 4N8CH 1V08A 4WRLA 5ITFB 4OGYH 3ZYZA 1ES0A 4QCIA 1ZT4B 1DWGM 3A4WA 1NEUA 5D8WA 4OZIE 4LPUA 1W72H 1TJGL 2ATKB 5I1DA 5B3JE 4U0QB 3S34H 4QF1A 3ZYIA 3S7GA 1ZGLA 3PDGA 4NSKB 3BKCL 4WW1A 2ZZUT 2C0HA 5BXPA 1Y7VA 3SKNA 1PX3A 2D22A 3U1SH 3ME0A 1ED3B 2N4IA 5TGBA 2B1HL 2OSLA 4U7KA 1GUVA 2QQQA 3GJFB 1YY9C 2VCCA 1CFBA 3RRQA 3L2MA 2HH0L 5C6WH 1J05B 3ARED 3CMOL 3U0PA 3IU3B 1Z0MA 4LLYB 1Q94A 3R1GL 3BO8B 4FG6D 3N04A 4JRYB 4NO0B 3T4YA 2IH3B 1JXKA 1KYOJ 2JB5L 2V9QA 1WSST 2K7PA 2ZOKA 1KG0B 3WD4A 3NA9L 3QWRA 3VGDA 4KZDL 3UPCA 3FFCE 1WFNA 1XSIA 5CPTA 4K3JL 4R4ND 4JLRB 4WDIB 2YBUA 4KVNH 4AIZA 1IRAY 4PCSA 2QQLH 2QQNH 3FB6A 3NYDA 4MAYA 4JFXB 3RVXD 3T2QA 4E42B 5IESH 3ABZA 5EDXA 4LCWB 2Q6WB 3IFNL 3PL6B 4UTBH 1KEML 4MA3B 1JRHI 2OXHA 3OTTA 4OM1H 4U1KB 3QQ4A 4XMKL 3LHPH 1EZVY 4EQ2A 2NZ9D 1UWSA 3LS4L 4YQXL 1UD3A 3DMMD 3N11A 4DM2A 4L4OA 3ZJ6A 4XPHH 4DGIH 1CLOL 5DXWA 1J1XH 4N1EA 2DQUL 4I0PA 1QHZA 2Y1VA 1MCLA 3ETBF 4Q9QL 1XGYL 1T80A 2IADA 3IETA 3H2WA 3SDCD 2DLTA 1KTDA 1BIHA 3OAZH 2AABH 2YC1B 4D72A 3T0EA 4LQFH 1UXSB 1DBMH 2AEIT 3AREB 5FFLA 5ALCH 4HFUH 5CEYA 1F58L 1T04A 3CFBA 3D3VD 4G42A 2XY2A 1QYGH 1NC4D 5D9OA 2QJDA 4NM4H 1H5BB 4S0SD 2EDTA 2OYPA 3UG5A 5FCZA 1DUZA 2ED7A 2I27N 4Y5YA 3BZFA 1OWWA 1EVUA 2PWGA 5L7XH 3SDDC 4WHDA 3IDIB 1DVFA 1IEAB 1BFTA 1GOMA 5DQDL 3R0NA 3H9HA 1T0NA 3GI9L 2EYSA 1KUMA 4QOKD 2O5XH 2VXTL 1W72B 4XB8A 4XBEL 5D2NA 1XCTB 2J7LA 1V0KA 4NQSB 1J8HE 2B20A 2O5YL 4KVCH 1F6LL 1EEQA 3MODL 3AZSA 5J9PB 5MENA 5C0DA 1CXHA 3VCLB 1MWAL 2BXZA 5DDHA 1U9KA 1QEWB 3RWFA 1VGEH 3HAEA 3MJ7A 5E6ZA 1T4KA 5ALBL 3ULVE 3C9NA 4FLOA 4XP6L 1FVDB 4U6XA 1J1OL 5IJVA 1MNUH 5ABGA 1QKZH 4HOWA 5ECUA 3HLAB 5CJQL 1YEKL 3HNVL 5GGVY 3PZOA 2NY3C 1YYMH 4H5SA 5HGBA 1EV2E 2OS7A 2PW1A 3SQOH 3VD7A 3DMMB 2W38A 4QRTA 