5JIPA

Crystal structure of the clostridium perfringens spore cortex lytic enzyme slem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
GFAQDKNPLSTFGPDLNEFSRDVNFLTLAKNSDFIYLRASGSGTGKLRIDNKFLEFAKECRRLGIPCGAYHFAKPSKDLDSAVIQADQFIDVLQQGFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTDEGKLDGVGSPVDLNWGPNSIDSLMPPSAVTGLNAYISGNKIFVNWTANKEDDLNGYNVFVNDNYAGTLPRKATKIVIDKSRFYLPKGKPIKISIEAFDITGDFSKERTEYILDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Clostridium perfringens SleM, a muramidase involved in cortical hydrolysis during spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords Cortical-lytic enzyme
total genus 95
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jipA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5jipA01
3IB4A 3MR9B 1K4DA 5KAQF 2ZG1A 2DQUH 4Z78B 5FKYA 5L9DH 2D2OA 5DQ9B 3VI3F 1HYSC 1ZBVA 2QMKA 3ZKXB 1IC7L 2MCPL 1N2RB 5FV1L 4B50A 4QTIL 2VQTA 1NAML 3VIHA 3BN9D 3CFEA 4Y8AA 1TIUA 4UDUA 1P6AB 1L8NA 1ZLSL 5I6XC 2IUZA 3BHBB 4MD0A 4AQ1B 4P2CG 1DWJM 1G94A 4YHIA 5HI3C 3LRHA 5JNYB 3MNWA 5EU7C 3QIUC 2HFEB 3BPLB 2H1PL 1I8KA 1IFHH 5GGVY 2OX5A 4PJDA 4DJMA 5JHLH 1CICA 1U8QB 1KIQA 1YEGL 1R5WA 1EDTA 1NGQH 5FYKU 5J3HC 4HG4K 3QUMA 4X83A 1Z32X 4JO4H 1B1YA 4UT9L 3BH8A 3KYNA 2DQEH 4OLUL 3SO3C 2VDRH 3MGTA 3TPUA 2D7QA 1NUFA 2EIEA 3AB0C 2OXHA 3AC0A 4HXBH 4NZTH 5GS2H 3PGFL 4YO0B 5INCA 5DURD 1QSFA 3TN0B 4TTUA 1EUUA 1WIPA 5F6HJ 1RK1B 4NSKA 2BHUA 4D6HA 2FSEB 4NRSA 2YKKA 1F5WA 3PWLA 4MWFB 3CH9A 5D5ME 1MSPA 3TH3T 1CIUA 4PP2A 4TULL 4Z76A 2GJ6E 2QLVB 1W1VA 2EDTA 4QXGL 1UD6A 4R3SB 3X13A 2VXTH 1QLFB 2X9WA 1OF2A 4DZBA 1LQ0A 2R1XA 2IALA 3KHQA 3ZOAA 4MJ6A 2PO6D 2IAMB 3VGAB 3F7RA 4A3HA 4WGVB 5HDBE 3LV3A 3PV6A 3HZVB 4QHUA 5ID0B 1K4CA 2QMJA 2X7LB 1GQIA 3HU7A 4KK5C 2I5YH 3QI9A 4OZOA 1K2DA 5HHOD 1DL7L 1JGUL 1MEXH 3HG1E 4OLUH 3OGSA 1V6UA 4MA1C 4PB0L 1I1AB 4QTHB 4NO2A 1T80A 4W86A 5TE6L 4QRRB 2VC2H 2J4WH 4OIIL 1FO0H 3WKML 5IB4A 1F2XK 3EJYD 4OLWL 3ULVC 2HKFL 4LGPB 5CMAB 5T33L 1M03A 1HVQA 5MEQB 3MTRA 1EEZA 2XQYG 1NDMA 1Q9WA 4MB4A 4C56A 1CDCA 1AXIB 4NGHL 4AL8L 2V9QA 4JFFE 4I5BA 3FO1B 3MODH 3RWJB 3SQBA 4CDHA 4F7PB 3CZLA 5CEZH 4PB9H 4BUHA 1BSIA 1CXKA 1JPTH 5IGXH 3EJJX 3EJYC 3AHTA 2NTFA 2VZ1A 4K71B 4Y4HB 5CSBA 5BMFH 4HGKC 1BHGA 4TOYL 1EO5A 4HMDA 2YDRA 1MFVA 1PKQA 5E1HB 5IKCA 3SUWA 2AI0H 3BP7B 2ZOKB 3D39E 2XZZA 1MJUL 2J3SA 2XUCA 3H7LA 3WKZA 2X1QA 5J4MA 3GBEA 4NO5A 4Q9BA 4PGDA 3A67H 4AEHL 4WENB 1JHTB 3WFEL 1ZHNA 4UIMA 2DOCA 3EW3B 3HNTL 1OM3H 3C8DA 4WI5A 5F7DA 1NDGB 2VUYA 5T1KA 1A9EB 1H3UA 3HI6L 4XP1H 4NCC2 4ZOAA 4GRWB 3RDKA 4H8WC 4WHYH 1E3ZA 2E3ZA 3JWOC 3VIIA 3TBVB 4AH2A 1F3DJ 4CUCA 4TTDD 5I0DA 3DHUA 1T7YA 1VGKA 1DWIM 4R4BB 5CIPB 1F02I 1NC4B 3JTTA 2XRAH 3WD2A 1W72L 2FDMA 5D70L 5EA0H 4KY1H 5I75B 5E24E 1AJ7H 1VERA 4MVBD 3SE8L 3TIEB 3ARRA 2CCRA 2V9TA 4JREB 4WW2B 1RJYA 1T5WA 4PJ9C 5DRWB 3OPZL 1G7PB 3RNQA 4C7DA 2UUDH 4TVSa 1LO5A 5DRZA 1LF1A 2PO6A 4DKEL 4OCWH 1MJ7H 2HVJB 5EORH 2V7NA 3QFJB 3SBWA 5HI5C 3QEUB 1JJUA 2KKQA 4E42B 4U33A 5FKPB 2J8OA 5IMKA 4O2EB 1MI5A 4WW2F 1H0DB 4DOHE 2PXYD 4IIQC 3PDOA 3GSXB 3MCLH 2FL5B 4KRNA 2VI0A 1H3PL 3WNKA 3Q6GL 4LAQH 1UD2A 3MRCA 3SDXE 1NFDA 3QGVA 2GUYA 3G6MA 5DC9B 4AD0A 3A6BL 1G7HB 5DA4A 1X3DA 4CVWA 1NAMA 3O8XB 1BYAA 4HK3J 3QDGA 1WVZA 3F58L 4A6YB 3HMWL 4P46D 4ACZB 2GK1B 1H49A 2YL9A 2XXCB 1RURH 3IXAA 5E6ZA 2Z0BA 3MRGA 2IPUK 2GY5A 1LD9A 5L2KE 4G9DB 4P4KA 3FRUA 3W39A 3W0WD 1OSEA 1FVDA 2H45A 5F7YC 5EBGA 5CD3B 3QXTA 5D7IF 1UR9A 1RZFH 3G5YB 4NNPL 1X1NA 5FM8A 5JHDB 3C8KA 2WBJA 4M9PA 3VRJA 1UKOA 4TYUA 3RBGA 1DP0A 4PD4K 3C5JB 1V0NA 4YBLB 2ICWI 2FBJL 3K80A 3D3VD 4K2UL 3UX9B 3H9YA 4I4WB 4HSQA 4PTXA 4N90E 5C2BH 3QDJA 3QQ9C 1I8KB 2CNCA 2DWEA 2BSED 4HWEL 3ULSA 3GNRA 1R7AA 2XQYK 4X4XA 5EU5B 5JDSA 3WSQL 1Z9MA 5IFTA 4AT6A 5GS1B 1V02E 3DRQA 1AI1L 4UBDC 4KTEL 4DFIA 4OAWB 5B3JE 3GH5A 1F90L 3WBEA 1HKLL 1PZ3A 3QUXB 2A3EA 4L8CA 1JFQH 5EZOH 1EHXA 2VX5A 1MFAL 4XMLH 3BP4A 1JPFB 4U1GC 4D0BB 3GHEL 5BJTB 3F6IA 5FXCH 2CIPA 3BESR 5DFAA 5KVMC 3MJ9H 4QDMA 4TSCL 1KJVB 1NFDE 3SDXA 4JFTA 1SEQL 3DURA 3KPPB 4ZTPL 4AZ8A 1PSKL 1RJCA 1E71M 5D9SB 2H2SD 3FOMA 1MVFA 1NGPL 3SDCC 4HFWA 3BH9A 4FQJH 3VVGA 1W0VB 4ZTOH 4F3FA 4RQQA 2AJYH 1S7SA 3PP3H 2WXDM 3U7VA 2VX4A 5EUOF 3BD3A 3VXSD 5D7JD 1WBZA 5KSUB 3MV9A 3M8OH 4HU8A 2G8ZA 3WS3B 4FQPA 4G7VL 3DXAB 4M1CC 5DMKB 4JL2A 2YPVL 2ZKHL 5L88H 4DK6A 2WZEA 4K3EL 2QADC 4OF0A 2DQCH 5BVPL 4GW5B 3ET9F 1EHNA 1UG9A 4WV1A 5HVHB 1VESA 5E2TH 4QHUB 4AY0A 2XG9A 5J0BA 2YR3A 4U1MA 5C6TH 1KJ3L 1A7BA 2R69L 2CKBL 5C0BE 3BWAA 5B21A 3RY5A 2O26U 3DPBA 4LDOB 4YBHA 5TFSL 3UYRL 4OM1H 3KXFE 4LLYA 4JAMA 2R23A 5HD8C 4N8PA 1OGGA 5F1NB 5IROA 1XSIA 1T0NB 4MA3B 1DQJA 2WINB 3VXNB 2UYLB 3P4NA 1HYSD 5EU4B 2APBA 1UH4A 4S11A 5C70A 4PG9B 1QRNB 4K3JH 5TE4H 4XMPL 3VFRB 2APWA 3PWNA 4RFNB 4GH7B 3BZ4B 4PJ5A 3SCOA 1UYWH 4X8XA 1GPFA 3K4AA 3ZYZA 3IRPX 3JV0A 3ZO0A 4XNMA 1MCWW 2AJVL 3BKCH 1RHHA 2FJGB 4HWBA 3AJ7A 2DRUA 2C3VA 3M17A 3OJDB 5CSYA 1LO0L 4FFVD 5C86A 4AXNA 3BQUD 4O4YH 2UUDK 2H8PB 4Y4HA 2NY2C 1S7VA 4KMLB 3DUUA 4KRMB 3KWWA 2FCBA 3LKSA 4ELME 4XCNB 1QVOA 1JIBA 1RK0B 3CFCL 3AZRA 4NSBA 