5JIUA

The crystal structure of ranbpm/9 ius-spry domain in complex with ddx-4 peptide
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
209
structure length
209
Chain Sequence
NEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Interaction between the IUS-SPRY Domain of RanBPM and DDX-4 in Germ Cell Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ran binding protein/peptide
molecule keywords Ran-binding protein 9
total genus 55
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jiuA00
4N7UA 4V1PA 2VOKA 4P9JA 5F6LB 5JIUA 4B8EA 4P9IA 4QT6A 4WVMA 4N7IA 3TOJA 2YYOA 5JI9A 3KB5A 3ZO0B 4WVMB 4KG0A 5C33A 4P9LA 2IWGB 5F6KA 2YUEA 3UV9A 5JIAA 4X8PA 2LM3A 4XW3A 2WL1A 5JI7A 2E63A 4X8NA 2FBEA 4B3NA
chains in the Genus database with same CATH superfamily
3VZMA 1LCLA 4LR4A 3RS6A 2PFWA 3S57A 1WLDA 3PNAA 4JHTA 5E16A 1SLTA 1AYM1 1ZZ6A 3KZ4C 2HWF3 1Z78A 4C1XA 2JJ6A 1VE0A 4QX2A 5IVCA 1REEA 3IPVA 3VBHA 2SLIA 4M3CA 5E8AA 4FVVA 4KI5M 1AUYA 3LAGA 2DVGA 2RS31 4YM2A 3BVCA 4QKBA 3MPPG 2XPJA 2WWJA 5BYNA 1OKQA 1CZSA 4RR3A 3MIGA 2VZVA 3JBG3 1HB3A 4HSJA 1UN1A 4I09A 4N43A 1H8TC 3L2YA 4UOJA 3P5BA 1VMFA 4GJZA 5LCWL 3HAGA 1UAIA 4YSFA 5F9TA 2FDJA 2QNKA 2Y6LA 3VKLA 2A70A 4NJ4A 2VZSA 1BK0A 3B3QE 1A3KA 3O0WA 1PGSA 3H1YA 2AR6A 2HJIA 2BP6A 3C8XA 3T09A 3U37A 3WCSA 5I0RA 5F37A 5H9RA 1GWLA 4F8AA 1PIV3 4LKDA 1Z7S1 5F3EA 1TNRA 4LO6B 3SH3A 4BWOA 3J7NA 2FDIA 2YU2A 1VBC1 3IMNA 5K8SA 1A8DA 5BPXA 3WP6A 4AGRA 1NA1A 1T6BX 1GOFA 1SFPA 4DQAA 3LEIA 4PI0A 2C0ZA 4NPMA 2RMU3 3PU3A 3LB9A 4NRMA 3VBFC 1H8VA 1EAH1 2PQSA 4LJHA 4GB31 3WDTA 4KWJA 4AFMA 5JR2A 5A6QA 2ZBJA 4ZXKA 2ADDA 1D7PM 2Z5WA 3JUUA 4UFKA 3ZMOA 5GZDA 2HWB3 2NYYA 1JOPA 1GZCA 1POV0 1ZZ7A 4LBQB 1TVGA 4NRQA 4U2AA 3BUCA 2QDRA 3I2FA 3VBHC 1VBB3 4CDWC 4WZCA 1SBFA 4K40A 3VBRC 1JUIA 1O3TA 1BMV2 2V5DA 2A75A 3I2JA 1AR73 1ODNA 2R063 3K4AA 3AX4A 1H1MA 1E57A 1GQGA 1NQDA 3M2MA 4H3WA 3WNPA 2UWAA 5A7WA 2DTWA 5HCHA 3D6EA 5T50A 1PO22 2AEYA 2QUOA 3VHRA 1UQXA 4X6QB 4LO4B 1GMMA 2E31A 4MADA 5A3WA 4IEXA 1EUUA 1HN1A 1S0CA 4D6SA 3ZSKA 5A6XA 2GNMA 1OF4A 1DF0A 3RG0A 4A41A 1YUDA 3MLKA 3JB4C 4CTEA 1RUG2 2GMMA 1Q8QA 2VTXA 2VAUA 4UFJA 4YW1A 1NCQB 1QHDA 1RHI3 2GNDA 4MHUA 5A1AA 5FDBA 2QQPA 3AMNA 1RHI1 3J9SA 3ZPYA 1URXA 1UYYA 3PU8A 4EQVA 1JS9A 2JE8A 4NROA 4NIGA 2FCTA 2R6QA 1DQ5A 2RJLA 1W8NA 1F4HA 3TN93 3AXDA 3THCA 2PHXA 2XBO2 2HYKA 4YGDA 4F7ZA 4QDSA 4AVBA 2CDOA 3EBRA 3AMMA 1B35A 5APAA 5IVVA 4L92A 3N9PA 3RZHA 1ZVFA 2TNFA 4LE3A 4Y22B 1CR7A 5FPBA 5GALA 4QHZA 2V72A 1RYYA 3ROUA 4HFSA 2EF6A 3DV8A 4I3GA 5FZGA 4LA2A 5FP8A 4R4XA 3AP9A 3WNLA 1UOJA 3J8F1 3I3DA 2VQTA 1AXZA 5J7MA 1RUG3 1HJGA 3UJOA 5CFDC 1RUD1 4YZ3A 2K0GA 3VBRA 3TNQA 2IWGB 5FMBA 4PF1A 1ZBA1 2B4KA 5LRSA 3SCHA 4XQWA 4BQ1A 1JOJA 4YW5A 1TNFA 3KT4A 4CDUA 5H9SA 2Z79A 2WC2A 1O4ZA 1CIWA 2HWE3 1KJRA 1RUC3 1V6OA 2V4AA 3MHZA 2JKBA 3VD4A 2RJ2A 2D40A 4OI1A 1FPN1 1S55A 3HNMA 2Y38A 3KS7A 1F31A 5IVFA 2ARAA 3VD7A 5KC5A 2R0HA 3WW4A 3D3AA 3NW4A 5FPLA 5FYYA 5LK5A 2IFRA 3JD73 2BOIA 3TN91 2JDNA 3ZKUA 3A21A 2HLEA 1Q8PA 1QKQA 4QB1A 3ZO0B 5A7PA 2XWJB 1QOSA 2NP0A 2W5FA 1RUNA 1JODA 1YIFA 1C28A 1CZTA 3CHXA 3KCCA 3PTRB 4NHLA 1X8EA 5D21A 5C8WA 2HH9A 2UWBA 4YFWA 4ORFA 5JAXA 4ZZ8A 5IATA 1QJY3 4D3WA 3PDQA 3SQOA 5F39A 5CYYA 2WIIB 4LITA 2QQOA 2WFF3 1PGL1 3O0XA 3LDBA 1B09A 1MZ6A 1NLSA 3HNYM 1OOPC 1H8TA 3O1UA 4JKLA 3ZYRA 1X8MA 1SHWB 2A5ZA 2Y33A 4JTNA 1W8HA 4CDUB 1UOBA 1YHFA 3USUA 3H0OA 1PMIA 4Y5SA 4CRQA 1EUTA 1FAYA 3P6BA 4Q8KA 2W46A 2QTWB 1O6UA 3LOIA 3GBWA 3LIHA 1JHNA 1KFUL 4I0WB 1RMU1 4CEYB 2XWBB 1W0PA 3CEWA 3KHBA 2BVVA 5FXVA 3ZSMA 3HR9A 1SACA 2DU1A 4IV3A 4CP1A 1LB2A 1TME3 1BJQA 1AXYA 1ULPA 5SV5A 4IV1A 2P2KA 5JXGA 3RDIA 4DIQA 5A3MA 1N1VA 3RZGA 2HBTA 4AHXA 1QJU2 3KGZA 1OF3A 1SLCA 3Q8FA 4OHVA 2RMU1 4OFGA 1JZ8A 4YWAA 3I7DA 1ZRRA 4CZSA 1BLZA 1LOFA 4UYBA 1RL3A 4MGTA 1F35A 1OQDA 2K2SA 4Q0QA 4EN6B 1S2BA 3AMPA 3OY8B 3M3IA 1VBA1 4IV1C 4BQYA 3WXPA 1REDA 1WCSA 1Z7S3 1H8TB 2JG8A 3ZSJA 1H4GA 5FPVA 4QPIB 4XMAA 1IGOA 1CAXA 4LKFA 1BVVA 1MS0A 2ARCA 4S2FA 1R1A2 1W90A 1E5IA 4Y5TA 4QX5A 4RFT0 3SC7X 2R071 4IE7A 1SLAA 3WNXA 1PMHX 2DCTA 3R4UA 4RL7A 1DZQA 3CQOA 3GHMA 4M4RA 4PLMA 1IQDC 2Q1MA 4HG6B 4BQ5A 1YJKA 4YLZA 4JRLA 4PDWB 1CPNA 1BBT2 1UOGA 3O12A 5FMDA 5I0UA 2F4PA 3S30A 1RVF3 2D97A 5JOZA 2ENRA 3B7MA 3PUHA 2ZHMA 4LBJA 4M3CB 3WSOA 4NRPA 4IE0A 4CYDA 2J1TA 2CY6A 2RS53 3RNSA 2V4VA 3LA3A 3NNMA 4DS0A 3OGRA 4Y20A 3NJZA 4LEJA 2BEOA 3VDCA 4XFAA 1ASJ3 1QGLA 5FP3A 4CU9A 1QJU3 4GH4A 5DAVA 3Q8BA 1LOBA 2CGPA 1JYNA 1FPN2 4CEWC 2KD7A 4QHBA 5FUNA 3C7HA 1S0FA 2OPKA 4P5HA 4QX3A 3FL7A 1ND3B 1I1EA 1NLQA 3B93A 1UU6A 3LA7A 1MACA 4HSLA 4QWNA 1NG0A 1RVF1 3C2UA 4YNIA 4Z92B 1R64A 4TLFA 1MPXA 1GSLA 2VE1A 2WO7A 4Q8LA 2W2IA 3JB8A 1ZRDA 1R1ZA 5C71A 1L7RA 2ZGMA 3BTXA 2YC0A 2EIDA 3I49A 2ZGKA 1HRV1 4A7KA 3MF9A 2LUWA 2WO1A 1XU1A 2WINB 5JI7A 2VW1A 1J1LA 1OHFA 3PJYA 1MEC1 2A6WA 1VBB2 5FQ0A 5AC93 2DCYA 2RS33 3EMRA 4TN7A 1RUD3 5FV3A 4KMQA 1XXNA 3JBG1 1AR62 4WM8B 2A71A 1A78A 5FZ8A 4TZDA 3OB8A 5HCBA 5C7GA 3THPA 4R8HA 3GZUC 3V0AB 3JXSA 2OZJA 5E89A 3KV9A 2DU0A 1B35C 5FYMA 4P14A 2C9KA 5IHRA 4RGKA 