5JIPA

Crystal structure of the clostridium perfringens spore cortex lytic enzyme slem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
317
structure length
317
Chain Sequence
GFAQDKNPLSTFGPDLNEFSRDVNFLTLAKNSDFIYLRASGSGTGKLRIDNKFLEFAKECRRLGIPCGAYHFAKPSKDLDSAVIQADQFIDVLQQGFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTDEGKLDGVGSPVDLNWGPNSIDSLMPPSAVTGLNAYISGNKIFVNWTANKEDDLNGYNVFVNDNYAGTLPRKATKIVIDKSRFYLPKGKPIKISIEAFDITGDFSKERTEYILDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Clostridium perfringens SleM, a muramidase involved in cortical hydrolysis during spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords Cortical-lytic enzyme
total genus 95
structure length 317
sequence length 317
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01183 Glyco_hydro_25 Glycosyl hydrolases family 25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jipA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5jipA01
4BH8B 2AQ3A 5F7MC 4PLJC 3P4NA 1Z6JT 4PRIA 4H88L 3ZMRA 5F1KC 3MRFB 4XP1L 4ZSOA 1FP8A 2W1NA 4LVOC 4XNYL 1CXIA 4NRYB 3CMOH 1OGAD 1C5BH 3CU1A 2C3WA 3EYOA 1W1PA 2VX6A 3O3DA 3ZL4L 1BD2B 1YN7A 5I8EA 2N1KA 5HYFA 3R1GH 3TO4D 5MEPA 1TDQA 1XR8A 5D2NA 1IZKA 5HHNA 2X70B 1DBAL 1ONQB 4KK9D 5HYSA 3JTSA 3O8XD 4LSRH 1XIWB 1IJ9A 2QHAA 2XRAL 1M6OB 3UZQA 3NAAH 3GXFA 3ARDD 4M5YH 4AZGA 1HDMB 5GGUB 5FIEA 5E1AB 2FWOB 3B5TA 4Y4FC 2OMBA 1K6QH 3RWHB 3QNXB 4IOSD 3MO1A 4XBEH 2BNQD 3NGBC 3RTQB 4HIXH 1EERB 4X7FC 5FUZL 1R3KB 5T3ZL 4PJAA 1UXWA 3Q2CA 3C09C 2J4GA 5JPMB 4M1DL 5F93C 4F7CB 4Z5RA 3LN9A 5E2TH 5JA8B 3PZOA 3EYVA 1B3WA 5FM5O 1C3FA 3DIFB 3M46A 4D0DB 3Q5OA 1KPUB 1G7JB 4XP6L 5MI0C 1KXTA 3KYOB 4GRMB 4GRLA 4EUPH 2R2EB 1DBBL 4P48A 1NGZA 3HTLX 3WBEA 5FYJH 3JTTB 1HYSD 4W7WA 1A8JH 2O61A 3N9KA 3TWCH 4D0DA 4KTDL 1CT8B 2DYPB 4P2RA 5JHDB 1FVCA 1UWSA 5JQ6H 3BLPX 4DM1A 3KVQA 4ISVB 5KSAD 3QI9C 4M02A 5HGBB 1R0AH 1EHLH 5ANMA 5I19L 4QRPD 4NJ9H 4GKZB 5HHVH 1BFOA 1VSCA 5M7QA 1GOHA 4UIKL 4Z8FL 2LU7A 2XIDA 2V5MA 5IQ7L 1KCVH 3BDBA 1E72M 1Q9KB 1ZLUK 1E43A 3X13A 2OWCA 5EIIA 4ELME 5H37H 3S34L 5GS2H 3GH5A 3O8XB 3VE0A 1E4JA 4Q6IB 5CSZA 15C8H 1MIEH 1FNLA 3VRLF 1H49A 4HWEL 4YK4C 3EOYG 3HAEB 2ZWYA 1WAAA 1A4KA 2DDXA 3MODL 3NSNA 2JJSC 5I75B 3A0OA 4F7MA 2V38A 1PX3A 5DHYB 1HHIB 3ETBF 2BSSA 2XIIA 3FN9A 3X14B 4WU5A 1IL1A 3WKZA 2VMFA 1AQ0A 4OF3A 1HJWA 3ME0A 2FGLA 4NSKB 4M7LL 4OZFB 5I15H 3MKKA 3D5OF 1G9MH 1LK2B 4S1QL 4L4TE 3TZVD 4PG2C 1CYGA 4RGNB 4KWUA 1TZIA 1BVZA 3V0AC 3RRQA 1EVTC 3L6FA 1J8HA 1F11B 1XCQA 3FO2B 2X4UA 3V52H 5HGHB 4WLCA 1AJ7L 1ROWA 3TFKC 1A6TB 3MRMB 4LF3A 5HD8D 4C83A 1I1YA 4YR6B 3EO0A 5MERB 1TJHH 4OV5B 4PLKC 3V8OA 1UR2A 3VILA 3L5WB 3H9ZA 1DVFB 4J1UA 1Q72L 4U1KA 1BVKB 4OCSL 4OM0H 3FQNB 3AIBA 2I9LA 3UTOA 4HZAA 3SDDB 5GS0H 4AZHA 3BN9C 3QQ4A 1HJUA 3C6LD 1MXDA 3MGTB 5IB5A 4X9FA 5J1SC 4S2SB 3MLVL 1NEZA 5GGSA 2DQFA 3CXDH 1W8OA 4JFYA 1UZ8B 4W7UA 2GUYA 1LD9A 4JVWA 4K7FB 3BC9A 3FO0L 1RURL 4K94H 2ITCA 2R9HD 2WSPA 3U46A 5C8BB 1M7IA 4OCWL 3FHAA 4KUZH 1HHHA 3HC3H 4LIQL 4HKXA 5CEXA 1MF2L 4LLMB 1SQ2N 1PQZB 5C71A 5I8CA 3MRLA 2CQVA 3H9SE 3AAZB 3X3FH 3FO1B 4CMHB 5LJYH 2QQKL 5BVPH 4PJAE 1FO0B 1QSED 1QSFB 4LYQA 1BVNP 4XNXH 4UDUA 5I6XC 2ESVE 3VG0L 2XQBH 5GS3A 5E8NA 3T0BA 4RGOH 2OWXA 1UG9A 1ACYL 2EIEA 5DJXB 3UXFA 1DWIM 5F1NA 1II4E 1LO2H 4NIKB 5EOQH 2ZIDA 2HJKB 2W4XA 1MJUL 4HEME 3HRPA 4Y5VC 2Q8AL 3QRGH 2CNCA 2QPSA 2RAMA 2DT0A 4Q2ZA 2DPEA 1KCLA 2A9MH 1NCAH 5FYJE 3ECQA 4G6FD 2XY2A 3ARDC 3GNML 1MCIA 3MROA 4OI7A 1FHDA 3QXAB 5A3IC 3NPSC 4HCRA 4UQBA 5DVMA 3PZVA 1QKZL 1J8HD 4XMPH 4Y1AA 5EA0H 4EBQH 3WD0A 3GMPB 1IC4L 3T0EA 2DN7A 5I73B 4HMEA 4DUWA 4U5KA 1AQKL 1MH5A 1Z2KA 4R0LA 4P9HC 1CGVA 1TNNA 4R4NC 3WUZA 2OX5A 4YWGH 4UUJA 5ITFA 2IGFH 3QDME 5C6PB 1WC7A 5L88L 1QNSA 3TIEB 3MRCB 1AY1L 3CLEL 2Q8XA 4O2EB 4I4WA 4BSWB 3IDYC 1GGCH 1HKLH 1JDAA 5D1QC 2E9WA 2JTDA 5D7JD 5F7NC 4LYRA 4I0PC 1KIPA 3KYKH 2XWTB 2FSEA 1UA6H 3DXAA 4JFOA 1L0QA 4YHLL 1KB9J 4AG4L 1A0QH 1UB5B 2BNUB 4DWSA 5EULV 2J7BA 4XCCL 3DXAB 3IU4H 1RJCA 4PJCE 4DK3A 1DBML 4PLNC 3UETA 2VDML 4X7SL 1RMFL 5FYJD 4ZUVB 1TJGH 1AXIB 4R7DB 5IR1B 5DJ8A 2YLLA 4M81A 1SMAA 2RB8A 4WUUB 4ZFGH 1EA9C 1A7BA 1TJGL 1AQHA 5C0RH 2WZIA 4Z0BH 5IR1A 2VKXA 4PUDA 4U2ZA 5I24A 3IRPX 3NFPB 1MCNA 4Z0BL 4JFEB 5FM5M 3LV3B 4NKOB 4HIIB 4HXAL 2NXZC 4QXGH 1P7KA 1DZBA 1GGBH 4HJGA 4U1LB 2GHWB 4G6KL 1E70M 3L4UA 3HG1A 5C7XH 4GMSL 4PJ7B 1NCDL 4WI3A 4MXWL 3WFBL 5CP3A 2YXFA 5ABEA 3P77A 5A2FA 2BOBB 4OCXH 2Y2WA 1BQHA 1UH2A 3TPKA 4I1NB 2IMMA 4XPHL 3EDFA 4KQ3L 3TN0A 4OAWB 3RTQC 5BOZG 3MO1B 3V6ZA 5DRXB 1MWAB 4U33A 3CX5K 1WO2A 5I1DB 4U31A 2HT2D 1NCCL 5MEPB 3KPNB 5IB4B 2DWDA 5LWYH 1A7QH 2BVEA 1BREA 2UWEE 3MV9E 2VN4A 3GMRB 5BMFL 4AL8H 2G3JA 1IGMH 1LP9A 5JW4R 2L0DA 1I1RA 2GDVA 1PPIA 3U46B 1U8NA 3FB7A 5I1CL 2QSCL 1IM3A 3CFCH 4Y4HA 4LSQH 5EUOE 2BVOB 3MRLB 1OGSA 1FORL 1P53A 1FYHB 4PJ5E 3PWPA 1OB1A 2OLDA 4Y5VB 4Y4HB 2C26A 4LEXH 1BMGA 5IB5B 3TFKD 1PYWA 4MA3A 5I66A 5HXMA 3WHE1 1IAOB 2WMIB 1Q6DA 4JFFD 3MBEA 4XPAL 1I8KA 2NW2A 4Z8FH 3VDBA 4ZEPA 2NTFB 1B6DA 2F5BL 2HJKA 1K9TA 1UOKA 5A6KA 2GFBB 5ETUA 1YEKH 5T3ZE 3RPKA 1HDMA 5H8DA 4Z7UA 4HUWA 2VABA 