4O5LL 5HHME 4S1RH 1PD6A 2VLKA 1A6VH 1X5HA 3KPOB 4EN3D 1VEOA 2F8VA 2AAVA 1DEEA 1T7XA 3V6OC 1FL3B 5D93B 2VUOA 1ZHNB 3S9DB 1T1YA 2O61A 4POZC 4AZCA 2EE9A 2DIJA 3G5VA 3PWUB 3WIHL 3MKKA 1DLFH 3L9RA 1KWKA 3O41B 3D2UD 1V02A 4QLJA 3BH4A 2V2XB 1VGKB 3MRNB 4ZFFA 2OI9C 3ZM8A 1A02N 4CCCA 3TBTB 5D7LB 4PTMA 4Y2DB 5IMLB 1NUDA 2VAJA 2Y5EA 4MXVE 3IDXH 5F7FA 1HHGA 5FCUH 1XH1A 4N0CC 3FO9B 3EOAB 3UTPE 4XCEB 2ITCA 1GGUA 4OF6A 5CZVH 1GGIH 3RDTC 3EDFA 5L8LB 1N5AA 1Q6EA 1JAKA 2EO7A 3GH7A 3HPJA 3S96A 1IKNA 4GAYB 3SQOL 3HLAA 3GBMH 5I8CB 4LCUB 5AEAA 2B20A 2DM4A 5EFDA 1H0DA 1RVFH 3ES6B 3RZWA 1R3IH 2APFA 5CBAB 4U5IA 2FL5A 4UINL 4OZGB 2HJKA 4LSVL 3BH8B 3KYNB 1QSFE 4HWBL 5GS1C 2X5PA 1F3JA 1YEHL 3QI9C 2XIDA 5D9OA 2X1WL 2PW2A 2GK0B 1G9HA 3GB7B 4L4TE 4P3DA 3LB6D 1P1ZA 3E6HB 3O81A 2VZOA 4MA8H 5AD0A 1P4BL 3DMMC 4P2OB 1EVTC 3MRIB 5ISZA 3C60A 3UJTL 1MPAH 4ZAKC 3U0WH 4KAQL 1N6QH 5F9JA 4GAJL 4EUPB 1BP3B 4U6YB 1R87A 4LRNL 5DJAB 1CWYA 5IBUB 1N64H 1ORQA 3IDGB 5ISZE 2FBOJ 2PWDA 2BOBB 3A0OA 1QOXA 2V5SA 3RL1B 2LABA 1KIRA 5IF0A 4WTWA 5IB3B 2APTA 4TVDA 4KTDH 4YEFA 2DEPA 4M8UA 1ZHLB 3DMMB 4P2OC 5IFJB 2WC3A 5CEYA 3JXAA 4JM2F 4G5ZL 2BVUA 3RWIA 3N1GC 2VLRA 1AI1H 1V05A 1AXSA 4KFZC 1D5ZB 1DFBL 2YIHA 4OI8A 3BAWA 1A47A 1OWRM 4HUUA 1B31A 4B9ZA 4AT6B 4LCWA 4CBPA 2W9LA 5JA9A 2NY5C 1MCFA 1V3JA 2H2SC 1BF8A 3RU8L 4TQEH 4PJHA 1E4XL 1G6RA 1ETZB 4K3DL 2CO7B 1MFCL 2VISA 1S5IH 5EBWB 1FC1A 4N8CH 2LE9A 3KPPA 2CH8A 4PJ8B 3NH7H 5D7LE 2XNAA 2WHMA 3TO2B 3RIKA 2OTUB 1UVQB 5D71L 4M7KL 3HZMA 3FO1A 3MV8D 2IF7A 5E99L 1UD4A 2YUZA 4MJID 4YHLH 1IRAY 5GQBA 1G7QB 1PKQE 4HIIA 2ADGA 3HFML 4KDWA 3V5HB 3P0YH 4FABH 3QRGH 3ARBB 3OF6A 4GMSL 1ADQL 3BP5B 2YEZB 2IH1A 1CGUA 2CDEA 4XHQA 4WO4A 5D8JL 4C54A 1GYAA 3RIAF 1ZU8A 1QVBA 4AZIA 2F58H 2EQDA 3CC5B 4HT1H 2IXVA 2IBZX 3G5XB 5GJSL 5I74C 1CDBA 4X9YA 7FABL 2F5BH 4EBQH 2C8NA 4XX6A 4HULB 2RGSA 3GJFK 1U58B 1B88A 1TVHB 3C2AH 4OSUH 1N7MH 4KK8C 4XVSL 1DBBL 5GRZA 5ANME 4X6DE 1QI4A 1A7QL 3QIWD 4MAYD 2K3TA 2HVMA 4HUVB 1S9WB 1IC5L 2P48B 2IAND 2AVGA 1NWUA 1SJVA 2EDFA 3I9GL 3O6FD 2KZWA 4K3DH 1OP5H 1A2YB 3BN3B 3T0EA 3P11L 1CGWA 2Y6SD 4ONHB 5JLZB 3VTRA 3IDYC 2CK0L 4CVXA 1BZ9A 1B3YA 4YXKL 3WSQH 4AG4L 5I76A 3ZE0F 3S3JA 1FORH 4W6YB 1HWGB 3WY1A 3DTXB 3W9DB 8FABA 2VRAA 3HAEG 5DRWA 4X4MA 1MCPL 5MENE 3K7UA 1G9NL 5FB8A 4MXQD 3WLWC 3S36X 1AQDA 4CNIA 3RPIB 5JA8B 2QQKL 5HHVH 2F58L 3NIGF 4R90L 3MJ7B 4EKJA 1S3KL 5CINH 1OIMA 1KTKE 1H11A 1I1AC 1AVAA 5DTFA 4YE4L 4U6HB 2VLKB 1FLRH 3KPOA 2IWGA 1YMME 3ZE2E 3GKWL 1C92A 4JZNA 3LPPA 1YJDC 2F53B 4JZJA 3WIJA 1I3VA 4H1LB 5E09A 4KKAD 4K07A 4XP5H 1FZMB 4JO1L 3SCSA 1UB6B 3FQNA 5C07E 3MRMB 2QPUA 2DDQH 1UM6H 1JZ2A 1WZKA 1WQVT 4KUCD 5C0IA 1T66D 4EXPX 5KN5A 2YA1A 5MP6L 5L88L 1MI5B 1FVDB 2BK8A 3PIQA 3SOBH 5HPMA 1EEQA 2X09A 5IM7B 1DBAH 1DQDL 2VIRB 3PE9A 3WIFB 4S1DD 3NMEA 4WFFD 2P7TB 1MCRA 1G7HA 5HPOA 1ZXQA 4LPVA 5DGRA 3RX5A 1QLEH 4PJ9D 4GO9A 1AKJA 2CEQA 4M7LL 3L5XL 2NTSP 5A8PA 3KLAB 1EGJH 2ZSWB 3U1SL 5IHZA 3UPCA 5BXFB 3V7MA 3DC0A 5JIHA 4G6KL 1Q6CA 3QI9D 3MRBA 4J8RB 1DWAM 1L7TL 4UV7L 4W70A 3SGKA 1M1SA 1XC6A 5BV7B 4IS6A 4BQ6A 3IAQA 3FB7B 2FEDC 4MJIA 1YEDB 2W38A 4J7RA 2X70A 3ZE2F 5LQBH 4M03A 3BKYH 3W29A 1JZ4A 1NBQA 2NXZC 3TBSB 5JHDE 1GSMA 5DGQA 2HFFA 3KEHA 1JE6A 4ZS7L 2D3NA 1T0MA 2P45B 3L5WB 4HMEA 3ARTA 1AD9A 3CZ8A 4RA3A 2WYSA 4P23B 3WS6C 4N5ED 3VFOB 1G7MA 1M7IA 3V79C 1GGYA 4JAWA 2V5TA 4ZO8A 5L7XL 3JV5A 5F9AC 2EJ1A 4WNQB 4IHOB 2QSVA 3O2WL 5DRXB 3QEQE 3TTSA 3H9SA 4D6JA 3JWDH 2HFEA 3VXRD 1VA9A 2VLRD 2IH3A 1Q6GA 4PJFF 3SDXB 5KTEH 5D5MA 5MHSE 2YD6A 1UM5L 4CJ0A 1NCUA 5E2VL 1IBGH 1LO4H 4YQXH 4ODUA 4P4KC 1YEGH 4LVNB 3F5WA 4NQCB 4F37K 3BWAB 4W81A 5DR5L 5ABGA 4KV5E 4EN3B 2R23B 3ROOB 1D2KA 3THCA 2XN9E 1LE9A 4XNXL 4MSWB 5FOJA 2HRLA 1RUKH 5TDPA 5I0ZA 1IL1B 1BJMA 2B0SH 3PNWA 4RDQF 3BKJL 3LKOA 5EBWA 4C7FA 3VGHA 1I8MB 4QHKJ 4LVHB 2JB5L 1MREH 5IB5B 4H2CA 3VH8G 1NGYA 1J10A 1AO7A 4I48A 3RZCD 4FMFA 4TSBH 1NGZB 3BO8A 4GO6B 1C16B 4F2MA 1D9KC 1HQRB 3IF1A 2GJ6D 1T89C 5J56B 1EEYA 5GSVB 3W9EA 5LWYH 1KSRA 1NCWL 2K1MA 1U91A 1QSED 3KAAA 4UUJB 3SKMA 4UQCA 3BT2H 4R4FH 2PUQT 4W7VA 4XCNA 1QPKA 4JFZL 3SDDA 4GG8B 4AEFA 4AM0A 2VDRL 4V28A 5I66A 4WIWA 1PEWA 4KMQA 1LL6A 1K3ZA 4KRTA 4PR5A 1IGFL 1EBPA 1ZK9A 5HHPB 1DZBA 1QRND 3RWDB 4WHDA 2BRQA 2GSIA 3WNOA 4OQTH 4GG6B 2DKSA 4P57B 4CCDA 1FG9C 5CGYC 3KVQA 1DVFC 3V0VB 2FH8A 4JM4L 2AQ2A 3O41A 4JLRA 2GFTA 2P5ED 4MCYA 1NCAH 3RTQA 4NHCL 5C7XH 4BKLA 4JFFB 4LSSL 4WUUD 4JVUA 4ODBD 4WIQA 1ES0A 4OM1L 1PG7H 4M5YL 1KCUL 1W9PA 4GG6E 5CAYB 2R8SL 3PL6D 4JFFD 3NCOA 4OLVH 4X8JA 2XXMB 1EQCA 1S8DA 4JG0H 3T4AA 1OT2A 4M93C 3RIFK 4Z7WE 4J12A 1FC2D 1IJ9A 4Z2GA 1HOCA 3DVNA 3GIVB 1Z5LA 1FRGH 4ZXBD 4S1SL 5FK9A 4DTGL 3H7BB 3DX9B 4UQAA 2D7PA 1RPQA 1TQCB 3BSHA 3G6JB 3GKWH 1GGBH 5ERWA 1BVNP 4OCLC 4HHAB 3LZFL 2JJWA 4W85A 5FL1A 3WQWA 2YBTA 1F3JB 4B5EA 3QXAA 1HHGB 1EXUB 2OL3B 3O3DA 5CP3H 4QXTA 1Y6KR 4OBSA 4QRSB 1LG2A 1FYTA 5E6IB 3W81A 3QNXA 4W4NA 3U30C 3MRMA 1Q9OA 4CGTA 5E8NA 1A21A 5F89A 4XPBL 1ZT1B 2VLJB 4JY5L 3MSDA 1T4KA 3W6MA 1F6AB 1T2QL 5I6SA 1ZLSH 1OGTA 3OR6B 3MV11 4RAVA 4X80L 2BNRA 4OF3A 4TPRL 1JGDB 3NSXA 4F9PC 