5JJ5A

Crystal structure of iron uptake abc transporter substrate-binding protein piaa from streptococcus pneumoniae canada mdr_19a bound to hydroxymate siderophore ferrioxamine e and iron(iii)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
308
structure length
308
Chain Sequence
b'GHAPDKIVLDHAFGQTILDKKPERVATIAWGNHDVALALGIVPVGFSKANYGVSADKGVLPWTEEKIKELNGKANLFDDLDGLNFEAISNSKPDVILAGYSGITKEDYDTLSKIAPVAAYKSKPWQTLWRDMIKIDSKALGMEKEGDELIKNTEARISKELEKHPEIKGKIKGKKVLFTMINAADTSKFWIYTSKDPRANYLTDLGLVFPESLKEFESEDSFAKEISAEEANKINDADVIITYGDDKTLEALQKDPLLGKINAIKNGAVAVIPDNTPLAASCTPTPLSINYTIEEYLNLLGNACKNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter substrate-binding protein-iron transport
publication title Crystal structure of iron uptake ABC transporter substrate-binding protein PiaA from Streptococcus pneumoniae Canada MDR_19A bound to hydroxymate siderophore ferrioxamine E and iron(III)
rcsb
source organism Streptococcus pneumoniae
molecule tags Transport protein
total genus 104
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5jj5A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5jj5A02
4XPIA 1ESZA 4FKMA 2AFHA 1MIOB 5GGXA 4PAGA 2OSVA 1FP4A 1N2CB 5FLYA 4UDNA 4DBLE 2XH8A 2M6KA 2PS9A 2MINB 2PS3A 3ZK9A 4WZAB 2Q8PA 1KAEA 1QH1A 3AEUA 3HXPA 1G21B 1H1LA 3PDIA 3TEFA 1M1NB 1KARA 4OXQA 2RG7A 1N4DA 4H0FA 3LHSA 1TOAA 3AERB 4WZBB 1K2VN 5I4KA 4LS3A 3AETA 3MINB 4K3VA 1PSZA 4UTOA 3AESA 4WESB 3TNYA 4IRMA 4MLZA 1PQ4A 4WN9B 5AFSA 5KHLB 2XDQA 5BVGA 1K0FA 3AEQA 1N2ZA 4WNAB 5CR9A 5JOQA 3U7QB 4G09A 4MDYA 1KAHA 4TKVA 1M34B 4TKUA 4OXRA 2WI8A 5BVGB 3UJPA 4FI3F 3MWFA 5KOJA 4XPIB 2AFHB 2PS0A 4NNOA 3TLKA 1FP4B 2XQVA 4MO9A 2AFIA 2R7AA 3CX3A 2PRSA 5JG7A 1QGUA 1QH1B 5JPDA 3AEUB 3AEKA 3PSHA 2OV3A 2R79A 2ETVA 4H59A 4ND8B 3G9QA 4N01A 3HH8A 4HMPA 3AETB 4HN9A 4B8YA 3AESB 4M7OA 4UDOA 2XDQB 3ZK8A 3AEQB 4HMQA 3ZTTA 5HX7A 4FILA 3PSAA 4OVKA 4TKVB 5KOJB 1MIOA 5M3BA 3K1AA 4G07A 3ZKAA 4BBPA 2X4LA 2XV1A 4INOA 2YNMC 3MWGA 5CX1A 1L5HA 2M6LA 1M1YA 2AFIB 2OGWA 3BE5A 3R5SA 5BVHA 1QGUB 1G20A 3AEKB 3BE6A 3R5TA 4INPA 1H1LB 3PDIB 1QH8A 1N4AA 4PM4A 3MFQA 4GICA 3HJTA 4WESA 1EFDN 5B58T 4WNAA 1K75A 2Q8QA 5KOHA 2O1EA 2XY4A 4FNAA 3ZK7A 5M2QA 3EIXA 4MX8A 5M29A 4TKUB 3K1AB 3GI1A 1K7SN 3EIWA 3NU1A 1N2CA 5HDQA 4CL2A 2WHYA 2MINA 5CX1B 1L5HB 4WZAA 5M34A 3LI2A 4UTPA 5JJ5A 1M1YB 1G21A 4ND8A 5BVHB 1M1NA 1G20B 3AERA 2PHZA 3MD9A 4WZBA 1QH8B 2OV1A 3MINA 2QI9F 1XVLA 4NNPA 4WN9A 4HMOA 2XUZA 4LJSA 3U7QA 2YNMD 5KOHB 1M34A 5GGYA
chains in the Genus database with same CATH superfamily