4CMHC 3WN5C 3MNVB 3O2DH 5F44A 4U6HB 1L6ZA 1BQSA 1DANU 4FF5A 5FYKE 5C0CD 1T2QH 4P46C 5A6SA 2R1WB 1CCZA 4IRJA 5EORL 2GJXA 2GJJA 4XP9H 1K4DA 3KLAB 3P11H 1HHJB 1WBZA 3MLRH 3LEYL 1E4KA 3NCJH 4LLQB 3WBDA 3RKPA 1F58H 2DL9A 2M26A 3V9FA 3BGMB 2QKIB 4GPNA 1EBPA 3FZUD 4FQXC 1V7NH 3WF0A 3HMXL 3VWKB 1DLFL 4EI5B 3VW3L 3BQUA 2ADIB 3V2AR 4DKEH 3ZOAA 5HDRA 2J88H 3QAZC 4AEEA 4ZAKB 2MCPH 2HT2C 3HMXH 4F7MB 1BGGA 2BY1A 4C55A 2YZ8A 3U9PL 1SBSL 5DVKA 5E08L 2EXOA 2BNRA 4OCSH 3R8BB 3RP1A 3WMBA 1JP5A 5IMKA 5D7LB 1K4CB 4QRRD 4NQUA 3P9MA 3EZJB 4ODVL 1ISYA 3GSRB 2PWEA 2P5EB 1NJ9A 4NQEA 4Y19D 3TA3B 2AQ1A 1QYGL 4I3RH 4Q7DA 1F11A 4XXCC 5HYEA 5EOTB 4E8DA 2Q1EA 2ZSWA 4DCQB 4GAJL 2VZVA 3T04D 2VLJB 1CD1A 4S1SL 3GMMA 4HWNA 1BBDH 1S3KH 2VLRA 5HBBA 5JPNA 1J5OL 3CK0L 2XVGA 4D0BA 5D9PA 1BOGA 2DYPD 4MNQB 4X5WA 15C8L 2HLAB 5DT5A 1ISZA 5KSUA 3EIFA 5EBMB 4RRPG 2D0FA 3Q3GB 1QBBA 2HG5B 4N68A 4JQIL 4PUBH 5AZEH 5CEZL 4P9HH 5DD0L 2Z91B 3WIHH 2X4OA 3UR7A 4XC3H 3TBWA 5BO1L 3GI8H 3H7BA 1XD1A 5F7EH 2J7EA 2XQBL 3UTTA 3AU1A 3TN0D 5FGBC 4K7PL 1NLBH 3BEWA 4WI5A 3MJ8A 4JB9L 5GHWH 1E0VA 4LLAA 3C6SB 4TNVF 3L5XL 3K4DA 3QEQB 3ZYJA 3ZJ7A 4NWUL 2FH8A 4X6CB 2R29H 5F3HA 3E1F1 4M43H 5GISH 5J13B 1FL3A 1F8TH 2ZX5A 4GQ9H 3C9NB 5KN5B 2V9RA 5MENE 1KG0B 3EAKA 3GNMH 1QTYT 4JPKH 1F8TL 4BELD 3GIZL 1ISWA 3ZL4H 3EFDL 1WPCA 2J74A 5C6WH 1XCTB 3GJFH 4I9WD 3E8UH 1WZKA 3I3EA 3QPQD 1WEJH 1A6ZB 4Z76A 1XR8B 1E4XI 4M6ML 4D71A 4LAJH 3QFDB 4IDJL 4MCZA 4P2OC 4N8VA 4RE3A 3C09B 2XZZA 4R96A 1D9KD 3HMWL 1X3DA 4JY4A 5ACZA 1UD3A 2O92A 2A6DA 1JRHI 4H2CA 1XGQB 3FT4B 3VCLB 3SQOH 4CN1A 1INEL 3FQWB 5CKGA 4AXNA 2EPNA 1HHKA 1XGZA 4WFFD 3SE9L 4F9LA 1OHQA 1DVFD 1MHHA 3BZ4B 1ZU8A 3W27A 5ADPL 4ZTOL 4TX8A 3VU2A 2X1XR 3SE9H 3BSGA 1W1VA 2VJXA 3J7HA 2PF0A 1OSPL 3CSGA 3JV6B 3ZR6A 1CGSH 5B3JF 4MNQE 3ZKND 1AHWC 4UV7H 1KB3A 1R8LA 1IEBA 4YPGA 2EDHA 5GRVK 4F80A 3BAIA 3GXIA 1US2A 1EV2E 5MEND 1EEYA 4F15B 5ISZD 1HHJA 3VXSE 5JQ6L 2V3GA 3BZEA 1H3GA 5CAYB 1E6RA 3AY4C 3VJ6A 5JHLH 3TO4A 1Y6NR 5CG0A 5M3WA 3OX8B 3ZT7A 1NMBL 3BP4B 4CVXA 1XGTB 1WE5A 4HUMB 2GJ6A 2O5YL 3UBXI 3WKML 2VXUL 3LH2L 5GJSL 4UILL 4K9EH 1N6QL 4PJ8C 3PJSB 4Z7UB 1JHLL 2VWEE 3UYPA 5E5RB 3UG3A 5BRPA 5EBAA 1HQRB 3DX9A 2DQHH 3QUYA 3SCVA 1MY5A 1QFWI 1HK6A 3PHOB 3N13A 4G43B 1J8KA 1DQQB 1JV5A 2RFXA 1T83C 5DQ9B 1FVCB 1TQCB 2X4PA 5LBSH 3N1GC 3D39E 3TOPA 1Q6EA 5DURB 4HK3N 5JOFA 2V2WB 5FYLE 4N0FA 3QIWC 2GSGB 4PMOA 5EC1B 5FGRA 4Z78A 3G5ZA 1PLGH 4LRNH 1HYRC 1Y6MR 3TA9A 3F7RA 4FQXA 4OZFH 3RDKA 1D3CA 4DWSD 2R0ZL 3QUZA 5EIVA 4E4PA 2MQCA 2H6PB 1I9RH 2H3NA 3W9EA 4M8VA 3ZLQC 5DD6A 4PJBA 2BJML 4IMKA 4TUKL 1U8MA 3O3BB 5FKYA 2OYLA 2B2XL 2PYED 5TPWL 1RU9H 3WLWD 1TVHB 3PABB 1V8HA 4IRJD 3V6ZB 2DSWA 1S7TA 3CPLB 2GFTA 2XVPA 3BAXA 4R5EA 1RJZA 1JF5A 3RM9A 4Z9KB 2JE8A 5HI5C 5I1LB 1HL8A 4MWFB 1E5JA 3PN8A 4DGYL 5DUBB 2V6HA 3CBWA 2IADA 4UU9A 4F7EB 2OMNA 4GINA 5BZWA 2X9XA 3T2QA 4J27A 4FQIL 4FQCH 2IAMA 3ZKQD 1EMTL 3FOLB 1N7MH 5ITBL 4LCWD 4N8PA 4ENED 3HA0A 3VRJB 1TZHA 3U4BL 5CBAB 3WUWG 3R8QA 4FTVE 5K9QG 4W6WB 2DIJA 1M71B 1W0VB 4GW5A 5DHVA 4OIBA 3N04A 4QWWC 1LVEA 4UBDC 1H8NA 3IVKB 5INCB 1QVOA 3PNWA 4K7PX 3PUCA 5I1KL 4BSJA 2PW1B 5EH1A 1BECA 4Q22A 3WDPP 1DL7L 4MVBD 4PIRF 4APQA 1N0XL 1T5XB 4JG1L 5C9JA 4OCYL 5C0IA 3NDYA 1F02I 3GMOA 3MBXL 4WWKB 5IHUH 3VRLE 3QNYB 3T3PF 1J18A 3ZR5A 2J6EH 5CMAA 4ZO8A 4YX2L 3G6MA 4OD2A 1PG7H 5EN2B 5IJVA 3G9VA 3UZVB 1M4KA 4XPGL 3GSQA 3T4AB 4IRSA 4RAVB 2A9ML 3KLHD 4PJ5D 4EANA 4U7MA 2EEDA 4U1MB 5SWZB 3DMMC 4LYPA 2B20A 2AEQH 4LCIL 3MMEB 3OB0K 3PZUA 2IPUG 1OGGA 4JLRA 3VXQB 5JHDD 5K59F 4X7EC 1FFNB 3MOQA 5EU5A 1AGBB 1QO3A 3CUPB 1RQ5A 3K8KA 4DZBA 2VL4A 3IJHA 4NFCA 1I3GH 3AICA 1RIUH 4FG6D 1ISXA 4U1NA 5DI8A 5EO0A 4UQCA 2Y6SC 3WY1A 1A47A 1U93B 2VL5A 2CLVA 2C4XA 5EUKA 2CK0L 3UTSD 5CJOL 1CLYL 4JO1L 3C5ZD 1RZIB 1MI5B 3LHPH 3VIMA 1AFVH 2XI9A 3PDOA 2QMKA 1QLFB 1FG2B 1RZIA 2OTWA 4JDZB 4HMDA 4FTVB 1DUYA 3HUJF 4ZUTB 3PJSA 1HN1A 3T1WA 1FN4B 4NQSB 2Z91A 1CE6B 3L3JB 3ZTNH 3NABH 3KPSA 1G84A 2CIPA 4V2XA 4F57H 3AMLA 3RA7H 2W5FA 3ZYOA 1M7DA 3ZTJH 1C5DB 1UZ6E 4NO0D 3N1PC 2LVEA 1M7XA 1S7XB 2B5IC 3MO4A 1EOKA 3GHEH 3O11B 5D7JB 2CGRL 3A4XA 4LP5A 5A16A 2VC2H 5J7CC 5AYBA 1NGYB 3MV8D 3IB4A 4YDKH 3VW3H 4HAGA 2BK8A 3TVMD 5IB2B 4ZUUA 4H88H 4R2GB 3AZRA 2XTLA 3CDYA 2XTJC 3UO1L 1EHNA 1B0WA 2JJTA 1FVDA 3EO1B 4GKNB 3IDJA 1E6NA 3D3VE 1HVXA 1I8MB 4MAZA 3QHTC 3Q6FB 4OFKA 2BXZA 4IOFC 4UFIA 1X6LA 1YYMH 5F1IB 1P6AB 1ED3A 1WCBA 3KYNA 3QH3B 2I24N 4QYOB 1UKPA 1VFAB 4JL1A 4S2SA 3EO9H 4EN3D 1Q0YH 1UADC 1NWSA 3G6DL 1DN0B 3IAPA 5GZNC 1MCHA 2W92A 1HILA 1S7RB 5DYOA 3DPBA 2AAVA 4QRQB 1MCEA 4GRWF 1WT5C 2ZXDA 5AYUL 2VNCA 3VFWB 4OOZA 1UWTA 2F2HA 2BP3A 2UYLA 4OLXH 4M61A 5HJ3B 2BSSB 4CUCA 2H32A 3DOSA 1NQ6A 5F9JA 1NGQL 4RSVA 1T0MA 4R26H 4FFVD 4XMLH 2WVVA 1GCYA 1F3JB 1KCSH 3MXWH 1B3VA 2HRLA 3IGAA 3BEVB 1H15A 4LAQH 5KOVC 2PO6C 4OZIF 3IFNH 1CFTB 4JPIB 3PP3K 2W65A 3TO2B 4DM2A 3LQZA 1HINL 3GJFA 2I60H 1PW3A 2XN9D 1AQDA 4XVTL 1N8ZB 1XGYL 3ZKMC 3JWNC 2FO4B 3VM5A 4WTWA 1U8IA 3WIFA 4D8PB 4FP8L 3TM6A 3AZSA 1RHHA 3MQIA 1J9YA 4JKLA 5E4EB 5FA4A 1FGNH 4Z77A 1U8LB 1ZBKA 3BW9B 5J57B 1KEGL 5MHSE 1NUGA 3VFPB 5IW1B 1RZ8B 