3VBSA 1WD3A 4GB32 2CU5A 4KNCA 1JYWA 4P5YA 3AYEA 2ZACA 4BK4A 4HPKB 4C0HA 3TWIA 5J36A 2OX0A 1AR92 2BU9A 4XILA 1WMDA 4LO8A 5DABA 1KS4A 3NSTA 4K8FA 5FO9B 1QQP1 2WT2A 3HQRA 4WBBA 3MLJA 4CUCA 5A1LA 2RHPA 1WCKA 2VXJA 3S0MA 3AP6A 4OUEA 4CSWA 2RG4A 1LODA 1GP6A 3CLPA 4XBLA 3MGUA 1QJU1 4D69A 1Y43B 1S1AA 2Y6HA 4DOUA 3M7AA 3QH6A 2W1SA 2XLAA 1PO21 3MFAA 5DMYA 2RM22 1RUJ1 4AFAA 4JDOA 3UT0A 1GFF2 2VVFA 1W9YA 5C3OA 1ODMA 5FXWA 4GXLA 2E9QA 2XGXA 4EWAA 1XNKA 5CG8A 1JI6A 4QQLA 4ZU5A 4LORA 4DINB 3H8XA 2WLPA 2XJSA 1DBNA 3I2HA 2VNGA 3ZXLA 3VDAA 3WY6A 4CCKA 1X33A 3O1PA 5FR3A 5HV4A 1TZOA 4Q4X2 5FY0A 2XUEA 4K21A 5J98B 4CCLA 1JBCA 3IDAA 4CDWA 4D8MA 1UX6A 3PVBB 4NN0A 4OI2A 1U12A 3K46A 4IEZA 3ABZA 1DFQA 4QPGC 4BCUA 4JAAA 2VUAA 4L97A 1PO11 1RUE1 2Q8CA 4YW2A 2WNUA 1V9U1 2PXJA 3TBDA 1F5FA 3PMSA 4P9GA 5BNNC 1NA1B 1DYKA 5AFBA 2XJRA 4YZ4A 5ACA3 2V5YA 4BJ0A 1W2NA 1WWYA 2WAOA 4HKLA 4BMEA 5FYZA 5A70A 2XONA 4A7ZA 2WKKA 1I5ZA 5FOBB 5FCCA 2B9UA 5FOJB 3D8CA 3LSDA 1S0JA 2BW8A 3H7YA 4I0BA 2ZKLA 3PUSA 4BHPA 4RHV3 1CPMA 4IGPA 4YW7A 1UX7A 1LHVA 4OZXA 2MEV1 4O7XA 2Y26A 3CKHA 1AX0A 3L2HA 4L0PA 3HEIA 1W03A 1FOD2 5FYUA 2HEYF 4LT5A 2MEV2 2H0VA 2B42B 2CGOA 3ECQA 5JVVA 1DQ1A 1R091 3J7HA 4W6WA 4AAXA 5JIUA 3N7JA 2PHDA 4QXBA 1Y4WA 1UF2C 3FHIB 4AOCA 2BZDA 2FMDA 2Y6JA 1RJ8A 1RUOA 1T2XA 5E88A 2K9ZA 3U07A 1H2NA 2YFUA 3JD72 1DU3D 3NKGA 4CCDA 1QF3A 4B7KA 4E4HA 4DZGA 1UYPA 2OUHA 2ZGRA 1AJOA 2IUWA 4C8DA 5T5OA 3ZYIB 2P3IA 2VMFA 2XJTA 2XJPA 2VNRA 2YBKA 2J7MA 2XB6C 3TEYA 4E4SA 4FTEA 3S7EA 3R6SA 4AHYA 4QD2A 5JUVA 1VAMA 2D6NA 5FZ0A 3I2GA 1PIV2 3ZIXA 1YQ5A 1VAKA 3POJA 3WW3A 1HB1A 2VBBA 4QX1A 2Z69A 4QQHA 3FFZA 4FFHA 3ZIWA 2WFF2 4JCKA 3B00A 3DPRB 4HANA 5I0TA 4ASKA 5IVJA 2X29A 3GF6A 3HWJA 4FI9A 4M3CE 1D0GA 2Q8OA 2ORZA 1NY72 5ABJB 4IEPA 5CB7A 1UU4A 4FOQA 1K5MB 5KHKA 1IPSA 3OF1A 2BGOA 3WHUA 1ENRA 3B9IA 1YIPA 2IXCA 2WA4A 4HMZA 4AVVA 1MQTA 1RUJ2 3CU7A 2UY9A 3QH7A 4XW3A 5DN2A 3VDDC 1W8WA 1GLHA 5FWJA 4NR1A 2WYFA 3HBZA 3ZOIA 2R073 2BNOA 2VXRA 4RGAA 5FZ1A 1ZA7A 2DUOA 2XVKA 3MLLA 1COV3 1BEV1 3N9MA 1UL9A 4KGGA 2Q1FA 4AEDB 1PNGA 4W50A 1CZVA 2CYFA 1DP0A 2N7GA 2ZHKA 4B8EA 4KQ7A 3ORJA 1GICA 1RUF3 2G4IA 1VRH3 3H9AA 4CVUA 2ILMA 1SEFA 3C7EA 4OUSA 3DN7A 2WS91 2Q5TA 1UZWA 1YEWA 2YGLA 4XEZA 1AR91 3HBKA 3ZSEA 2RR13 4Y1YA 5EJ3A 3VKOA 3LEKA 2PELA 3H42B 5I8SA 2PLV2 3FN9A 1DLLA 2FDGA 1LHOA 3WQ1A 1X50A 2MNGA 1CAUB 4IETA 4JRAA 3W9AA 4X6RB 3RYPA 1EAH3 4QKNA 2VW0A 5BNOB 3HN3A 1L7QA 1OQ1A 4PIZA 2WABA 2JG9B 4IEVA 4AQ2A 1IS4A 4XF4A 2R49A 1FATA 1OFSA 1XYPA 4HLTA 2C9AA 4AEJA 1UY3A 1JZ3A 1W06A 2LROA 5J37A 5GZGA 5JPMB 4BIFA 1NA1C 2VZOA 5L36A 4LHNA 2XJVA 1OVSA 1QU0A 1G7YA 4R4ZA 1EYBA 3ILFA 3HPNA 3VB9A 2R30A 4TXWA 3SH5A 4Z2WA 4RA0A 5CAZA 2RS51 3FHQA 3ZYFA 3N9QA 3VV1A 3POEA 1P8JA 5FMCA 5DXDA 5I8YA 4QDRA 1AHSA 1UZVA 4LULA 4NHKA 2W1QA 4NIAA 3QCWA 1RUI1 3RJRA 3PTYA 4DB5A 1LESA 4Q0UA 4FTSA 4Q2FA 1RIRA 1UNBA 4CPBD 3CF6E 4COVA 4N43C 3O1RA 2HWC1 2OVUA 3EHKA 5FZAA 3W21A 5C8CA 4RR3C 1US3A 2R061 4UFLA 5FYHA 5D2AA 1RXGA 2PAKA 3RWNA 4FO9A 1LHWA 5D1IA 5KR7A 4WZFA 3BGAA 1V6IA 2XL9A 2ATFA 2OXBA 2ZEWA 2DV9A 4ARYA 2HWF1 2WN3A 2ZOEB 2WZR3 5FZDA 4DXRA 1W6QB 5F6KA 5IYYA 2XBO1 3EJKA 5ANQA 4W6YA 2EA7A 2RS13 3L9JT 1XE8A 4RS5A 2IFWA 3LDKA 3WF1A 1HXS3 1UMIA 3ZXJA 4B1MA 2PMWB 4FQZA 3QOPA 2ZAHA 4HPKA 4QPGA 5FJKA 2W39A 4ZZ5A 1OA3A 1MS3A 2PHRA 1WMEA 3N36A 1CX1A 4J25A 4MSVA 2UYAA 5DG1A 4KL1A 4N7IA 4QX7A 2OZ6A 1I9RA 2QKDA 1UZYA 3R05A 4JTOA 1ZA4A 2IXKA 2MPFA 1QIQA 3POGA 4FQ4A 4RN5A 3ZFFB 4AGVA 1RUG1 2PAEA 3PL0A 5DZFA 3VBUC 2QQJA 3FUOA 1UYXA 1RINA 3CNAA 1HRI2 3M70A 3VLBB 5HV0A 1CQ9A 2DVAA 1RUE3 2EXJA 1WUVA 2WBKA 3KF3A 3MW3A 3WNNA 4WV8A 2R7EB 3ZSLA 1VALA 3M3CA 4OVEA 3VZLA 2RE9A 3UL2A 4N7UA 1G86A 1HRI1 1OXCA 1YI9A 1C1LA 1YJLA 4MGSA 1QXPA 4UW6A 4FXKB 3THDA 3FUQA 4DO0A 2VMGA 3N7KA 2EVXA 2WUHA 1W6PB 1BQPA 5L7OB 2C5DA 1SZBA 1AYM2 1U5YA 2WNVC 1WW4A 4IQPA 4BE3A 2BGCA 3J26N 4LIUA 4QKFA 4RS5B 3GDBA 1JYVA 3B5LB 2VG9A 4EN7B 4DMIA 4MGKE 3RZJA 4NVPA 1PK6A 2J1VA 5F2WA 1TMF1 2VD7A 4AQ6A 4LBQD 1LGNA 5FMOL 3F2ZA 1STMA 5LWBA 4QM9A 2IZWA 2C24A 1VBD1 3APBA 3NV3A 3O1SA 1D0HA 4LE4A 2VU9A 1NCRA 1R1A3 1FPN3 3OTFA 4OMDA 3LGRA 2DBNA 2PN5A 4GA9A 5IWFA 4O61A 1NXD1 2BUKA 5FREA 2FCVA 4CDQC 2GN7A 3S6PA 4PLOA 5IW0A 3W5MA 3OSDA 1GP4A 3P1IA 4H14A 1PGW1 4HKWA 2D3PA 3K77A 3VBOB 5A3TA 5C4WC 1REFA 2SBAA 1AR72 2W0XA 4IW3A 4YG3A 1FMD2 3S7IA 2XL7A 2WNVA 3AXEA 4FFIA 5FYVA 3A0NA 2JDAA 1FYUA 4QX8A 2Q1ZB 4NIIA 5JOYA 4PQQA 2D6KA 1A6CA 2PYTA 5GLUA 5FZ6A 2BDRA 3ACIA 1WW5A 4GWIA 3AB0A 5DDJ1 1JN2P 1D2QA 2Q0AA 4AL9A 3WQ0A 3OGSA 5FPZA 1W6OB 4JC1A 3Q8AA 3LPFA 2FBEA 4HT1T 2JDZA 2VUJA 1LOCA 1FX5A 1W8OA 3RZZA 4BOWA 4Z2AA 1PVC2 1KEXA 4ZS2A 1LJ7A 4MH0E 3WUDA 3KQ4B 2AEZA 2AZ5A 5KXBA 2IVJA 4Q4X1 1MR5A 5CFDB 1NCQC 1O7FA 2OPWA 3MIBA 5JCTA 2BWCA 1ENSA 1NCRB 4DY3A 1CVNA 2VMDA 2VW2A 4XFHA 1X82A 4JV4A 1GQHA 2VCAA 3H1WA 1E5RA 4YM3A 3PVNA 5F7UA 2XUMA 4AFDA 1V00A 2GZWA 1E5HA 2WL1A 4NUBA 1WLCA 5FK8A 1DHKB 3AKQA 3N7MA 3WDUA 5EIYB 2RR11 1TMF3 1BK1A 4XJWA 3ON7A 1YO8A 3WINE 2JICA 1A8MA 1PM4A 3MW4A 4XUPA 1GYKA 4Y26A 5T5LA 3ZN6B 4AK3A 4E2QA 4I2OA 