3QIWC 1TFHA 2HJLA 3QDME 1IT9L 4RAVA 4M1CD 1NSNH 3EGSA 3TVMC 1F13A 2DJUA 1JXJA 1C5CL 4P48A 3SDCB 3L3KB 1UZ8B 4O2EB 5D1XC 5TQ0H 5DC4B 1Q6FA 5CZXC 1S7TB 3O3EB 5DO8A 1O7SA 1Z3GL 2NXYD 3BH9A 3CNKA 4QFUA 1JF1A 3D3VB 3U9UA 3UJTH 3QNZB 1NC4B 4B3KA 2VOTA 3UG3A 4YH6A 5J12B 4P2RA 1KPVB 4PJIF 4WVRA 3VG9C 1FGNL 4OF8A 3ALXA 4KK5C 3U7WH 1J10A 5DTFA 1ZVSB 1NEZA 2FZ3A 2HJFA 2NW3B 1XH1A 5JTWA 4KQ4L 3C6LA 2VVNA 4M43L 4QOKB 3N50A 3W0WA 1W1VA 2HFEB 5DD3L 5IV2B 3MNVA 1Q72L 1E4XI 1QVOA 5E09A 2A3HA 2GJXA 4AM0B 5DC9B 1HCFX 2EH7H 4MNGE 4X4ME 3GEWB 3C5SB 4WHTB 5LGJB 1PKOA 1T1ZB 1K9EA 2D03L 4OZGA 5JDJA 4ETQB 2OWCA 4CD5A 3NCFB 15C8H 3QDJA 1ODUA 4FA8A 1EO7A 2B7DT 5ACMA 3UXFA 3EOTL 2IG2L 3FAWA 1J7VR 5DJAA 3AAZB 4L4VA 1JVKA 3D85D 2FBOJ 4OTXH 5EBWA 5E95B 3U4EB 4LL9A 3HZVB 3GMRB 1E4KC 2PUQT 4M4PA 4S1RH 5KBNC 3CHFA 4CD8A 1US2A 2R0KL 3PWPD 3SE8L 4OV5A 1I8KB 3EFFB 5I2UA 4M6OH 3L5WA 1WGOA 3UBXG 2IGFL 4XZUA 2PN5A 1XR8B 2NXYB 3DGGB 2XIDA 1U91A 1N26A 3SQBA 4IMKA 1ZK9A 4NZTH 1T1WB 2C7UA 4DQOH 5E8DL 3VXRD 4KY1L 3SUUA 2NTFB 5FUZH 4UTFA 1R3KA 2ZCHH 4C59B 5AC4A 3AMKA 1I9JL 2ICCA 4I0CC 3BSZL 1FVEB 4HIJA 5TFSL 4J23A 3EDEA 3KJ4C 2OL3A 2CKRA 4ETYA 5IHZA 1H15B 1ZANH 3MRHB 3MC0A 1EFXA 5H35A 2XPKA 1U92A 2A9ML 1H5VA 2ARJB 4MD4B 5I66A 2EPKX 3WIJA 2V17L 1D9KA 5LG1A 1TDQA 1XF1A 5C9KA 1TVBA 3KPRE 3HI1B 3BT2H 3QO0B 2VJXA 4MA8L 4CMMB 1MCPH 1BAFL 1CD0A 2EIDA 1X5IA 1WP6A 2QLYA 4KK6C 4WI6A 4UB0H 3GO1H 4J3UA 1C91A 2WMKA 1Q1JH 3OQ3B 4D0BA 1EIBA 2GITB 3LD8B 2X4NB 5F6HJ 1V6WA 5I1GL 4OCLC 1AHWC 1Q0YH 4H26B 5KVGL 4TSCL 4NUJB 3D85B 3UTSE 2BVUA 4EJ1C 5FYLH 3GRWH 2FLRT 4MWFB 4M24A 4GRWH 4JVPA 2VRKA 3O2DH 3PWPB 2QSCL 4OZGF 5IMLA 4XP5H 2J47A 3FOLB 3SCMC 4L4TD 3N85L 3N1GC 3GNPA 4ZS7H 3RWDA 1Y0LA 4YUEH 1Z0NA 2GJ6D 4DK3A 1LEGB 