5AD0B 1U8NB 3QJHA 5C0FA 2AXGB 4H0IA 4RAUB 2UVEA 4WNQB 1NUDA 4RMTA 1QFUL 4I9WE 4YDLC 2V5TA 2XTJD 1PKQE 3OF6A 4MA7H 4GMTH 1UJTA 1AGFB 3V5HB 3U36B 4N0YH 4HG4J 4P23C 5F72S 1LLOA 4WTXA 4Z5RB 3MV9A 3IDMB 3RX5A 2VX7A 3D69A 4HPOL 5JW3H 3QQ9C 5ACMA 2ITCB 2YIHA 4YFLF 3EYSH 5ECUA 1GGIL 3U9UB 3MLRL 4G8GD 3PGFH 1YNKL 3N1MC 3CVHL 3P9WB 5CPQA 3VIGA 2R2EA 2R0LH 2IFFL 3KYOA 4GRMA 5EWIH 4GI6A 4NQCB 4H04A 2VCAA 3GJFK 1FHGA 1G6RL 5I1JL 4IRSB 4RAVA 4ODTL 3REVA 1JV5B 2MJWA 2H26A 4FZ8L 4XAWH 1TPXC 3TO4B 4D6FA 4HBCL 4LU5L 4HF5L 1I85C 5ENWB 3RU8H 5KEZA 3JUYA 2MQ0A 3R0MA 3UG4A 2ADGA 4JZJB 1NL0H 1ZHKB 4A2MA 3T2PA 3GMNA 4PMVA 1KYOK 3NIFE 4LEOA 1IFHH 2RGMA 3LIZL 2V5RA 4HPYH 1OOAA 2G5RA 2MNUA 2F19H 5FKPB 2EXYD 5IHZB 5C08B 3DX7A 1MIML 2WMGA 1LL7A 4QCIA 3VNZA 4GAJH 4PY7A 2OTPA 2WUBH 3SDAA 3ZE2F 3CSYB 1YDPB 4Q9RH 5C0DA 1KIPB 3CK0H 5IG7A 4AD5A 3GMQB 2VXQL 4OUOA 3MTRA 4Y16A 2P24A 2X4SA 1IEAB 3NDZA 1WZLA 3STLA 2DSUA 3D18B 5CILL 3TNMB 1HX0A 5DUBA 4MB5A 3CUHA 5KSVB 4MD4B 3STLB 5DMIH 4ACPA 4BQ8A 4QCFA 5I1HL 4TVPD 1W72L 5KZ6A 4NM8L 4JRYA 2MANA 3KLDA 2QR0A 2XZQH 4MSWB 1U8MB 2EPKX 2VDPL 2NY2D 4MNQD 2YA1A 3L3IA 2DIEA 3QUXA 1SY6H 5DT1L 1JI1A 4L3CA 1J88A 4HS8H 4JZNA 2MHAA 2OSWA 4RGMC 3C9NA 4KROC 5KN5A 2B31A 4MB3A 4HCRL 1TCRA 4L3CB 4OB5H 3C2SA 4WO4A 4OZGB 4AD3A 1W2VA 4OCNC 4YHYB 1GJWA 1CLOL 4Y4KB 4N1EA 3BRDA 2VAJA 5GXBB 2RCSH 4M29A 1B2YA 4K9EC 2DQJL 1IGYA 5DJ6B 5C6TL 5LGKA 3WE6A 2ZUQB 2F53A 4QDMA 4UR9A 3RL1A 1INEH 4UDUB 3FQTA 3BIBX 4I0PD 2ADFL 3D0LA 4OZHF 3OBAA 2PO6D 2W9DL 1B6UA 3DI3B 1OT1A 3CFKA 4N42A 3BI9X 3B43A 3WMCA 3MYJA 4ONOA 4MNKA 1C7SA 5I6SA 5DTFA 3LKOB 4BFGA 4JFSA 1KJ3H 1P5VA 1Y18B 3PWLB 3P4LA 1W9PA 3DSFH 3UP1A 4OCRH 2F8XC 3BKJL 2PO6A 1FAIH 2D3LA 1R3IH 3LN4B 5SWZE 3DC0A 1BLNA 4NRSA 4KHTL 1AQMA 2SEBA 5ABFA 5F8QC 4YEEA 3IDUA 4JO2H 2BZDA 2OTUA 2B1HH 2DLFL 3B8SA 2WWDA 1BD2D 1R3JA 3OZ9L 4L4TB 1I1XA 4HZLB 3P4MA 5D8JL 2H2SD 3VXNA 3IFLH 5FA4B 1NCAL 5C09D 1DSFH 1WVZA 4LHUA 5T1KD 5BJTB 1QNQA 3EGSA 4NT6A 2BNUA 2NTFA 5IW1A 4DWSB 3VMPA 2FYYA 1MQQA 1J87A 1JYNA 2CIIB 5I0DA 1OAKH 1BQCA 1DFBL 2ZX8A 4WW2C 1B0RB 4FTVD 3MNZA 2WB5A 2F58H 1MRDH 1IAMA 4TOYH 4KAQL 3T1FB 1CLVA 3D87B 1K9FA 5FDWA 1QEWA 4X6EB 3N15A 3CFBB 3TTYA 1IBGL 3VUPA 3BH4A 3ARGA 3O41A 2CDGB 4P3DA 1MPAH 4JM2C 3S3JA 2K7QA 1IBGH 7TAAA 5KVDL 4OCXL 4KVNH 4OM1H 1FLRL 1J7VR 4XPTL 4YO0A 2A6IA 1UJ3C 1LO0L 1JGLL 4WHTB 4PYSA 4F2MA 1J86A 3VXRE 2AKRA 2WNGA 4P49A 4FHBD 1O7SA 4L29B 4P23D 7FABL 5C08A 3W28A 4C56E 1CL7H 4MMXC 3UMTA 2BDNL 1NFDE 1I1AC 2IALA 1SEQH 4MXVE 1G7LA 3WUWA 1IE5A 4UQDA 3Q6GH 1OF2B 1JRHL 4KK6C 2JIEA 2WKLA 2DS4A 2XG4A 5BMFH 3QZWB 1QD0A 4UT6L 2OJZL 1B2WL 3LS4H 4GXVL 1VF8A 3BEWB 4LHUD 1MVUB 3O3AB 4OM0L 1NGYA 4XRCB 1E4WH 1RZKH 5FFLA 4YGVB 4XT1C 4UFHA 1X5JA 2FX9L 4X6CA 3BSZL 1P7QD 3FCTA 3WF2A 3ARDB 5I77A 1NAMH 1UKQA 4P4RB 4PJ7A 2P47B 1FIGH 3GM8A 4FQHA 5F9WB 4EKXA 4IPLA 1RUQH 1MAKA 1DQML 2Y24A 1AO7D 4XMKL 4OZHB 3PWNA 3FB7B 5J6GA 1JZ2A 4WENB 5F8RC 5E8DL 4P2OD 1O5DT 3WO3B 3VI4E 1NCBH 1UC6A 3WYRA 4ZE4A 5TQ2L 4HX1B 4FQQB 3U4BH 1WKYA 5I6XB 1PZUB 5IESH 4PUEA 1TTUA 1KLGB 4H7VA 1ZWIA 5BVPL 4MA7L 1Q1JH 4YDIL 3B8YA 1NWUA 2UVFA 3GMRA 4B41A 1V6XA 5E4IA 1C5CH 2YRPA 4V1DB 4RGND 3C8HA 4RWYL 1YPZA 4MDJA 5EFDA 3O2WH 2ZXAA 4U2YA 1HNGA 2FEEL 4NQED 4Y19A 4YIQA 1C16A 5EZLB 1ISVA 5BXTA 1T1YA 1BP3B 2EIDA 1DANT 3EO0B 3G5VA 4D6GA 1JNHA 3JVGC 3MUJA 4JN1L 5DJ6A 5F6HI 1HXMA 4AQ1B 4PJHF 1JGVL 1ULVA 2RQ8A 4NO3A 5BRZA 5GS2D 5K9OA 4GOSA 1CFTA 3DYPA 4M1CD 1WDRA 4GKLA 5CZXC 1RZKC 1INQA 3RUGF 5T3XH 2CJUL 3K0WA 2CLRB 1IQDA 5HGDA 5C09B 2DQGH 2D0GA 4FZ8H 2B0SH 3MV01 1VJZA 1FO0A 2KUTA 4ALAL 4WWKD 1NWRA 4JFDE 4OLYH 4PJHE 1P4IH 3SDXF 1P7QB 3HS0B 4PJEB 4BQ9A 2EO9A 4JFWA 1B4JL 4YHNA 2D3VA 4W88A 1XF3B 1EXPA 2O5ZL 2YS4A 4JANB 1PKQB 4AIUA 1N3NA 3CUPA 4DZBB 3BPLB 3GBDA 1CFSB 4XXCA 1WK0A 2J8FA 3QDJD 3IAGC 3CXHJ 4J4PA 2DQEH 5IJVB 2AXHA 4XBGA 4RZCB 4P2QD 3VXRD 1WBZB 2VH5H 1K4DB 2GT9A 1N5AA 3WFHB 2AXFB 4G80A 5K9QI 3V6OC 4Y16D 2W63A 5IMKB 4PV8A 2C3GA 2YD2A 3HG1E 3D18A 2QL1A 3W37A 5ESQA 3VI3E 3JSSA 1A7RH 1GZPB 1W2PA 1JHKH 4UB0L 3IFPA 5I74C 4F37K 3AMDA 5DI8B 5EO0B 4JZJC 4KQ4H 5IVXF 5TE7H 5DR5H 2FLRT 4OBRA 2IXUA 3K8MA 3L5XH 5C07B 3WHE0 4OKVA 4N8VG 3MUY1 3PWPD 1P7HL 5DR5L 5CD5C 4KRUA 4GJTB 5SWQA 5C08D 3IDGA 1OP3K 4FFYL 1RUMH 4F33B 3ARED 4KPHL 3TYFB 9CGTA 5JNYA 1QLEL 1ITXA 1WIUA 3U48A 4IRSC 1B0RA 3DRTB 5DJYB 3PP3H 3VD4A 4DAGH 1E1EA 2WANA 4XNQA 3HAEA 3BCDA 1WAWA 4OCMC 3T77A 1CG9B 4JREB 5E99H 3FONA 5EU3B 1X9QA 1LO3H 1VEMA 2HMIC 1R3LB 5TDOB 2UY4A 5SWZD 1UWXH 1M01A 1UQSB 3X13B 1FJ1B 1BGXL 5GSVA 5DFTA 2G75A 5DS8B 3G5ZB 3VDHA 3O4LD 3WH6A 3G6DH 1CU4H 3ULUE 4K68A 1YEDB 3RL1B 1IAII 3OAYK 1RFDH 3ZE1F 2J8OA 1PQZA 2IAMD 5CD3A 3D3AA 5JDJA 2OWWA 3H3KA 4HJGB 5CIPB 4Y4FB 4GBXD 3QUZB 2XXCB 4M3JA 3I84A 2FECI 3E6FB 1I85A 2VDLH 4ONFL 4HX1A 1H3UA 1HINH 2WWMD 4JFYB 3OIHA 3VIFA 3JVGA 3GBML 2PBOA 3NTCL 1B3YA 2J5LB 1JCKA 3KE0A 3G5XB 2PC8A 5BRZE 4Y7MA 2J7CA 2IBBA 5EOQL 1P4LB 1VA9A 2Y8KA 4NHUB 3SUTA 3H9HB 2HJLB 4HS3A 3CUJA 2WV3A 4P5KA 2UWEF 3CZFB 3L9RA 5FXCH 1RJLB 5KJRL 4OZIE 4QGYA 1NEZB 3FRUB 3DMMD 4KTDH 5D8JH 2ICWI 4K3JL 3KXFA 3TBYB 4XP4L 