4WXMA 3UHPA 5C8ZA 3WL7A 2QTCA 4YJ3F 3R7LA 4Z4FA 3I45A 1H22A 3FJOA 1D4FA 1ZUD1 4LBWA 4URYR 3OZRA 4AY2A 1NPTO 3BMCB 1RBZA 4I5FA 2XVAA 3ME5A 2ZJYA 3QEOA 2WM9B 2DJIA 3SZ3A 3EAFA 2JI6A 2FZ4A 4WKNA 4Z1MA 3SF0A 2JVKA 4LBYA 2ZW9A 4ACBA 5C7YA 1SBTA 3D1JA 3CUVA 4Y2JA 3AVXA 3NRBA 3K05A 5AK5A 5HA5A 4PIMA 1JAXA 2OGSA 4UHHA 1IZ9A 3D2CA 1BWPA 4J2TA 5CXXA 4F97A 3V8EA 3EGEA 4FTWA 2CJWA 4YHBA 1VMEA 4C3OB 4ETIA 4OSPA 1F1BA 3HJAA 4BMNA 4FFRA 1E32A 3ZDZB 4AQYB 4NE2A 1HZZC 4P33A 3UMVA 4ZMRA 1PT6A 3NBYC 4KH1A 5KCMA 3E05A 1D0VA 4HRAA 2ZYSA 1HE1C 1Z6ZA 3HXOA 4X9XA 2X4IA 3CSDA 4YA6A 1DCTA 1TZ2A 2DBRA 3QF7A 3M6FA 5DHSA 5DHRA 1F0KA 3EH1A 2R65A 2XD4A 1NJ8A 1QOPB 4NE9A 2W6IA 4GGOA 2HI0A 1WZUA 2HWKA 2V1UA 1WDTA 3BMNB 3D59A 3IE2A 4HPWA 3LPMA 1CZNA 4MAAA 3ZC3A 1VMAA 1NUSA 5KSPA 3ZEIA 3ZE0B 2GSWA 1PZGA 3EFEA 2F3QA 2P5SA 4NFYA 4B85A 3M6MD 1VQ1A 1VGQA 2ZG6A 1SPBS 3L6OO 5SY4A 5JCJD 3IBFA 2I2FA 3H4TA 4UNQA 4EG1A 2Q2WA 4KCGA 4HMQA 1P2FA 1LPAB 5IS2A 4ID3A 1SVSA 1URPA 1ATZA 4P86A 4CM4B 1KK1A 1PFKA 3RS4A 3WGMA 4BNMA 1DC5A 4J75A 2NO0A 4JKYA 1AMNA 4Z1MD 3GCWA 4B3HA 3R2JA 1RQ2A 3MWJA 2I3ZA 3RVDA 4JGIA 4QT4A 4HUQA 1JWAB 3FZGA 3EVFA 3DS8A 2GJ9A 3WADA 5LCXA 3HDHA 1H1LB 3WV5A 2PH5A 3H2IA 3M1LA 2EX1A 1AGRA 4Y67A 1VSVA 5FTLA 2FN7A 3OJLA 4XWTA 5EERA 5BQ5A 1F06A 1AU9A 3OQIB 1DQPA 1A1SA 1SFRA 3CE9A 4LF4B 1ZESA 4QHSA 1XA3A 3FPEA 3OZTA 4LA4A 4TTSA 3R4VA 4ZO9A 3RC7A 2BSQA 3GUVA 4JBHA 3WAKA 1YBHA 2P5TB 2AOTB 2DKNA 1M9NA 2XAAA 2IF2A 2W2XA 3HV2A 3UJ3X 5M5BA 1JUDA 3QOFA 3RW9A 2W6ID 3BXHA 4E5PA 1U28A 2WWHA 3VZPA 1B6RA 3MTIA 3E9YA 3KTDA 5EA2A 1L5HB 1X7ZB 3PC8A 2VH1A 4EJ6A 5CYGA 2XMQA 5CDFA 4ZQBA 1IBSA 1M1YB 1U2DC 1RKQA 4PVCA 4FNOA 4XEUA 1ZM2A 3RE1A 4RTMA 1NG9A 1TFRA 5A5DA 3F6YA 2C84A 1EP9A 2B8TA 3FHJA 5H9VA 2P9TA 3ZTWA 4KHPB 3EPPA 1Z8DA 4WXHA 2R44A 5DWVA 4D3DA 2OWEA 1ZMTA 3MJEA 1GTVA 3Q6IA 3ONFA 1XV5A 3F78A 3FRHA 1DEOA 4WBSA 2AKYA 5DO9A 5EUCA 1G41A 1Z6XA 2PCLA 3FNHA 3FPFA 4OY3A 2L18A 3WLSA 4MKXA 2VJQA 4OB6A 4YP6A 1W36D 4BOYA 3UKJA 4NE7A 4IKPA 4D8WA 3RC3A 4CEJA 2PD4A 9LDBA 2GKOA 2VNAA 1ISSA 1JI3A 3F3MA 3SNHA 1SG6A 1CFZA 1POWA 2GEDA 2BTQB 1KRXA 3UJ6A 1SGWA 4NH4A 4V2UA 5JJIA 5CLIA 4L51A 4PYKA 1TOAA 2WWIA 2C96A 4IGEA 3P0IA 4IEIA 3K70B 4TWBA 1F7UA 521PA 3QVGB 3BWBA 3CEAA 3JQAA 2QVXX 2YDXA 4KL8S 4RFSB 5ER6A 4C1NA 1PWYE 2O07A 3DA8A 1NFQA 1V43A 4DDUA 1SM4A 1N9GA 3AVUA 5LYJB 2DC1A 2R4TA 3KEGA 3HB7A 1UOEA 3LCUA 2A3RA 1L7EA 3LQFA 2P6PA 4FDMA 4EZEA 4XWKA 5FWNA 1GSOA 1A97A 1O8CA 3UOWA 3FYTA 1T4MA 2Y1XA 3CLSC 4RYDA 1TK3A 1G4AE 1P7ZA 2GVNA 2PSDA 5FOWA 2OO3A 3VVLA 1LBIA 5HQJA 5JPDA 1NXWA 3VKHA 3JASA 3EC7A 3LKVA 3K32A 1KOJA 1IC6A 5F78A 3OE5A 3LHIA 3QMMA 1XTSA 4YGYA 5DEIA 2R66A 4MPRA 2B30A 4I14A 3U3JA 2XDAA 1Y8RB 1KZ6A 1Q2XA 1XQXA 3DWEX 2WWTA 4DMLA 1IVNA 2NLOA 2F6RA 3IOMA 4IVQA 4ENUA 2VEDA 1WP9A 2Q27A 3G1TA 3P2JA 1ESMA 4D4JA 5HM6A 2VHEA 3ORYA 3EULA 1Q7RA 2J8ZA 1FXWF 2GQ0A 3W3AA 1P77A 1XYVA 2P2NA 3NNNA 3ORFA 1U0HC 3PFFA 4YCDA 3UJ9A 2EVWX 1Z5UA 4DQVA 5DTQA 1AMUA 2XZOA 5THKA 4Q9AA 4KGVA 3FPGA 4X00A 2YXEA 1DB3A 4OIMA 5FA8A 2FWRA 5AWFC 3S27A 4D3SA 1BWSA 3GO4A 1MTOA 3KU1A 2NUAA 2B4QA 1AUQA 4CG3A 