1VAHA 3VXRB 2ZUWA 5CBAA 1R3IH 3TA3A 3HI5L 1K6QL 1RIUL 4AL8H 1EOKA 1Z9LA 2AEPL 5A43C 1AIFB 5BWFA 2ZG1A 5DYOA 1G84A 1V7NL 5F7FA 5C0FB 5A2BA 1U8OA 4YBLB 2HISA 3IAPA 4LASH 1GOQA 4ZNEE 2VX4A 3ULUD 1RZIB 1JYNA 1X5FA 4G6KL 2CLVB 4ACZB 2CRMA 2IQAB 1B90A 2YL6A 3E6FA 1A3HA 1ZGLP 5JW3L 4O00A 1T22B 1KCVH 1OARH 4OJYA 3EYFA 1HVQA 4GW1A 1S9XB 5IFJA 3WJJA 3P0VL 5JORB 5EOTA 5GGTH 2YD2A 4X7DC 1T0MA 2XWBB 2ZPKL 2YL8A 3IJHB 4LDEB 1MJUL 5HDQH 3B8SA 1RUAH 3VD9A 4L8SC 2ZX8A 1X4ZA 4PYHA 3D0VB 3JV6B 2DLHA 3MLZH 4WV1A 5E8NB 5J6HA 1GGCL 3S37X 3WMCA 1EUTA 3MO1B 4X4XA 2C1OA 4YAQB 1IQDB 3QIUA 1E4NA 4DK6A 5F97E 2XXMB 1QHPA 2XZCL 4L4TB 1ESWA 4UQCA 3B6SA 2XJ7A 4P3DB 4R0LA 4X4YB 2GJ6B 3MFFB 1HCVA 4YHLL 3ZSTA 1OD8A 1JYVA 1J12A 2YWYA 5GRUL 1JAKA 3QHZH 4UR9A 3CVIL 1KTLA 4V1DD 4Q6YA 4IOFC 2YN5A 4L29A 3O6LH 1X5AA 5JHLL 4H04A 1MJ7L 2ZUUA 1QLEL 3MNWA 2UYLA 3LS5L 4MJ2A 3V4PH 4Z7OE 2VCBA 2WHJA 1E27A 3KS0J 2CK2A 1FG2A 2ADIB 1CICC 3KPQB 3QEGH 3ALFA 3WF3A 4HJJL 3HPJB 3L2LA 2VH5H 4HJGB 5T1DH 4EUPG 4JDTH 5JW4R 2FSEB 1UM6L 4OCRL 2IEPA 4PGEB 3MRLB 3QT2A 4LLQB 4GMSL 4ODXB 2FL5B 3HI6H 1WDPA 2R1WB 4NRSA 3QEQD 2DDQL 3X14B 4XNMB 4G9FD 3SKMA 1JWSA 2C3VB 3IJYA 4HUXA 2XFRA 5EOQL 3K81A 1GQJA 4OZFG 1S5IL 3FRPA 2WWMD 4E8CA 2C9AA 4ELMA 3I9GH 3PWLA 4LSTH 1YQ2A 1EGJH 3HNSL 2EPOA 3AMCA 4OKVB 4OZ4A 4JGJA 1DHKA 1EHNA 1G9MC 4QNPE 5I1JL 3KPLA 4TOQA 1WT5A 5LGHH 3J7HA 4IRZH 4ORGA 1NARA 1CD8A 3VI3E 2EYRB 2DSVA 4UV7L 1NQ6A 3S2CA 2P44B 1KIPB 1UR0A 3HZYA 4HFWA 4V1DB 2EDYA 1W32A 1V02E 3TYGH 3PZTA 2HKHL 2JLLA 4JO2H 3ZKND 5INCA 3VWKD 5IB5B 2BDNH 3QIBA 4HS6A 2VDKH 3QQ3B 4YHNA 1KFAL 4PY8J 3KYMB 1EDGA 5FGCE 4JCLA 2CKBA 2V3DA 1JGDB 3CIQA 1NDMA 3SN6N 4K8RH 1HH6A 3M1BB 5IW3A 2AOSA 3BAYA 1PJ9A 3JWDL 5DI8B 4PRBA 2F8OA 4LPYA 4Y19D 4BFEA 