3Q48A 2JELL 4F58H 2I9LB 4MJIA 3WF1A 5FECB 3KYAA 1RHHB 1A3RL 4DQOH 3HZVB 3OR7B 1E15A 3LQAL 3C8KA 4GLRI 1ZGLM 1UGNA 5MHSD 5FO9B 3MV8A 3GRWL 5FA3A 2KZWA 3SGEH 4WIWA 2DBJA 1FZOB 4QT5B 5GJTH 4JDTL 1CBVL 1N82A 4X98B 5BYWA 3P4MB 4HZLA 5D1ZC 4AZ5A 3QA3A 1GPFA 2YBRB 1GQIA 1OGTA 3OKOA 3WD1A 2XFFA 4HH8A 3CHDA 3WD3A 2B4CH 5I1JH 1QPKA 5SX4H 1FYTD 3QCTL 4AIZB 1CFBA 2CRMA 3CZJA 1JPTL 4TNWF 5EWIL 4AH2B 3CHCA 1BIIB 3ARZA 5CGYD 4XWGH 2G5BB 3WJLC 1M03A 2XTJB 2P48B 4IOIA 4JFUA 4Y1AB 1Q72H 4QHKJ 2D20A 1DLHB 3BSHA 2WBWB 5MEOA 2GJ6B 3EYPA 1XGTA 1PD6A 3BYYA 4DW2L 1U8JA 4M7KL 4JHOA 3IJSB 4P57A 2LE9A 3LPGA 4POUB 2FSEB 3S4SB 2CKBA 2BRRH 4U6VH 5HGAB 1D5ZB 1KR0A 4ZO9A 5HGBA 3LVEA 2PB1A 4YHIB 3QQNA 4NQTA 2XN9B 1LE9B 3SUUA 3PGCB 3BH8B 3RGVA 3UC0H 1I9IH 1C08B 2OCFD 4S1DC 4YXKL 3A3HA 5IFTA 1KB5B 1MF2H 3ECBA 3AIVA 5KVEL 1XF1A 2X44D 1RSFA 3DRQB 1LK3L 1F00I 4N0FB 5E9DE 4NN7B 5DD1H 3LY6A 1T1WA 3MLSL 1D9KA 5F71A 5A6JA 2VXQH 1U91B 1IRAY 1FO0L 3V4UH 5E5MB 3I75A 1T1WB 5DUML 4Q7NA 1EVUA 3QDHA 4HW6A 3E6HB 5GGQH 1CD9B 5T1KB 3MRIB 2FL5A 1GZQA 2APBA 1I7UB 4N5EC 3NFNA 3VGAC 2ED7A 2QADD 4RX4A 5FO8A 2NY7L 4J23A 4U1KB 3VG0H 2NY5L 3GKWL 1Z3GL 2HN7B 1TMCB 1QRNE 4G9DB 2Q7YA 4UOZA 3QG7L 2DAVA 3HE6B 4S1DD 3RVVC 4D0BB 1F3JA 3GFUA 2APFA 3VH8B 4F9PA 1R5WA 2BNRB 4AZCB 1VADA 5HYIA 4M4RA 3ARTA 3VWJB 3VD7A 5ICYA 3EYFB 2HLFC 1U9KA 4WSJA 4ELKB 1FZMB 3GSRA 3O45A 1HI6B 1SJVA 5MERA 1S46A 4J7RA 4X0KA 3H42L 4NDMA 3T3ME 4G8GE 4LFHG 3MRRB 2WZEA 1GIGL 3PQYE 1B0GB 1RZFH 3ROOA 4IPNB 2VVSA 3H3BC 3MC0A 2D31A 3B2VL 5D2NC 1I1WA 2WC3A 1WICA 2VZSA 1Z5LA 3ROOB 4LVNB 3VGBA 3GSWA 3H9SD 5CJOH 3CHEA 5C6TH 3LRGA 3A6BH 3PP4L 3ZDZF 3AGVA 2UWEB 3Q3GA 5E8DH 1GC1H 2G9HA 1JGDB 1FFPB 4BZ1L 2OS7A 5B38G 1T5XA 4KMQA 3WXWL 1PVHA 4LKCB 1X5ZA 3IGAB 1GQJA 3SGDI 2R23B 1E4KC 4KHTH 3FFDB 2ICEB 1YA5A 4D0CA 1BBJA 4CD8A 4DTGL 2VZOA 1OAQL 1FL3B 1H3WM 1AI1L 2CBJA 1BLNB 1NFIB 1KIQB 5C0RL 1JUFB 4AT6B 1GW1A 1E55A 3RZCB 2OTUB 4F57L 3OZ9H 1U8LA 3RUGA 4JFEE 3RIKA 4BUGA 5A95A 1SBBA 2D7PA 2B1AL 3MYJB 4XC1H 2CCRA 2DTMH 2N7BA 3WIIH 1MLCA 1YYLL 4NO2B 2TAAA 4AH2A 1JDCA 4HWZB 1UWGL 1F3DJ 4WV1A 3U4EA 2DIBA 5CGTA 3O4OC 4ZXLA 1AQDB 2YMXH 1UM5L 3QEGH 3OKDA 4MDIA 4NYLA 1V7ML 1ORQA 1AIFA 1MLCB 2DDQH 4K2UH 2VDQL 4NO2A 1YYML 4M1RA 2C1OB 1C8XA 3SCPA 1G7PB 2FX8L 4TVPE 5D96C 3MJ6A 1XF5A 5EO9B 1WP6A 5E7FA 2FJHA 4L4TD 4KKBC 2ITDA 4HUVB 3RIAK 2VWEC 4ZFOA 32C2A 1BZ9A 3TPUA 2I9TB 4LRIA 1TQCC 3D3VA 1BBDL 1JN6A 1S3KL 2F9BT 5AC5A 4Y4KD 1KWKA 2NY3C 1LEIA 4G6JL 1FRGH 4HIJB 1J9CT 1D5BB 2YWZA 3KPSB 3OKNA 3FMGL 1D9KC 4P2RE 1G0YR 3O3EB 2YPLD 1OM3H 5D1QD 2W66A 3HKFA 4Z7QE 3GMLB 4XVSH 4ISVA 2QQNH 4X9BA 3SDCA 1GQLA 3HE7B 2ED8A 6FABL 3BISA 4K3HA 3VXTB 5AYIA 4QXTA 3O2LA 2Z8SA 3NABL 5A8NA 2VDRL 2X7LA 3OGCB 4WIQA 4YZFF 3HCVA 4JKPL 1RU9L 1J0KA 5EU6D 5IMOB 2Q20A 4L8SA 4MMZC 1NEZG 3HI5L 4NWUH 4J8RB 4MSWA 1Y6KR 2VLJD 2QKIA 4F15C 3OZPA 4B9ZA 4GT7A 4MAYA 1SVZA 4NGHL 4RIRA 2WQRA 4WFGE 5FCUH 4ZAKA 3GHEL 3WFCL 5GRUH 3SBWC 4KKAD 5MP6H 3QWRA 4NWTL 4XZUA 5DVNA 5TQ2H 2CERA 1ODAA 1UKSA 4D6IA 4PREA 1EBAA 1KTDA 4KUCD 4U6XA 3IKCA 1A1OB 4Y2DA 4M7JL 3UTSA 5L0QC 2Z35A 3CNKA 4X9HA 1IEAA 1I7TB 4PTUA 43CAB 3CZKA 2A9NH 4AJ0A 3Q0HA 5I2UA 2UUDK 5L8KB 1LP9E 1I1AD 3VIHA 3DURB 1GONA 1H3VA 3QEQD 2VCCA 3IXAA 5DHVH 3BP5B 1QR1B 1YMHB 1F97A 2BVQB 3VXSD 4AY0A 4PRHD 3AMGA 3SGJC 3KLSA 5DWUL 4JG0L 4LPYA 5BXFB 3QDJB 5DTFB 4DGIH 3O3BA 5F21B 4G9FA 4V2CB 1IM9B 5EFIB 2LFGA 5IVXE 2ZUUA 5E6YA 2WMIA 1RJZB 3ARUA 3MA9L 4TNWK 4V28A 1TJHL 1JPGA 5DC4B 3RY5A 2AEQL 1NBZB 4LCIH 5IK3A 2X1OA 2UY5A 2YRLA 2LTQC 2VUOA 4F8XA 3CO4A 2EH8H 1JPGB 4JFDD 3GDBA 5SWSA 3V8CA 4E5XB 3OB8A 2IQ9L 3RWEB 1RD6A 4TXEA 5FM8A 3V0WL 5FEBA 2Y07L 4QRSA 5C0AB 3ZDXF 4FFZH 1OP3H 1EHLL 1CFVH 1F4WL 5IFPA 2XUCA 4I77L 2WVSA 1HXMB 4RE2A 3K74B 3D0VA 1N0LA 4WW1A 4Y4HD 1A3RH 1U8KA 2WINB 2CLZB 4NZRL 1DLHA 1S78D 4CMMA 2R8SH 4K7PY 4QO1A 3W11C 4Y16C 2WIIA 3ZKSD 1MIEL 4LXFA 1WFOA 4FLRA 1U8QB 4EXPX 5KBNC 4LKXA 5DJXA 2HMID 5CMAB 2Z1SA 5LXGH 3L7EB 4L9LB 1NFIA 4KK8D 3OAYH 3D9AL 3BGAA 3CX5J 3LRSB 2R2CA 3MUIA 3NCOA 3VFNA 3VXSA 4L4PA 2AGJH 4FFYH 3DETC 2FEDC 2YD5A 3QT2A 4M43L 2VUYA 2Q6WB 3VFRB 5E6IC 3GKWH 4ACYA 4EKJA 4WDIA 4MYWB 1DBJH 4U6TA 2VITB 4JB9H 4L3EE 1N64H 5T5FL 4WEBH 3UERA 4EXKA 1LJYA 1UR8A 2YUZA 5H35A 1A7NL 3EYFA 4PRPB 3ZYZA 4TTDC 4EDWL 2CMRL 2AK4A 4GAFB 3O2VH 3TA3A 5LA0A 4F8QA 4Z2IA 4PRNA 6TAAA 1KTLB 5J3HC 1KB5L 1J8HB 3T0EC 1CDJA 2EZ0C 1N4XH 2AJSL 5KANG 4QRPE 1W91A 3SBWA 1RZFL 4B7LA 2DQCL 4LQ1A 5KTEH 1KB5H 2EPMX 2EDRA 4ZAKD 1MCFA 4YPJA 3WNMA 4W8BA 3BQUC 1R87A 3QIUD 3MLVH 4J1UB 4LIQH 1N6VA 2ESVB 2NR6D 4F7PA 2YD9A 4WFHD 1LF1A 1D5BA 1TVBA 4PJEF 3GSNA 1CU4L 4LCCB 1MCLA 1QP1A 4KU1A 3SO3B 3DO7A 1JAEA 1FH8A 5JW4N 3SQOL 3Q5YA 2GK1B 3LDBB 2ZSVA 3LD8B 3WXVL 5JZ7D 4B9YA 5C0CA 5HPMB 1P2CA 2FATL 2VLJE 2R69L 5H94A 4OOUA 1BF8A 1XF4B 3MRBA 1IM9D 3V6OA 4BKLA 1C8YA 4LQFH 4R3SA 2IQAA 1EQPA 3GBNL 2YUVA 4P3CH 1MW3A 5JW4Q 1TITA 3PL6A 5KJRH 2AABH 3IU4L 1CGSL 4MS8D 2GSGA 2J8UA 1BWMA 5TFSL 5E2UL 3O6MH 3FB8A 1OW0A 5EZJA 4HKZA 1EZVX 3MRNB 1ZT4B 1G6RB 4I18B 4X7DC 4B0MM 2NY7H 4XHJD 1OD0A 4WJ5B 5TFSH 1NMBH 1MRCH 3CUIA 2Y8VA 1QI5A 3EDKA 1MJUH 