4WOCA 3DMTA 1BX1A 5IWCA 3WIDA 3JPWA 4CMCA 4KUHA 1VLZA 1YT5A 3EIUA 3G2QA 4BP1A 3LBFA 1K5GA 4L5AA 4U02A 4HATA 4DR5B 3AY6A 1UJ5A 5JJLA 4L5CA 2GDJA 2R1UA 5FWDA 3OFVA 2F00A 1JTFA 3RB8A 3IVGA 3O1HB 4H9GA 5KJFA 1WUJS 1CIVA 2Z04A 2ZYWX 4C0KA 1DXHA 1V3TA 1H2RS 4Q9KA 3WAGA 3WGGA 4C4ZA 1L6IA 2ZR7A 1O57A 4MDFA 3BB1A 3TTTA 4B43A 2WM8A 3TVYA 2C5GA 1WU7A 3CC8A 2AOWA 3D8NA 5ALVA 1XE3A 2JIBA 4RTQA 1QH8B 4AIRA 5EPUA 3SHVA 3S7TA 1PG0A 2CXNA 4AIIA 2FSVA 3LPLA 2W0MA 4YWJA 3CNQS 5FI3A 4MCHA 3I0NA 2NPFA 4CM8B 2ZKIA 1FRVA 1PVVA 2P9ZA 5AK3A 5LC1A 4M46A 4AZ0B 3CNBA 5FUXA 2HLDA 5SYAA 3ROMA 2J0SA 4R8MA 4CWAA 1OU0A 4RENA 1KSGA 4JIMA 4MVJP 3LBHA 3ZJVA 3NCTA 4EHBA 1TMGE 1FRFS 3KUXA 1ZK3A 3OZWA 1MAVA 3LKZA 3P9PA 4G8BA 5TXGA 2OQVA 1EX7A 4B48A 4D43A 5FOUA 4CIWA 4AP5A 3QUTA 4D42A 5L6LB 1Q0HA 1DAEA 2I6SA 1JIIA 1PW7A 3E82A 4YT2A 3SXJA 2YZGA 2RGUA 4IJQA 4K3VA 1RI4A 5C4GB 5EWJA 4WESB 5J3JA 1CR4A 3F8WA 5KHLB 2GFQA 3M1AA 4MTLA 4V1CA 2G9QA 1G66A 1RQGA 5DCWA 5KVSA 3ND9A 1YAJA 2KB0A 2YQZA 3O5AA 4GECA 2YS6A 3PPYA 4OG2A 5EKXA 4DMMA 3CMMA 3M4NA 1I1QB 2EBWA 2H06A 2AQKA 2XCIA 4C4RA 5KDDA 3L6UA 2GK3A 3P20A 4OQZA 2EJUA 4KE6A 3A1TA 5A2QA 4Z6KA 2I1WA 3IQGX 3K0KA 3GEBA 4YDSA 3TNDA 5FAKA 5JH7F 1GGVA 1SCJA 4J1TC 1LSJA 2C2WA 3K15A 3NFRA 3QFRA 4MIOA 2DPHA 5TQ2B 3E7XA 3WK7A 5BNZA 1EUYA 2Q7DA 4YXWA 1U5BA 1SBNE 5L3QB 4YRZA 1PYDA 4HLCA 3A4MA 3NP9A 1AZWA 1RIIA 3CNEA 4LJYA 4UVDA 3RD5A 4XVHA 3KDPA 1REQA 4RD1A 5T4BA 4YACA 3NALA 3CLUC 4JR1A 2HEIA 2HLDD 2UVPA 3SM3A 3TL6A 3INGA 4OMCA 2BFDA 4P54A 3LYAA 5EKTA 1G8PA 2DUMA 3O84A 2EBFX 4HQNA 1PS9A 4II3A 3REOA 4EG5A 2XZTA 1YACA 4Z0PA 1G19A 3LDGA 4HSEA 1YZFA 2JAWA 2W8ZA 2WF8A 3I01A 3NHSA 3OEHA 4PGHA 3KX2A 1FUYB 3E48A 4JJ6A 3NNSA 3WLLA 2HHAA 1A88A 3KB6A 1JHXA 1MB2A 4EB6B 2QLMA 3H6HA 4EKIA 3S2UA 2YWHA 3TQQA 4B8WA 2IUFA 1PTKA 1XZHA 3TEMA 4TTTS 4AXXA 3H19A 4KQ1A 3TYXA 3O3CA 4P0TA 4Q3CA 4RSRA 1QYIA 4MLDA 3LHDA 2HPAA 1R16A 1CY0A 3OZSA 3OECA 1RC0A 4DC0A 1QH9A 2AC4A 2OD7A 1FMJA 1G5FA 3SBDA 4EPXA 1R6UA 1YOVB 3K96A 1SD5A 5CVDA 2W42A 1NQAO 1OXUA 3IQHX 5IBRA 2GNOA 2ONJA 1EFKA 2O52A 5AJHA 3STWA 1Y3FE 2BDEA 5JI2E 1THGA 1YKGA 2YXDA 3QMWA 2RONA 4H6WA 4MYSA 2GBLA 5FPTA 3NIBA 5LA6B 3VH2A 2P9JA 4E1AA 3P0HA 1CB0A 3CVXA 2FWNA 2VPQA 2GAAA 3FSEA 1E9DA 4RKWA 3H87A 2HJVA 3F9CA 2RKOA 2BCGY 5GONB 1ECPA 5AUPB 5JQWA 1NF8A 3TLJA 2V7PA 3PC7A 2GCOA 3SSMA 1Z15A 4MRPA 4BQNA 2B4TO 3OEHD 1B16A 4PZ9A 1GN8A 3TOCA 4PAGA 3EMVA 4Y2GA 5IVIA 1RHQA 3S2SA 5C52B 2NQ2C 3L6BA 4DCSA 3BKWA 2OMEA 3C4VA 4BTLA 3I2KA 1ZNXA 3VPSA 1S3IA 5IDWA 4EW6A 5AVZA 5IUNC 2HJRA 4JVNA 3W2FA 5JW6A 5ALKA 3BH7A 1CZLA 4HDKA 1T0HB 1YQQA 4WI1A 4ZYYA 1LK5A 1QYDA 1WABA 4MWSA 4TYMA 5FBQB 1ODLA 1P3JA 3NT2A 4M22A 5JSUA 2X40A 4O4LB 2XB2A 1K98A 2BONA 2D4HA 5CH8A 2YZKA 1KZ9A 3ZHTA 3EX7C 3OIYA 3OE1A 1BGXT 5HCIA 1SOAA 4W6QA 2Z6UA 1E1CA 1N6PA 3EAGA 4HAOA 1RBMA 2ZWVA 3EA4A 