2DFBA 1QJEA 1JZ7A 2CWMA 2VOTA 5A6YA 2HWD1 4NAMA 1WKYA 3OD0A 5A7SA 4M0HA 1RMU3 1PX4A 1FNYA 4CDXA 4KG0A 1CJPA 1RITA 3HT2A 4G9SB 3ZXAC 2UU8A 2E32A 2ZHLA 2ZKNA 4NHMA 3WQBA 1AXKA 2X5IC 3E1F1 2D3RA 1SDWA 3TEWA 2W91A 5IK7A 5A7NA 2IC1A 3AKRA 3V64A 4URAA 3JU9A 3KCYA 4LBLA 4ASLA 2VPVA 2JG8C 3ACLA 1KD7A 4FOYA 5IVBA 1UXXX 1IPKA 2D6OX 3O14A 1APNA 4B4RA 1N3PA 3FLPA 2PLV3 2YPDA 4HN0A 3FWEA 2G9ZA 1G9AA 3I59A 1RB8G 4JHZA 1LOGA 3RZMA 1U0AA 1UOFA 1YNAA 3MEPA 5LBBA 2OA2A 2P5BA 3KVAA 5A3OA 1HKDA 1UMHA 1WBFA 2AACA 3IAPA 2WO2A 3ZXDA 5T3NA 2VUCA 2Y8KA 1HQWA 4AFBA 2YDEA 1C4RA 2P34A 2Y34A 1M4WA 2JDHA 5CVRA 4C1WA 5IAVA 3NNJA 2YGMA 3GALA 1X9TA 1MEC2 5C3RA 1LOAA 1QMJA 5EQUA 3POSA 5FP7A 4Q4V3 2DWRA 1MS8A 3O1OA 4LBMA 4FPFA 1K45A 1OOPB 1PIV1 5JR7B 2ZEZA 1RUH1 4EWDA 5LK7B 3I2OA 5IK4A 3VKFC 3VD9A 1ND2C 2DVBA 2WS93 2JG9A 2YROA 3I2DA 4P00B 4V2VA 4XQ4A 4BMBA 1RGSA 1Q3EA 1YI7A 2BGPA 2XMLA 1AR63 4CUBA 1AR71 1IKPA 1W6NB 3K2OA 2Y64A 3KV5A 2OIIA 2CDPA 4DRVA 1IS3A 1W2OA 1SMVA 1BKZA 2R16A 1AYM3 4OHWA 1DDLA 1L3JA 3EXUA 3FE5A 1W9WA 3B9CA 4XFCA 3VDDA 1SLLA 2CNAA 2WZR2 2YC2A 4MXVA 4NE9A 5DZGA 1N47A 3WG3A 4QPWA 4HOOA 1S0GA 4EN9B 1WLTA 5I93A 5FZFA 4AQTA 5FZKA 3M3QA 5C6CA 2Z42A 2QE3A 1QEXA 1R1A1 4UFHA 4XXAA 1W8FA 5ACA1 2DF7A 3B94A 5CKQA 2BJSA 4META 2JEMA 3N9NA 4CA9A 4QPIC 4CDUC 2BOJA 5KC6A 1AX2A 1DG6A 1MZFA 1FOD3 4XJZA 3SNMA 1PX3A 1OURA 1VBE2 3AK0A 1OVPA 4OLLA 2VH9A 2D44A 5FZOA 1W6NA 3A0KA 4CU7A 1M06G 1ULGA 2FMYA 4IXLA 4PCRA 2WAAA 5FO7B 2BV4A 4NO4A 3ZFGA 2AH2A 4RHV2 3LOBA 2VMHA 2OT7A 3X29B 4XBNA 4COUA 1YXWA 4YM0A 5FLJA 3T4VA 1JYXA 4HVRA 1G9BA 3OUIA 1OPMA 2Q4SA 3HQXA 3QBQA 1C8M1 4GMP3 3RYKA 3TB0A 1O8PA 3GYDA 3LEGA 3LZZA 4NPRA 2XQRA 5JIAA 2TEPA 1GKBA 5I91A 1GNHA 3RZKA 4LUMA 4ET7A 3OPZA 1NAEA 5FKCA 2VECA 4JGYA 2GAUA 4IEYA 4M4PA 1C8NA 4A6OA 1K42A 4UWDA 1YQ8A 1HIXA 1ZRIA 4YVSC 2OKXA 1H0BA 2O8OA 2YPJA 4XDQA 1RUI2 4LHKA 4AEMA 4IV1B 4DRRA 5CFCB 2P6HA 2W68A 2WQ8A 3A4UA 1CAUA 4JGZB 4XACA 4A3XA 1W9FA 2LS6A 1ND3C 4R52A 4PT6A 2HWB1 4BH9A 3GHNA 2WR9A 3H3UA 2NMNA 2JG9C 1W6PA 4H2AA 4LKSA 3ES1A 4BU2A 4ATFA 1GZWB 5DAXA 1UY2A 3I2KA 4AYUA 2BNNA 2C26A 2FZ2A 1FV2A 1YWKA 1AL22 2VO5A 3A22A 4GZ9A 5GZEA 1HQLA 1W39A 3MIHA 4AI2A 1EV13 2DYCA 3OCPA 5FUIA 3E6DA 1J3PA 5CBLA 2Z4FA 2VMCA 2GC2A 2O1QA 4OMCA 4PF5A 1HB4A 4PLNA 4V1PA 4I30A 1RUD2 4AEDC 3LFIA 2GALA 3NWKA 2FZ1A 2WSVA 4GAZA 2AYHA 4AZZA 1QDCA 2KA3A 2YYOA 2DTYA 1AJKA 2VQUA 3CJIC 4MUVA 3UKTA 3VBSB 2XHNA 5JSOA 1JZ2A 3O5SA 4YM1A 4XAAA 1QJX2 1Q56A 1JUHA 5EXOA 1B35B 5GLVA 3OBTA 3VHPA 5DPNA 5C8CB 4FPCA 2X53S 5CFCA 5EYXA 3I4IA 1GZTA 3NV2A 1BEV3 5DDJ3 5J96B 1VRH2 2X09A 3NV1A 1ND2B 2VNOA 4XCBA 1QJX1 5JXIA 3WF2A 3LIGA 1JXNA 4XUTA 3GBFA 1HV1A 2VNVA 4YYOA 1O3QA 5EJZB 3K51A 1LU2A 1Y9MA 1L7LA 2WFF1 2X10A 3ZFFC 4BQ2A 1PGW2 1NYWA 5FY4A 4C90A 1LECA 3HVDA 4OHYA 4I3PA 1QXJA 1ZBE3 2G1MA 1UPIA 2QBXA 3LA2A 3OPTA 3LPGA 1CJDA 4HN1A 4EJRA 5T5JA 3NJYA 4TYSA 1C1FA 5K0UB 2QZ2A 3S5QA 4LBOA 4P9XA 3A7QA 2FDHA 4GKXA 2ET7A 5FPUA 2VL4A 5FZ4A 4Q4W3 3C7OA 4FPLA 4Q5OA 5K7PA 3FX3A 3CMGA 3A23A 4Q4W1 5FTTC 1VBA3 5G04L 1TME1 5BNNA 4XC9A 4JDMA 4FOVA 5H9QA 5TSWA 1O3SA 1IS6A 2WZ8A 1VBA2 3NAPA 2P3JA 1VBC3 3D0SA 4MGYE 4M01A 1SBDA 1XYOA 1VBE1 1LEDA 4E4DX 1W2AX 3GCXA 4Q4X3 4K9SA 5JPNB 4LO7A 4CDWB 2A3WA 4UW3A 1H6YA 4XJAA 3VN4A 1Y9GA 4FPHA 4XBQA 2E26A 5JLVA 1UKRA 1V9U2 2QQWA 3T2PA 3ZN6A 1WMFA 1ZX5A 4INDA 4N9HA 1GQPA 3SKJE 4LLFA 3FJSA 1O4YA 5L19A 5EZWA 4CXXA 4MYEA 1SQ4A 3VZJA 1XPWA 2UY8A 1ULCA 1W9SA 1EPZA 2GC0A 3CJXA 3SEPA 5L9BA 2LM3A 5AC91 4WVZA 1T6GC 5K9YA 4GIQA 1F5JA 3MFCA 4QPYA 4BPZA 4X8NA 5DUUA 1LTEA 1W6MA 1DQ4A 3SITA 3WF0A 4WM7B 1OLME 2W87A 4Y1VA 5AC92 3LWCA 2VMIA 1JYIA 3OYWB 1QJY1 2R0FA 3HQUA 5FZEA 3E6CC 1MVEA 1DGWX 2XLGA 3MW2A 4BB3A 4W8JA 4YZ5A 3MICA 4K7JA 4WM8A 3KWVA 4MXWB 2WT1A 2ZGPA 2F6BA 2VCCA 1XJAA 2ZMNA 4B7EA 2PA7A 3J4UH 5F5CA 3U4XA 4YZ1A 4EYUA 3NMBA 3AYCA 4XXPA 3MV11 3H1MA 4IDZA 1GV9A 3GGLA 1YQ6A 2WQZC 3ILRA 2Q8DA 1XNAA 2ZTNA 1JTZX 3B01A 5FKBA 3NQHA 3E5QA 1NQJA 4QXKA 4BXFA 2ZGNA 1H30A 4BLJA 1POV1 2X8KA 2ZA9A 4AFCA 5A6ZA 1MZEA 2HWC3 3DF0A 1POV3 3LQCA 2VZUA 4ONUA 4XF0A 1CAVA 2QCSB 1VJ2A 1BYHA 1OA2A 2ZGLA 4IE6A 4L11A 4MX3A 3ZYPA 1GUIA 5J48A 2ZGTA 3HD8B 1JZ5A 2JB8A 5CKNA 3I8TA 1MS9A 1OI6A 3J8F2 1Y7BA 2VJXA 3MIDA 1IZ3A 3HN1A 4UBGA 2YMZA 1CIYA 3O0VA 2E7AA 4IGOA 5BY5A 1PVXA 1OD5A 1YFWA 5A80A 4ZU7A 1O3RA 4GB33 2B7YA 4KBZA 2DCJA 2VTFA 2FDFA 4HXCA 5GZFA 3SCFA 2NPIA 1S2KA 1HXS1 3ZFEC 4DUXA 3AKTA 2JD9A 3RI8A 3I3QA 4AWDA 4ARXA 2VC9A 5EV7A 5FRAA 5LATA 4XCAA 1ZREA 1YC61 3K75B 3IDEA 3JZVA 4CEWA 2WRAA 3ZDSA 3EO6A 1E5SA 2B45X 1OLMA 2R041 4GH4C 4LTAA 4NPLA 5HCAA 3AJZA 1OFNA 4MO3M 5GZCA 2A1XA 1UY1A 4N53B 2WLQA 1ZZBA 2XG3A 3EQEA 1AF9A 2ZGSA 4QKDA 4FT8A 1W0NA 1X36A 3ZXKA 3AJYA 3ACGA 3KF5A 1XSQA 2C6SA 2GC1A 4BM8A 5KXEA 3ME2A 2FDKA 4G4FA 2G9GA 3NVCA 2QQMA 2ZS6B 1Y3TA 3JBG2 4PBPA 1MS4A 1ZZCA 1PVC3 5EJ1B 4FAHA 2A6ZA 4DXTA 3WNMA 1I6XA 3NL1A 3ES4A 4CEYA 1BZWA 1TG7A 3ELNA 4FPJA 4XVHA 3RYRA 1UO9A 4MGZE 4OI0A 3HJRA 4E8DA 3T2OA 1R081 2BFUS 1XSRA 4RSUA 3J8F3 5FP9A 2B46X 3UESA 4XURA 2WT0A 4CEYC 5L73A 1XQNA 4AI8A 4HK9A 4Q26A 