2ATPA 5C0AD 5SWSD 2EKJA 2VISA 4O58L 1H8SA 2XPGB 3OTTA 4MCZB 3BPNB 4PJCA 1L7IH 4E0RB 1H0GA 1NBQA 4L3EB 5GS1B 4BA0A 1YQVH 5ABFB 3RWJA 1RK1A 2YMXL 1BHGA 3NCCB 1YN6A 4X8JA 5CEXB 3OZOA 3H42H 3O4OB 3RVUC 3O6AA 4W5ZA 3IU3A 4H1LH 4KI5C 2VLRE 3DNKA 3E2HB 3BD5A 4KKLD 2BNQE 3PWNB 1QSFA 4Z18A 3TIDA 5T3XD 4JDTH 5FUZH 2OL3B 1QSZA 1JDDA 3KPMA 4LLWB 3CVHB 2D7OA 5A2JH 3TA3D 2BVDA 1Q4NX 3QA3B 1S8DB 5J9PB 1HHHB 5JXEA 1Z0NA 2EYTA 2XZAL 3CFDA 4W70A 2WHLA 1HT6A 1SFSA 4G9FB 2WLYA 3MUZ1 1R3KA 5IGXH 3EHBC 3WXWH 2GTZA 1H3PL 1QSEE 3OLGA 5ESQB 4QHKI 4HBQA 3TT1H 2NXZB 1DTUA 4RMWA 5GZND 4M7ZB 3MRDB 4MQTB 4PTTA 3P4OA 3V5KA 3HI6H 3QNYA 4RBPK 3RVUD 3IYLW 4OGAC 2OJZH 1EAJA 3CFCL 1V6VA 1J0IA 3ZKXB 4Y5YB 2G41A 4FQ2H 1OAQH 4RMVA 1CK0L 2WP3O 4HKJA 4GZIA 1IGFL 4GG6B 1LQ0A 2LQRA 4MB4A 3K1DA 1EGJH 1XMWA 4XVJH 4PGZA 4HUWB 1QOXA 5AUMB 4OFYD 4HEPG 1E4NA 4BQ5A 1R7AA 1JWUA 2DD8L 5CSBA 1U0QA 3IS0X 1CDBA 3WQWA 1URLA 1WZMA 2C1PA 2DTML 3QIUB 1TUXA 4PJEA 4Y1AD 3UC0L 1T22A 4P3DB 5IHRA 2WUBL 5D1QB 1AGBA 5D7IA 5H35B 4O4YL 5B21A 3THDA 3DLQR 3HC3L 4LK4A 3TBTA 3HE7D 3I85A 3AIRA 2VRAA 3S96B 3VE0B 2BVPB 5FCSH 3BD4A 4S3JA 3VVGA 1FFQA 3NVQA 2ICWJ 1HJXA 1K8IA 2GAZB 3SN6N 4GW1A 3ARFC 5AG9A 3AYRA 5GGQL 2OYKA 2WBJD 1BG4A 3W25A 3H9YA 4JPWH 2ZCHL 3D3VD 5I73C 4TNVK 1JGVH 3ARGC 5IVOA 3CPUA 4OUEA 3QCVL 4GLRH 4X5XA 3T0ED 4UNTA 1T83A 4Z7UF 4XTRD 2BY0A 4XTRC 3IF1A 3BKCL 2VO5A 2XSAA 1IC4H 4XB3A 4ZXOA 1SY6A 4HUKB 2AI0H 3VOCA 2V9TA 4YAQB 3KPNA 4KJQD 5IB4A 2HJLA 4HS3B 3VTRA 4PRHA 2Q8BL 4M82A 2R1XB 3QIWA 2XKNB 4Z2GA 3S5LA 3VFUA 3BPCB 5DA4A 1MW2A 4HS6A 1LWJA 4HUUA 1EHXA 2WBJC 1OT2A 4HS6B 5DJAA 3W26A 3VA6A 1ZT7A 1PFCA 3DX6A 1JYVA 5TF0A 2P24B 1ITCA 2X4SB 3VXPB 5DRXA 4YWGL 5BQ7B 2DM2A 2X4OB 1CWYA 4V1DA 3UTZB 5C0NC 4Z2KA 1UWIA 4NZRH 3QDJE 4JZOA 3HLAB 1T1YB 4XX6A 1MWAL 3MV9B 4NZJA 3RCNA 2NY0B 3D1MC 5ERWA 2VDMH 3BKYL 1YPZF 3R06B 5JPNB 1UXSB 2KQNA 4MAYD 3V4VH 1QRNA 3HC4L 5CFHA 1X7QB 4LLMA 1QFWL 3OKEA 2I25N 1JF1A 5D9OA 5CUSH 4CJ1A 5DURD 1YEGH 3RMEA 2VLME 3LMJL 4JZNB 3RIFK 4MD5B 2HVJB 2OQJB 4P4KB 4M00A 1AC6A 1YN7B 3SDCD 4NNPH 3ARVA 4ZS7H 1JGDA 1UEYA 3D25A 3OWEA 1BQHB 3HR5B 3TBVB 2CIKA 5T3XL 4CN6A 5FECA 1OINA 3OSKA 3WLBB 1W0YT 5T3XE 2DJUA 1OAYH 4QRUA 3HNVL 2W65B 4PMZA 4RA3A 5CJBA 3RWCA 4C59B 4O51B 3BFOA 4H1LG 1J1PL 1KN4H 4CGTA 4ZQKB 4XPHH 1V0KA 3LIZH 4ZG1A 4DAGL 5FKPA 5CWSA 2IGFL 5IHZA 3KPTA 1HHKB 4NQCD 1DQTA 4PV9B 3F5KA 2P7TB 1Q0XL 1XR9B 3QDMA 4BZYA 3SE3C 4PV8B 3EO9L 4ZMAT 4R7NA 4ZXBB 3SCMD 1HH9B 2Z9TA 2EPLX 3NFSH 4H5SA 3W2DH 3IJYB 4NCC1 1KOAA 4IHOA 1EGZA 1E3XA 1A1NA 1BQLL 4NJAL 2ZUYA 1ZHNB 3QEHA 4Q6IC 1MQ8A 4NUJA 4P5MB 2D7MA 3LKQA 3QEQE 4J4PC 4LGRB 3QHNA 5IEKA 6CGTA 2XFXA 5ACLA 2YD3A 3EDEA 2HT4C 4HFWB 4TSBL 5HHQA 4EOWL 4Y5XA 3FRPA 1NLBL 1MFCL 4Z95H 4I0KA 3G6JA 4NM8H 3WQVA 3QUZC 4JGMA 3QOKA 2J8UB 4HV8A 5D1XD 1FP9A 4ZO6A 4N90D 5E2UH 1ODUA 1FORH 4TOQA 1L0XA 1IAKB 1HKMA 5J1TC 3AM8C 2I07A 3OHXB 4JPKL 5CS7A 4YFDB 3FONB 5EU3A 1HQRA 1I9JH 4UINL 4WFGD 3U83A 3H7BB 4LSVH 1SEBA 5IW6A 3TJEH 3VWJD 1H41A 1B88A 3U6RA 1OARL 2OI9B 4ODHL 3HN3A 2WYSA 4XWOC 5I18H 3RIAF 1NP2A 4GKZA 5HI3D 1F6LL 1M05A 4PJEE 5DO2C 4AZIA 3MLTA 5DYOB 5AZ2L 3W0KA 2NXYC 1CBVH 4WHCA 2DWDB 1BX2B 3MUHL 3HUJE 3U57A 3PDGA 2YJQA 4B5EA 5E6IA 5T1MA 4S1RH 4N0YL 2NX5E 5I16A 2X4UB 5HGHA 2Z31B 4P5TD 5CBEB 5T1DL 2VRJA 3BAYA 1UWXK 4S1RL 1I75A 4KJQC 1JPSH 5DDHA 3TO2A 4X6DB 2CKSA 3QFJA 1QNZL 4NBXB 5E8OB 3CH9A 3CDFA 5I76B 3P73B 3VGFA 5FCZA 3NUKA 4ONFH 4XCYB 1QNOA 5F9JB 4HF5H 4CD4A 3FCTB 3DUSB 6A3HA 3O6FA 3MNWB 5FKAA 4KC3B 2GTWB 3TVMC 3SGEI 3W5MA 5DQJA 4RE4A 1DBBH 2X70A 2XKNA 3CMGA 4LGPB 5GGSY 2X0HA 3OLIA 1BFVH 2XVNA 1QA9A 3D48R 1R5IB 5F7DB 1M6OA 3CAFA 3RZCD 3WD5H 1QSEA 1ZE3C 3I2CL 3SPVB 1FL5A 3O9WB 4ZFZB 1OPGH 3UYRL 3DMMA 3E0GA 1MCBA 2W9EH 3ILQC 3C8KB 3W81A 1SJEB 3HPJA 3RL2A 5FIPA 1US3A 3IAQA 1K9EA 3RM4A 5C2UB 1MIMH 3D39B 1J0YA 2DQIL 4LPVA 3HPLB 4YXKH 3VD3A 1EJ6A 4QY8A 4UQ3B 1QFOA 2CLRA 1C90A 4XPFL 3TNNA 1U6AL 1H5BA 3N85H 1CL7I 4JZOB 3WUBA 1VHPA 3MBEB 3GZKA 4WY7L 2LVCA 1HL9A 4PJGA 2QQKH 2NNAB 5GS0C 2EDDA 3BXNA 3KWWB 1MQKH 4OLUL 3MOAL 2VDOH 2A2QT 4HMCA 1ND0A 2AEIT 4JO3L 4MJ6B 1BIIA 2VIRB 2IANE 3GJEA 4OLUH 4B16A 5I1EL 4C7FA 2V17H 1KEMH 2YL6A 4OF7A 3D9AH 5CEZD 4G6MH 1JD9A 1X5KA 1I9RL 1MOEA 2J4WH 2V17L 4Z7OF 3SKOB 3DRQA 3SDXE 1GORA 3BAJA 2A38A 5JPMA 3DVFA 3HR5A 3TBVA 1JAKA 1SEQL 2GIYA 3VXSB 2O9OA 3QCVH 4LNVA 4WGVB 2NY2C 4QLLA 5SWZA 4YX2H 1TMQA 1ZA3B 2AV7B 5DXWA 1JTOA 3V52L 1HKJA 4HA4A 1JZ8A 1G9NC 3LPPA 1GOWA 3SDYH 5DEGB 4AIOA 3LN4A 1JXKA 3K2UH 4GH7B 3L3HB 2JALA 3KPOB 5HGAA 3K2MC 1CI5A 4MNGB 2AEPH 5EZIH 4Q0XL 4BF7A 3O2VL 3ZE2E 2GW5A 4FQHB 3MREA 2OXGA 3M1BB 1KULA 3DUUA 2RCSL 1AD0A 3EYVB 1OWRM 3QULA 3G6JB 3UZEA 3GM0A 2GJPA 3DUUB 3L3DA 4PGEB 2Z4QB 3L4YA 4UFJA 3RY6C 1LDPH 1J1XH 3SGDH 3AFBA 5E24E 2X2YA 2X89A 4PRPD 4Q58C 3TNMA 1NWTA 1OTUC 1X5IA 1FNSL 3BPOC 1EX0A 3W9DA 4P9MH 1LK3H 1YY8A 1QQDB 2ZOKB 3SIMA 2NY1D 1J0ZA 3C6LB 3WS6A 3ILPA 3SKMA 3ARGB 2EO1A 4P3CL 5HHQB 1KENL 1MJ8H 4HFWA 3GH4A 4LPUA 1KNOA 4GXUN 2P8LB 1YECL 4YNYA 3T2NH 4KKBD 5D93B 4BZ1H 4HOWA 1VDGA 4EZMA 3CC5A 1EFXB 4RFOL 5I1HH 2ENYA 1I7ZA 3FT2B 1ETZA 4EI6A 3IJ7A 4K8RD 