1P7VA 3NTRA 3PRYA 1NVWQ 3PGKA 4IVRA 3SE7A 5LL6P 1ARZA 1NXXA 1UPAA 4PLFA 1L1FA 4TTJA 1PUXA 4N5HX 2FZ5A 2H00A 2PXXA 3CX4A 5AI6A 3IT3A 1JSCA 3CCFA 3H1TA 3MT0A 3GOQA 2J5XA 4V0RA 2O2HA 4ZI5A 1JHVA 3PVSA 2Q1XA 3IMEA 4G3XA 3IQDB 1MRSA 2CL5A 4KV9A 3V32A 1DUVG 3THXA 4F5WA 4UM9D 3LUDA 2QUJA 5LJIA 2W6MA 4Q1BA 4GFDA 2X2OA 4HNSA 1BW9A 3GYBA 1O6ZA 3N8IA 4YJKA 5K0JA 1EK6A 4GZLA 2B82A 4KQXA 3NTQA 1D1SA 3QSYA 2DFPA 1MEJA 4EY6A 3H4MA 4RY8A 3SEAA 1CXZA 2QLTA 4IDQA 1E2GA 1CUVA 1VGRA 6GPBA 2O8BA 4UTVA 2GJ8A 4H7JA 3UUWA 4RELA 3IA7A 1X15A 3QKWA 5AKJA 1YAHA 2OBBA 1TKAA 1U1GA 2ZI5A 2XXAB 3KJFA 5FO0A 3FR8A 1RHKA 1UEJA 3LUGA 5C1BA 4Q37A 4JEIA 1GZHB 2RGBA 1CEEA 1UP4A 5DX1A 4QBFA 2NSDA 2F62A 1UKBA 2QV0A 4R2LA 4CDMA 1A4IA 1M1UA 1Z2EA 3DEFA 3DEHA 3NYIA 4M0FA 3RS0A 4N3NA 3V2HA 1M2HA 4LRYA 2OBFA 1Q77A 1W76A 2QMOA 2P9GA 1P9NA 2WKQA 5HYVA 2IBSA 3HUFA 3TO5A 3NU1A 1CUYA 1U7ZA 4PE5B 4GOJA 4AURA 1FQKA 2P0AA 3K8YA 3WL8A 4DLNA 1RYNA 2XKAA 4JU8A 3TINA 4ARVA 4TV9A 2ONCA 3VJKA 4Q18A 1UZLA 3DKPA 1HYHA 1XWIA 2VJBA 3T5BA 1K63A 4HNGA 3LY5A 1O6FA 5CCEA 2B5WA 1XHFA 1Z7WA 4XDHA 4YLYA 1L8QA 4CMGA 2EKPA 2IEYA 3RAJA 5KNBH 2O4UX 2BDUA 1PL0A 1CUWA 1XQ9A 4ZTBA 3KR9A 1E77A 1NF9A 1DQZA 4CTMA 2NUPB 2TSYB 2X6TA 1LDNA 2HCTA 1Y7IA 2NNWB 3K6RA 5BMOA 1UQRA 3P32A 5EOVA 3ZNNA 2W4MA 4H1WA 1NF3A 1J90A 1RXUA 3P96A 4TQAA 3GDWA 3GFOA 1X7GA 3FPAA 3OP4A 2PZEA 1HGXA 3O82A 3KZKA 3M83A 1K9VF 5DLYA 5CCBA 1LWNA 1E7SA 4FMCB 3B2EA 3OPMA 4AY3A 4C4OA 4G0QA 2NSYA 1WDMA 1HE2A 3S1AA 5IFKA 4UQOA 3OPYB 5DXFA 3WGVA 4Z4GA 1T3HA 3HXMA 4CQJA 1KQ3A 2ZAGA 5D5QA 2ZWMA 4RD0A 1JFRA 3D8TA 5IJZA 2EBUA 4NCAA 1LLFA 2XYVA 4C21A 5A62A 2HHHB 3AETA 3M2PA 3MUFA 4IRMA 1DC3A 4QEDA 4A2PA 1DELA 8LDHA 3HYSA 1F4LA 5IW8A 4D25A 1T2VA 3ZJ5A 2BAGA 4QJ4A 3QI2A 1KVRA 5A4KA 3ZU3A 4TWIA 3NKVA 4FFDA 1BSVA 1Q3TA 4IWXA 2VDQB 3X1MA 5HJEA 4B75A 1XZKA 4YDHB 1E5LA 2GS9A 2POQX 3I34X 3KR1A 4WGFA 2Z0MA 1QQAA 2PMFA 4UREA 5AH0A 1BE0A 3NRCA 2Q0XA 2R00C 3EGXB 5JNRA 1IHPA 4WL0A 1HTTA 3EQ7A 1P33A 1VG1A 3TW8B 4N48A 3WP0A 2QY9A 1DBRA 1MQ8B 2XIJA 3BXPA 3WK6A 1SQFA 5BN3A 3OAAD 3UYKA 4JB8A 3BEDA 2C7QA 1AY0A 3LV8A 1X38A 1XLVA 4Q6BA 4BLQA 3L0CA 5HUHA 5FULA 1IL0A 3B3GA 1TW3A 3HE3A 3JVDA 2FW1A 1T0JB 3SE0A 4QFCA 3HBNA 3G1UA 4ZJPA 2P67A 2ZB2A 3GYGA 3F5QA 3A1EA 4ZIRA 3K6SA 4MO2A 1Z0AA 3AHDA 3MVEA 5FUVA 5BYKA 4FBGA 5BSWA 1EUDA 2LKDA 4ALMA 1W5BA 3ZQKA 3HB5X 3HJNA 2Z98A 5KZMB 1GGHA 6NULA 3MJTA 3UFXA 2EQ5A 3T9DA 1Z6PA 2WP8J 5AOCA 3LVBA 1VL5A 1VPEA 1F12A 1V3UA 5DYTA 3VYVA 3W6PA 1R0YA 1WY7A 2FRDC 3NHBA 3KLNA 2HCBA 4RD4A 2V1XA 3CZCA 3ZXSA 3HTXA 4D3XA 1H0SA 4JEMA 1K8XB 4PANA 2O0KA 3D7SA 4XUDA 3T41A 1YXMA 1XYYA 1EZ1A 1US8B 2KSQA 2ODPA 2H3HA 1JEJA 2OO5C 5EWLA 1WCYA 4NBKA 1FMTA 4GMGA 3L82B 1H0KA 3P0EA 1HC7A 3BFJA 3H11A 3WGUA 4DYHA 2MSDB 3MOSA 4L57A 4UAJA 3W9YA 1AO3A 1IBRA 4FFMA 1AQIA 2IHJA 3IC5A 2CHQA 4EJFA 4BMYA 4YQFA 