3BQUC 4P2QB 3MR9A 4H0IA 1A1MB 4ZE5A 5HGHB 4KDTA 3DV6B 5IIEB 4P7LA 2QSTA 3HUJA 2E8YA 4M7ZB 4Z7OE 3H3KA 1E9LA 1I7ZB 2V9RA 2Y9RT 2V17H 4DN3L 4UNVA 1GHSA 1LHZA 4YZFE 2LU7A 1FNSH 4Z7VA 4LLUB 3HNTH 3GGWA 2XSBA 4ATDA 4G8FA 4XZWA 1BIIB 1D7FA 1LDPL 1Q9LA 3C60D 3L3HA 3WL1A 3RL1A 5C9JA 2IMNA 1R5IB 3LEXA 1G6RB 1CXFA 1MCJA 2A38A 3U4EA 5TF1L 1ESWA 3TN0D 4L4VE 4HCRH 1JF1B 4Q9CA 4U1LA 3QUMH 1E4XI 1CZ8L 3O9WA 5DRNA 1LMKA 1T2QH 3BAXA 1U8LB 5BRQA 1J9CT 1NCNA 2Y5TA 4QEGA 3HAEA 2Q76B 4IHOA 3D3VA 1BAFL 1JGUH 1AE6H 2DT2A 3ZDXF 5CJ8A 2L7UA 1IBGL 3MBED 1JFHA 3DIFB 3DVFA 2WBJD 4TRPL 1JGIA 2VC2L 1FNEA 1PJ9A 4BFIA 2PYEA 1E72M 1U92B 2BSTB 4YHEA 4BYHA 3G08A 5FYJH 1KEML 1FVCA 4JE4B 5KS9F 4FQXA 4O5LH 5T3XE 4RGND 4S2SB 2FO4B 3PL6A 1DBAL 4ISVA 3D85A 3L3GA 4ODXB 3AXXA 1TETH 5M5DA 5IHUH 3UJJH 4OQ1A 4PRPA 4UILL 2V3EA 4NCDA 2C4FU 5CSUA 1VHPA 2X7LA 4LSQL 3BJLA 1IM9A 2RB8A 1YN7A 2YUVA 3FRPA 2JELH 5JLZA 3L7EB 1JPGA 3SJVB 3D5HA 3QIBC 1YC8A 2PWHA 4PEEA 3C6LB 4FG6C 1ZS2A 3KLSA 4JRXA 1TUXA 4ODSH 1J0KA 1V6XA 2HH0H 1K85A 2CLZB 4AD5A 1AXTL 1KC5L 4X5LA 1AE6L 2DYPB 2RFXB 5B22A 4NQDD 1MCOH 1PY4A 1ZA6B 2R0WL 3KYMA 3PABB 1CZ1A 1A7NH 2PF0A 5I17A 25C8H 5KSBB 4RNRA 4AIOA 4D0DB 3VFGL 4GQPH 3QIUA 2RGMA 2X4RB 5F93C 3P0GB 3WMSA 3OLDA 4F8QA 3PHQA 4ZUUB 2QJDA 5ALCL 4D9QD 5H8DA 3JWDC 1BBDL 1DN2A 43C9B 1U30A 1WCQA 7FABH 1FZMA 3WLBB 1IFHL 1UB6A 2A6JB 3FQNB 1WE5A 4S3JA 1IM3B 2XTJE 2YA2A 5I75C 1KR0A 5SWQB 4DWSB 4Y88A 2X4OB 2XA8L 4YZFF 4P3CH 1FV1A 2EDLA 3HC4L 1U8NA 3I75B 3ALFA 5D1ZD 3QHNA 1TTFA 1JN6B 1JXJA 4JFFA 4F58H 1HHJB 2ATPA 3IU3A 3PUCA 5SX5K 4R96B 5IM7A 2G3NA 1KULA 3MS8A 1R3LB 1UYWL 2ESVA 3KDMA 5GGQL 4BS0A 3ZJ7A 1M7XA 3VDCA 1KYOJ 1MHPL 1NWRA 3DVNB 5FYJD 5BVPH 1L0QA 1G01A 2NW0A 2CDGB 3UC0L 2HJLA 4R0LA 3N17A 4J3TA 3L2MA 1NEUA 5K9OB 1KXTA 4CRPA 1AC6A 1ZANL 3DV4B 3D6GA 2YK1H 2WCGA 1FORL 2HKFH 3AXIA 5EN2B 4IPNB 5ADPH 5HPMB 5DRZB 4K71C 3ZR5A 4MJIB 4M1DL 3LN5A 1N2RA 3PXJA 3WL9A 2CERA 2PB1A 1RHFA 2A3BA 1RFDH 1MCBA 1X5LA 5IV2A 4W88A 5IEKA 4O2EA 1UJ3B 2R2BA 5ESAB 3MRNA 2LVEA 1EAPA 4OD1L 3R8QA 1F58L 1G0XA 5C6PB 1L9MA 3EFDL 1W9BM 3L5WA 1GONA 1C91A 4URTB 4LVHC 4HUKB 4C58B 3EKCA 4R7DA 4KHTH 3P30L 1UYQA 1BYBA 1MNUH 1OBAA 3L4XA 3TTYA 3IDJB 2KBGA 1GQJA 3RVWD 1P4IH 5EIVA 5I8KL 2WSKA 2W66A 1WDQA 4N0UE 4MNMA 2YPKA 4PBXA 3MO4A 1QG3A 9CGTA 4CVUA 4ZUSB 4PP1C 5C0NC 5E08H 4M8QA 3TH2T 3Q1SL 5FYLE 1A6VL 5J12C 1A6TB 1OGAD 3WFBH 1N5YL 3AREA 1CE6A 4FQCH 3NN8A 4YHNB 1EDGA 1PG7L 1P7QD 1F4YL 4AIXA 4XP6H 1YA5A 2YRPA 4R9HA 3SCMD 3QDMD 4AZ5A 1VFFA 1RUML 1T1XB 4X5XA 2GJRA 3SKOB 5ACZA 3I50L 2DAVA 3FQXA 1KUMA 1A3RL 4NQSA 2J7HA 1QLFA 1CLOL 4LU5H 5EIIB 3TTQA 3L4YA 4PLKD 4RWHA 3AIEA 4PRIA 2QSCL 3SGJA 1KG0B 1GPOH 5GS1A 1OD7A 4KI5F 3QHZL 3SDAC 4Z0XB 5FCUL 2H2PD 4WWKC 1XGYH 1OSZA 3R06B 5I1EL 3C08L 3JV6A 5A8OA 1NFIB 4Y5YB 5KSAA 1TZHA 2A77L 2D23A 4JQIL 3VM7A 4WLCA 3UZQA 4RWYH 3DMMA 1T7ZA 3BUYA 1MIMH 2DN7A 4E0RA 1VENA 3EOBA 3UYRH 3QUZD 3CZKA 5BV7C 2DQXA 5D1XD 3B2UC 4N8VB 2J8GA 4HZAA 3DVGA 3LKQB 1VJSA 4FRWA 1C7SA 4OUUB 4M6AA 2LU3A 3G04B 5FKAB 1T0PB 3DJ9A 3VIOA 4KTYA 4P8WA 4BZYA 4I0PA 4OGYH 5EOCH 1RJLA 3PXHA 1JNLH 1BM3L 1YEFL 3MRFA 1JNNH 4UFMA 2XWTA 1JV5B 3AXLA 5I19L 5GGSY 4K3JL 1UWIA 4HGWB 3ULUF 5E2VH 4PMOA 3QWOB 4M62H 1O6IA 5I16B 1TZGL 2NZ9C 3EYVA 2OWCA 5TQ2H 4GUPA 2FX9L 5INDB 1QZ1A 3HCVB 3T08A 3ZKMD 2ZOKA 5CWSA 5JOFA 4PJGA 2J7EA 1XGUB 3SJVA 1RY7B 4LLYB 3F5LA 1F8TH 1VSCA 2OYLA 4X8JB 5C09A 4OCXL 4C57C 5I2IB 3VXQB 5MENB 3VUPA 5EFIA 2J7CA 4UIMB 2WWDA 1OP5K 1T20A 1MIML 3U0TA 5BRZA 5T1KB 2Q8BH 4D0CB 2D3LA 1HKFA 1U58A 4WW1B 4ZYKB 2P8LA 4M29A 1IKFL 3SKNB 3ZSTA 2VLJE 3KPMB 2UZXB 2A9NL 5FYLH 3U1SH 3MGAA 2FX7H 1WFTA 4XPAH 2NY2B 4HH9A 3TNNB 5DZLA 2YL8A 3WUEA 3O11A 2E40A 1ADQA 3AXHA 1DBBH 2J8FA 4IDJH 5B3JF 3TIDA 1U8HB 2FGWL 3QXAB 5CUSL 1CDJA 1S7VB 1J1OL 5BS0D 2ZXBA 1RZIB 2Q86A 3DWTA 2DI8A 2AI0L 4WKHA 3VXPB 1JMZA 3U0PB 3LQAH 2HVJA 4QLLA 3AREC 3IJ9A 3PGFH 5FV2A 3O2LA 1FBIH 1JK8A 4PRHD 5IFHL 1TZGH 4MAYC 1IEAB 3ARFA 3QXVA 2UWEE 1F90H 3P11H 4XNQB 3C6LD 5ERWB 5FM5O 2DQCL 3CZFB 4HHAA 5DUBB 3D9AL 1EMTH 4J3VA 4YC2B 1P7QA 1QLRA 2VDML 5D1XA 4XZBA 4GZIA 4MQXC 4JJHA 4G8GB 3LHPL 2APXA 3ARED 3P9LB 2CLRB 2EKSA 3Q5YA 3OQ3B 4HIHA 3DMMD 2XFXB 5KANI 4A6YA 1I9IH 4PRAB 3CDGA 2XZQH 5HHQB 3MLRL 3OZ9L 5KSBE 4ZODA 3VFSB 3REVA 4QOKD 4YX2H 2IGFH 1KBGL 1B0GA 1QFWH 5A43C 1MFUA 5EORL 4JR9H 4JFXA 4OZFG 1IM9D 2C7FA 4BQBA 3NUKA 4F7TA 3AQUA 3HE7B 2WBJB 3VRJB 2YD8A 2WV3A 4K3EH 4MDJA 5HDLA 1FO0B 3SIMA 2HLFD 2R2BB 2XGIA 1CFSA 2J7BA 4M81A 2R2CA 1UA7A 4G3YH 4I0PC 1KJ3H 2HLAA 2KZ1B 4NKIH 3IJ7A 3QUYD 4W7UA 1FPTL 1JUFA 2P42B 2AK4D 3I6KA 2ZOLB 3GXDA 3S8WA 3LDBB 1NBVH 2JCCE 1ZBKA 5DXWA 3TT1L 2C4XA 5D1QD 5FDWA 3RCNA 5ISZB 3NZ8B 1JPFA 1I3RA 3K2UH 3ZIZA 2DQGH 5MERA 4PJDB 4EUPA 1ORSA 5DJ0A 4JO3H 2EKJA 2PYEB 4C4KO 3HC4H 1TJHH 1OAUH 3GSRA 4KK6C 1F4WH 4TUKH 4FQ1H 3ARYA 5E8DL 1FFNB 2WIIB 4Y2DD 1V3LA 2CYGA 1EFXB 4KI1A 3D3AA 1JDAA 2Y24A 4RMQA 3TBSA 2FBJH 4BSWB 3WH9A 5F6HI 2VLLB 5AYQA 4KZDH 3HFMH 3GBDA 1UT9A 4LHUB 3GSQA 5AZEH 1UH2A 3MRQB 3CK0L 1D6VH 1BFVL 4OZGE 2NY1B 5CP7B 4P23A 5J57B 2I9TB 3C09B 3VFOA 1Z9LA 1GGIL 3WS3A 