5CEYB 4JVUA 3BKJH 1B4RA 1S7TB 1AR1C 1T7XA 2XZQL 3CPLA 3O6KH 3TP4A 4ZPVA 4KUCF 1CVSC 2CJUH 3PDDA 3WL0A 3RVWC 1TR1A 4LP4A 3P4NB 4BS0A 1ED3B 4MXVF 5TE6L 4CADA 2QQLL 4NPYA 2DI7A 25C8L 1JGIA 3STZA 3QFJB 3QISA 1SM3L 5TGBA 2E8ZA 2MWCA 4OGYH 3VGGA 5A8PA 4DQOL 4L4OA 3ALXA 2AI0L 2HWZL 25C8H 4PR5A 2Y5TB 3WMSA 4NNXB 4MNHB 5JDSB 3WQ6A 4OKDA 5FHAH 5EMYA 5C92A 4HPHA 1OAKL 1KCRH 4PGDA 1J1PH 1CEOA 4QRSB 1YMMB 3V6FB 3OAZH 3PNWB 1UWGH 5E2WH 2M2DA 1FE8L 4H1LB 2IAMB 4W81A 4ODUA 4Y5YC 1QPPA 2F58L 5ABHA 1O6IA 3VFWA 5L2KB 1V08A 4Z7VE 3G08A 2IANA 5CBAA 1TIUA 3KYKL 4Y88A 4KDVA 1YEEH 2DEPA 3U7WH 1A1MA 4HUXB 3PXJA 3JWOH 1LG1A 5IWLA 1DQLL 1WNOA 1DWAM 1CN4A 5JMOC 5GS1A 3VPLA 4XVSL 2D7TH 1E56A 1EAPA 2AJYH 1T03L 4U1HB 3KDMA 3KYMA 1C16B 4NC2B 5EZLA 1RPKA 1MWAA 3RZCA 4X0VA 4RQQB 4M6NL 2UY3A 3IDNB 3D5HA 1KLFA 1P84K 4IBLT 5CGMA 2XYCA 4D3CH 1W2KT 2WWCA 2D1ZA 4TUKH 3DWTA 3HB3D 1H0DA 5D5MB 3WHXB 3W5NA 4O2CB 5ECJE 3RA7L 2IC2A 4MQ7B 4U7KA 4EQ2A 1H9VA 3OKNB 3CMOL 5JLZB 1KGCD 2EIZA 4DZ8A 1T5WA 1OGAB 1ZK9A 2GDUA 4K9EL 1N6QH 2R0WH 3A4WA 3MLYL 3FT3B 5DRNA 4LSVL 1JF6A 2L7UA 3Q5TA 4W4NA 4IS6B 4H26B 1HJQA 4C54A 4S11A 4TVCA 2VSCA 4YHYC 3RWEA 1AGFA 4FS0A 1MAML 4K2UL 5KVFL 3BXNB 3WUFA 4PRBA 2NNAA 1NCBL 4HKXB 1EEZA 1LO5A 1XIWD 1RULH 2CHNA 4QXUH 2V7NA 4P23A 1JMZA 4B3LA 4ZUSA 4LARH 4NKDB 2ZG1A 4CKVX 2W0FA 4ERSH 2BMKB 3LMYA 3MUAA 3T4YB 4QOKD 3RNQB 4C56D 3VIPA 1CTOA 1NGPH 5HNNA 4M62H 3ULUF 2CLZA 5CJXA 3ESUF 4UIMB 1YPZE 1EXUA 4ZNEA 3K46A 4V1DE 4NI3A 4UDTB 3PDOB 1RIHL 4IJ3C 4Z7VB 5ESAB 1MVUA 3O3AA 3WFHA 4WJXA 1ZT1A 4JAWA 1VFMA 2BDNH 1V7NL 3DV6A 3LDBC 3LKRB 4JN2B 3QRGL 4X7CC 2HVKA 2B0SL 3IS1X 4R27A 1B30A 3MRHA 1T0NA 3FAXA 3DUSA 1XGYH 1S7VB 1CGXA 3PGDA 4J3OC 4PREB 1JNNL 3VFTA 3O6LH 4JQXC 1VKXA 5HHXL 5C09E 4LEOB 5T1KA 5HJ3A 4DN3L 3X14A 1X4ZA 2VDKH 1A7OH 1MCKA 2VXTL 4CRPA 1FL5B 4ZFZA 3T0EB 3BE1H 2RIKA 4D1IA 4KJPD 2YA2A 5I79A 1IFHL 2GK1A 4FP8H 2AJZA 2QHLA 1U95B 4GKNA 4M8QA 5KSUB 3B3IB 2YD4A 4PRAB 3N12A 4M7JH 3MXVH 3CLEH 3VWKD 4DVRH 1BJ8A 3BKYH 3O6FD 1WCBB 4JO1H 4HA1A 3MODH 3QDMD 5E6IB 4GZEA 1FP5A 2YEZB 1AGEB 3T3PE 3V7AE 4H0HB 3BJ91 1TPXB 4XCEA 5BRZB 4KH2A 2QLYA 3VIJA 1EUTA 4OTXH 5FUOH 5HYQB 1JJUA 2ADJB 3WD4A 5IHUL 5B4MD 3UROR 4YBLB 3ARBA 1OWQA 1KWGA 1JPTH 5T1LA 2AGJL 1NGWB 2J88L 1I3VA 3SKUD 1DEDA 1UM4L 2X1IA 4GAYA 3MV9D 1MHPH 1WWWX 1HCFX 2WBKA 4S10A 1XT5A 2VTFA 3UJTL 3QI9A 4DOHB 1G6RH 2H8PA 2DQGL 4WI7A 2EJ1A 4P8VA 5A69A 3RDTB 4DW2H 3MS8A 4TVPL 3VIOA 4WFFE 5C0GA 3L4WA 1JBJA 3AXHA 2NY6D 4X99B 4HZ8A 3WH8A 3RWJB 2E0PA 2R0KL 1QLEH 1UM5H 1PBYA 2DF3A 3WSQL 4M1CC 3OLEA 1JIBA 1ZLUH 1A7NH 1XCWA 5F89A 4FMVA 3CDGA 4RQQA 1KBBA 4ZO7A 3WE6B 2X4NB 4HT1H 3BP6A 3PWJB 2QTEA 1FVEB 3KLAA 4I77H 5DSCA 1RUPL 4Q9QL 4X5LA 2BS9A 2R1WA 4FTVA 1MHEA 4G8GA 3T08A 2DKMA 5JLZA 5FGBA 1U8JB 4POYA 5FOOA 4OLEA 5E6ID 1IGTB 1QBLH 3HC0B 1K3IA 3EOTH 1R5VB 3C60B 4ELMF 2Z92A 4TSBH 2YKKA 4PJBF 2QV2A 1CFNA 5D7KE 2PO6B 43C9B 3K3QA 3MR9B 5DUMH 4IRZL 3IDNA 1OB0A 4KJYB 4EUPA 5DFVD 1T20A 3NTCH 4GW4A 3QIBD 3CHFA 4ATLA 1W72H 3PL6C 4ZQKA 1VFBA 4ORGB 2C8NA 1MHHB 2HT3D 1HXYA 2V7NB 3VXMD 4LCCA 3QG7H 1UD4A 1OB1B 2G8ZA 5E5UB 3V5DA 2IH3B 1JK8A 4DFHA 5EO1B 1XCXA 3UJJL 4ZOCA 1OCWL 2FB4L 2XQYG 3C5JB 5J6HB 5CD5D 5DJDA 4I48A 5C07E 5A6AA 1R3JB 1IKNA 1KB5A 3GXMA 1CVRA 1IV8A 3C8DA 4ZUUB 4LSSL 3JZ7A 2OR9H 5TDNA 3I6GB 3VXNB 1MLBB 3BZEB 1CGUA 4FG6C 1I7ZB 2NY4B 3FT2A 4NNXA 1CGWA 3NA4A 1SJHB 3FQXA 1EJOH 1TVDA 3GSNH 3TCXA 3EGSB 4NT6B 4PJFA 3B2VH 5DT7A 4PJIF 2YPLE 4P2QE 4BZ2H 3AXLB 3AREB 1CWVA 4LCYA 3CMJA 4GSDH 1WZ1L 4JJHA 3UPRA 2DH2A 5CPSA 3CXHK 3JTTA 5EORH 1OVZA 4WO4D 1JYXA 4WU7A 5KW9H 5BXPA 3HE7C 1LDPL 1XAUA 3M7SA 5JUEH 4HTYA 3BJLA 4QTHB 5ENWA 3MJ7B 1JGUL 1HKFA 2P1YA 3DSFL 1D9KB 3F65A 1RJYA 3R0NA 2DQXA 5JZ7C 1DWJM 1FNEB 3T2NL 1E27A 4FRWA 4MWFA 2I60L 3Q6GL 5GRZA 3GNOA 4Y5XC 1RIVH 1S8DA 2R1XA 1D5XA 3I6LD 5DFWH 2QADC 5J9PA 1P5UA 4PY7B 2E7CA 2X4TB 4F9JA 1FDLL 1W32A 4Z7NE 5IFHL 2XA8H 4MQ7A 4O02H 2ADJA 2XGBA 4JR9L 3BSZH 3QWQB 3GXDA 4G5ZH 1R5WB 1Q38A 1YEFL 4DZ8B 4XNZC 4EN3C 4R6UA 1NL0L 5E7BA 1EMTH 1BQUA 4YAQA 5BXSA 5TE6H 5T3ZD 3UTTB 4PJFF 1UR4A 3EYOB 4HIHB 2EDLA 3VXOB 3MCKA 3TJHC 4S1SH 3F7VA 4QLJA 1DFBH 4UV4H 3GRWH 1RZ8A 3QXVA 3MJ9H 4OLWL 3S88H 1D6VL 5JO5A 2PYEB 1WDPA 4WFED 1UWUA 2P4AB 4UAOC 4UZGA 1R5IA 1WCGA 4KQ3H 2NSXA 1N59A 4OLWH 3S88L 4XPTH 1IT9L 3IVKA 2J6EA 4OZIA 4ZPTA 1W0VA 4J3SA 4WV1B 4IDLA 2P42B 3MUGB 2NZIA 3QCTH 2NY5H 1NC2A 4YBLC 3WD2A 1XF2A 3BWAA 3JWOL 2DQFB 5F9OH 2R0ZH 1V0LA 3LKPA 2C4FT 4OF6A 4HCRH 1OGAE 1Y0LA 2IFGA 4KRMB 2M8XA 4QRRE 4Y4FD 2DMKA 5D93C 5HDQL 4M8UA 3GSXA 1DDHA 4M6OL 4ZD3L 3C60A 2C7UB 4M4PA 1JNHB 5GIRA 3S4SA 4RGNE 5L8LB 5K9JH 5SWSE 2FDMA 3QXUA 1ZANH 4JO4H 1PZ3A 4G42B 4TULL 1TVNA 3QWOB 3MLUH 1DQMH 3MFGB 3RX8A 3L2LA 4NWTH 4ZOEA 4IIQA 4JFXB 3HMWH 1W3HA 1YNTB 1V3LA 4W4OC 1HIZA 4OFYA 3DTXA 4NO5A 3ULVC 3VXTA 4OLVH 2XNAB 4APQC 2CDEA 5CHNB 1HYSC 1ZKAA 1A4JB 2AJZB 3FT4A 3QIBC 3VCLA 2ZE0A 1RURH 4L4VD 5IIEB 4OI9A 5KSBE 1R5VA 3LHPL 3LEVL 5F3BB 2VQ1B 3NOIA 4MHHI 4JRXE 1MFEH 3VXUE 1KXVA 1NCNA 1NOUA 2VLLA 1TA3B 1ZAGA 1BZ7B 1XF5B 2F54E 1IAIM 3HE7A 5B39B 2O9PA 1HHIA 5HI4C 1KXQE 3IJ9A 1VFBB 4FXKB 