1J39A 1ZK4A 1II9A 5AI8A 1GCGA 1WXDA 1SVMA 4RHUA 4MICA 3DE3X 5FKJA 1Z4IA 4YRNA 3FPLA 2H65A 3QVJA 1T5TA 3RRJA 4UUAA 1VKHA 2DQSA 1I2DA 3FCYA 3GK3A 1F2UA 4J3FA 4UBJA 4FGKA 4RTNA 1BDIA 4W1RA 4M1OA 3BPSA 2F8LA 1J56A 2YICA 1Z56C 3DBHA 4MKRA 3S28A 3UJCA 1G7TA 1P8JA 1KNQA 4HQKA 4PSDA 3R7WB 3VHXA 4CU5A 1GU0A 3BRSA 1AGNA 1R3DA 1YD7A 4Q4LA 1T8TA 3JD4A 2D2VA 2O23A 4GYKA 1ZAYA 1ONBA 5KYTA 3SKXA 2I4NA 3DTYA 1I2MA 2XZLA 2B36A 3PDUA 1JW9B 3DO6A 3TR5A 1G291 3DE2X 3JZIA 1M1NB 1LPOA 1P5RA 4GI3A 1QPGA 3VU9B 4GXNA 4G5RA 4Y2PA 2FUNB 4TMKA 1RWWA 2FXIA 3MS4A 4NYMR 3V7NA 4E22A 1K6MA 4TTRA 3R7NA 2AXNA 4Z9AA 4JB0A 4OUDA 2WAAA 5DHFA 2GERA 2CNLA 1KAHA 3E5NA 2C5HA 3RSOA 2SKCA 2NUBA 3OUTA 4LHSA 2J85A 3E2PA 4J7AA 2WHQA 1ENYA 2P8SA 5FOTA 2FSUA 4XOIA 4ZRNA 2VO1A 4FYXA 5ICSA 3PQCA 1KDOA 2QX7A 1TZBA 1C1DB 2YFHA 3PUZA 4BBZA 5EJEA 2W93A 2MTBA 3WI7A 2E4AA 1E0AA 1JQJC 4W8HA 5B1SA 1RXSA 1ZGHA 2RCYA 4YMIA 2ZZKA 4YUXA 1HO3A 4DMGA 3H86A 1N6OA 4H59A 1G6HA 1P7CA 1AQ6A 2E5WA 1EVJA 3GZ4A 3MW8A 3H3XA 4FEGA 4J90A 1KKUA 4X6YA 1JQBA 5EYPB 2AEEA 2VI5A 1G17A 3P2EA 2IT1A 2WTXA 4KR9A 4N3AA 5ELMA 3AESB 1Z8FA 4DB2A 3PD1A 2H1IA 3NORA 3MF4A 4MP6A 4BO2A 1MN6A 1Z0DA 2AX3A 2R8OA 3PSAA 1UMKA 1RI5A 3R7AA 3TG2A 4RTLA 1HFWA 4KWEA 1I3NA 5IKEA 1EK1A 3QE4A 4DQLA 4IQ8A 2VRCA 5IT4A 2FG7C 4TM7A 2VP6A 1NBHA 1ZAKA 2ZYTX 1GL9B 1V2HE 2SBTA 4JUIA 2B4AA 1LW7A 2ZRMA 3GLIB 4PEVA 1EFPA 1T10A 1VP3A 2B5VA 4REMA 3ZWWA 4BNDA 1YE5A 2G06A 4RK6A 2FHPA 4XD7A 4ZREA 4CTNA 2P90A 3HJCA 4RA6B 1NFFA 2M2IA 3MHTA 5EZ6B 4GICA 2GN0A 1EJ2A 2IH5A 4ROSA 4HNRA 3U7RA 4AY6A 3EDYA 3UUFA 4GPBA 3B52X 2GBFA 3AGPA 3R0VA 4UPEA 4OAQA 1EWYA 1XXHE 2P5UA 1RWQA 3DQQA 1UXHA 2WJJA 5KU7A 1N5JA 3EY9A 3LT5A 1YZNA 3F7NA 2WIFA 3EA0A 1ECBA 4P7JA 1JR4A 3ZX4A 4BGVA 1FA9A 1DAGA 4C3ZA 1LI4A 1U0JA 1RAAA 4O2AF 3FUVA 4JQCA 1T0BA 4MVXA 2Y93A 1T26A 2OEPA 3B6EA 2I03A 5DTIA 1RZ3A 3BYZA 4LGYA 3RIHA 2HSWA 5HQ3B 2Q3EA 3CN7A 1F4PA 5FNZA 1V41E 4UVIA 4QFBA 3UV6A 2COUA 4DUYB 1TA0A 1XCGB 3LCRA 3PQ6A 4CV3A 3L7KA 4KB5A 3FUXA 2FSSA 4B3TB 4NNPA 1T2EA 2X8BA 4S1PA 1Q0PA 4Z3DA 3ZVNA 1AKVA 4L8VA 4HL6A 1E4YA 1M6WA 2ZBDA 3OFKA 4PRLA 1I4OA 1XZQA 3MTDA 2PZMA 3SZOA 3FTEA 4FUQA 4OMUA 5K3EA 5KNCA 1JG6A 4P0PB 1XCLA 1RABA 1H8EA 1PJAA 2BCJQ 1H4TA 2R8ZA 1KEEB 5GGXA 2AXQA 3D3EA 5AW0A 4V1CI 2C97A 3IDZA 4L15A 3RHZA 4UM5A 3GMTA 3DZKA 4HWSA 1GU7A 5DEOA 5KTTA 2BGKA 1XQYA 2C82A 2I65A 3DBLA 5AJYA 5BSUA 1SUWA 1XLTC 2M1XA 1D1QA 2IYFA 3ESCA 3IJEB 3TH5A 3GEIA 4B44A 1H5NA 3ZE8A 3O4JA 3ZXXA 2V0GA 1G55A 2IDKA 3IEUA 4A8JB 1MABB 3KD2A 4C0JA 4F2GA 4N7JA 3N5KA 3U56A 2C8VA 4WBNA 2CK3A 4GNRA 3WLPA 1K0FA 1AS2A 1HXHA 4NR0A 3U7QB 2UKDA 1NI4A 4P8RA 1G8FA 1J5EB 2D1FA 2J5RA 1L4GA 1QVWA 621PA 3KQUA 2ZTMA 1Q0TA 3ZE1B 2UYHA 3HFSA 4PCVA 5EZSA 1Z6GA 4KE9A 5ITZB 3ZD7A 3WTCA 4MV4A 3OA0A 4H6VA 1UP7A 4NTZA 2OWDA 4NPHA 4BJ5A 3HCNA 5IWAB 5AVOA 5DBOA 2PX2A 1IHDA 