3PIGA 4LA3A 3N35A 3GM8A 4LNVA 5FWEA 4GD4A 4XYXA 1R082 4RQPA 5IUQA 1V70A 1QQP2 3KVBA 3NO8A 1CWPA 2E63A 3TNPB 4DPNA 1D4M3 2GSYA 3IZOA 1JZ4A 5L7OA 1W3XA 3KQRA 4H7LA 4IL7A 3U14A 2CWSA 1EV11 2A3YA 1OBNA 3ZMNA 4AHZA 1LOFC 5LEKA 1HV0A 3UKNA 1HQNA 2XLFA 5A32A 2DURA 3TOJA 2NQYA 1TME2 3U10A 2ERFA 4CCEA 4Y3OA 3EB7A 3ASIA 3VKMA 1A34A 5FY1A 3BPZA 2QZ3A 5ABJA 1ZZ8A 4DUWA 3NV4A 2I2SA 4L8QA 4IV3C 3ETQA 3ZFEA 1D4M1 2I45A 1WW7A 4QXCA 2ARBA 3T0BA 5KXCA 2HWE1 3NKTA 4CP9A 2XBO3 2WWSA 4BK5A 4YVSB 1VRBA 4YGBA 4CCCA 4FTBA 2ETEA 3ZKYA 1CX4A 3I3MA 3ACFA 3U11A 1WZXA 2Z2SB 3AKPA 4D6RA 2HWB2 1LHUA 2ZMLA 1XU2A 4UBHA 4FP2A 4RQPB 1QDOA 2E7QA 4XABA 5FY7A 4NWWA 2QQLA 4KBBA 1FXZA 1W6QA 4JDNA 1FV3A 5ANNA 4LBQA 3WR0A 5CISA 5SV8A 1C5HA 2GP5A 4D94A 3IIAA 1UMZA 5FFOC 1W6OA 1YFUA 2EIGA 5E6HA 1V0AA 3LEMA 3OGGA 5T55A 2VM9A 4K1ZA 2CHHA 2RS12 3KSCA 4UF0B 1HX6A 3ZN5A 2HEWF 5FZIA 2YZ4A 2XQXA 3ST7A 3LDRA 2IXJA 1HN0A 3KD4A 1O8SA 1Q5OA 3MDPA 3Q8EA 4TWTA 2X05A 1MQTC 3E5UA 1UCXA 4ZS3A 1WLWA 1PZ8A 1XNDA 3OBZA 3R4SA 5FK7A 3RPQA 3WNKA 1G9DA 2PHWA 2KXLA 3IDBB 2WYSA 2DFCA 5LA2A 4AI3A 3R0RA 2ORXA 2VZQA 1VLNA 5LA0A 2BQPA 3KMHA 3W5NA 1WA4A 1ULEA 2WDBA 2VGDA 4XHXA 5L9RA 4YVSA 2WNEA 2BBAA 4FSJA 1CAWB 1OUSA 1QJZA 1YFYA 2BVBA 4GKYA 3VBUB 5C9AA 4JGZC 3CDZB 4H7MA 5HCFA 1PO12 1J1TA 5FP4A 1UY4A 2VOVA 1KXGA 4XF1A 2W95A 3N9OA 5FUPA 3POWA 2G9FA 1GZ9A 1PO13 1ZBE2 4COZA 4N9IA 5LASA 2XJUA 2RVAA 4RD7A 1DLCA 1RUF2 4E4ZA 3V0AA 2J1EA 5GLWA 2G19A 4MHRA 4YG0A 1J83A 3WHTA 5KHJA 4LMFA 5T52A 3BTYA 3MYXA 4ASMB 1DQ6A 1RUF1 3T3YA 4XFIA 3KGLA 4BYYA 3I2IA 1YFXA 4CP2A 1JH5A 5A3LA 3MBWA 4YZ2A 4QB6A 2VZPA 2VZ1A 4IEWA 5FYBA 2VBPA 3ZYJB 3O1TA 2RS32 1PZ7A 3AM2A 3K4ZA 3LCPA 1BHGA 1C5IA 4OULA 4Q0SA 4Y24A 1LOEA 3IB3A 1W9TA 1LGCA 1OH3A 4Y4RA 4CUGA 3KV6A 5AVPA 2JDYA 2YU1A 1X7NA 3I59B 4CPBA 2CTVA 2EALA 3C7GA 5LZ6A 4TLGA 3FBMA 1XBFA 5GLZA 4BQXA 1UU5A 4IEUA 3T1MA 2VVDA 5C4WB 3OBAA 2Y60A 4IEQA 2B5HA 1GR3A 3KB5A 4KU8A 4URTA 4AHWA 4P9LA 1XNCA 3FHAA 5F3IA 1J58A 5F5AA 4MXWA 1AX1A 3VBFB 3ZFFA 4I02A 1FI2A 2W08A 4IESA 2VR4A 3H8RA 1KFXL 4NAOA 1NUKA 4XJ9A 1VR3A 4Q0PA 5C3QA 3V0BB 2KR2A 3CJIB 1D4M2 1HLCA 2RM21 4EV0A 2RS52 5FXXA 4QQ2A 3TYJA 5JZGC 2EXIA 4M0NA 1DGWA 1RUI3 3BB6A 3WG2A 1EAH2 1OPOA 5A1FA 2ET1A 1CONA 2WFPA 1C8M3 5JSPA 4W65A 2E7TA 1AYN2 1K3IA 1H1IA 2DUQA 3WG4A 4D7TA 2Y0OA 5CNAA 3NNGA 2R1BA 5DG2A 3MIFA 4KU7A 2B9VA 1G6NA 1UD1A 3H50A 1YRZA 4FPGA 1OC1A 2ZZJA 3GZEA 3HOBA 1U5IA 3LSEA 4FXGB 2PHUA 4AEDA 5I8TA 4PBOA 3DL3A 4M00A 2CL2A 4XFFA 4E27A 4K20A 5JZGA 5KBFA 1OLQA 2DVFA 4MV2A 4AG4A 2BWAA 4L99A 5GLTA 4A3ZA 1RJ7A 5ABJC 4ZY9A 2VBDA 1ALYA 4K6BA 1K5MC 1OA4A 2AENA 4AR2A 4LOTA 5JDBA 4IV3B 1LNSA 5K4LA 2NZ9A 1N1YA 2EXKA 4Y1XA 3RMXA 1UXZA 1AR83 1SLIA 2RDNA 4DUVA 1C8M2 4OQ8A 5JOWA 3MF6A 4FOWA 1LEMA 5FLIA 2XH6A 5A3NA 4Q29A 2JXAA 2JECA 1J3RA 5FZLA 4A42A 4X8PA 5IJRA 3PMEA 3T4HB 2IXIA 2VZRA 1RHI2 3OG2A 3T30A 5FZOB 4RQPC 2ZX2A 4CU6A 4BIOA 2HEVF 4GMP0 5J1XA 4JGYC 2X5IA 1PZ9A 3OEBA 4XTPA 3I3EA 3CZUA 4AXOA 3KM5A 3OEAA 3WDYA 4CDXC 1QOOA 4C91A 5A7OA 4J1WA 3ZX7A 1VB4A 3AP4A 3IPVB 4FFFA 2GNBA 4XZPA 2UURA 3VBHB 2JE9A 1HB2A 2P3YA 3BYWA 4MVTA 2WZEA 1J59A 1PO23 1V6JA 2GN3A 3MPBA 3UJQA 4RGGA 4XFGA 4WVMB 1R092 4HVQA 5C5TA 1PMJX 4OHZA 2YUEA 2ZEYA 3FFQA 1O91A 2E51A 5BUVA 1KDKA 4L2NA 4PDWA 1CGPA 3ZM8A 1EPWA 1JZ6A 1W28A 2J1UA 3M3EA 5EWSA 3ATGA 5F3GA 3WP3A 5FPXA 1GP5A 1ULFA 2LRPA 2OYZA 1N1SA 3NJVA 1OH4A 1I3HA 2GH2A 3LF7A 5F5QA 1VBD2 2R043 4HBNA 3WEZA 1XB9A 1YCIA 3AFKA 4Y20B 5F5IA 4AF9A 2PTMA 4LXLA 2OW4A 2HWC2 2OUJA 3D5OA 4XOGA 3N4MA 2V09A 5ISLA 3HT1A 1H9PA 4DEVA 3H8OA 1ZBE1 4FP3A 2XVLA 1VP6A 1DQ0A 1VBD3 2R042 2VMEA 2ID4A 5F8PA 1X9PA 3D82A 1QJFA 3HIFA 1UW8A 1WMXA 4W4ZA 5JWPA 3VDDB 1V9U3 3QACA 5JSRA 5GJ6A 3DXTA 3O1MA 3BPSA 2B39A 4MZUA 2UYBA 2D5HA 5LBFA 3WDWA 1LULA 4KWLA 2BNMA 4ISQA 2E6VA 2K46A 2YFZA 4QX0A 2W52A 3TRSB 1XOYA 2YC4A 4CCMA 4CCOA 4F3JA 3BTAA 3V65A 1JW6A 1R093 2V73A 4DY5A 5A7WB 5CADA 1I5PA 1W8UA 2KM2A 2CAVA 4A2UA 4MGIE 5F3CA 1AYN1 4QB2A 1ND2A 1SFNA 1XC6A 4BA6A 3UETA 4AQSA 4LO5B 3AYDA 3DUIA 5D8AB 2AC1A 2JWPA 4RR3B 4CEWB 2YBPA 1LENA 3O7OA 4XQDA 3WP5A 4IUGA 4AVCA 1O4TA 4FPYA 4COYA 3DCQA 1RUJ3 2D6PA 4IERA 2GMPA 3DYMA 4A7YA 4UW5A 1F4AA 4CDQB 4R9BA 5K0UA 2BPA2 1JYCA 3N7LA 3WW2A 4D7SA 3TEZA 4LK7A 5C3SA 1GNZA 1QNWA 1ZNPA 1JU4A 2QQVA 3QLQA 1AYN3 4QM8A 4D7YA 1ASJ2 4K1YA 4XETA 2WNOA 1QOTA 1DQ2A 2GNTA 1XYNA 3PJQA 5B2GB 5BNPA 3K48A 4A44A 3SLIA 1UY0A 1MZ5A 3ZN4A 4DXZA 5L7OC 4OI4A 3WUCA 1IPJA 3VBUA 4CCNA 3OOXA 5M0TA 3PUIA 4Y22A 1TE1B 4XDPA 1SCSA 1O5UA 4ZU4A 2DCKA 4Q4W2 1H6XA 4B4PA 3I54A 2L9LA 1UPSA 3NNLA 4JX0A 2A73B 3UKVA 5DAQA 4A6SA 1W3VA 4AI0A 2WS92 3WNOA 3THTA 1WGPA 4AGGA 1IG0A 1AL23 1Q43A 3WDXA 2HWD3 1WBLA 1GWMA 3GCWA 4QQOA 1LR5A 5KHHA 3ZXGA 4MG2A 4GH4B 1DZRA 4CXWA 5CEHA 4GWMA 2W3JA 2YG0A 3NAPC 2VCMA 3IM0A 4XUNA 4E8CA 1KITA 2BTVC 3SMHA 1PNFA 1CD3G 1DCSA 4JZRA 3VBOC 3VD3A 3ZR5A 1OKOA 5I0SA 3ETPA 3AMQA 3G7DA 2TUNA 5DDJ2 1DZTA 4CXYA 1CESA 5AFEA 3LFMA 1NE4A 1WA6X 3INAA 5BNPB 3VL8A 5HXVA 5HBAA 1J3QA 1YYNA 2XOMA 4PJYA 2VQAA 3MZHA 4Q4V2 3UYJA 3SXWA 3VHOA 1NLRA 1DGLA 4HETA 3WOGA 