1GGTA 1TPXC 3DGGA 2BZDA 3OB0H 4HEME 1J86A 2NW2A 3MROA 3RWGB 2C5DC 5C0AB 1CU4H 2GIYA 3VWJD 4LP4A 1A5FL 4H8WH 3KPQB 4MXVF 5IEHB 1N7ML 2FECI 4I2XE 5C0EB 4Z77B 4IOSD 4K7FA 4A3YA 3TV3H 5HY9B 2C9AA 2BVQB 3VH8B 5GJSH 3ARQA 2H26A 4XWOD 5DA0B 4F66A 1YEHH 3IDYB 3WIIL 3ZDZF 3FQRB 4P46B 4GKNB 4YDIL 2RFXA 5E6ID 4HTYA 1F6LL 2Q7YA 5E9DD 3TJHD 3WD3A 4DOHB 1T0NA 4NNXA 4HC1L 3MRHA 5BS0A 3OAZK 2V3DA 1TJHL 1BFNA 3MRDB 4HV8B 4P46C 5MHSD 4LVOB 4P9HL 1N26A 4YGAB 1H3PH 5MI0C 1AQHA 1L7IL 2NY1D 1KEGL 1X7QB 3T09A 3VI3E 4PJBB 1H9VA 3R1GH 1IGMH 3FTGA 4N0YL 4M1CD 1NDMB 2MSPA 4CW1A 4LPXA 3AHXA 4O02L 3NCBB 2HTLC 3EYSL 4F7EA 3B2VL 4HEPG 3CIQA 2OWXA 4GUPB 5INDA 1C16A 3DVIA 2OSYA 5DT7A 3T4YA 4HLJA 4PJGB 2XA3A 5D6DC 2ESVB 3KDMB 4HBQA 1H3VA 5E5MA 4LL9A 4U7KA 4N5EC 3SKMB 3LEVL 5LGHH 1FCCA 1MCQA 3WQ8A 4WHTA 2IBGA 3RILA 1KIPA 4RGMB 3QH3A 1I85C 1SFSA 1PEZA 1DUYA 1M7DB 4D0CA 1JNDA 4L4PA 5LBSH 3BZEA 3G6JE 3S34H 3UTQA 5DJ8B 5CPTA 5DK0A 3VXSB 4NFDA 2YUXA 1FSKB 3UZEA 2UY6A 3IFNL 4MNKA 3BPNB 3RWDA 3SCVA 4PRIE 4GMTH 3IKCB 2XT1B 4KVNL 3MOBH 3HZKB 2JCCF 3RAJH 4JHAL 1X5KA 3L3OA 2BFVL 5KSBF 1XCWA 5CSGA 1FNFA 5L2JA 5GRWA 1FSKC 1FHDA 1QBBA 1YNTA 2EDBA 4XCEA 2Z35A 5CZKA 3WF2A 4DUVA 1SM3H 1ND0B 2GY7B 3HR6A 2HN7B 4KHXH 3VIGA 4DWHA 3T0DA 5D72L 1AY1H 4YEEA 4DQOH 3ES6A 5DQJA 2VLME 3VD7A 5LGJA 1DVFA 4JN2A 2JIXB 5TDNB 4OFYD 1KR1A 4UV4H 1CLZL 4QFUA 5D7IA 3Q6FA 4M6NH 5DVLA 4PJ7B 5E7BA 5CEXB 3WBAA 2VXSH 3I3EA 3NCCB 3ZDYF 1NMAL 4F9LC 5E2UH 2EH8H 1EA9C 5FHBH 3BGMA 1TTGA 3VGAC 3DUSA 3UTSB 2EXWC 3AREB 1JWUA 1MRDH 3LAFA 4GAFB 1CE6B 5FEBA 2JK5B 4L3EB 5J12B 3V7AG 3S35H 1IEBA 2XY1A 5KS9B 1IGYB 3CCHA 4PG2C 4X7TA 2IFGA 4OZHA 3VWKC 3FNDA 4MD0B 1MI5D 1WISA 4HQQH 2YK1L 5BXSA 1CR9L 2ZSWA 2P4AB 2HG5B 4PYHA 3IXAB 4HZ7A 4JDTH 2AXFB 3WFCH 1A14L 4HAFA 5GRVL 5AWNL 3B9KD 5D2LF 1RZ8B 2Q6WA 3QXUA 1OTUC 4D6FA 5BCAA 1ZHLA 5IFJA 1HNYA 4WKFA 3EMZA 1MH5A 4M6MH 3RWIB 2JELL 1UZ4A 5FGBA 2EZ0C 5B3NA 4YHNA 4UB0L 3H42H 3UYOD 3BJ91 3DARA 2XVNA 1FLRL 3HE7C 3OKOA 3RGHA 3X11B 1U2YA 3TP4A 1BOYA 3SGDH 3ILQD 5ACZB 1E70M 4Z2HA 5KAQG 1NANH 3MC0A 1MWAA 4ODVH 3H9SD 5LJYH 5EIIA 3V4UL 4MWFA 4O4YL 4ODWB 3G04A 4MQ7A 3MLYL 3QUMB 1YNLL 1PZ2A 3VILA 1WUNT 4JEGB 1G9NH 3L3HB 1KCVH 5KSAB 4KTDL 4BQ3A 4X98A 3AU1B 5E9AA 1GL4B 2K7PA 4J4PC 2UY4A 1GORA 2DQDL 2F8OA 1LG1A 1RJZB 5F1OB 2IALB 1TLKA 2G41A 4ZFZA 5C0JB 2YPLE 2R2HB 5KVEH 1HDMA 5CPSA 2VABB 1RD6A 3MNVA 4KJWD 1VCAA 1MCCA 2V5CA 1INEH 4MAYB 3E2HB 2LAAA 4PGCA 1KPRB 3ELAT 1CLYL 4E41B 4HLZG 5E0CA 2ZSVB 2NY4B 4NUGL 5GRJL 1AQKL 5CKGA 2ADFL 3AGVA 3BSZL 4Z5RA 2W0FA 4MNGA 1LEKA 5IWLC 5HYEA 5C09B 4LU5L 3FMGL 2OQJA 5DD5L 4U4BA 3NFSL 4JFDB 1QYGL 2QQLH 3S4SB 4DZBB 4HPOH 4V1DB 2A9ML 1S7XB 4IMLA 1FE8H 2ATKB 1S9WA 3BGFB 1ZS8A 6A3HA 4UT6H 3RP1A 1CDIA 3H6JA 5A3HA 1GOWA 3CUPA 5DQDH 1A3LH 2Y25A 1P4LB 4PLJD 2AEWA 1JNEA 4G3YL 2CLVA 1NGZA 1TXKA 3BO8B 3RKPA 1YDPB 3VI4E 3QI9B 2CBIA 5ITBH 4HK3N 4MB3A 4OLXH 4R7NA 1H8OA 1KEMH 5CPQA 3MBXH 3G6JF 4FLOA 4UINH 1OPGL 3T0ED 2GYSA 1AGEA 1RIHH 1Z3GL 1DQJB 3OKNB 2PTVA 2VXVH 1QRNA 3V6OE 2Y4SA 3OIHA 3HAEH 4GPNA 4L8SB 4D9RD 3BDYL 1KB9J 4NM8H 4UCFA 3RWFA 5JORB 1FGVL 4JG0L 4AD2A 2UY5A 4K23L 5C09D 4V1DE 1SYVA 4Z7NE 2WAGA 3UG4A 5C07B 1MPAL 3RVWC 2E6JA 1P7QB 3RX7A 3HC0B 3U57A 3MV9E 2HKHL 4H8VA 2W92A 1NMBH 1ZA6A 3KYMB 2NZIA 3OKEA 4L29A 1FFQA 4BZ1L 2NX5B 3UBXA 32C2B 4GOSA 1NC4A 3JTTB 3MRPB 3LZFH 1S9YB 4FQHB 3X3GH 5EBMA 4ZUUA 3RAJL 1DBMH 2OJZL 1H5BA 5J7CC 25C8L 2ZUTA 5I74B 1HN1A 2NXZB 2UZIH 1CD8A 2WMPA 2QKIA 2DIBA 1SMDA 1X5AA 5SWSD 2Q8BL 1NKOA 3FKUS 4NN6B 3NPZB 4NOFA 5ALBL 2EDHA 3MZGB 3FT3B 4YK4C 1WTLA 3G5ZA 4Z7UB 4CAGA 2DQFB 3I75A 5K59E 4MNQE 2YKLH 4POYA 2ZG2A 5DEFB 4ZAKB 1AO7E 1C8QA 4XPHH 2FIRT 3EYUH 2YUWA 1CFQB 1R5VB 2XTJD 2WVTA 1UA3A 6FABH 1JWSB 2AJUH 4CKVX 4DZ8A 3B9DA 3QHZH 2DI7A 3QUYC 4Y16A 3MJ9A 5HVFB 4CKQA 5AUMB 5DQJB 1NMAH 4HD9A 1TCMA 1RUQH 2HKHH 4OLEA 4OIBA 5J06A 3CX5K 5D1ZC 5CGMA 4LQ1A 4PYGA 1C7TA 1MCHA 2H6PB 2XG5A 3HPLA 1JPST 1K8DA 2QSQA 1XF3A 2QR0B 2Z1KA 1HILB 4G9DA 4P4KB 3UTPD 3GUTA 1SBBA 2GJXB 2W65B 2GITB 1EMTL 1UHVA 3FQWA 5AG9A 1BECA 4OZGA 4MCZB 1UWEL 3IT8D 4YHZL 4P59L 2EXOA 1DCLA 3RDTB 5IVXB 5KVFL 2JALA 3QCVL 3LH2L 1KXVA 4HIXL 5CJOL 3ECQA 3ARFC 5D93C 1UJ3A 2ZWYA 1BBJA 3K4DA 2X6MA 4FS0A 1UZ6E 4XXCC 5D1ZB 1JNLL 1U8PB 1FNAA 1CQYA 4PJCE 1MOEA 3IGAA 4JZOB 4L3EE 3VXUB 4QYOB 3PWJA 3N06B 2VXQL 3ZL4L 4OOUA 1ODZA 3VW3H 4PBGA 1ODUA 1HJVA 3MV8B 4JFOA 4UI2A 2BVEA 2CHOA 4P2QD 4AEHH 3I3DA 2BHZA 2XKSA 3DXAE 1HT6A 2FX9H 4YHKH 4OT1H 5A2IH 3U7YH 1KIRB 5IF0B 4L8CB 3TWCH 5JHDA 4G8IB 1O5DT 4JZ5A 3IJYA 3RVXD 1I1FB 3UTOA 3AMGA 4OIAA 1WEJL 3WSUA 4K9EC 4NQUA 1EERB 3JUGA 4HWZB 1NBZB 1AGDA 2WUCL 2PWGA 1AXSB 4LARL 5DC4B 2NY6C 1H8SA 3CXDL 5D70H 5EA0L 5E08L 2FWOA 4FMVA 3MUAA 3BW9A 4U5KA 2M2DA 4WFHE 4FN0A 3LKOB 2GUOB 2VZTA 5JBDA 3QJHB 3ZJKA 4TULH 1OB0A 3I6LE 4XGZA 4PMXA 5AYBA 5CQ1A 4R5EA 1WK0A 2VE6A 1Q4NX 2XOTA 3E0GA 4DN4L 3ARDD 3VNZA 2X1PA 1J5OH 1RI8A 1GRWA 3CFIC 4FQLH 4TVPL 4JCLA 5A94A 4PJCF 1CLYH 2CK2A 5IB2A 1JTOA 3HG1D 4WEMB 2XNAB 1G9MC 2R2HA 5JO5A 1U8MB 5J1SC 5AYIA 2Z1SA 5TE7H 3DBXA 3FMGH 5IVNA 5M7QA 1A0QH 2VTFA 1KTDB 