4A36A 3K0FB 2PZGA 2R79A 1TUBB 1VDZA 1I51A 2WIBA 5LLSA 4DY4A 4I3FA 5T5QA 3L2OB 4E08A 3TMYA 1BCRA 2FX3A 5EFZA 3NHMA 3IKLA 5E0KB 5CIYA 3WNQA 5KNCD 4JHLA 4ZQCB 5EGNA 1ULAA 2NZ8A 5LQKA 2I67A 2B8EA 2X1LA 4G56A 5FA6A 3TZLA 1AKRA 4YB8A 3UMSA 1ZKDA 2IITA 2N42A 2RC6A 1QXSA 4DLYA 2G71A 2YIMA 2NQTA 4BUJA 1CSEE 1N5LA 1VHTA 2A57A 3GLUA 4J0IA 4QIHA 2J9XB 4K6OA 4YJFA 4BBPA 4C76A 2V7XA 4AJ1A 3GRRA 3W3AH 1CP2A 1NW3A 1Q17A 1C1XA 2E7ZA 3AG6A 4HB4A 2ORIA 4HWTA 3JVUA 1U0GA 1VYHA 1HDEA 3C4JA 3L7BA 4ARBA 3DDOA 1ZSYA 4DSZA 5KTYA 3ZDXB 1I7QB 4EF6A 4OCZA 3KVOA 4BFLA 4QAQA 1QGUB 4I1SA 1B8NA 3PLNA 3TUJC 3NBMA 1JBQA 1ZQ9A 1ONNA 2QEQA 4FC7A 3C8ZA 1BXGB 4MW0A 2DKFA 2ZTSA 5G40A 5I7SA 1EIWA 5AT1A 2CK3D 1YMQA 2IYYA 2IPNA 2ZU6A 1J1ZA 2G28A 4MWTA 4R98A 3W6UA 5AQ1A 2JL1A 2QE6A 4JBNA 4G0XA 4OQXA 4XQ9A 4UEKA 2H08A 4OXXA 2ZIXA 1XNHA 2JJQA 1WHSB 1II0A 4AK9A 4BQFA 3H42B 2ZUWA 2HBZA 4RJKA 1TJ4A 1WS6A 2G4VA 2WSSA 4BO3A 3VO9A 4RHXA 1XPJA 5CA0A 3KSDO 1EVLA 1RQRA 2YRXA 1ZGBA 3HFGA 2C7VA 4KQFA 2J9YB 3ML1A 2FN3A 3GX1A 4HZIA 5JUWA 4P2GA 3L9WA 4RKFA 1NN5A 1ZM3A 3H7IA 4Z99A 4ECEA 2CBGA 4D3ZA 3HWSA 5JJCA 4NBRA 2JIZA 4YRFA 2WWGA 3N58A 3PEFA 4WFIA 2KS6A 5BSHA 4DV3B 4K9LA 2ZYHA 2GEJA 4XSVA 3I1JA 3FWZA 5DMHA 5KQRA 3PPXA 2RD2A 2O2CA 4TVKA 3RF6A 3WXBA 1PFQA 3IUEA 4O8CA 1VHLA 4ZCLA 3E1KA 3WLNA 5I01A 1YULA 5JBIA 3PNOA 2HIAA 3DDZX 1D09A 4R8SA 4X90A 1IBCA 1SCQA 3C3PA 3LRXA 4E2ZA 3EBLA 5A9SA 4KNYA 3ELUA 5A5EA 1EXMA 2FQYA 3RNOA 3ZDQA 3H8WA 4JI4B 5K6AA 1MU0A 4Q03A 4V0NA 1H2WA 5TRTA 2VBCA 2PVSA 4RVGA 4WZAB 3QX8A 1ZRHA 1G64A 1VL8A 1I0LA 5BN5A 2QR2A 4HDSB 2Q6VA 1OAAA 4HUQB 2HNAA 3ESYA 1C30B 1P9WA 3MT9A 421PA 4E46A 3RLFA 5KTSA 2JLBA 3TQRA 4LZAA 3C3CA 5BWOA 3UATA 4EX7A 4DQUA 1XU9A 3PJFA 4CF4A 3KFVA 4U8HA 3RS3A 2X8JB 3MGCA 4GMXA 4LISA 4ZO8A 3TTWA 1NULA 3EYAA 2ZRCA 4MDYA 4NOKA 4RHEA 1ACJA 1BFDA 2GCIA 2ZVQX 4KNWA 3C2QA 4LSMA 4TKVA 4YRQA 3AJRA 4KRFA 4DUGA 2UV8A 3LC0A 1WTCA 3FYCA 4G36A 4QVGA 3LW8A 3WR5A 3QFSA 4HADA 4KO2S 3KZVA 1NSYA 2BF7A 1BQ4A 5CT8A 2Z9BA 4YRDA 2I34A 3QKTA 2VDNB 4TQUS 4YMGA 1BQ3A 5FBHA 4UUBA 3WZ2A 4CQMD 5CDHA 3ZZNA 1HWYA 2XCUA 3H8SA 3HU1A 3NFYA 2HK6A 1P8AA 2X8AA 3E9EA 1KVTA 2V58A 4HTFA 2JVIA 1HDGO 2Y1KA 5EWMB 3DMHA 4HF7A 1XC7A 3PTZA 5E9WA 1CVLA 3C70A 3NH6A 2E87A 1MTZA 3L41A 1RZRA 2B1QA 2P62A 2JBHA 1ZUHA 2OPBA 3QVTA 4J91A 1VJRA 2FOXA 3NC0C 4NPAA 4GSLA 4WXPA 4ZODA 3WMFA 1N0UA 5F51A 3KWJA 3ADDA 3MS2A 4Q4HB 4WUTA 1ORDA 4KN9S 5BXYA 1LPBB 2G7ZA 3A6DA 3A1WA 3FVRA 3EDCA 4FN4A 2QAGA 4BEWA 3KS9A 2AFIB 3PV0A 2XEXA 5EMNA 3A1NA 4F85A 1NPDA 1LQ2A 1HT2E 1IB0A 2RGCA 1RM4A 3HXTA 4DRXA 3ASZA 2HEGA 4NFLA 1SWWA 3ONNA 4P7GA 5KQSA 4KDRA 5B6PA 5K3FA 2GKGA 4IPTA 1H8HA 5EHIA 1MOQA 5E0OA 5SV2A 1SCIA 2G7MC 1KEPA 3DMYA 3R8CA 4EW2A 3K70C 5EVCA 4W5NA 2QD2A 3GNQA 4KIGA 4R68A 3I42A 1RT9A 1QPZA 1EFRA 5IXYA 3ZW8A 1KI8A 2VZ9A 1PGJA 1IEQA 1N9GB 1SHJA 3GRCA 