2YDSA 3TJHD 4DTGH 5IHBA 1J05B 1PY4A 5D2LE 4U6YA 1NGPL 4ELKA 4JFDB 4P8UA 3VIIA 3SHSA 1TZGL 4ZNCD 1RPQA 2XJ7A 3DVNA 2R1YB 4EIGB 1WQVT 5C70A 3L3OA 1B31A 1GVYA 2ZP0T 2R1YA 1IKNC 3ZHLA 4XNQB 5JW5B 2WUCH 1KPVB 5F1IA 4X6FB 3RWGA 4TVPH 3QEGL 1BGAA 5LGHH 5TDOA 3ZT5A 5CQ1A 5FYKD 2Q8BH 3G5YA 4OGYL 5E9DD 1A14H 4PLJD 5FK9B 2V3EA 5IBLC 3AYSA 1KGCE 3D6GA 1ES0A 5LAXB 4ZS6D 2P49B 3U4AA 4LCYB 3P9LB 5D6DC 2CK0H 3AXLA 3WELA 5I1AB 3L3GA 5LGJA 4EN3A 5E09A 5LQBL 1YMHA 2DB8A 1ZBVA 2CBIA 5SX4I 1AO7A 3VRIA 2XICA 2Q87A 3P30H 4FFVC 3NJ3A 1JWSB 1HSAB 4FQLH 1AY1H 1H8OA 4QEGA 3WLBA 3GSUB 1I7RB 1QBML 2WBJA 2A83B 4M56A 3QFJD 2XZAH 1XZ0B 2JEQA 5HVHC 1HHGB 3MBED 2GUOA 2BCKB 2PKDA 3STZB 1BBJB 3TVMB 1WAAE 4NZDA 1FRGL 2FHCA 3LRHA 4HIEB 3JWOC 1HWGB 5FGCB 2XG5A 1X5FA 4EOWH 1AHWB 4LASL 1LWRA 4X80L 4PYGA 1J10A 2EC8A 3SOBH 3ALFA 4M6NH 1DVFA 4K7PH 1ZA6B 1P69B 1NH6A 4ONGH 4YQXL 1ZVSB 4KMTH 3NH7H 1A2YA 2HFEB 2NTSP 3GHBL 5J12C 4IMLB 2VURA 3IFLL 5INCA 3MLWL 3U7AA 4OQTA 4LHJB 2Y36H 1U2HA 2K9UA 2X40A 1JHTB 1QNRA 1CFNB 3PWPB 3QCUL 5F7YC 5AWNH 2PW2A 3HE6D 3GEWB 4G8IA 3EFDH 4JEGB 1G9HA 3PZQA 1MW1A 1JWMB 4BA8A 3HU7A 3OJDB 3EBAA 1V02A 3UCQA 2YUXA 4IS6A 1N4XL 2AJSH 2V5YA 1YEIH 4AEHL 5DLMH 1LP9B 3MRQA 4W93A 3ZHKA 1JN6B 4WDIB 2DQDH 1U3HB 3STBA 2XWTA 2VAAA 1E4IA 1LO3L 1G1CA 5HOSA 3GSQB 1GC1C 1GSMA 4LSRL 2ERJC 4HT1L 3T4AA 4NRXA 2YPKB 4U1SA 4QTIL 4P59L 3H3PL 3LRSA 3WBAA 3MRCA 5J13C 1GGIH 3BD3A 3S2CA 2GT9B 5ITFB 3T4YA 3HCVB 2NY3D 4DGIL 5E2TL 2QSCH 3BN9D 1CQYA 1ZXQA 3GMOB 5I66B 1QBLL 2VDLL 4QXTB 1MFNA 1M05B 1W8NA 4UDTA 1DLFH 3OKMA 3X17A 5B38A 5EUOA 2V7HA 2P8LA 4JFTA 2NW2B 2OBGA 4YN5A 3MLXL 1QUNA 3M17B 1G7QB 1EDGA 1U93A 2VL5B 2JF1A 2XV6B 1CT8A 2DYPA 4P2RB 1NKRA 4JKPH 4U1IA 4HPGA 1G7HA 3BAEL 1Q6FA 4WFHE 4PTXA 1J8HE 4AK1A 1K8IB 2E6JA 5C2BH 4UQEA 3ZDYF 5D4YA 1F13A 1OAUH 2F15A 2GJ6D 2HFFA 4ODVH 3WH7A 2Z4QA 3T3MF 1KB9K 4JREC 2CDEB 4I3RL 5FOJA 2BRRL 5D1QA 2IQ9H 5KOMC 2G75B 5DS8A 1S5HB 1OCWH 2FB4H 2VH5L 5C0DB 5IKCB 1OARH 5MENA 1FNEA 2ZX7A 3RPMA 1YEKL 4ZXBD 1CFVL 1J5OH 4P4RA 4FK9A 1NEUA 2Q86A 2DQHL 4A3HA 4HIIA 1U95A 2C3XA 2WVTA 3RM8A 3WS3A 4L1DA 4ODSL 1V3MA 4AZ7A 4OZGF 5LVEA 5F96L 2NT0A 4A6YH 1DEEA 4ZDHA 4RISL 2NY2B 3VFSB 2PWDA 3IDXL 4ZAKC 3MLZH 3ORJA 2CHOA 1FNGA 4KQ4L 4JRYB 1NBYA 5I74B 5C0BB 3IDXH 1S7WB 2A6JB 2C3VA 4X5XB 1RUKH 3DRTA 5DJYA 5GNYA 3JUZA 4NQDD 1NBYB 4HD9A 2WCAA 3UTPD 2R0LL 4HU8A 1JTTA 1QNZH 2E5EA 4OFDA 3F7YA 2ZUMA 1NM9A 3TC9A 3BVNB 3CIVA 5DMKB 3NCBB 3BZFA 5E8EB 2AJXH 3TBYA 4PR5B 5D70L 4QKXB 2VIRA 4GG8A 4GG6A 4NO3B 5IFJB 1D5MA 4X83A 3WSUA 4WGWB 4ELMB 3BPLC 3CZFA 3L9RB 2EEAA 4QY8B 5ADOL 1INDL 4KRPC 4PJ8A 1KN4L 5DK2A 2XA8L 2WMPA 3TBSA 5DUPL 4G9FD 2Z1KA 4UT7L 3BIKB 2Q3ZA 3O9WC 4XNUH 1ZBCA 3SCOA 3OV6A 1XYFA 3SCRA 1I1CA 2WBJB 3K80A 2YBTA 4R96B 2BXYA 1PKQA 2WW5A 4MA1B 3TH2T 1J0HA 3B4NA 5AD0A 4NUGH 3WFZA 1Y18A 4Y4HC 4LNRA 3AFLA 1FO0H 4K94L 1LEKA 3B9DA 4MVBC 3RWIA 3W53A 5D5MF 1GOIA 5CINH 2SEBB 1CGYA 5L8JB 5IBTL 1KGWA 5IDIA 1S9WA 3V5KB 5GHWL 1FNSH 4KJPC 1OGBA 2DLGA 5FYJL 1P84J 3D0LB 5IBTH 1F2QA 3L95A 5GISL 2IF7A 5A2IH 2H26B 1FVEA 1G7IA 3MPCA 4Q2ZB 3THMH 1U8PB 1NFDF 5ICXB 1HKKA 2H2PD 3ARFB 1IQWH 2GSIB 5ILTL 1UYWH 4GUPB 3A67H 4IOIB 2NXYB 4LSSH 2PW2B 4L8SC 3TF7C 3MRKB 3WF4A 4ZSOE 1KJ2A 1XFPA 5HDQH 3WIJA 1EJOL 3GSNL 4C7DA 1BFOB 4HK3J 3F5WB 1CXLA 2HH0H 3T0AA 2V3DA 2LABA 3DX7B 1KEGH 5SV3A 2DBLL 4Z2HA 1UH3A 2VLRB 3NZHL 5J1AA 1G7QA 1T89A 3DIFA 3NCYP 3VXMB 1K4CA 3BESR 4TSCH 3ZTJG 5B3NA 2DDQL 3I6KA 2X9WA 4WNQA 1MFUA 4GRLC 1NGZB 1AH1A 4HWBL 2ICES 5DRZA 2R56L 4OQTL 4R7DA 4YPGB 4PCTA 3MV7D 3ZE1E 2I07B 5T33L 4XH2B 1DQDL 2Z93A 4PMYA 4UT9L 5BZDA 1UQZA 4QRPB 1F4HA 3POCA 5J3HD 2C3HA 1JFHA 3DX8B 2EZ0D 3FB6B 5KSVA 4P8XA 3SE3A 4TUOA 4MJID 1I1AB 3P0GB 3PWUB 4YHLH 5H2BA 3PTQA 2F5AH 4OIIL 5EU6E 5IB2A 1KF9B 1J0JA 2ZKHL 3KPRA 1V6UA 2MCG1 1X5XA 3EJYD 3V4VL 4XCCH 1I1AA 2BVPA 4PJ9C 1KJ3L 1S7QA 4ZPVB 1Q94B 5EBMA 2X6MA 2B2XH 2UWEA 3FY1A 4XAWL 3NZ8B 5F9AC 1CLZH 4JRWA 4LLUA 3WNOA 4LF3B 1SMOA 3CVIL 4I0PB 4WO4B 5GS0L 2HJFB 3H6JA 3PF2A 4ZXBC 1JWSA 3IJ8A 2EDWA 1OF2A 4WU5B 1NPUA 1QI3A 3HE6A 4F37F 4U05A 3MLWH 4PBGA 1IKFH 5JOPD 3L1OH 3SE4A 4AZCA 4J2XA 5J56B 4W6YB 4CW1A 2JF7A 3KL0A 3MLYH 4JL2A 1PGRB 3MV8B 5GRUL 1U30A 5HHPA 5AWNL 3E2HC 4OCWH 3IU3B 2Q86B 5F7FA 4DVBB 1IGJA 4PG2A 2ATPB 5BVJA 3IETB 3TESA 4RWHA 1IGCL 4KKNA 2HFTA 3G04A 1IARB 4KI5E 1ZLSH 1DEEB 5JOEA 3ULUL 1LE5A 5GS1C 2Y4SA 2NY1B 3CU7A 5T1MB 3FQUB 3PZMA 3C5ZB 2IJ0C 3B9KB 1OAZH 3HFMH 4O2FA 1MCPL 1JYWA 1GAFH 3QHFH 2J77A 4PMRA 1VERA 1K3ZA 4QHMA 1R6VA 4RGOL 4WFEE 1VFFA 1X4XA 5HGGS 2CPUA 3BP7B 3QNXA 4UCFA 1NC4B 1UVQA 3FMGH 3GSOA 5D1XB 3BXWA 3LPFA 3P73A 5ABDE 4H26A 2ARJA 5IHLB 2J25A 4HWBA 1NGWA 4HJ0D 3EBVA 3OJDA 1JWMA 3WQ4A 4JG0H 3SURA 4MDJB 4XGZB 5TPWH 3W0WB 4JN1H 1LD9B 3ZSSA 1UZ8A 2DQTH 4WUUE 4UT6H 2VDPH 1IM3B 3VO0A 5HHOB 3JTSB 3EHBD 1A6UH 2NY0C 3L4TA 2V5DA 4KK8C 2EE9A 1KPUA 4OJFH 1KCKA 1Z9OA 4CDGC 3UESA 1T5WB 1UWEL 5DK3A 4K3EH 4YHIA 1S7UB 4G7YL 3MX0A 5EZIL 1DBKL 4H25B 4R4BB 5TJWK 1V3JA 3NIYA 4LSPH 2VXTH 4XB7A 1U8OA 2NW0A 2EH8L 1JZ6A 4YH6A 1UEMA 1CLOH 3ZKNC 3B9AA 1PY9A 1FIGL 1G7MB 1LEGB 5GGVY 1GH7A 1F4WH 4IEFB 1QO3B 2B8OT 