1XCQB 4GW1A 4JN1H 1UXSB 3GSWA 1AD0A 1BFOA 3RNKA 4HX1B 3MU7A 3SDXF 4PJFB 5D7LD 2YMXL 5F97E 4UTBL 1A4KB 3MBEB 2W60A 3QA3B 1OM0A 1WBYA 3SGJC 2OLDA 3KYKL 3K46A 3U82B 5HHPA 2HT2D 4KGLA 4ZXLA 1C12A 1MAMH 2XGBA 1IAKB 3BEWA 3T1FB 3GO1H 4IMLB 1P6FA 2AK4A 3IJSB 5ITBL 3TJEH 3FT2A 5KOMC 3VE0B 5DJ8A 3IFOA 2HFGH 4PLOB 3RGVA 1BAGA 4LYRA 4OZIF 3VWKD 3TA3C 4XXDA 4ODTH 4L4JA 4D1IA 3SO5A 4I3SH 43CAB 5FECB 1BPLB 5D9NA 1UEMA 5I1KH 1K9FA 2X4UB 4YNYB 3ARGB 3ILPA 4X9BA 4YXHH 1I9RL 3GMPA 4JFED 4D2NA 3EYFA 1AQ0A 1Z6JT 4MHHI 2Y06H 4KRPB 3TBYA 5FDYA 3VA2C 1VIWA 3A3HA 3P0YL 4FABL 4G6MH 3ZDYE 2XHYA 1CQKA 4KXZH 2O61B 5EUOA 2Z4QA 1ISVA 3RL2A 3AS2A 5D96B 5D8JH 4OKVB 4MX7B 4WW1A 5DD3H 3NIDE 4CU8A 4PGZA 3AIUA 3T04D 2DB8A 1NCAL 5C7XL 1PBGA 3QCTL 3VIMA 3NZHL 4IPLA 4G80A 4MD5A 3VM5A 4U6VL 3BZDA 1QVOB 1HX0A 4DCQA 5E8NB 1OSPL 5EBMB 4RX4A 2FLRT 4PMDA 5GJTL 3WQVA 5F9WB 3LEVH 5TGBB 5LGHL 5IVZA 1B90A 3SUVA 3O8XC 3SE4C 1DJSA 4J1UA 1G7LB 2J6EL 3S36H 3LKNA 3PGDA 1FLTX 1BVLB 4N9GA 5FF6A 4YQXL 1JZ3A 4GT7A 4ZFGL 3MOAL 2PYED 3T1WA 2JFEX 1JK8B 2D22A 5TQ2L 1DN0A 4H26A 4Z7UA 2IPTH 5J9PB 1AIFB 4HZ6A 1CBVL 4LCWD 4TNWK 1CS6A 5C08D 5DDHB 4PJDE 4LYPA 5D7LA 5CBAA 4O9HL 3X14B 2Z92A 2R0WH 4DKFL 4EQ2A 5C0AD 2H3NA 4RGMC 2PR4L 4MXWH 5ICYA 5I6XB 5EOTA 2EC9T 2J1KA 5KS9A 4P99A 5IV2B 4ZPVB 2X4QB 4PJHE 3ESVF 3SKUD 2EC9U 5BRZD 2YDQA 3SGEI 2FJFB 3B3IA 3DI2B 3EDEA 3TJHC 4MNJA 1R24B 5C71A 3D25B 1Q9LB 4GAYA 1WITA 2XICA 3AHZA 1X5ZA 1HILA 1QRKA 1QKZH 3QPXL 3MSGA 1W3JA 3WMCA 4TX6A 2AAAA 3L6FA 1GOQA 2NY1C 2A73B 4LF3A 5H35B 2NYYD 5I77A 3BKCL 5B38G 4CMHC 3O9WB 1XCTA 4RFOL 1NCDH 4KGJA 5FOBA 5KBNC 4WFEE 4ZUSA 3QBTB 4QOKE 5DLML 4NF7A 2BVDA 3MLSH 1BBJB 2DDQL 4PUBH 3F8UB 2HFFB 4NFBA 5EZLA 5DZOA 3MO1A 1P1ZB 4FNLH 3D3VB 4AZHA 1JHKH 4HJ0C 3ARVA 3HE6B 3OJMB 1NM9A 3BISA 3SKJL 4PJ7F 3MLZH 1KIUA 4MQ7B 3D0LB 1XD0A 3QDHA 5JW3H 1LJYA 1IAOB 4NCC1 5F7MC 1KCKA 2D9QB 4G8GE 3WD4A 5EFFA 4OGYL 4YWGH 3NZ8A 4DUXA 4PJHB 3C9NA 1TJIH 4UU9A 1A14H 4EQ3A 4U6XB 5DT1L 1HZHH 5C08B 2BNQA 3HRZA 2EZ0D 4JFYA 5MERB 3VXOB 2BMKB 1A64A 4M48L 3CIVA 1DQML 1LVEA 1J05A 1FA2A 1GUVA 5D5MB 3GSNB 3GJFA 4Y4HD 3VXSE 5H2BA 3PDGA 1T21A 3NFNA 1J8KA 1I75A 1D5ZA 5ADOL 4Y5YA 5HOSA 3GMMA 1V08A 1MHEB 3BW9B 5GHWL 4OZFH 1F00I 2R29L 2EYTB 3IFLL 4BK4A 1KELH 1NJ9B 3FN0H 3ZSSA 5JUEH 3UC0H 2CDEB 1XEDA 2I9TA 4QRQA 4JRXB 1NUNB 2ZZUT 4K7PL 2ZIDA 2BXZA 4XVUD 4CJ1A 3P9MA 5ESVA 5IB5A 4PJEF 2DM3A 3WUWG 4LCCA 1AO7B 2EBNA 1RIVL 4IISA 5IFPA 2IJ0C 2VL5B 1HJWA 3MV7D 4TVPD 1J12A 1MCEA 1JV5A 2DQDH 4PV8A 1CU4L 1MFDH 4KMTL 4L5FH 2ERJC 1E6QM 4WCYL 3D18A 4WHYG 2D24A 3QO1B 2R0KH 4OLZH 2CIKB 5BS0B 5IB1A 4XT1C 3T1FA 5I1CH 2AK4B 4MS8C 1BG4A 3FJTA 3HUJE 3TN0C 1S7TB 1RUAL 5EU7E 4GSDH 4ORZC 1A7OH 2EEAA 3U9PH 1P4IL 2NX5E 1T1WB 1OCWL 5BOPA 3UJIH 1U42A 3ZTJG 5A69A 4XXDB 1HHJA 2ATPB 3IU3B 4HFUL 2DTMH 3ARGD 4FXKB 5GGUA 2X4TB 3QEGH 3ABZA 3HC0A 4HKBB 1KELL 3FN0L 4LNRA 5HHMD 4P23D 3U6RB 1B3VA 1D5BA 1A2YA 2JB6B 3OG2A 2CUIA 4MMXC 2C3GA 4LPUA 3ZTNH 3FFDA 1ZHBA 5FFLA 3GMLB 3GMPB 4FTVB 2D0FA 4P9ML 1YY8B 4FXLA 4Y16D 2YXFA 1RIVH 2P5EE 1S8DB 3T4AB 3ZYOA 5FA3B 4F33B 4WUUB 5CFHA 2F19L 5EN2A 3MGOA 3IETA 4WY7L 1EOMA 1QTYT 1TR1A 3STBA 4PJFE 4UB0H 3GZAA 3ULUD 1NPUA 4PJ5E 5C0BA 4YC2C 3AIWA 2DT0A 3WF0A 2W9DH 5ECJE 3K0WA 1K8DB 3WJLC 1OIFA 3D69B 1C3FA 2CBVA 3MJ7A 3KNBB 4CD5A 5ESAA 2Z31D 3PQYD 5T3ZE 3DLQR 5C8JA 1JRHH 4X7DC 3B8SA 4YFLF 2EDKA 4JR9L 4YHLL 4LEXL 1CFTB 3SY0B 4Z7WA 1CK0H 5I18H 4OD3H 4NKDB 4JFDE 5JW5A 4PRHB 2F53A 4OKDA 1J0YA 1Q94A 1UGNA 3IDJA 1W9UA 4P5MB 2IAMD 4N9GB 5FF6B 4ML4A 4U1SA 1QA9A 5CCKL 5DJDB 5DMJB 2P8PA 4K94L 1DBML 1QSFD 2F5BL 4E41E 4EBQL 2W63A 1T4KB 3KL0A 5DJZA 1OAZH 5ADPL 1U3HA 1KPVA 4P2RA 1MQQA 1G6RH 5AYUH 1A6TA 1UA6H 1JL8A 2X9XA 4JN2B 4B7LA 4UFHA 2MNUA 1B0RA 1BGXL 5HGHA 1N8ZA 1YEKH 4H8HA 1MFBH 5IVXA 1BTCA 1OL0A 1FRGL 4OV5A 1X4ZA 3I9GH 5JMOC 1AFVL 5CGTA 2P24B 4NJ9H 5BXPA 4OCWL 1JI1A 1T1XA 4PY8J 1KC5H 4GXVL 2FWOB 1NCDL 3QDMB 5F9OL 2OZ4A 2J8UB 4PS4L 4K7PX 4JHAH 3QDAA 3ULUC 4IS6B 4NKOA 2W07A 2RBLA 4NC0B 4IRJB 5EU6E 3HMCA 2ICEB 1OGAB 4G8EA 1R5IA 3VXUD 2QADD 3F7VA 5CIPH 4G8IA 4IRSD 2NW3A 5TQ0H 5BYWA 4W87A 4HLZH 1FFPB 3LY6A 3PP4L 1E6OL 1Q72H 1QW9A 3SBWC 1MH5B 5D7KE 3TN0A 1JZ6A 1WZAA 4YDIH 1FFNA 3CMOL 2DSUA 2IANB 3HE6A 4YWGL 3SCMA 1CL7H 5B38B 1J18A 2Y6SC 1YNKL 4M00A 4XAKD 5T1DL 3C09C 3WF4A 1UXSA 1IEHA 1MAJA 5KZCD 2XWDA 5HGGS 5DUMH 4L1HA 4ONOA 1UZ1A 3GSQB 1UD3A 1E27A 1WBYB 3IDMB 2O9PA 2EPNA 1OF2B 3UTZA 3MOAH 4Z6AT 3BXWA 3TOPA 4FFZH 1NWSA 4MA7H 5L6YL 3HMXL 3UTSE 3O9WC 3WLWD 4BZ1H 1LO2H 3DHPA 3OA5A 2FDBP 3DRTB 3HN3A 2OJEA 4FZ8L 4U1KA 5A6LA 3U7YL 4NM4H 4MNQB 3H9SE 3S37X 5GS3A 4F7CB 3C6SB 3OHXB 5T3ZH 4XC1L 4LLMB 2A1WL 2J4WL 5CJXC 2JCCA 3NIFF 3PZMA 3QAZC 1HH6A 3ARBC 5CWSB 5JOFB 3PZQA 5GSVA 1QLEL 3WF3A 5C0JA 4R8WH 3OXSB 4PJ9B 3UROR 1T7WA 4X6FB 4XPTH 5HVWA 1GOHA 1I7UB 1BFSA 4U1NA 3WQ5A 5ABHA 1F2QA 4GG8A 1YEIL 1S9XA 2CRIA 3VFTB 2OYMA 4NN7B 3CNKA 5EOCL 5I66B 2WQ8A 3JBG7 5FIEA 1KT2B 1QUNA 3RWJA 2DSVA 4QF1A 1GHFH 2AJUL 5C8BB 5DJXA 1UZ8A 4TUKL 1S9KC 4ZENA 1HQRA 3RL2B 1B4JH 5BZDA 2Y8KA 3PWVB 2YD1A 4GG6A 2BV9A 4C55A 3UEQA 5DD0L 4LPWA 3PWPA 