5FBZA 4FPEA 1V6NA 4IEOA 1VRH1 4S2DA 4AVSA 2NN8A 1K12A 1NCQA 5C33A 3T08A 4UAPA 2PHTA 2ZHNA 3B69A 3BU7A 2D5FA 1RVF2 5L9VA 2WN2A 4QU1A 2NM1A 4WVVA 4ZPIA 5FZMA 3GJBA 5FZCA 2RDSA 4GQ7A 5D8AC 3GZAA 5F2SA 4KWKA 2WA3A 5A3UA 4LPLA 2H6BA 3FLRA 1KDMA 3POFA 2ZX1A 1Z7S2 1COV1 1SBEA 3PIJA 1AL21 2W1UA 2RM23 4Q4Y3 2UWCA 1RC6A 1WW6A 3MO4A 2RR12 1G9CA 2Y0IA 3CJIA 4SBVA 5F6LB 4V2WA 5IT6A 5EYYA 1PK6B 3VGIA 4QT6A 4JKMA 1YLLA 3AC0A 1VBB1 2OS2A 1AR61 3BN6A 4FPKA 4HZFA 1IS5A 5K0UC 4Y1ZA 4ES9A 1W8ZA 2BYVE 3WVJA 4LLOA 1ULDA 2VZTA 3VZKA 1QWRA 3M8LA 5GKAC 4BXSV 4OHXA 1HRV3 3M3OA 4IGQA 4EZHA 1WCUA 4GJYA 5HXMA 2XJQA 4BDVB 2J1AA 2XR4A 1GZWA 1QH6A 2D43A 1NCRC 3DKWA 1CAWA 4B3NA 2DUPA 1VPHA 1H2LA 2J42A 5JZGB 2OQ7A 4EZ4A 4Y5Z0 1IOAA 4PI2A 3W20A 3VZNA 2QJVA 4ITCA 4P9IA 4D6QA 5LEJA 1DGRN 4F83A 1PHMA 3H7JA 1DYOA 3HNBM 1HJFA 2WO3A 1AR82 4JVAA 4Q27A 5DQ0A 4PQ9A 4B1LA 1RUC1 2ZX4A 4QDQA 1ASJ1 2BFUL 2VTXJ 1ENQA 4RFRB 4YVWB 2PHFA 3VZOA 1FMD1 3Q9OA 3ZLIA 2DCZA 4BQ4A 1GWKA 1QH7A 3GJAA 1QJY2 2GDFA 1PM7A 1NXMA 4WM7A 1AR93 2BERA 3IWZA 2C4XA 1N3OA 1VMJA 1KGYA 5HI0A 3P3PA 3HMYA 2Y6GA 3H8UA 1UWWA 4QGNA 5JOXA 3UGHA 1F2NA 3QD6A 3DXUA 1ST8A 2VOKA 2WNUB 3ZPOA 3JCIA 3D0JA 1SG3A 2ZZQA 4N90A 1C57A 4K3UA 4Z07A 3V56A 4BISA 2P1BA 1RUH2 2P6CA 4NIHA 3ZFGC 4KG8A 3OUHA 1DGRA 1GNYA 3MIEA 4HONA 2OQ6A 4XUQA 3VUOA 2ZMKA 3IBMA 5T5PA 4NMIA 4XJ8A 1UIKA 5T54A 5JMOA 5ERLA 5FYIA 4MLOA 1O5LA 2XKPA 3EYPA 1FOD1 5LRRA 3WCRA 2R1DA 1OSGA 1ZRFA 1AZDA 1QQP3 4PDWC 4QQPA 4XJUA 4DEQA 3U75A 3PURA 4RHV1 1IQAA 3IDCB 2D7FA 2WQ4A 2GU9A 3BIEA 4AEKA 5A32B 3RWKX 1LGBA 4YPJA 1RTVA 3VHNA 3VBFA 1VIWB 4ISRA 5F32A 2XXZA 3NAPB 4CDXB 2WZR1 4YVWA 4EROA 3C3VA 4O65A 1W2TA 3OGJA 3V0BA 2A6VA 3M1HA 4LHLA 5J09A 3U1XA 4ZONA 2LALA 2ZCWA 5G05L 4C0BA 1KJLA 4Q1RA 3RJ2X 1W2UA 3PUAA 3RZLA 3DKQA 3PLQA 1KRIA 1TEIA 1GBGA 4PIXA 4LKEA 4TTGA 4FAGA 3WDVA 1Z0HA 3RI9A 1OMIA 5C8CC 1K5JA 4NHXA 5IAXA 4XUOA 1GANA 1U5XA 3T1LA 5LW9A 3UV9A 2O14A 4XTMA 1HXS2 2ARXA 5ACA2 3I3BA 2GP3A 1UZZA 1WD4A 2JG8B 1HRI3 3LE0A 3TN92 2R062 5IFTA 2ZX0A 4AE2A 1CAXB 1LRHA 1IKQA 1R083 1U5ZA 2F17A 1XE0A 1COV2 1LKNA 4COWA 3AVSA 5CFCC 5C3PA 5BV6A 2HWE2 2JKXA 2E33A 4DFSA 3USSA 3OGVA 1N1TA 4ZXEA 2JDPA 4BQ3A 4UFIA 1S0BA 4JGYB 4Z8BA 3T0DA 1BVP1 1BXHA 4UT5A 4KGQA 4UF0A 3U0ZA 4HKOA 2XHKA 1PGL2 1IHMA 4KWUA 3FLTA 4YVWC 4WVWA 4XZUG 1H9WA 2EICA 3CZJA 3GBGA 4S2HA 4WM8C 3ZYGA 1JYTA 1TMF2 4OUMA 4YW6A 5JXJA 5FJHA 1W05A 1BEV2 2D98A 1XRUA 2J22A 2H6CA 2YV8A 2D6MA 2ZEXA 4NWVA 4R9AA 4GWJA 2W94A 3S5AA 3E5XA 3K4DA 3DPRC 4E2SA 4XE9A 5FO8B 1OD3A 4FBFA 1S0IA 2P17A 1VAVA 3DGTA 4B4QA 4XPVA 1ND3A 4I0AA 5IK5A 2J1RA 2PLV1 3AZYA 4Q0VA 3WF4A 3K3OA 3RGBA 1V6KA 4P08A 5H9PA 4U36A 2J1SA 1TQ5A 3SKVA 2YBSA 4QHOA 1EV12 2IXLA 1NY71 2NLRA 3WP4A 3N3HA 3DYOA 3T0AA 4H55A 1HDKA 3G6JB 4NHYA 2F4LA 2E53A 1NE6A 4WM7C 4EN0A 1MS1A 5DAPA 4UW4A 5FZ3A 3N9LA 1D2SA 1HRV2 2W47A 4XIKA 1RXFA 4S2GA 2MEV3 5CA6A 3WZ1A 1ENXA 3BIWE 4CU8A 3WF3A 4J6GA 4FFGA 1EY2A 3E6BA 3ZDVA 4UXAA 3SCGA 4GALA 5A3PA 2Q30A 4M3CF 3C7FA 2BRTA 2H0BA 1Q8SA 3VD5A 2DVDA 3ZFEB 1H4HA 4AW7A 4AVTA 2D3SA 2VZ3A 4LOSA 2HYXA 1NZCA 3OUJA 4QGMA 2XKOA 2WJSA 3JQWA 4OYUA 3OD4A 2LW8A 2QQKA 1Q8OA 1FT9A 1DYPA 2FQPA 1NT0A 3ITQA 4CP9B 1J84A 1VMHA 3ZFGB 1G8WA 2WWUA 2XVGA 4MOAA 3VBSC 1LHNA 3OJBA 4QPIA 2W1WA 3WQ7A 2ZGOA 3AP5A 1C3HA 3K3NA 5IFPA 3URFA 3AP7A 2D93A 3POYA 4RYDA 4EE2A 5BNNB 2BBVA 1ZYBA 2ZABA 3WW1A 2HWF2 3KT1A 5C70A 3WG1A 4XAEA 2RMU2 5HPOA 2YY1A 3CIHA 5FAXA 5EHDA 1SDDB 5LBEA 2QVSB 1SLBA 4YW3A 5CU1A 5I0DA 3KHCA 3GZTB 1S4CA 4A4AA 1PVC1 1Y9QA 2PAMA 2WNVB 1ONAA 4JGZA 4JQTA 4OQ9A 3UK9A 5C9AC 4DXSA 3ILNA 2AUYA 4QAWA 5CIRA 1MVQA 3RFRA 4DNYA 4Q4V1 5D8AA 2W9XA 4P9JA 5FZBA 2D6LX 2IVIB 4ZKTB 2R072 3VBRB 1JMUB 5LBCA 3UGFA 4CCJA 5BNQA 3D4KA 4LUKA 3ALQA 4QMAA 5CG9A 3FMGA 3GXUA 1H2MA 1SFYA 2Y6FA 3PVEA 5B4XA 5EFUA 5JI9A 1V6LA 4CDQA 5FBJA 4QPGB 5FY9A 2A3XA 5CKMA 2ZGUA 2A6XA 2FCUA 1GOHA 2ZJCA 1BBT1 4XMIA 4YW4A 5FYTA 4N53C 5IVEA 4AI9A 2RDRA 2CSGA 5LY1A 3VKNA 5LA1A 1SPPA 2W92A 4FPOB 3AYAA 3W59A 5FZHA 3VDBA 4YGEA 4YFZA 1W04A 2VULA 4QU2A 3CBNA 5FPAA 5EPAA 2RS11 1RUE2 3BCWA 1QNYA 2TBVA 5BNOC 3KV4A 2JIJA 3AZZA 3PUQA 2VOXA 2YHJA 3FZ3A 3U4SA 2WNUC 3MI8A 5DUXA 4BLIA 2B8MA 2QDNA 2YXSA 1POQA 3WV6A 2P4EA 1UIJA 2PQQA 1AVBA 3AKSA 5DAWA 4LHSA 4Q4Y2 4CE8A 2VQ0A 5FQ0B 2P3KA 5KWRA 1US2A 1QY4A 5F1RA 1ZRCA 5FZ9A 4CUAA 2P37A 1V6MA 4J1XA 5IK8A 2ZPXA 2AREA 1MQTB 3B02A 5A7QA 2YB7A 4ES8A 4Q4Y1 2X5IB 3T2TA 1OLRA 2PHLA 3IAQA 2EXHA 2RV9A 1WCQA 1RUH3 2VUDA 4JQRA 1FMD3 4CP0A 1MEC3 2I74A 4N8MA 3KLSA 4ZHNA 5A33A 1XNBA 1OT5A 1YQ2A 4IE5A 4P9WA 4OCTA 4YARA 3KCXA 2GMEA 5B4NA 3BI3A 4I01A 3BU0A 3RSJA 4XIOA 2MHFA 1AR81 1QXRA 1G9FA 3NNFA 1SPPB 3MV01 1W8TA 5FMOS 1VB2A 3ZVXA 2GH8A 1N3QA 1KS5A 4AVAA 2XDVA 3E97A 2NMOA 4L9BA 1WCDJ 1W99A 5FXZA 3BTZA 5IVYA 2LTNA 4Y4YA 4HK8A 3TAYA 4HL0A 3VBOA 4O9GA 3I97A 1ZBA2 3POIA 1ULOA 5BNOA 5GM0A 5C9AB 3SHRA 2CV6A 1S0DA 1W0OA 3MUZ1 4YG6A 1JHJA 3WD5A 2CGNA 2EAAA 5DUWA 3ZXEA 4PIYA 1OQEA 2DDUA 5FZ7A 5LY2A 4LQRA 3ZXFA 1GU3A 2ZGQA 5FIXA 4EN8B 4N53A 3MUY1 3OY8A 1RMU2 1MS5A 2Y6KA 4MGQA 3J7MA 4XFBA 4XHBA 1IG3A 2WZPP 