4Y2XA 1WMSA 1L5WA 2OZVA 3BM5A 3FRJA 4RE6A 5EMLA 5K3AA 2QOEA 3DP9A 4U0JA 1NXPA 3MTQA 1TGVA 3KOYA 4K26A 3QWBA 5AUQA 2QMHA 1NX6A 1HNNA 3Q8LA 4RKYA 1G21A 2CLFB 4FXPA 1N0WA 2MSWA 2C3UA 3GFQA 3ENVA 2UXBB 4BFTA 1RZRD 5CRIA 3TE6A 4UE6A 4XXHA 3E61A 3EXHA 2C7BA 4FCVA 4WECA 1ND5A 4LCEA 2QSZA 5J5AA 2QUAA 4EBFA 1F1JA 1GR0A 1CDEA 3ZS8A 2E4VA 3ZJ4A 3GEPA 3PNSA 2CDNA 2GI4A 3PHBE 1Q1BA 2F48A 4TWJA 2HCRA 2ARKA 3DC7A 3JQ9C 3U4MA 1G4HA 5TX7A 5AW8A 3UAOA 3E03A 1WO8A 3KYIB 4D6YA 4JITA 4JL8A 5EL0A 1XNJA 3PDIA 4WOJA 1E3EA 2FPIB 3P9IA 4MWGA 4X24A 4YJHA 2WLSA 3WP1B 1YA6A 1JR2A 1H8HD 4REOA 2GBIA 2NUAB 1N0IA 2J3MA 3M2TA 3DE1X 4QKQA 4XB1A 1VE5A 1Z63A 3X1XA 2IIQA 2OZLA 2ZR0A 1I5RA 3T6KA 1EFRD 5J2UB 4MPPA 2WNIA 5ADWA 5LP6F 3KHUA 4P31A 4D3FA 4M0LA 1QHHA 3EGDB 5ENZA 4D56A 1UZAA 2GPTA 4KAXA 3TQTA 2MSLA 1KFBB 3ZCTA 4JJFA 4ZN6A 3O4FA 1BXKA 2ODBA 1H2HA 2B34A 1HL7A 2EKBA 4CEHB 1ZD3A 1P0QA 1JP7A 1F8FA 5JD5A 3I32A 4E31A 1PJ8A 3B7GA 5ADHA 3B5IA 2KQUA 1Q21A 1P45A 1VM6A 1D2CA 1RXIA 4GI1A 5HPYB 2GH1A 1Q7BA 3D8SA 1HQKA 1TQ6A 2SHKA 2O8VA 3PUJA 3FKQA 1S2LA 2FW6A 1E2MA 4H27A 3WNVA 3S8MA 2HHJA 1Z2PX 3KJNA 1H2EA 1DLIA 2CF5A 3G59A 2FPGA 3CQ9A 3HEMA 2EP5A 4KE7A 5GMOA 3VR5D 4QGSA 3U4QA 3K92A 4OBWA 3CBQA 5H5JA 1S02A 2JCYA 3VJRA 4ZK6A 4MUXA 3DYVA 2WUVA 3ZQ4A 4AI6A 3TPCA 3LY7A 5HIKA 2ZSEA 2AZDA 1LD3A 1UZNA 5CX1A 2R6CA 1DO2A 4AVYA 1RADA 3AZPA 4O59O 3U44A 1BVYF 3BE5A 4MV3A 3A2MA 4ND4A 4EHHA 3MUEA 3M3DA 3I9OA 3SJZA 5TMEA 3OIGA 3AUFA 4C0AC 5BYAA 2EW8A 5K8JB 4OGWA 4CPDA 2LV8A 4M8NE 2OD9A 2V7WA 2JZNA 2WBLC 2BISA 4LHXA 1VXRA 3H9GA 4HYQA 3T1OA 2NPIA 3UEOA 1M2KA 3DFIA 3IVCA 5ALJA 5J59A 4V1CB 3EOAI 4JL5A 1E1MA 1Y3AA 4EI8A 1JHMA 3DCJA 3F7TA 3GJYA 3A10A 4B3DA 3U5TA 1L5NA 2O8EA 4UCFA 1EX1A 4MARA 2W2VA 2O3UA 5COAA 4PNEA 1OTHA 1JE1A 2BFCA 4M9ZA 2B0JA 4MKIA 5DZSA 4AF8A 4E6PA 2XADA 4AKGA 2EIHA 3AFGA 1DADA 4OJTA 2HM7A 5A7HA 3KT8A 2J7PD 3CW9A 1YJXA 3V4ZA 4B7UA 2I91A 5H7XA 4HNQA 4DLKA 4DJFC 2JGDA 3UFBA 3CM0A 3KKZA 4AN4A 2OGUA 3HC7A 1P6QA 4QFMA 4J16C 3SC2A 3JQBC 3ROZA 1EESA 3O9ZA 2ACVA 1CUGA 2ZRKA 4U9HS 2GZ1A 5BVGA 4C7JA 4B0PA 2PU7A 4KPFC 4TUYF 1J1IA 2PIDA 4MK4A 4GW3A 4O2AB 4FZVA 5H02A 2BFDB 3VGJA 1PBTA 3WMRA 1Y1RA 1NBAA 3H75A 3COYA 4GPTA 3JX9A 2BFOA 4X3PA 2A1UA 4N6OA 4PYIA 3NWJA 3RDPA 1LY1A 2FFJA 1GOTA 1ZOPA 1BX0A 2GEFA 4KGDA 4IXDA 1PZEA 4ZOLA 2FQXA 2GN9A 4OHRA 4EJSB 4ENQA 1RWKA 2IOFA 1DZ3A 1M1YE 1T3GA 5CB8A 1VPWA 3EEQA 4PGAA 1C8KA 2X9GA 1K4YA 2LCFA 1MJGA 3DMDA 5HKAA 3QVMA 2W2TA 2XUKA 2WHXA 4EEKA 1Z0IA 3NAGA 3CZQA 1HF3A 1VSTA 1Z7EA 4LHEA 3CY6A 4XRGA 3BS4A 3IXLA 5KJ6A 2O2ZA 3QEKA 3ZHQA 2AXEA 1ZOLA 1JEYB 4DGSA 1JEDA 5T3YA 1VBKA 1LVHA 1NTRA 1PFYA 1A7UA 2Q45A 4UDYX 5E3JA 5A7GA 4XKJA 4OFBA 4L2IA 2GSDA 2RH9B 5A6SA 1WXQA 2ZT6A 1N5RA 3IUSA 4FK8A 5DNUA 3WDKA 4R2HA 3N6XA 2EJBA 2ETVA 4PBSA 4EFLA 5AW2A 4A2WA 4A16A 4M9QA 4OXIA 4KITB 1AQNA 5A3SA 3GLGA 