3T8XB 4JFPA 4ZSOE 1E56A 2KDGA 3WDRA 3CUPB 1WGOA 3VCLA 3EBVA 1P4LA 4JPWL 2XYCA 3W0KA 3KS0H 4HPOL 4MD5B 4B41A 3STZB 4Q22A 1ES0B 4APQD 1EHLH 4FMKA 1V7ML 2Z8VC 1PPIA 4XP4H 5EB8A 4A2LA 1PBYA 3FO0L 3MLWL 1B2YA 1WCGA 4PGDB 4UNUA 5DMYA 4S3KA 1U33A 2CKBH 4XP9H 3L4VA 4JFEA 4RMSA 3LH2H 5GGUB 4ETYA 1US2A 4HJGA 4CCEA 4NQDB 5A1AA 1YHTA 2DMBA 2AEPL 4F15C 3HJEA 4QLRA 2WW5A 2ZCKL 5DUPH 1ED3B 1I1RA 5D2LA 1A7RL 3KPNB 4FQQA 1GAFL 4Y4FB 1DWGM 4CN6A 1GZJA 1X5FA 5D7JB 5IXEA 5F8QC 4PREB 3BDBA 1CLZH 2B4CC 2QQLL 1X4YA 3FT4B 4QNPE 3MFFA 3REVB 3MLVH 2XACC 2B1HH 1B0GB 3OLIA 5I1EH 3MGOB 2BXYA 2FJFA 3B3IB 3B5HA 1K9EA 2XQBH 2OR9H 3W37A 3QPQC 1CNVA 3S4SG 1RH9A 4QT5A 1WWCA 4NOBA 2GQHA 2PO6C 3LOWA 4M4RA 4OF5A 4MGXA 4NZUL 3RO8A 4H5SA 3HC3L 4OLXL 5DDHA 4LF3B 5H35A 1G0YR 4D6IA 1N3NA 5FA4A 1KCRL 2DM7A 2QTEA 1BD2B 1H3XA 1WJ3A 2DI9A 1NAMH 2HTKD 2OL3A 2V7HB 4LQFH 2X1OA 4I2XB 1JGLL 1U8OA 2XIBA 3BHBA 1N0LA 1SHMA 2P8MA 3LN9A 5EZLB 4PY7B 3T2OA 1HIMH 2P8PB 3NDYA 5EC1A 3J8F7 1KJ2B 4HS3A 1E43A 3W24A 2O5XL 4IRJD 3B43A 4XAWH 4MQTB 3AHYA 1R7OA 4TSAH 1QFWL 4ZE4A 1ORSB 2BRRH 2BNQE 3WFZA 3WD0A 4EI5A 5K9KA 2B2XL 1K9TA 1X44A 1Z9SA 3C9NB 3MLVL 2UV3A 5E03A 2YWZA 1ZHKB 5KSVB 1ACZA 4PIRF 3WH7A 3KYKH 1CBGA 4MB5A 5I1LA 1RK1A 4FF5A 1Q6DA 3NN8B 3VGGA 3VXRE 4JFVA 1SMAA 3OZPA 3RWEA 2OSWA 1RVFL 5MEPB 4QOKA 1MWAH 3KPLA 3B9KB 4JKPH 5D1ZA 4FXGA 1OGAE 2J7DA 2BSRA 5E94A 5KVEL 5C9JB 4KVCH 2ILLA 2HRPH 1HI6B 4Z7WF 3CU1A 3EYUL 1TFVA 4JY6B 2WZIA 5DSCB 4DM2A 5F1IB 3NBNA 5F9WC 2H26B 3CPLB 3DROB 4L9LB 3QQ4B 1HHKB 1EBAA 3BRFA 4L3ED 1T21B 3ECBA 3NFNB 4ESKA 2F8XC 4JFUA 3L1OL 4EZMA 4YBLC 1W0YT 4Q9QH 2AJXL 2B4CL 3PL6B 3ARUA 4LAQL 1BGGA 3V5KB 1E0WA 4M02A 1TTUA 2B2XH 4HP5A 3MMWA 3D18B 3MNVB 3QUKB 5ESQB 1BBDH 1U3YA 1MQPA 2VAAB 4KHXL 2ARWA 1TG7A 1JF5A 2GUOA 4E41A 3FTGB 5DI8A 3NPSC 4HKJA 3O3AA 3WNMA 4PRNB 4NP4H 2VXTL 4WV1B 3GYCA 4I5BB 5J11B 1EQPA 1NGWB 4P8VA 2PF6A 2FB4L 4LK4A 3BIKA 3WDPP 3SE3A 2BCKA 4WFHD 3E6FA 2NT0A 3T4YB 5KVGL 2H9GB 2QQQA 2KQMA 3ZTJH 1ZLWK 3AAZB 1XIWB 1ZS8B 2XFYA 2X1IA 5HI4C 1B0IA 5IHSA 2HJFA 3U2SA 1MCNA 1F4XH 2GK2A 5BOZG 1E6JL 1BFOB 2VSDA 4OCYL 4PJFA 4R7NB 3KLDA 4HKXA 1PFCA 1PKOA 2XI9A 1T2JA 4KKCD 1P5UA 3FHAA 4U1GB 5DMGD 1E15A 5CHNA 4WUUE 4W8AA 2FHFA 1P5VA 1Z0MA 4TUFA 4UQBA 3MACH 2JJUA 4PTWA 4AL8H 2DBJA 3VG9C 4JFPB 3U7BA 2H8PA 3RI5K 3D69A 4P48A 4KUCF 3DHJA 5I17B 1WAAF 2FH6A 4PSRA 1BLIA 4HH9B 2WVVB 5IDIA 3O11B 4NKMA 3QIUB 1INQA 4EI5C 5TDOB 3U30B 1YEFH 2J5LC 3T0AA 4TUOB 3RVTC 5JW5B 1D9KD 3VD5A 2VLJD 1FFOA 1A6AB 5E9DA 2IADA 3O2VH 2R4RH 3WLBA 3S2CA 1YMHB 2CIIA 4N0CD 3HZYB 1Y7VA 2WMIA 1M05A 5E4EC 3CSYA 3HHRB 4UZSA 1QYGH 1XRVA 2JJSC 5EPMB 4DTGH 1U9KA 4P7OA 3Q48A 2FEEL 3HI1B 4ONFH 4HFUH 3FB8B 2BC4A 2R1WA 3ALGA 1XD1A 4R96A 3WELA 1ACYL 3EYOA 3CFKA 4HIJB 4PJAB 4RRPG 3P4OB 3LN5B 3WFBL 5FUOL 3WHE1 4NKDA 1ZB5A 4PRHA 4OZFA 3GNPA 4H88L 4OD2A 1Q94B 2DQIH 2E9MA 5EOQL 3O45A 2JIWA 4DCQB 2VCBA 4DGVH 4NT6A 5E8PB 5EU3A 2G75A 4JPVL 2Q8AL 5C0GB 2GAZB 4ZSOA 1W0WA 3OKYA 1U3HB 2NNAB 1MCKA 4J4PD 4HC1H 2I5YL 4DAGL 1DEDA 2YPKB 1PX8A 2PW1B 1DN0B 3W2DH 2R56L 2G5BB 4NWUH 4IOFD 2EH7L 2GTZA 3TWCL 2ED8A 1CTOA 4LYQA 2PW2B 4OCMC 7CGTA 2MQCA 2BRRL 5IVOA 1EAPB 1R8LA 3VGFA 2IAMC 3O6LH 5L0QC 4FLQA 2NY7L 4B53A 3OGCA 1IGIH 5ICYB 4XWOC 3OAYH 4GLRI 3TGXA 5F9JB 5B38A 3W38A 2CMRL 2G9HB 1G5AA 5DK3A 4TVCA 3LHPH 4EIGB 1JDDA 3FQXB 5D1QB 4FG6D 5TD4A 1JFQL 4C59B 2HT4D 4ERSL 1LEGB 1UWXH 1C93A 1HCFX 2XA8H 2C1PA 2JF6A 2QBWA 1CGVA 4IJ3B 2X4SB 2OJEB 3DETC 5LAXB 1OTUD 2VABA 1R0AH 4IRSA 4Y7MA 4P5KA 1JVKA 3CMJA 2C3WA 5IQ9A 3L4UA 4DN4H 3LIZH 4NNYB 1I1FA 2NY6B 4QRTB 5C0DB 1WT5A 3OKMA 2DGAA 4ZTOL 4Y4FD 5K9JH 4OZ4B 4LCWB 2ZICA 2HA1A 1A7PH 4XNYH 1H3TA 4X5XB 4WFGE 4RFOH 3POHA 1FZOA 2YC1B 1OTTD 4Q58C 4RAUB 2PNDA 3MXWL 2IG2H 1ETZA 4M7KH 2FZ3B 4UQ3A 4PUBL 1E5JA 5T3XD 1BZ7B 3UTZB 1NARA 4WJ5B 2MCPH 4QHNA 3NA9L 2CRYA 3M07A 3P9WB 1L6XA 2DSWA 5E8EB 1V6VA 1GH7A 2VKXA 1KCVL 1I1AD 3N9KA 3CSPA 1FPTH 4OUOA 3SKJH 4MLSA 4ZPTA 5EO1B 1AGBB 2KH2B 1H0IA 2CESA 2CLVB 3ZYJA 3SDDD 4H0GA 3NCJL 5L7XH 4XPFH 3FFCE 4HT1L 4AZBA 2DQTH 2CRZA 1KXQA 4ZTPH 3LKPB 5KVFH 5AAWA 4UQEA 2OMNA 4G8GD 1W1TA 4HS6A 4YXLL 1OP9A 1NC2B 3AUVA 2N56A 2A74B 2UWEB 5CUSH 1MHCA 2EDQA 4LSTH 3WUZA 3VJ6B 4LSQH 5FGRA 2C7UB 3L4WA 3CDCA 4JKWA 4ORGB 4UIKL 5I1IL 3PHSA 3PWNB 1BWWA 5JOEA 1ZGLM 4PFEA 4NO2B 4OTXL 1OW0C 5E9DE 3WFDL 1XR9A 1WAAE 4Y4KC 1FP9A 4M7JH 3BEWB 4D9LH 2DMKA 2FJGA 3WEZA 3PWVA 2HH0L 2C3VB 3M17B 4CW1B 4XNXH 2X0YA 3PWPB 1L0YA 5D96C 4F7EB 4D9QE 3DSFH 3Q6GH 4QNPF 4Z2LA 3KPMA 1MCOL 4KKCC 4OGXL 4HK0A 2KPNA 3BEVA 5BW7C 4KJQC 1FYTE 1P53A 2IC2A 3PWPE 43CAA 1EX0A 2VZSA 3Q2CA 4RGNC 3FT4A 4HMCA 4ENED 4KC3B 4OJYA 3TVMA 4JKPL 1BQHA 1FAIH 3UG3A 4Y5XA 5CEZL 2VXQH 2EDOA 2CIKA 5TH2B 3TBWB 3AS0A 3ILPB 3LS4H 3BP7A 1TJGH 3IK2A 1FL6A 5H37G 2HWZH 4FFYH 2YRLA 2GCYA 2BDNH 1AQDB 1US3A 1BQLL 1A4JB 1V8HA 5J8OA 2EDEA 2D0GA 3RWCA 4BCEA 3CPUA 4TOYH 4FZEH 3GSOA 4PGEB 3ARFB 7A3HA 3IAPA 3VRLE 3VNYA 4ZFMA 1S7WB 4NC1E 3QIBD 5C0FA 3FN9A 4FXKA 3TZVB 2QQNH 4OJFH 4KUZL 1UUQA 4PP1D 1H3GA 5HHOA 1E4NA 4QO1A 3G6DL 3KXFA 3QJFB 5F7WC 3TIDB 1WCBB 5K93A 1UCTA 3L3JB 3BCDA 3WFDH 