3VL9A 4ATEA 2JDKA 3LD8A 4GMP1 2EAKA 3UGGA 1OOPA 5A33B 1LAJA 4UI9L 4AI1A 4Z82A 3T2QA 3DECA 1HW5A 1W6MB 4W6XA 1BMV1 1SCRA 1LU1A 3IMMA 4YGCA 1VBE3 3OYWA 3UNPA 3AZWA 5LB6A 4D0QA 3FBYA 2JE7A 1UYZA 1KQRA 1RUC2 1GOGA 4XDOA 4XF9A 1UKGA 1AL0G 1NKGA 4P02B 5FLHA 3AFGA 3POBA 1F15A 4JKKA 4LK6A 3RRDA 3H3ZA 3RVHA 1YQCA 2JIGA 4LIVA 3SEEA 3W58A 3WX5A 5BNPC 2RDQA 3F95A 4R9DA 5J3UA 2GC3A 2HWD2 4YRDA 2QQNA 2ZX3A 1VBC2 2EIBA 3ENRA 4E2GA 4SLIA 5C5UA 4Z1VA 3CO2A 5EP9A 4FCAA 5KHIA 4UFMA 3R4DB 3FC0A 4Y1UA 1BCXA 1F9KA 3CL1A 1NX9A 5FYSA 5FY8A 2JENA 3Q8CA 3IN9A 4LBNA 4K8RB 5C4WA 4Y33A 3BKZA 3M4FA 2EIEA 1OUXA 2RJKA 3PVOA 1XNTA 2ZAAA 5FYCA 3SH4A 2VVEA 3PHMA 2HBUA 4NOTA 4BZ4A 2JD4A 3GNEA 3TEXA 4P9YA 2O0OA 3OBRA 4HVOA 3BOPA 1NZIA 2CAUA 3DEMA 2FD8A 2QFEA 1JU3A 3AZXA 4R9CA 3ZR6A 3USUB 2JB4A 3DYPA 1ZM1A 2VY0A 5DUVA 3BOWA 1CAVB 4PHZA 5CFDA 3RMYA 2ZXQA 3AVRA 1UZ0A 3NJXA 2QQUA 1PK6C 4XF3A 3AZVA 5DZEA 1ZBA3 4KH9A 3ACHA 4WVMA 1CN1A 2FHRA 5AVAA 2VOWA 3IT8A 1EP0A 1O59A 2O8QA 4LBKA 3O1VA 2A7AA 3AMHA 5E1RA 4BQWA 1H1AA 1XE7A 1S2EA 3P3NA 4Q1PA 4QXHA 5KXDA 3ZYHA 3IKWA 3LKJA 3J7LA 1JOBA 1QJX3 2ES3A 2IXHA 2WSUA 2AGSA 5CZKA 4QGLA 3ZYBA 2JDUA 2QQIA 2DBIA 3BALA 4G3YC 5LA9A 4EWEA 3OPWA 1ZZ9A 3NRUA 4N43B 3RQ0A 2A6YA 3AL5A 1S0EA 4A45A 1D4VB 1BBT3 1NOVA 2ADEA 4TSVA 5KHGA 5JMCA 3SISA 1ACCA 1DIWA 3KT7A 2JDMA 2C1FA 2JX9A 2Q8EA 5BXXA 4O9EA 3WLUA 4NIDA 5FY5A 5JXHA 3DPRA 1FNZA 3WT3A 3JD71 3IIIA 4AAPA 2VCBA 4OZOA 4B29A 3BODA 1H2KA 3H3LA 4GULA 3U78A 3JQXA 4E9KA 4IE4A 1K5MA 1F8VA 3AL6A 2HKXA 2I07B 4GWNA 4RS5C 1Q8VA 2R32A
chains in the Genus database with same CATH topology
3VZMA 1LCLA 4LR4A 3RS6A 2PFWA 1WLDA 3PNAA 5E16A 1SLTA 1AYM1 1ZZ6A 3KZ4C 2HWF3 1Z78A 4C1XA 2JJ6A 1REEA 3IPVA 3VBHA 2SLIA 4M3CA 5E8AA 4FVVA 1AUYA 3LAGA 2DVGA 2RS31 4YM2A 3MPPG 2XPJA 5BYNA 1OKQA 4RR3A 3MIGA 3JBG3 4HSJA 1UN1A 4I09A 4N43A 1H8TC 3L2YA 3HAGA 1UAIA 4YSFA 5F9TA 2QNKA 3VKLA 2A70A 3B3QE 1A3KA 3O0WA 1PGSA 3H1YA 2AR6A 2HJIA 3WCSA 5I0RA 5H9RA 4F8AA 1PIV3 1Z7S1 3SH3A 1TNRA 4LO6B 4BWOA 3IMNA 1VBC1 5K8SA 1A8DA 5BPXA 3WP6A 4AGRA 1NA1A 4DQAA 2C0ZA 2RMU3 3LB9A 3VBFC 1H8VA 1EAH1 4AFMA 3WDTA 4GB31 4KWJA 2ZBJA 4ZXKA 3JUUA 2Z5WA 3ZMOA 5GZDA 2HWB3 2NYYA 1POV0 1GZCA 1ZZ7A 4LBQB 4U2AA 2QDRA 3VBHC 1VBB3 4CDWC 4WZCA 1SBFA 4K40A 3VBRC 1JUIA 1O3TA 1BMV2 2A75A 1AR73 2R063 3M2MA 3AX4A 1H1MA 1E57A 1GQGA 1NQDA 4H3WA 2UWAA 2DTWA 3D6EA 5T50A 1PO22 2QUOA 3VHRA 4X6QB 4LO4B 4IEXA 1S0CA 3ZSKA 2GNMA 1DF0A 3RG0A 1YUDA 3MLKA 3JB4C 4CTEA 1RUG2 2GMMA 1Q8QA 4YW1A 1NCQB 1QHDA 1RHI3 2GNDA 5FDBA 2QQPA 3AMNA 1RHI1 3J9SA 3ZPYA 1URXA 2R6QA 1DQ5A 2RJLA 3TN93 3AXDA 2PHXA 2XBO2 2HYKA 4YGDA 4F7ZA 4AVBA 3EBRA 3AMMA 1B35A 4L92A 1ZVFA 2TNFA 4LE3A 4Y22B 1CR7A 5GALA 3ROUA 4HFSA 2EF6A 3DV8A 4I3GA 4LA2A 4R4XA 3AP9A 3J8F1 1AXZA 5J7MA 1RUG3 3UJOA 5CFDC 1RUD1 4YZ3A 2K0GA 3VBRA 3TNQA 2IWGB 1ZBA1 5LRSA 3SCHA 4XQWA 4BQ1A 1JOJA 4YW5A 1TNFA 3KT4A 4CDUA 5H9SA 2Z79A 2WC2A 1O4ZA 1CIWA 2HWE3 1KJRA 1RUC3 1V6OA 2JKBA 2D40A 4OI1A 1FPN1 1S55A 2Y38A 3KS7A 1F31A 5KC5A 2R0HA 3WW4A 3NW4A 5LK5A 2IFRA 3JD73 3TN91 1Q8PA 1QKQA 3ZO0B 2XWJB 1QOSA 2NP0A 1RUNA 1YIFA 1C28A 5C8WA 3KCCA 4NHLA 1X8EA 2UWBA 4YFWA 4ORFA 5JAXA 1QJY3 4D3WA 2WIIB 2WFF3 1PGL1 3O0XA 1B09A 1MZ6A 1NLSA 1OOPC 1H8TA 3ZYRA 1X8MA 2A5ZA 4JTNA 4CDUB 3USUA 1YHFA 3H0OA 1PMIA 4CRQA 1FAYA 4Q8KA 3LOIA 3GBWA 1JHNA 1KFUL 4I0WB 1RMU1 4CEYB 2XWBB 1W0PA 3CEWA 2BVVA 3ZSMA 3HR9A 1SACA 2DU1A 4IV3A 4CP1A 1LB2A 1TME3 1BJQA 1AXYA 5SV5A 4IV1A 2P2KA 3RDIA 5A3MA 1N1VA 4AHXA 1QJU2 3KGZA 1SLCA 4OHVA 2RMU1 4OFGA 3I7DA 1ZRRA 4CZSA 1LOFA 1RL3A 1OQDA 4Q0QA 2K2SA 4EN6B 1S2BA 3AMPA 3OY8B 3M3IA 1VBA1 4IV1C 3WXPA 1REDA 1WCSA 1Z7S3 1H8TB 2JG8A 3ZSJA 1H4GA 4QPIB 4XMAA 1IGOA 1CAXA 1BVVA 1MS0A 4S2FA 1R1A2 4QX5A 4RFT0 2R071 1SLAA 3WNXA 2DCTA 3R4UA 4RL7A 1DZQA 3GHMA 4PLMA 2Q1MA 1YJKA 4YLZA 4JRLA 4PDWB 1CPNA 1BBT2 3O12A 5I0UA 2F4PA 3S30A 1RVF3 2D97A 5JOZA 2ENRA 3B7MA 2ZHMA 4LBJA 4M3CB 4CYDA 2CY6A 2RS53 3RNSA 3LA3A 4DS0A 4Y20A 3NJZA 4LEJA 2BEOA 4XFAA 1ASJ3 1QGLA 1QJU3 4GH4A 1LOBA 2CGPA 1FPN2 4CEWC 4QHBA 1S0FA 2OPKA 4P5HA 1ND3B 1I1EA 3B93A 1UU6A 3LA7A 1MACA 4HSLA 4YNIA 1NG0A 1RVF1 3C2UA 4Z92B 4TLFA 1GSLA 4Q8LA 3JB8A 1ZRDA 1R1ZA 2ZGMA 2YC0A 2ZGKA 1HRV1 4A7KA 3MF9A 2LUWA 1XU1A 2WINB 5JI7A 2VW1A 1J1LA 1OHFA 3PJYA 1MEC1 2A6WA 1VBB2 5FQ0A 5AC93 2DCYA 2RS33 1RUD3 1XXNA 3JBG1 1AR62 4WM8B 2A71A 1A78A 4TZDA 5HCBA 3THPA 4R8HA 3GZUC 3V0AB 5E89A 2OZJA 2DU0A 1B35C 4P14A 3VBSA 1WD3A 4GB32 4KNCA 3AYEA 2ZACA 4HPKB 4C0HA 3TWIA 5J36A 1AR92 4XILA 1WMDA 4LO8A 1KS4A 3NSTA 4K8FA 5FO9B 1QQP1 2WT2A 4WBBA 3MLJA 2RHPA 1WCKA 3S0MA 3AP6A 1LODA 3CLPA 4XBLA 3MGUA 1QJU1 4D69A 1Y43B 1S1AA 4DOUA 3M7AA 3QH6A 2XLAA 1PO21 3MFAA 2RM22 1RUJ1 4AFAA 4JDOA 1GFF2 2VVFA 4GXLA 2E9QA 2XGXA 4EWAA 1XNKA 5CG8A 4QQLA 4ZU5A 4DINB 2WLPA 2XJSA 1DBNA 2VNGA 3ZXLA 3WY6A 1X33A 4Q4X2 4K21A 5J98B 1JBCA 4CDWA 1UX6A 3PVBB 4NN0A 4OI2A 1U12A 4IEZA 1DFQA 4QPGC 4BCUA 4JAAA 2VUAA 4L97A 1PO11 1RUE1 4YW2A 2WNUA 1V9U1 3TBDA 1F5FA 3PMSA 4P9GA 5BNNC 1NA1B 1DYKA 5AFBA 2XJRA 4YZ4A 5ACA3 2V5YA 4HKLA 4BMEA 4A7ZA 2WKKA 1I5ZA 5FOBB 5FCCA 2B9UA 5FOJB 