5A6JA 4YR6A 2WW5A 1ZT7A 5IVXB 3MLSH 3QEQB 2KUTA 1WICA 1HSAA 4G9FB 2EDDA 3QUZD 2D7QA 2HT2C 3BPLC 5FOBA 2AJYH 5FK9A 5HYSA 1UCTA 1CPUA 1BQHA 3F6IA 3L3JA 5KANG 3LPPA 2VYRE 2OMBA 5DJ6B 3EOBB 3AIQA 3MJ8B 1BFNA 5AYIA 2X4QB 3PL6C 1G6RL 1XAUA 1VPOH 4HQQH 4M1GH 5C07E 2NY0D 4KKAC 1TZ7A 5E70A 1NM9A 4G80B 3W27A 5FECA 4X9IA 4Z7VE 5IMOB 3FTGB 2HT3D 2XTKA 5GS0H 3Q5TA 5JMRA 1GZPA 3B2UD 3K2UL 1LEIB 2NPLX 3BE1L 3GMLB 3WQ5A 4K8RD 1ZLUK 2BOCB 2FNBA 3QWOA 1D5BB 4EKJA 2P5EA 3NDYA 1NCWH 5DD1L 3GSVB 4BQ6A 5DVLA 4ELMF 2MHAA 3V4UL 4J7RA 2XRAL 3VWKB 5T5FH 3AREC 1ADQH 2EDHA 5D5MB 5ICXB 1FL6B 3HR5A 4Q9CA 4D6EA 5EBMA 3N9GH 1FO0L 4FG6C 3WSUA 4ZOCA 3UEQA 3BUYA 4IHOB 1H5BC 2W65A 3TBWA 3V52L 4FXGB 3LDBB 2QPSA 4IDJL 1DUYA 4GRLA 5C9JA 3O3UN 4UQBA 4TUJB 1ONQB 1F4XH 2OTUA 2Q20A 1LL4A 4PJ9D 2HKFH 4Y19B 2P8PB 4GI8A 3OKLB 1I3VA 1UC6A 4R4NC 3I6LE 3VXOB 2VL4A 5EO0A 3AS2A 3QUZB 5C0EB 5DJDA 3NFNA 3BI9X 1TFVA 3RVXC 1YMMA 1MRDL 3QXUA 3M6DA 1AH1A 3L4UA 2AKRA 1GNXA 2AAVA 4W85A 4X6EB 3QDAA 1IGJB 1WLHA 4K7FA 2Z1SA 2NY0B 3X13A 3HAEG 4KV5E 5JUVA 1T66D 3IFOA 4TUKL 2ZUYA 2EH8L 3LPGA 2NZ9C 5IW1A 1G7MA 3G08B 1I1YA 4ODUA 2B39A 4E5XB 2QSTA 3DMMC 2E9MA 1CE6A 4PRDA 3VJ6B 5FYJD 3BDXA 3V79C 3N1FC 5D6CA 5DMKA 3TBSB 3O0RH 2YUVA 4C57C 4FQCL 4OGAD 1J8KA 3SDCC 3W6MA 2NLJB 4OZHA 4KJYA 2GSGB 1GCYA 1T21A 1FYTD 1U3HA 1UENA 1GHRA 4C56D 4DKEL 2R2EB 4FQIL 4Y4HA 3GHBL 43CAA 3CUGA 5E0CA 3VD5A 1I3RA 4PTTA 3S35L 5J12C 2E8ZA 3WUEA 4LEOA 2FDBP 3WN5B 1HHHB 2A1WL 2XKNA 4ODBD 5DJ0A 5HHPA 4N0CC 4ZEPA 1RAMA 1UWTA 3O45A 4PJ9B 4YWGH 1RIHH 3UBXB 1C5DB 3C6SB 3O11B 1TCRB 4KUCD 4H25A 1AY1L 1BOGB 3AM8A 1NEZG 3QPQD 4N5ED 3ECBA 4P9HC 4APQA 4DKAA 3RDKA 4BFIA 4MXQD 5A16A 3LKQA 3T1WA 4J6RL 4XC1L 3ROLB 3CUJA 3ARDD 2VLJD 1S5HA 5JR1L 4OT1L 1CDJA 3RWIB 