4Y0GA 3N1FC 4XI5D 3RWCB 4OT1L 2CSPA 1BJ1H 2ZZUT 1G1YA 3VWKA 4EJ1C 4LPXA 1PSKH 2EDKA 1XGRA 3O0RL 3SDDC 1ODZA 3QIWD 4XCFH 2C1PB 1X1NA 2A6IB 1MFDL 2XFXB 4O9HH 2GJXB 3IXTA 1DVFC 3I3BA 3PTKA 4P5TC 4U1GB 4M1GL 1AGDA 4AM0A 3U0TB 3OKLA 4J3TA 1G9NH 3TZVA 3LKRA 4OCRL 5C0BA 4PRWA 1G0DA 3IFOB 1MJJA 4JZJA 3PHAA 4MGXA 1U8QA 4GQPH 4RGNC 5HI5D 3AHVA 3LAFA 3H9SA 5EB9A 3MFFB 2DKUA 1KN2H 2J6EL 3MNZB 4PGBA 2WVUA 4PTWA 4R0LC 5DWUH 3IFOA 3PGDB 1H09A 5JBEA 4L9LA 3S5LG 4MAVA 3VFGH 3CLFL 1L9MA 4O2EA 2ZCLH 2YHGA 3N18A 4JHAH 1UACL 4ZDHB 3VFOA 7CGTA 3WKNA 3FQRA 5I71B 2E27L 4GMSH 1MHPL 3D3VB 4NBZB 4Y16B 2E7LA 5ALBH 2JJWA 4PB9L 1NAMB 1RHFA 3ARBD 1CENA 1XEDA 3QIUC 1P6WA 4ZFOL 1R24B 1BPLB 5E99L 5BCAA 2I5YL 5I8OH 5IEHB 1J05A 1XH0A 2OSLB 4GO9A 3I02A 1QYGH 3AHYA 1RIUL 4GBXC 4QWWD 4A6YA 3B9KD 2F19L 1YZZA 5JXAH 1TVPA 2JCCA 4L1HA 5IXEA 5DMKA 3VDAA 3TO4C 2MTPA 1BYDA 1MQRA 1E6OH 3VXRA 5HBFA 4TSAL 3ZKXC 2E3VA 3QPXH 3U30C 3OAUH 1HP5A 4GRLD 1LO0H 4PUBL 3QDJA 5AZEL 1CFQB 4LCUB 1BFNA 4M7ZC 4EE9A 2PYEA 1KTKE 1QFWM 2H6PA 4AT6A 4RRPA 4YXLL 4AWEA 3SKNA 2J7LA 4LBEB 1CFQA 4LDOB 2FR4B 1XGPB 3GBMH 3ZQ9A 4YHZH 3EW3B 4W87A 1LL4A 4Q9CA 4EUPG 1G6RA 4A2LA 3W6MA 3GBNH 5ERWB 4BQ3A 1FL6B 3Q6FA 5IROC 1WTLA 2BOBA 5KANI 2Y36L 4F8TA 4CU6A 3GH7A 2X4TA 4NZTL 5B4MC 2ICEA 3WS6C 1DWGM 3BHBB 4HH9B 3GHBH 4WKFA 1BWWA 3BP7A 5FHBH 1I7RA 3IJHB 1HZHL 3NGBB 1E73M 4LNRB 1CTNA 3ES6B 4W86A 3TJEL 4CVZA 3KPOA 3LV3A 1I4FA 4NKOA 2R2BB 4MJ6A 5IBUG 4RA0C 2APVA 3S37H 1N64L 1QRKA 1OAYL 5T5FH 4OCLC 4OZ4B 2ITDB 2G2RA 1YN6B 4X8JB 4ETQB 5E03A 2NT1A 4HLJA 4GI8A 2CMRH 2DQCH 4FN0A 4L8DB 1XR9A 2X1WL 4C7GA 1VJSA 4DKAA 2NX5A 3CCHB 2BHUA 3BW9A 4G80B 1TETL 4D9QE 1OTUD 5LA1A 4QHMB 3RPIB 1OTSD 2XACC 5J8OA 2DWEA 1ZSDA 4QAWA 2CXKA 5IMLB 3WNLA 1H4PA 3T1FA 1H0IA 5HD8C 4MAYC 5C0IB 4I0CC 4R8WL 3CVHH 4M62L 3C08L 5AYQA 5EU4A 3TH4T 1W72A 4JFFB 4JFQB 4ZYKA 1N8ZA 2F8QA 1KCSL 3SY0A 4PJGB 5E8PB 3RHWF 2E7LC 2XWJB 5DGRA 5JIIA 2VXVL 3U7YH 4HC1H 4JRXA 4H8WC 3CFEA 4PJCF 3BO8A 2VC9A 5HTSA 3K8LA 1D7FA 3RAJL 3MXWL 3BAWA 1CR9H 1P4BH 3LD8C 4HLZG 4DKFH 5CCKH 3P0VL 3O3EA 5FB8A 4ZENA 1X5LA 35C8L 4PB0H 5DQDL 2PBGA 1TJIL 4JLRB 3VXQA 1ZV5A 3TT3H 2NY3B 1KIRB 2XWBA 3OKLB 3OR6A 4JR9H 2BHYA 2J1KA 3ZSTA 3WKMH 4WKAA 1MFAL 2OK0L 1ZT1B 3QIUA 1UZ6F 2IMNA 4WCYH 4K3JH 3WEXA 5I1IH 5C07D 2XNAA 3V0WH 5L2JA 3CUFA 4JGUA 1FGNL 2DSKA 5E00A 2DD8H 4OGZA 4XPFH 5I18L 1BEYL 4KHXH 3C5SA 1MHCB 1OP5H 3U0PA 2Y6SD 2AV1B 4JQVC 3O2DL 5IB3A 4N8CL 1QQDA 2ZOKA 1L7IL 5F97E 2P44B 3W39A 3GYCA 3TTOA 3MLZL 1Q9OB 3RO8A 3WEMA 5IJKA 1UZ1A 4G8EA 3NCEB 4PP2A 4ZTPL 1F6AB 1DP0A 2BFVL 2A0LD 3P0YL 3AMCA 1ZVYA 4RNRB 3GNPA 3QDGB 1D2KA 3RZCC 5CIPH 1AR2A 5DJ0A 1HHGA 2W07A 2I27N 1H3PH 3INUL 4X9YA 4KVCL 1AKJD 3HHRB 5D7IE 4BQ2A 4URIA 1X5AA 1N26A 3W0WA 2R9HC 1I7UA 4OUUB 4FQJH 5F1OB 2AK1L 3O11A 1Q9WA 1FAKT 5GGVL 3O81A 2DQUH 4JRYD 4PJAF 5D7SH 1N59B 4X6DE 3U9PH 4N1HB 4NQCE 5GGVH 2VXSL 4M7LT 4M6MH 1FZJB 5FYJU 4AQOA 4CNIA 4U6VL 2DSVA 1KC5L 1T1XA 1NC4A 2EYSA 3WD5L 3CZEA 1H5BB 3L4ZA 3ARYA 1KT2B 2Q7NA 1WBXB 3GJFB 3PTMA 2D3NA 2QPUA 1VGEL 4UQ3A 3OAZK 4HIHA 3VXOA 1CQKA 1A7PL 1UCBL 3GRWA 4CMMB 4D8PA 1IKFL 4M3KB 3H8NA 3O45B 4PRID 2IUZA 2XVLA 5KVGH 1ZLWK 3RI5K 3DMMB 2J7HA 4E41A 2YEZA 3QBTB 2LTQB 1NMCB 5D2LA 3N1QC 3IKKA 4UQ2B 3DO3A 4NC0B 3LPWA 5GGRA 2YD8A 1KG0A 4M61B 4KUZL 2JJTC 4GG8B 4RMUA 1OM0A 5TDPA 4UQ2A 1CBGA 3WENA 2AABL 2DLHA 3S6TA 3T65B 4AC1X 5A8OA 4M1GH 2DSZA 4KRNA 1NDGA 3SCQA 3HE6C 2IXVA 2WHKA 3MRFA 4CU7A 4P2QA 3O6KL 2OM5A 3RPIA 2X05A 1VENA 4ODWB 5D6CB 4LKXB 2N7AA 4QF1B 4HIEA 1H5BC 3Q1SH 1D5IH 1WFTA 5F88B 4FABH 1I4FB 2WMKA 4AD0A 3MRHB 3Q1SL 2Y06L 4QRUB 3SDYL 5HY9B 4NQDB 3VMNA 3PGCA 4IIQB 3ZYIA 1XCTA 2YL9A 2Q6WA 3QO0A 4NN7C 4O58H 1WEJL 4B7IA 3ULUD 1G94A 2AK4E 3LQAH 2BHZA 1G7JA 1KXTB 4J12A 1DWFM 1SYVA 1HQ4A 3DBXB 1I8LC 2FX8H 2EIZB 2CRYA 3SEPA 2WCSA 2AK4B 4ODBD 2ZOLB 1OW0C 2YC1B 2ZUVA 4F79A 4GIAA 5KSBF 3SDAD 1LQSR 5DQ9A 5ID0A 3A6CL 1CDHA 2OLHA 2FH6A 4PRBB 5IGXL 3RFZC 5ABGA 5M5DA 1JGLH 3VXRB 4JDZA 1P1ZA 1FAIL 5J11C 5IJKC 3IDGB 4XVUD 3TT1L 3WEXB 7A3HA 3NIGF 2GCYB 5BV7C 5DZOA 1F4YH 3AOFA 4TVSa 2ZCKL 2GEEA 4HK0A 1OAXL 2HLAA 2Y9RT 2AV1A 1HF6A 1B0IA 3M17A 4PSRA 4UQAA 3DX6B 4LBEA 2XN9A 3LMJH 1MFBL 2VDRH 5T5NF 1FC2D 2FBJL 2MQ3A 1MEXL 3NYDA 3ECBB 3SDCB 4XBPA 3OR6B 4HHAB 4X7SH 5ICZA 4GFTB 1MEXH 4MJ2A 3SDCC 3BPCA 5IFHH 4Y4KA 1MXGA 2XVKA 3AZTA 1YMMA 3D2UD 4OZHE 3V6FA 5ISZE 1ADQA 2MPAL 1IZJA 5D96B 1BD2A 5L9DH 1GOQA 3L3IB 2B1AH 1NANH 3OXRA 2WUCL 1MY7A 3L5HA 4NKMA 3PQYA 2HWZH 5HHNB 2FGWH 5BV7B 1UH4A 4X4ZA 1E6JH 4G8EB 4PG9B 5J11B 3GIVA 1A22B 4NPYB 3HNVH 3UDWA 5LCVH 4YBQC 3ET9F 5DK2B 3KXFE 4OQ1A 3TZVC 4NSBA 1IGCH 4ACZB 3OGRA 1OTTC 2BVQA 4GRWH 4LSUH 3S7GA 3G04B 5GGTA 5LCVL 2KDGA 2PN5A 2X4QB 1HH6B 4HXBH 3RJDA 3NBNA 4KZEL 3W4RA 1S9KC 1VACB 3LZFL 2V2XA 2QHRH 1CL7L 3SGKA 2P8PA 2UV3A 4LLVB 4RFEB 3EOTL 4PJFE 4X98A 2DQTL 1IAIH 5D72L 1ZJAA 4MX7B 2X42A 4DKDC 3SCMB 3TCLA 4G3YL 5BZWB 4P59H 3RVXC 5I1CH 3U79A 4AMCA 4EIZC 3FOMB 1Z3GH 2J5LC 4G3YH 1QFPA 1YJDH 1BQLH 2DLIA 2E3ZA 1S7SB 5DZNA 1XYZA 2C3VB 2NYYD 2H41A 3JXAA 3OG6B 3BAEH 4NO0A 4DUXA 1BVLA 2FD6H 5TQ0L 4C57C 1P4IL 1RZGB 3EDDA 4DN3H 1AVAA