3D8CA 3LSDA 1S0JA 2BW8A 3H7YA 4I0BA 2ZKLA 4BHPA 4RHV3 1CPMA 1LHVA 4OZXA 2MEV1 2Y26A 1AX0A 3L2HA 1FOD2 4LT5A 2HEYF 2MEV2 2H0VA 2B42B 2CGOA 3ECQA 5JVVA 1DQ1A 1R091 4W6WA 5JIUA 3N7JA 2PHDA 3FHIB 1UF2C 1RUOA 2FMDA 1RJ8A 5E88A 2K9ZA 3U07A 1H2NA 3JD72 1DU3D 3NKGA 1QF3A 4B7KA 4DZGA 2OUHA 2ZGRA 1AJOA 5T5OA 3ZYIB 2P3IA 2XJTA 2XJPA 2VNRA 2XB6C 4E4SA 4FTEA 3S7EA 3R6SA 4AHYA 4QD2A 1VAMA 2D6NA 1PIV2 3ZIXA 1VAKA 3WW3A 2Z69A 4QQHA 3FFZA 3ZIWA 2WFF2 4JCKA 3B00A 3DPRB 4HANA 5I0TA 2X29A 3GF6A 3HWJA 4M3CE 1D0GA 2Q8OA 1NY72 5ABJB 4IEPA 5CB7A 1UU4A 4FOQA 1K5MB 5KHKA 3OF1A 3WHUA 1ENRA 3B9IA 1YIPA 2IXCA 2WA4A 4HMZA 4AVVA 1MQTA 1RUJ2 3CU7A 2UY9A 3QH7A 4XW3A 3VDDC 1GLHA 4NR1A 3HBZA 2R073 2BNOA 2VXRA 4RGAA 2DUOA 2XVKA 3MLLA 1COV3 1BEV1 1UL9A 4KGGA 4AEDB 1PNGA 2CYFA 2N7GA 2ZHKA 4B8EA 4KQ7A 1GICA 1RUF3 2G4IA 1VRH3 3H9AA 2ILMA 1SEFA 4OUSA 3DN7A 2WS91 2Q5TA 2YGLA 4XEZA 1AR91 3ZSEA 2RR13 4Y1YA 5EJ3A 3VKOA 2PELA 5I8SA 2PLV2 1DLLA 1LHOA 3WQ1A 1X50A 2MNGA 1CAUB 4IETA 4JRAA 3W9AA 4X6RB 3RYPA 1EAH3 2VW0A 5BNOB 1OQ1A 4PIZA 2JG9B 4IEVA 4AQ2A 1IS4A 4XF4A 2R49A 1FATA 1OFSA 1XYPA 4HLTA 2C9AA 4AEJA 5J37A 5GZGA 5JPMB 4BIFA 1NA1C 5L36A 4LHNA 2XJVA 1QU0A 1G7YA 4R4ZA 1EYBA 3ILFA 2R30A 3SH5A 4Z2WA 4RA0A 5CAZA 2RS51 3VV1A 5DXDA 5I8YA 1AHSA 4LULA 4NHKA 3QCWA 1RUI1 3RJRA 3PTYA 4DB5A 1LESA 4Q0UA 4FTSA 4Q2FA 1RIRA 3CF6E 4COVA 4N43C 2HWC1 2OVUA 3EHKA 5C8CA 4RR3C 2R061 2PAKA 3RWNA 4FO9A 1LHWA 5D1IA 4WZFA 1V6IA 2XL9A 2ATFA 2DV9A 2HWF1 2ZOEB 2WZR3 1W6QB 5F6KA 2XBO1 3EJKA 4W6YA 2EA7A 2RS13 3L9JT 1XE8A 4RS5A 2IFWA 1HXS3 3ZXJA 4FQZA 3QOPA 2ZAHA 4HPKA 4QPGA 2W39A 1OA3A 1MS3A 2PHRA 1WMEA 3N36A 4MSVA 2UYAA 5DG1A 4KL1A 4N7IA 2OZ6A 1I9RA 2QKDA 1UZYA 3R05A 4JTOA 1ZA4A 2IXKA 2MPFA 4FQ4A 3ZFFB 4AGVA 1RUG1 2PAEA 5DZFA 3VBUC 3FUOA 1RINA 3CNAA 1HRI2 3M70A 3VLBB 1CQ9A 2DVAA 1RUE3 2EXJA 1WUVA 3MW3A 4WV8A 3ZSLA 1VALA 3M3CA 4OVEA 3VZLA 2RE9A 3UL2A 4N7UA 1G86A 1HRI1 1YI9A 1C1LA 1YJLA 1QXPA 4UW6A 4FXKB 3FUQA 2VMGA 3N7KA 2EVXA 1W6PB 1BQPA 5L7OB 2C5DA 1AYM2 1U5YA 2WNVC 1WW4A 4IQPA 4BE3A 2BGCA 3J26N 4RS5B 3B5LB 2VG9A 4EN7B 4DMIA 4MGKE 4NVPA 1PK6A 1TMF1 4AQ6A 4LBQD 1LGNA 5FMOL 4QM9A 2IZWA 3NV3A 3APBA 1VBD1 1D0HA 4LE4A 2VU9A 1NCRA 1R1A3 1FPN3 3OTFA 3LGRA 2PN5A 4GA9A 1NXD1 2BUKA 5FREA 4CDQC 2GN7A 3S6PA 4PLOA 4H14A 1PGW1 4HKWA 2D3PA 3VBOB 5C4WC 1REFA 2SBAA 1AR72 2W0XA 4YG3A 1FMD2 3S7IA 2XL7A 2WNVA 3AXEA 3A0NA 1FYUA 2Q1ZB 5JOYA 2D6KA 1A6CA 2PYTA 5GLUA 1WW5A 3AB0A 5DDJ1 1JN2P 1D2QA 2Q0AA 3WQ0A 5FPZA 1W6OB 4JC1A 4HT1T 2FBEA 2JDZA 2VUJA 1LOCA 1FX5A 3RZZA 4BOWA 1PVC2 1LJ7A 4MH0E 3WUDA 2AZ5A 5KXBA 4Q4X1 1MR5A 1NCQC 1O7FA 3MIBA 5JCTA 2BWCA 1ENSA 1NCRB 4DY3A 1CVNA 2VW2A 4XFHA 1X82A 4JV4A 1GQHA 3H1WA 4YM3A 3PVNA 2XUMA 4AFDA 1V00A 2GZWA 2WL1A 1WLCA 1DHKB 3AKQA 3N7MA 3WDUA 2RR11 1TMF3 1BK1A 4XJWA 1YO8A 3WINE 2JICA 1A8MA 3MW4A 4Y26A 5T5LA 1GYKA 3ZN6B 4AK3A 4E2QA 4I2OA 2DFBA 2CWMA 2HWD1 3OD0A 4M0HA 1RMU3 1FNYA 4CDXA 4KG0A 1CJPA 1RITA 3HT2A 4G9SB 3ZXAC 2UU8A 4NHMA 2ZHLA 2ZKNA 1AXKA 2X5IC 5IK7A 2D3RA 1SDWA 2IC1A 3AKRA 3V64A 3JU9A 3KCYA 4LBLA 4ASLA 2VPVA 2JG8C 3ACLA 1KD7A 4FOYA 1IPKA 2D6OX 3O14A 1APNA 4B4RA 1N3PA 3FLPA 2PLV3 4HN0A 3FWEA 1G9AA 3I59A 1RB8G 1LOGA 1U0AA 1YNAA 3MEPA 2OA2A 1HKDA 1WBFA 3ZXDA 5T3NA 1HQWA 4AFBA 2YDEA 1C4RA 2P34A 5CVRA 1M4WA 4C1WA 2YGMA 3GALA 1MEC2 1LOAA 1QMJA 3POSA 4Q4V3 2DWRA 1MS8A 4LBMA 4FPFA 1OOPB 1PIV1 5JR7B 1RUH1 4EWDA 5LK7B 5IK4A 3VKFC 1ND2C 2DVBA 2WS93 2JG9A 2YROA 3I2DA 4XQ4A 4BMBA 1RGSA 1Q3EA 1YI7A 1AR63 1AR71 1IKPA 1W6NB 2OIIA 4DRVA 1IS3A 1SMVA 1BKZA 2R16A 1AYM3 4OHWA 1DDLA 1L3JA 3EXUA 3FE5A 3B9CA 4XFCA 3VDDA 1SLLA 2CNAA 2WZR2 4MXVA 5DZGA 1N47A 3WG3A 1S0GA 4EN9B 1WLTA 5I93A 4AQTA 3M3QA 5C6CA 2Z42A 2QE3A 1R1A1 4XXAA 5ACA1 2DF7A 3B94A 4META 2JEMA 4QPIC 4CDUC 5KC6A 1AX2A 1DG6A 1MZFA 1FOD3 4XJZA 3SNMA 1VBE2 3AK0A 4OLLA 2VH9A 2D44A 1W6NA 3A0KA 1M06G 1ULGA 2FMYA 4IXLA 4PCRA 5FO7B 3ZFGA 4NO4A 2AH2A 4RHV2 3LOBA 2VMHA 3X29B 4COUA 4XBNA 1YXWA 4YM0A 5FLJA 4HVRA 1G9BA 1OPMA 2Q4SA 3HQXA 3QBQA 1C8M1 4GMP3 3RYKA 3TB0A 3GYDA 5JIAA 3LZZA 4NPRA 5I91A 2TEPA 1GKBA 1GNHA 4LUMA 3OPZA 2VECA 4JGYA 2GAUA 4IEYA 1C8NA 4YVSC 1HIXA 1H0BA 2O8OA 2YPJA 4XDQA 1RUI2 4LHKA 4AEMA 4IV1B 4DRRA 5CFCB 2W68A 4JGZB 3A4UA 1CAUA 4A3XA 1ND3C 4R52A 2HWB1 4BH9A 3GHNA 3H3UA 2NMNA 2JG9C 1W6PA 3ES1A 4ATFA 1GZWB 4AYUA 2BNNA 2FZ2A 1FV2A 1YWKA 1AL22 5GZEA 1HQLA 1W39A 3MIHA 1EV13 2DYCA 3OCPA 3E6DA 1J3PA 5CBLA 4PLNA 2GC2A 2O1QA 4PF5A 4V1PA 4WM8A 4AEDC 4I30A 1RUD2 2GALA 3NWKA 2FZ1A 2WSVA 2AYHA 1QDCA 2KA3A 2YYOA 2DTYA 1AJKA 3CJIC 4MUVA 3UKTA 3VBSB 5JSOA 3O5SA 4YM1A 1QJX2 1Q56A 1JUHA 5EXOA 1B35B 5GLVA 3OBTA 3VHPA 5C8CB 4FPCA 2X53S 5CFCA 5EYXA 3I4IA 3NV2A 5DDJ3 1BEV3 5J96B 1VRH2 3NV1A 1ND2B 2VNOA 1QJX1 1JXNA 3GBFA 1HV1A 4YYOA 1O3QA 3K51A 1LU2A 4C90A 2WFF1 3ZFFC 4OHYA 1PGW2 1NYWA 1LECA 4I3PA 1QXJA 1ZBE3 1UPIA 3LA2A 4HN1A 1CJDA 4EJRA 5T5JA 4TYSA 1C1FA 5K0UB 2QZ2A 4LBOA 4P9XA 4GKXA 2ET7A 4Q4W3 4FPLA 5K7PA 3FX3A 4Q4W1 5FTTC 5BNNA 1VBA3 1TME1 4JDMA 4FOVA 5H9QA 5TSWA 1O3SA 1IS6A 1VBA2 3NAPA 2P3JA 1VBC3 3D0SA 4MGYE 4M01A 1SBDA 1XYOA 1VBE1 1LEDA 4E4DX 4Q4X3 