1CXLA 4X99B 4OLWH 1G7LB 1XH2A 2CLZB 3QR2A 2FX9L 2R69H 4RMQA 4CKVX 4UOW0 4QWWD 1HIZA 2YUWA 5JUEL 3RDTD 4P5MB 4EDXA 4LHUA 3L1OL 2H3NB 3W2DH 1HJWA 3ARQA 3MRPA 1UM5H 3DUSA 5ESVA 2AI0H 1CIUA 3PABB 4M1CC 4WWKB 2WMIA 3S6TA 5D9SB 4KI1A 4WO4D 1E6OH 4F7MA 1WIPA 4G8FA 4MJ5A 3HC4L 5DEFB 1FYTB 4XNQA 4YDJA 4C56B 6FABH 4XCFL 5CJXA 2IANA 5JOFB 1K2DB 2NXYC 4WSKA 2CUIA 4NJAL 3VXSA 1CD9B 2J6EH 4ZUSB 2Y5TA 3TZVC 3KYNB 4EUPH 1LO5B 1B6DA 3AS0A 3TIEB 5ID0A 4PMVA 4LLWB 1XGTA 5E2UH 3IXTA 5KTEH 1OD0A 2FJFB 1NWRA 3AQUA 2PYFB 4NSBA 4U6YA 3SDXE 3U7BA 3V4VH 3EHBD 1N5YL 4OZHF 4AISA 4UQ3A 2FD6H 4JQXA 2XKSA 2C3WA 4JFEE 1XGQB 4NO3B 1J86A 3PHOA 1PDKA 4OZFH 3ARDB 1GW1A 2VLJB 4Q0XH 1LDPL 1RZKL 4YNYB 2V9RA 3P9MB 2VL5A 1U8NA 2WV3A 1QRKA 2EXOA 1JWUB 2OJEB 3JTTA 4DGVL 2XSAA 3G6JA 1EAPB 2FO4B 4LGPB 1EMTH 2C1PA 5DF0A 3BAJA 4FNLH 3RDTB 3HU7A 4OQTL 3FB5A 5HVWA 3K8KA 1K8DA 4G43A 3LKRB 3TO2A 2ERJC 4AEHL 1GHFL 3LD8C 4H0GA 5I30L 4IPNB 1A6AA 2VXQH 4IIQA 5ANMA 4O2FB 1B0RB 4LBEB 1UB6A 3TJEH 2Y4SA 3LV3B 2J7DA 4M93B 3QRGL 1U2YA 3AY4C 4WO4B 4J3WA 4NNPL 2HJKA 4XAKE 5INDB 4NQCA 3UTOA 3QI9A 2YEZB 2E6PA 3MLWH 4XPFL 4ODVH 1J5OH 2WC3A 3K46A 4DWHA 1IAIH 1U42A 2EYTB 5HTSA 1YMHB 2YKLH 4PJEE 1B1YA 3RGHA 2ZOLA 4RISL 3I6KB 1R3JB 4HKZB 1XD1A 4OJFL 1FNEA 4HOXA 3DC0A 4DZ8A 3TYFA 1YN7B 4Y1AA 4U1NB 3T2OA 2YUXA 1J8HD 2VABA 3REVB 2JELL 1RSFA 1LK3L 2NQCA 1I8MB 1WO2A 4YBLC 1TJGH 3MROA 5K33A 3OKMA 3E8UL 1HYSD 1K5NB 2DQIL 4QY8A 1KV3A 3ULVD 2C3GA 4F66A 1FZOB 3L7FB 1BM3H 2GEEA 4WFHE 3WL9A 3A0OA 3L5HA 5BOZG 3CZJA 2YPLA 3CZEA 4JL2A 3CAFA 4C7FA 4PJXA 4HIEB 2W92A 4EBQL 3CMOH 1ZLVK 1JUFB 3Q6FA 5GGUB 3MV01 3U7VA 1KCKA 3QXDA 3KYOB 1AC0A 5IVZB 2JB5H 3HCVA 4PBXA 4EUPB 5CAYB 5A8OA 2D2OA 1EEYA 3NA9H 3NFPA 2YMXH 5MHSE 3ZE1E 2XWTB 3QWRD 1ZHLB 2ZNXA 