3POCA 5ICZB 2CQVA 2CBJA 2EKSB 5T33H 4BSVA 4PJIA 4UDTA 1KBBA 3CAFA 1J1PH 4W4OC 4KKLC 5HVHC 4FFWC 5I30L 1KJMB 3S35X 3X3GL 3QUZA 4OZHF 1HF6A 3HLAB 4XI5C 5JQHC 5BWFA 1WFOA 2XWEA 3DGCR 1K6QH 5HHXH 4PRWA 3GMQA 5ID1A 4X7SL 1FHLA 3CFKB 4PJAA 2HJKB 5BMFL 1UKTA 3CLEH 2DM2A 1NQBA 2EPLX 1BD2A 5FIPA 1QFUL 3REWB 1FO0A 4QXUL 2VRKA 5HGDB 3P73B 5I15H 4M61A 8A3HA 2VLMD 3PDOB 5DD5H 4CU7A 1LNUA 3VFPA 4EEEA 1H15A 5IG7A 3S6TA 3IDXL 4HS3B 2QHRH 4JY4A 2H3NB 2I60L 3AHVA 1GVIA 4D8PB 3D0VB 3GNMH 4QHLA 3BKYL 2B1AH 5MEPA 3SHSA 1CD1A 2I26N 1MNUL 1J1XH 3I6KB 4YN5A 1Q9KB 3EYQC 3N50A 4U1SB 1IV8A 4MTVA 1OP3H 1JYNA 2O92A 4G7VH 1F11A 2CHNA 5EZIH 1IQDA 5DC0A 5IB3A 2TAAA 4HZ8A 3UDWA 5KSVA 5IMMA 5HSFA 3O3BB 5BZWB 3NSMA 1T0MB 4HWZA 3G5YA 2J47A 1B0RB 5I1HL 3GTNA 3NZHH 1N8ZB 3WXVL 4P0DA 2W0PA 3HNVL 4RCAA 5A2KH 3RI5F 1JUFB 4XCYA 4PMUA 1H4PA 1J88A 3QPQD 4TPRH 2D31A 4H0HB 4G42B 3MJ6A 1J0IA 3K1KC 4NJAL 3VMNA 4XGZB 3T0BA 3H9SB 5T1LB 3LQAL 4XBGA 4ZNCD 2CD0A 3RY6A 4EVNB 3U46B 1DVFD 4AZGA 4P5TC 4NJ9L 4ODWA 3DGGB 1P7HL 4KROB 4P7NA 2WKLA 1CFVL 4QRUA 2BVYA 5FGBC 1C5BH 2DS4A 3GI9H 3NH7L 3GNOA 1RP8A 3HZMB 1QI3A 3X13B 5IQ9B 4G6AD 3VXOA 3RM9A 1IGTA 1FO0L 3WKMH 2WWMD 2YRZA 4ZAKD 1XGZA 4HX1A 3GH4A 4JHBA 3CSGA 5EU6D 1IAMA 4QCFA 2XPGA 4PJAE 2AP2A 1Z0NA 1W8NA 4G9FB 3GJEA 1S9VB 3PZNA 4HU0A 5ESQA 5ID0A 1BREA 3PNWB 3MRHB 4WI9A 2Q8AH 1E3XA 1PSKH 3ETBF 1B2WH 4Y1AA 1HXMB 4TUJB 3MRLB 4XPHL 1E40A 1QEWA 4F57L 5BO1L 1NGYB 1U3ZA 4OSUL 5A16A 3VRIA 2EXYD 3G6LA 1OD9A 3D1MC 4ZPTB 5EO1A 1S78D 5I71C 1WBXB 4C7GA 3RIAK 2X4PB 4XAKE 1BVKA 2BVQA 3V8CA 1KFWA 1BJ1J 1S46A 1B9ZA 1XMWA 3WUGA 1FP5A 1XYFA 1HHHA 4HXBL 4NO0B 4NZTL 4HS6B 2BVOA 4UUJA 4XNZC 4MNQA 1T04A 1IGFH 2VL5A 1YDPA 4MVBC 5GXBB 1H1NA 3H9HB 3UTSD 2PCPA 4YR6B 4HV8A 3MMEA 3QIUD 2HT3C 3TBYB 1N59A 3PBGA 2J2ZA 4DWSD 4LSVH 2ENSA 4P2OD 3T0EC 1XR9B 4MA3A 4IRZL 5FB8B 3AIQA 2RCSH 5C0CB 3BQUB 5HYFA 2DYPD 1HQ4B 3DUHA 4L8SA 5A6MA 2LFGA 3SDAA 1JTPA 1CG9B 4RL3A 5DK0B 1FH8A 4W8BA 1R3JA 3GK8H 1AQKH 1AHWA 4XBPA 4ONGH 4NRZA 5GZND 5DLMH 1INQB 1RULH 3LS4L 5ADOH 1WWWX 5I8OL 1IARB 4QXWA 3KYOB 4IDJL 4PRHE 3U36B 5TGBA 1E55A 4GKZA 3KWWB 3LEYH 1JHKL 1WP6A 5GS2D 4OD2B 3TYFB 2V2WA 2VDLH 2R0LL 3EOTL 4P2YA 2YBUA 4O58L 5E8OA 1EGJA 2E7LC 3D85D 3GHBL 4Z7UF 1G7JB 4IIQB 3GSOB 4PGEA 5IFAH 4JZJC 1BQSA 1XT5A 2OZ4H 3O6FC 1G7PA 1S7WA 1C5DB 3SN6N 3LPOA 2CXGA 5AC4A 4B3LA 5CILH 1NWTA 4GBXC 3QIBA 4M1GL 5TDNA 3NYDA 1KGCD 2PI6A 1LLOA 3FT3A 3LPFA 4K94H 2ADIB 4GZEA 1ZTXH 4I77L 5EOTB 2DQTL 4NKQB 2CUHA 4XCFH 3KNBA 3FO2B 3CJJA 5EUKA 2J7LA 3QNXB 3TYGH 4RGNB 1SYTA 1MW2A 4NT6B 1ERNA 2JEPA 4MB1A 3WMBA 5ETUA 4K23H 1VFBB 2VDQL 3BAIA 1ZLUK 1VFMA 1YEKL 3E2HC 4HOZA 5JHDD 4AIUA 1AO7D 5HYJB 3EJZC 1L7IH 1RULL 4P5MA 4P7QA 1NMCB 3CFJA 3L3IA 4N1EA 5CXPA 2BHYA 2QL1A 2QSCH 5FYKH 2EECA 4NQCE 2GJ6A 4PJ7A 5D1QA 3RBSA 3FW6A 4ONFL 1VKXB 4Z9KB 4KJPC 1YUHB 3RPMA 5DHXB 3CUIA 3THML 3HUJB 4S1RL 3TM6A 2AK4E 5CD3A 2YPLA 4MJ5B 5HDQL 3PP4H 4ZNEE 2D3VA 4OV6F 4U05A 1OOAA 2PR4H 1X4XA 3G9VA 3QEQD 3NIGE 2JK5A 5SWZA 1IEBB 1ZT4A 3S37L 4GMSH 1PW3A 3N85L 3L4ZA 5LCVL 4S1QL 4M1GH 1NFDF 2XVLA 4HUMB 5JW4M 3C5SA 4QLKA 2Z8WC 4HPHA 4M5ZL 1CGSH 5DRXA 4I3SL 1U8IA 4LCYB 2XKUA 2WNGA 4NIKB 1MUJA 2XKNA 2P5WA 1ORQB 1MQKL 2AXGB 3KPTA 1YECH 3LQAC 4DAGH 3W25A 3ALPA 4OAWA 2HMIC 1F4WL 4I18C 3RZCA 1GOMA 3QFJE 3QXDA 3EUUA 1FZJA 3GM0A 4G43B 3HZVA 5BW7A 2W4XA 3H3PH 4H1LH 3MRJB 4X98B 1U8LA 4TRPH 4ACYA 4P2QE 2D31B 4LHUD 3DXAD 1LWJA 1ZOXA 1GCFA 4FHBD 1A1OA 1X6LA 2SEBB 1EJ6A 1OAYH 4F8TA 4HJJH 4HUWA 3B83A 4QRUB 5FO7B 3KE0A 1ZVSA 5MEQA 1U92A 2BSTA 3UJJL 5IHUL 5E6IC 1YYLL 2VITB 1NAKL 4DEPB 1AGBA 4WI4A 4RFEA 4DK3A 5DSCA 4XB8A 1GHFL 2J88H 3D85B 1WAWA 4PJEB 1XYZA 2O5XH 1UFUA 4PBWD 2X42A 3QNZB 5T3XL 1PQZA 2EEXA 4J4PA 4AEIH 4F57H 1UACL 4LLWB 4HXAL 3QUYB 1QRNE 3WCYA 3S35L 1JD7A 1AGFB 1JI2A 3VXTB 4YHYC 1HXMA 4RAHA 3V4PH 1HWHB 4PUDA 3L1OH 4I3GA 3BAEH 2VDNL 2UY7A 5E99H 5JBEA 2GDUA 1V3KA 2ZPKL 2B7DT 3V6BR 4UOJA 4JKMA 2AMGA 1NDGA 4F15B 5I1AB 4YHPA 4HKJB 2VNCA 5C0CD 4HPYL 4BZ2L 3QOMA 2AQ3A 2I25N 1WICA 4NO0A 4XP4L 2GSGB 3OAUH 5EOQH 3ARZA 5J89A 3ILQC 2VCCA 2G5RA 4LLAA 1H0GA 4LSSH 3V6ZB 1IAIL 5KVDL 5F21B 1GOOA 5E0FA 1J5OL 3O9NA 2HJFB 3VMPA 4LSPL 4DW2L 2VDKL 3UBXB 4XB7A 4Y5XB 4UDTB 1I9JL 5FO8A 5JPNA 3O4OB 2EXWD 5HNNA 2EIZB 4EXKA 1Q8MA 4PRID 2PO6B 3F12A 1OY3B 1U93B 3BGAA 4AEIL 3KPRD 2X4OA 2JKXA 2MMXA 1W72B 5I76B 3V6FB 3X12A 5CJ5A 3TCLA 4QWWC 1FL3A 5EC2A 2VWEE 4JFQB 2EDJA 2DL2A 5EUOB 4TVUA 3ZZ1A 5I1DB 5HJ3B 4JFEE 2PXYB 1I3GH 5GSRB 1KPUA 4BQ5A 1HINL 5E95B 3RPIA 3EFFA 4PJGE 4LVEA 4X6DB 4NKIL 4M61B 3MNZB 1JGLH 1FYTB 4NP4L 2GK1A 5DJDA 1J7VR 4RIRA 3SE9H 1WWBX 1FG2B 2I24N 4WEBL 3D0VA 2PTTA 4WSKA 2MQ0A 5GGTH 1G7LA 2QKIB 5D72H 3BLKA 1ODAA 1MJ7L 4ZFOB 1TFHA 4I3RL 4FQIL 4I1NB 5B39A 1UCBL 2FD6L 2ESCA 1HKKA 1WDRA 3CLFL 3V4VH 1MF2H 5GGTA 3SPVA 4NM4L 4G7YH 5IMMB 3C6LC 3BRGC 1I7ZA 5GIRA 4MCZA 2EH8L 4F9PA 3QSKB 4N5UA 3CUGA 4JCMA 1BD2D 1JWSA 4I9WD 4XNUL 1L4IA 4IDLA 1D6VL 5CSZA 3GGWB 3T3ME 4I2XA 2IBBA 3UEZA 5HYJA 2GVYA 1CD1B 5FAAA 3PZGA 4G8FB 4LGRB 1GC1C 4MJ2A 3UESA 5FHAL 2A83A 4WDIA 4PGBB 4XPFL 4YPGB 2WWMC 2ICEA 1XCXA 1EXPA 