4K9SA 5JPNB 4LO7A 4CDWB 2A3WA 4UW3A 4XJAA 3VN4A 4FPHA 4XBQA 5JLVA 1UKRA 1V9U2 3ZN6A 1WMFA 1ZX5A 4INDA 4N9HA 4LLFA 3FJSA 1O4YA 5L19A 5EZWA 4MYEA 1SQ4A 3VZJA 4AI2A 2UY8A 1ULCA 3CJXA 1EPZA 2GC0A 2LM3A 5AC91 4WVZA 1T6GC 5K9YA 4GIQA 1F5JA 3MFCA 4QPYA 4BPZA 4X8NA 5DUUA 1LTEA 1W6MA 1DQ4A 3SITA 4WM7B 4Y1VA 5AC92 3LWCA 2VMIA 1JYIA 3OYWB 1QJY1 2R0FA 3E6CC 1MVEA 1DGWX 2XLGA 3MW2A 4YZ5A 3MICA 4K7JA 4MXWB 2WT1A 2ZGPA 2F6BA 2ZMNA 4B7EA 2PA7A 3J4UH 3U4XA 4YZ1A 3AYCA 4XXPA 3H1MA 1GV9A 2WQZC 3ILRA 2ZTNA 1JTZX 3B01A 3E5QA 1NQJA 4QXKA 2ZGNA 1H30A 4BLJA 1POV1 2X8KA 2ZA9A 4AFCA 1MZEA 2HWC3 3DF0A 1POV3 4ONUA 4XF0A 1CAVA 2QCSB 1VJ2A 1BYHA 1OA2A 2ZGLA 4L11A 4MX3A 3ZYPA 5CFDB 5J48A 2ZGTA 3HD8B 3I8TA 1MS9A 1OI6A 3J8F2 1Y7BA 3MIDA 1IZ3A 3HN1A 4UBGA 2YMZA 3O0VA 2E7AA 5BY5A 1PVXA 1OD5A 1YFWA 4ZU7A 1O3RA 4GB33 2B7YA 2DCJA 5GZFA 3SCFA 2NPIA 1S2KA 1HXS1 3ZFEC 3AKTA 3RI8A 4AWDA 5EV7A 5FRAA 1ZREA 3IDEA 3JZVA 4CEWA 3ZDSA 3EO6A 2B45X 2R041 4GH4C 4LTAA 5HCAA 3AJZA 1OFNA 5GZCA 4N53B 2WLQA 1ZZBA 2XG3A 3EQEA 1AF9A 2ZGSA 4FT8A 1X36A 3ZXKA 3AJYA 5KXEA 4BM8A 2GC1A 3ME2A 4G4FA 2G9GA 3NVCA 2ZS6B 1Y3TA 3JBG2 4PBPA 1MS4A 1ZZCA 1PVC3 4FAHA 2A6ZA 1I6XA 3NL1A 3ES4A 4CEYA 1BZWA 3ELNA 4FPJA 3RYRA 4MGZE 4OI0A 1R081 2BFUS 4RSUA 3J8F3 2B46X 2WT0A 4CEYC 5L73A 1XQNA 4AI8A 4HK9A 4Q26A 4LNVA 4LA3A 3N35A 4XYXA 1R082 4RQPA 5IUQA 1V70A 1QQP2 3NO8A 2E63A 3TNPB 4DPNA 1D4M3 2GSYA 5L7OA 3KQRA 4H7LA 4IL7A 2CWSA 1EV11 2A3YA 4AHZA 3ZMNA 1LOFC 5LEKA 1HV0A 3UKNA 1HQNA 2XLFA 5A32A 2DURA 3TOJA 2NQYA 1TME2 3U10A 2ERFA 3ASIA 3VKMA 3BPZA 2QZ3A 5ABJA 1ZZ8A 3NV4A 2I2SA 4L8QA 4IV3C 3ETQA 3ZFEA 1D4M1 2I45A 1WW7A 2ARBA 5KXCA 2HWE1 3NKTA 2XBO3 2WWSA 4FTBA 4YVSB 4YGBA 2ETEA 1CX4A 3U11A 2Z2SB 3AKPA 2HWB2 1LHUA 2ZMLA 1XU2A 4UBHA 4FP2A 4RQPB 1QDOA 2E7QA 4NWWA 4KBBA 1FXZA 1W6QA 4JDNA 1FV3A 3WR0A 4LBQA 5SV8A 1C5HA 4D94A 3IIAA 1UMZA 5FFOC 1W6OA 1YFUA 2EIGA 5T55A 3OGGA 4K1ZA 2RS12 3KSCA 3ZN5A 1HX6A 2HEWF 2YZ4A 3ST7A 2IXJA 3KD4A 1Q5OA 3MDPA 4TWTA 1MQTC 3E5UA 1UCXA 1WLWA 1PZ8A 1XNDA 3RPQA 3R4SA 1G9DA 2PHWA 2KXLA 3IDBB 2DFCA 4AI3A 3R0RA 1VLNA 2BQPA 3KMHA 1WA4A 1ULEA 2VGDA 4XHXA 4YVSA 2WNEA 4FSJA 1CAWB 1YFYA 1QJZA 2BVBA 4GKYA 3VBUB 5C9AA 4JGZC 4H7MA 5HCFA 1PO12 1J1TA 2VOVA 1KXGA 4XF1A 3POWA 2G9FA 1GZ9A 1PO13 1ZBE2 4COZA 4N9IA 2XJUA 4RD7A 1RUF2 4E4ZA 3V0AA 5GLWA 4YG0A 3WHTA 5KHJA 5T52A 3MYXA 4ASMB 1DQ6A 1RUF1 4XFIA 3KGLA 4BYYA 1YFXA 4CP2A 1JH5A 5A3LA 4YZ2A 4IEWA 3ZYJB 2RS32 3AM2A 1PZ7A 3LCPA 1C5IA 4OULA 4Q0SA 4Y24A 1LOEA 1LGCA 5AVPA 1X7NA 3I59B 2CTVA 2EALA 3FBMA 5GLZA 1UU5A 4IEUA 3T1MA 2VVDA 5C4WB 4IEQA 2B5HA 1GR3A 3KB5A 4KU8A 4URTA 4AHWA 4P9LA 1XNCA 1J58A 4MXWA 1AX1A 3VBFB 3ZFFA 4I02A 1FI2A 2W08A 4IESA 1KFXL 4XJ9A 1VR3A 4Q0PA 3V0BB 3CJIB 4EV0A 1D4M2 1HLCA 2RM21 2RS52 4QQ2A 3TYJA 5JZGC 2EXIA 4M0NA 1DGWA 1RUI3 3BB6A 3WG2A 1EAH2 1OPOA 2ET1A 1CONA 2WFPA 1C8M3 5JSPA 4W65A 2E7TA 1AYN2 4D7TA 1H1IA 2DUQA 3WG4A 2Y0OA 5CNAA 2R1BA 5DG2A 3MIFA 4KU7A 1G6NA 1UD1A 3H50A 1YRZA 4FPGA 2ZZJA 1U5IA 3LSEA 4FXGB 2PHUA 4AEDA 5I8TA 4PBOA 3DL3A 4M00A 2CL2A 4XFFA 4E27A 4K20A 5JZGA 5KBFA 1OLQA 2DVFA 4MV2A 4AG4A 2BWAA 4L99A 5GLTA 1RJ7A 5ABJC 4K6BA 1ALYA 1K5MC 1OA4A 2AENA 5JDBA 4IV3B 2NZ9A 1N1YA 2EXKA 4Y1XA 3RMXA 1AR83 1SLIA 1C8M2 5JOWA 3MF6A 4FOWA 1LEMA 5FLIA 2XH6A 4Q29A 2JXAA 2JECA 1J3RA 4X8PA 3PMEA 2IXIA 1RHI2 4RQPC 2ZX2A 4BIOA 2HEVF 4GMP0 4JGYC 2X5IA 1PZ9A 4XTPA 4AXOA 3KM5A 4CDXC 3WDYA 1QOOA 4C91A 4J1WA 3ZX7A 1VB4A 3AP4A 3IPVB 4XZPA 2GNBA 3VBHB 2UURA 2JE9A 4MVTA 1J59A 1PO23 1V6JA 2GN3A 3MPBA 3UJQA 4RGGA 4XFGA 4WVMB 1R092 4HVQA 4OHZA 2YUEA 3FFQA 1O91A 2E51A 5BUVA 1KDKA 4L2NA 4PDWA 1CGPA 1EPWA 3M3EA 5EWSA 3ATGA 3WP3A 5FPXA 1ULFA 2OYZA 1N1SA 1I3HA 2GH2A 5F5QA 1VBD2 2R043 4HBNA 1YCIA 3AFKA 4Y20B 4AF9A 2PTMA 2OW4A 2HWC2 2OUJA 3D5OA 4XOGA 3N4MA 2V09A 3HT1A 1H9PA 1ZBE1 4FP3A 2XVLA 1VP6A 1DQ0A 1VBD3 2R042 3D82A 3HIFA 5JWPA 1UW8A 3VDDB 1V9U3 3QACA 5JSRA 5GJ6A 2B39A 4MZUA 2UYBA 2D5HA 3WDWA 1LULA 4KWLA 2BNMA 4ISQA 2E6VA 2W52A 3TRSB 4F3JA 3BTAA 3V65A 1JW6A 1R093 2V73A 4DY5A 5CADA 2KM2A 2CAVA 4A2UA 4MGIE 1AYN1 1ND2A 1SFNA 4BA6A 4AQSA 4LO5B 3AYDA 3DUIA 5D8AB 4CEWB 4RR3B 1LENA 3O7OA 4XQDA 3WP5A 4AVCA 1O4TA 4FPYA 4COYA 1RUJ3 2D6PA 4IERA 2GMPA 4A7YA 4UW5A 4CDQB 4R9BA 5K0UA 2BPA2 1JYCA 3N7LA 3WW2A 4D7SA 1GNZA 1QNWA 1ZNPA 3QLQA 1AYN3 4QM8A 4D7YA 1ASJ2 4K1YA 4XETA 1QOTA 1DQ2A 2GNTA 1XYNA 3PJQA 5B2GB 5BNPA 3K48A 3SLIA 1MZ5A 3ZN4A 4DXZA 5L7OC 4OI4A 3WUCA 1IPJA 3VBUA 4Y22A 1TE1B 1SCSA 1O5UA 4ZU4A 2DCKA 4Q4W2 4B4PA 3I54A 1UPSA 3UKVA 2A73B 4AI0A 2WS92 3THTA 1WGPA 4AGGA 1AL23 1Q43A 3WDXA 2HWD3 1WBLA 4QQOA 5KHHA 1LR5A 3ZXGA 4GH4B 1DZRA 4GWMA 3NAPC 3IM0A 1KITA 2BTVC 3SMHA 1PNFA 1CD3G 3VBOC 5I0SA 3G7DA 3AMQA 2TUNA 5DDJ2 1DZTA 1CESA 5AFEA 1NE4A 3INAA 5HBAA 5BNPB 3VL8A 5HXVA 1J3QA 1YYNA 4PJYA 2VQAA 3MZHA 4Q4V2 3SXWA 3VHOA 1NLRA 1DGLA 4HETA 3WOGA 5FBZA 4FPEA 1V6NA 4IEOA 1VRH1 4S2DA 4AVSA 2NN8A 1NCQA 5C33A 2PHTA 2ZHNA 3B69A 3BU7A 2D5FA 1RVF2 2NM1A 4WVVA 4GQ7A 5D8AC 3GZAA 4KWKA 2WA3A 2H6BA 3FLRA 1KDMA 2ZX1A 1Z7S2 1COV1 1SBEA 1AL21 2RM23 4Q4Y3 2UWCA 1RC6A 1WW6A 1G9CA 2RR12 2Y0IA