5HPOA 5HI5D 1S7XB 3ARBA 1XF4A 4O51B 1O7AA 4LKXB 4K3JH 4MX7A 3WF0A 1G0DA 5FKPB 3MACH 3G6JF 1W3JA 2ZUNA 1BX2A 1DBBL 2J7CA 2DM3A 4LVHB 4JRXE 3SE4C 4AC1X 2GJJA 1I7ZB 3PWUA 1SYVA 3HB3D 1QSFE 2EE9A 4OZFB 4JKPL 3RWGA 4MAYD 2XVKA 4GG8A 4PV9B 1FN4B 4ZTPL 4QRSA 5FYKL 4PRNB 1A9BA 4N0YH 1V0NA 4NI3A 5FHAL 1J8HB 3OKOB 1ES0B 2G3IA 4RFOL 4XMKH 3WS6C 1CDGA 5M95B 4QTHA 3LS4H 1W8OA 3ULUC 4QF1B 4YQXH 4I18B 1RFDL 3QGVA 4M03A 2J88L 2YPVH 4WW1B 5T1MA 4I2XA 1TA3A 4FK9A 4QHNA 4UU9A 3HAEH 4KTDH 1G7QA 2DQUH 3D39A 3SKNB 3TGXA 2ESVA 2YS4A 4POZD 3V0AC 4L9DA 5GRYA 3PGFL 1I8IB 2CIPA 4I3RL 1PIFA 5L6YL 3S9DB 1WKYA 1FCCA 2VLRA 4MNKA 4TSAL 5ADPL 3IVKA 1EJ6A 1M03A 2ZX9A 3U0PB 3M17B 4LVEA 4RE3A 4P46D 3R06A 3N12A 2ZOKB 4YK4B 4MNQE 1KTRL 2DIAA 4XVUD 3N1QC 3UZEA 4PGBA 2WUBL 5DQDH 4AQ1B 2D0FA 2ZUVA 4ODTL 3MANA 3GI9H 3Q1SH 2VXTH 4AIZB 4XBEH 1WC7A 2CSPA 4PJXF 4X9BA 3FB6B 3L5XH 3OGRA 1INEL 2WCAA 1AFVL 4MAYB 3AU1A 2O9OA 1IM3B 1GAFL 2DLFL 2JIXD 3MLVH 3GKWH 4XP6H 4HPHA 5IVNA 4P8UA 2CJUL 2XYLA 2VISB 2AJ3A 3WEZA 5ETUA 2D31A 1M7DA 4OFKA 3UESA 2CUMA 4MNGB 2AQ3A 2J8UF 1UB5A 3KPRD 2WVTA 1GGIL 4U6HA 2BNJA 4CAGA 2DQEH 4V28A 4KRMB 4GZEA 3SKUD 5T33H 3D48R 1MSPA 3U4AA 4DN4L 3ZJ8A 2IADB 2XZQL 3RWJA 1FZKA 5GGQL 3RVTD 3B9KA 4KC3B 1NBYA 5I1HH 2E6JA 4P46B 1CFVL 5CEYB 2BY0A 4N0UE 3L3IA 4G42B 2FX8L 1FH9A 1AO7A 5I18L 4P2RD 1FGNH 5HYSG 1BQHG 2N1KA 4Y5YB 4WTWA 2WWMC 3BZFB 3DYOA 4PJGE 4XGZA 1GQLA 4YE4L 2XFYA 4KQ4H 1KB9J 1BTCA 4ZFZB 3H9HB 4M43H 1QNZL 2EYSB 5I75B 1BSIA 4OLYH 3UBXI 1AQDA 3NN8A 3MLXH 5C0ND 1MOEA 1Q72H 3CMJA 1AP2A 1KB9K 4UOJA 4PMQA 5BZDA 1MVUA 4X80L 5DDHB 2DJSA 3GH4A 4UTAL 1MFUA 1JYXA 1W1PA 3HAEB 3UR8A 2EDBA 3RY6A 2JIXB 1T4KB 4NBXB 1YDPB 3C9NB 3L3OA 2D03H 4U6XB 1SJHB 3VFPB 3GSOA 4QCFA 3QNXB 2VDQH 3ZKNC 1B9ZA