5C0AE 3CHEA 4KRUA 5FUCE 2E9WA 3MCKB 1DE4A 1DLFL 1JZ8A 2AEPH 3O3BA 4LXFA 5M17A 3TNMA 3C5ZC 2GFBB 3AY4C 5FOOA 1EUTA 3NCFB 1JCKA 3BI9X 7TAAA 4IMKA 4P5TD 1UB5B 3RDTA 2Z8SA 2C1OA 2IGFL 4KROD 1ZT4B 4ONGL 1HH9B 2XJ7A 2OBGA 4TXEA 2ARJB 2EE3A 3BZFA 1EZVY 1XGTA 4FQIH 5T1LD 1U8PA 4RGOH 5LQBL 4A6YH 2CUMA 3PWJB 5IUSA 3ZJ6A 2DIAA 2E5EA 1I1YA 1MUJB 4RGNE 2OJZH 4G7YL 2AABL 1DQDH 2V5DA 4PP2B 4Z76B 4NRXA 2NY4C 5DHVA 4ATWA 3GBLA 4XNUH 3QRGL 4K94C 2PYFB 3P77A 5M94B 2XM1A 4PN2A 5AY7A 5FCZA 4O02H 3DX6B 2Y2WA 1QSFB 2OYPA 3BUYB 4KZEL 1DQLL 2R0ZL 2YLLA 1BGAA 5D9MA 1NBZA 1NGPH 1VADB 4LQFL 2F74B 1KCUH 3IS1X 2J78A 4K8RL 4P5KB 3LRSA 2HWZL 5K59F 2ZCHH 3LKQA 2YLAA 4ODUB 4X6FA 3UDWC 1MRFL 3FCTA 1MAKA 1IGJA 4QRTA 4YHOH 1INEL 3V5KA 1S5HB 2ADGB 1T83A 5FO7A 3H9HA 3O6ML 4KQ4H 3PHOA 3QJHA 4J27A 4R3SA 4K55A 1A4KA 4Y89A 4DFHA 1II4E 2OR9L 3QA3A 5I1JH 3WQ6A 5SX5H 3OKLA 3OR7B 4JVWA 4RFEB 1XSJA 1BZ7A 5DVKA 1ZAGA 4JQXA 4B16A 3AXLB 3N9GH 1C5BL 3O4LA 4AD4A 4PJDF 5DI8B 3ULVL 5JTWA 3CK0H 1HHHB 1CG9A 1U8MA 3TPKA 5CCKH 5HPCA 3SCUA 1J01A 3RGVB 4R4NC 5DQDL 2AABH 1U2CA 5LA0A 3LKSB 5IBTL 3CTTA 3UCRA 2VJXA 1WAAA 1OGSA 4NRYB 4TN9A 2PCPB 2MTPA 4LAJH 3AAZA 5GS0D 1FNGB 3PHQB 1UR2A 4NQED 3U36A 3QO1A 5ICXB 2EEBA 4S1QH 4Y2OA 4BK5A 1PIGA 4XPBH 3RPKA 3ARGA 3X3FH 5HI4D 4B3KA 2OR8A 4AZCB 3MQIA 5HHMB 5DVOA 2G3JA 1XIWC 4YXLH 4C56B 3VU2A 3QNYB 4R4FL 4ETQA 3G6AB 3QIWB 2CKBB 1WIUA 3CXHK 4LSPH 4YHOL 4FQQB 4Y4FA 4H8UA 4ZFFB 2YL5A 1V0LA 5LA2A 1N4XL 1NSNL 3NPSB 5GGVL 3WO4B 3U6RA 4CNIB 2W91A 5I1JL 2D9CA 4CADA 2AKRB 2NX5D 3O6AA 1D5BB 3O2DL 2F61A 4P7RA 1NC2D 1LK3H 4LDEB 3NFPB 5DWUH 5ANMB 3GRWA 1BMGA 2ICCA 2J8UF 4U3HA 1T1ZB 2AK1H 1RSFA 1NGXA 4U6HA 2QADB 4JM4H 3CO4A 4Q6IB 3ZHLA 1MLCB 4NBXB 1ROWA 4APQA 2HTKC 3D5OF 4IIQA 3VXME 3OKDB 2X10A 2BERA 1XSKA 5T1MA 4JRXE 1HOCB 5D6CA 4M5YH 4I18A 1IAIM 1FYTD 1NAKH 4KI5D 1YZZA 5ACLA 3HMXA 1A6UL 4PTUA 4XH2A 5D1XB 1V6WA 2W0KA 4JPVH 1PGRB 1NH6A 3OJVC 1VKXA 1XH3B 3T3MF 3GB7A 5DQ9A 3PZOA 5T3XH 1FN4B 2GJPA 1F58H 4X9HA 2HT3D 1J8HA 4X5WB 2D7TH 3P4OA 2GI7A 3V52H 1LO2L 3WD5L 4WUKL 2OLHA 3LD8C 4J1UB 4M24A 5DJAA 5FYLD 4OJFL 5E6IA 1BJ1H 1BVLA 1KJMA 5SV3A 1BQUA 3H3BC 3MZTA 5K9KB 3KLAA 3T77A 2O9RA 4NZUH 1P9MC 3GBNL 4JFDD 4EAMA 4E42A 1LD9B 3BMWA 4UQ2A 1CICB 1U8QA 4KY1L 1UWUA 2A73A 2BNRB 2ADJB 2E7LA 5DHVH 1PX4A 2X70B 2IFFH 2A6DA 3V0AC 3ZE0E 2OWWA 5J1TC 1D6EA 2JF1A 1YYML 1X5JA 4ZPVA 4XCCL 1OTTC 5GZOD 2YOCA 3B9KA 5CBEA 2E7BA 4QCEA 4PMZA 2DQJH 5FL0A 2RQ8A 1F13A 2BS9A 1AXTH 3ULSB 1G7MB 2QQNL 1W1YA 1R5WB 4WI6A 3QQ4A 5I23A 5JZ7D 1KN2L 3LSOB 4OLYL 3S88H 4GLRH 3GSUA 4GBXB 1CVSC 2WWCA 1XGYL 5GNXA 1F11B 3UTTE 3CH8A 3LEXB 1J8HD 2WWKO 4O2FA 1ACYH 3NGBB 4B7IA 1W2KT 3AM8C 5IBLC 3MO1B 2CRMA 5JW4R 2H41A 2VDPH 5LAXA 4FQ2H 2V3FA 3NAAL 2AS5M 1FJ1B 2Q20A 4JRWA 1H5VA 4N8VA 4F9LA 1W0VA 3QUYA 1P84J 4D72A 1RIHL 5DYOA 3V5DB 4AZ7A 1LWHA 3QHTC 1QBLL 4ZS6D 1AFVH 4FLSA 4RAUA 1TPXB 4Z77A 4PG2A 3BN9C 3C87A 5IB4B 4UNTA 1RQ5A 4LSTL 3WS6A 2IPKA 1VBRA 5I1AA 1U6AL 3DRTA 4EN3C 1GGCH 1QSEA 3CX2A 5KZ6A 4U0RB 1HNGA 5F96L 2B5IB 3BAYA 5F9DC 3EYVB 1ZANH 4G6JH 1KXVC 5T5NF 1LDPH 4OUEA 2X40A 5EZOL 3R1GL 4YFLI 2Y7QA 3TCXA 1EV2E 5FUZH 1N6UA 1D5MB 1PX3A 2NZ9D 2A74A 3GJEB 2BFGA 4HCRL 4KJWC 5A6SA 1HEZA 1KNOA 3ALXA 3HR5B 3VJ6A 3TT3L 1T20B 6TAAA 3F12B 3WXVH 2Q3AA 1RZGA 4ERSH 1YEJL 4PR5B 3C6LA 5CJXA 5JZ7C 4LEOA 1UWXK 1XFPA 4LHUG 3SE8H 2R9HD 4KK8D 3MJ8A 5JDJA 1YJDL 2X4TA 2ZNXA 2DSKA 4JL1A 4YGVB 1Q0YL 2NTFB 4LEXH 4JANA 4F7MA 3MUJA 4Z7QE 5KS9E 2XTJC 2J4GA 1CXLA 3OAZH 2X9YA 3U9UA 2O5ZL 2XZAL 1CFVH 3NOIA 4BKLB 4D0DA 1CT8A 5AZEL 3BEVB 3CVHA 1NLDL 3U0PA 1GOKA 1GOIA 3WHXA 4EUPG 3QQ3B 1S7TA 5DJ2A 1JXKA 2DBLL 3VFNA 43C9A 1RMFL 1T1YB 3SCTA 3ZKND 5TH2A 3KJ6L 5FYJU 3RUGA 1VPOH 2VRQA 2AK1L 4A2MA 3B5GA 3ZQ9A 1A9EA 1DQMH 4ZXBB 1P2CA 3T2NH 5IW3A 5FM4A 3SDDC 3CZEA 3JUZA 1U8NB 1WZ1L 3B9EA 3QZWA 1ZWIB 1FYHB 4M93B 3WHE0 5A8NA 1YNTB 1JN6A 4ZD3H 1CN4A 4RISH 3UR7A 4M82A 2G3IA 1KB5H 3ME0A 4FTVA 1UXWB 1T6WA 1S5IL 3SY0A 1B3JA 3MV01 1MRFH 1HXYA 3IFLH 4GI6A 2GAZA 4EI5D 1I7RB 4ZSOB 3APGA 4LCWE 2R4RL 4NRRA 1T03L 2GTWA 2Y23A 5LGJB 3HG1B 4JFXB 4AISA 2F54E 5SWZE 2VR9A 4QT5B 3QFJA 1C8YA 2VVNA 2JJVA 1IVLA 4X0KA 1O0VA 3U7WH 4MPKA 3CSBA 2XY2A 2B1AL 5BRZE 4PRPE 3TNMB 3TBTA 3GMQB 4RFNC 4KWUA 3EYSH 3QUXD 1T5XB 3C5ZD 1EVUA 4PJEE 4Y2DA 5IMLA 2HLAB 1NFDB 1N3NB 2D7OA 3C8KB 2E7MA 2HT4C 3ZE1E 4BQ8A 1FL5A 2J12B 2C26A 4H25A 4HWNA 1HKLH 4JO2L 4Y8DC 5AWNH 1VPOL 2FX8H 1PZ5B 4JFHD 4P3CL 1E1EA 4LKCB 1E73M 4PGBA 3S96B 2JIEA 3HE7D 3C60B 1I1WA 1QPPA 2DWEB 4R7DB 3PZVA 2H1PH 2OXGA 5IP4A 2Z91B 2IH3B 3TFKD 4GFTB 1A7OL 4RISL 2CDFA 3FB5B 2H2PC 4WWKD 3V0WH 2OK0L 4MA7L 5L6YH 3BDXA 3MV7A 2ADJA 2VDQH 5E5UB 4CU6A 4NQXB 4PJCB 4W84A 4X6BB 4ZO9A 3INUH 4S0SD 3GDBA 1SY6H 3BP4B 4D0BA 5BJTA 5E56A 4NNYA 2OL3H 3BAEL 5JXEA 4OCXH 5CBEB 1TVNA 2VYRE 5F71A 4YDVA 1VADA 4JN1L 2VLRB 3CHFA 2NMSA 1GJUA 5CP7A 1FH7A 2PKDA 3M1BA 4L4VB 4UQ3B 1ZLVK 2YWYA 5JDSB 2GJZA 4I13B 4KK9C 3EO0A 5IK3B 2Z31C 3RA7H 3QUXA 5TFSH 4M7ZC 4XVJL 2XRAL 3CDYA 1O7AA 4Y19B 4GKLA 4PTTA 1PAMA 5DMKA 3RJXA 4J3UA 5L8JB 1UR0A 2AV7B 2XFRA 4POZD 2AXGA 1XV8A 5F7UA 3FB6A 3U83A 1FDLL