1MFPA 5LP1A 4P84A 1CZKA 3FCCA 4XIJA 4BX9A 3F4BA 2DPYA 1IYZA 1PR4A 1WVGA 3QMPA 4IAOA 1ORRA 2NTVA 3G68A 3FPSA 4RGBA 1VKJA 4DIDA 3LVRE 3O8NA 3ZHSA 1F4VA 1DX9A 1SXJC 2W6ZA 4FSHA 4WBNF 3AR2A 4MV6A 2PX3A 3BMOB 4R0VA 2PPLA 4BQQA 2XEDA 1EFVA 4EO7A 3OIDA 1P80A 1E3JA 1IOZA 1JIJA 1JMYA 4IRUB 5ER9A 3T3EA 1Z4QA 1JLKA 1QUEA 2DRIA 3ROKA 1JB1A 4HDNB 2B4KA 4KGZA 3AONB 4C0SA 4TS4A 1XQVA 2VAVA 1S7GA 2JC3A 3N9IA 2ZB3A 3ORSA 4QU9A 4YCAA 4YBZA 5H82A 3UGQA 2I0FA 2JBAA 3EEOA 1JMVA 2P6RA 1X7YB 4ED9A 2BFNA 1R74A 2OXCA 3H2YA 4BZQA 5JWOA 2L69A 2TMKA 3G89A 3QLVA 4KQ9A 4ZCPA 2HC9A 1V7PC 3RRBA 4G2NA 4P3KA 1JQKA 2WYIA 4U5QA 2XGOA 2FW8A 2UZAA 1SY7A 2HSGA 5IJXA 3U7EB 5EXPA 2Q41A 2GZDA 3BDAA 4J8PA 5EXTA 1JZTA 1SOVA 4NF2A 4TV8A 3O9MA 5EP1A 4DXAA 1E1CB 3F2VA 3UT5B 1IBMB 2OCKA 3G2KA 4LTNA 1HDCA 3ZH2A 4XOUA 2JCGA 4ND8A 5EPOA 3WGOA 5AOBA 3ZD8A 5DTEA 3ICEA 4CL8A 1TT5A 3LU1A 5HF8A 1CLUA 1NZDA 3FX2A 4KWTA 4JD5A 3TLXA 2BGMA 4P35A 3ZVLA 1Y4SA 5L4LA 1YFJA 2XUZA 2MJLA 5EUQB 1B0UA 1YVDA 1NM5A 2GO7A 3OQ1A 5HZGA 3WISA 1PL8A 1VSBA 3PIRA 3IA2A 3Q6MA 4BCCA 3V3TA 2XVZA 1A3CA 4B7ZA 2BELA 2GEKA 2PX5A 1PWXA 2XYQA 6Q21A 4K5QA 2IXDA 4M1WA 3V7FA 1K3UB 2D00A 2M6KA 3FKSA 3IJRA 5DSTA 3Q8KA 1YO6A 4FP9A 1KMMA 4GVLA 4LOJA 4Y2YA 1PHRA 1SOUA 3LHKA 4IDDA 2O0HA 5C1OA 1K8YB 1L7AA 3PFIA 3RAFC 4NU6A 5NLLA 2M32A 1LPNA 4FBLA 2Z2IA 1TIBA 3HWWA 1ZDMA 1PEKE 1JEEA 1E2EA 4ASUA 1T36A 3B1JA 1R9GA 2CZQA 4NKRA 1Y6FA 5J1SB 1I01A 1PSDA 4TKZA 1B3RA 5SZJA 3WQSB 1KIFA 2QN1A 1PLLA 4IO1A 5TQVA 1V9CA 2JLXA 3QK7A 4MRRA 1JXQA 3WS7A 5ECDA 3OD1A 1A9XA 3QXJA 2F8TA 3CRVA 1OC4A 4EG7A 6ABPA 3DXYA 2A8YA 3QTLA 2VT3A 4JLKA 1NDUA 5ALTA 5DT2A 4NONA 5EXSA 3WFJA 2XMPA 3DOIA 2P77A 2NP6A 3RTAA 5JANA 3BFKA 4KSBA 3R9XB 2HPZA 1DJNA 3T9AA 2F64A 3KC2A 4LC1A 1G5PA 5B4UA 2YHBA 1F2TB 4LGMA 3ET4A 3HH8A 4NFSA 3STTA 5I8WA 1VKRA 4EVSA 1LLCA 2B37A 3PQDA 2J0UA 5CDGA 4MYDA 4JSTA 1S4MA 3JD0A 2FNAA 2WD8A 3K5WA 1O97C 2JHPA 1E96A 4F38A 2FJPA 5IC5A 2EF1A 1PT5A 3GG9A 1X8XA 2CF6A 2X5XA 3I5UA 4KH0A 4QG7A 4XQGA 5FUBA 3FKSD 1MCZA 4CMEA 3IBYA 4G1UC 4YRGA 4GNKA 1YHYA 3OX3A 3CV3A 4EFMA 1WV1A 4Q1CA 3TMKA 3DVAB 2C7PA 3S1AB 1UQTA 4WT7A 1N0HA 5A1JA 3OOYA 4NBNA 3ZTYA 4B3CA 3WYAA 1YZHA 2XMSA 2XOXA 5FTKA 3TJRA 3KUKA 2JFPA 1E9RA 1S89A 5C8XA 4JASB 2AN5A 2VJLA 3CN9A 4C06A 4IJ6A 3T3MB 3PDJA 4MB6A 4Y98A 5ES4B 1C7FA 5E7IA 4DADA 3B1VA 1GKIA 3DWFA 1L4FA 1Y9DA 2GBGA 3GMSA 4NFHA 1USIA 5LWHA 2A59A 1HE3A 4N5DA 2HXSA 2BRUA 3INYA 2R0QC 4E6EA 5ICCA 1DAOA 2A6PA 2PAAA 3EZGA 3K9CA 3R0ZA 4CT0A 2AW3A 2FEOA 1SQ6A 4IX1A 2PFKA 3ILXA 3L9XA 4IEFB 2VSYA 5ED0A 5EJ7A 4ZMSA 3RIEA 3W04A 2ZVDA 1HSZA 3L8FA 2VQFB 3KK0A 3IJ5A 4R2JA 3DOEA 3CLVA 4IX9A 2RAPA 1AZTA 4HMOA 3MBIA 4MCIA 4MXDA 4NZMA 5ALQA 3GD5A 5HFJA 1IOWA 5KC8A 3CNLA 2AZMA 1JQ3A 1RQ7A 3LXXA 1GQRA 3U61B 1NUUA 4G8JA 5ETJA 1F8UA 2ACKA 2VYQA 3IALA 1DQYA 2XCOA 4GYWA 4HBZA 4W5JA 4BE9A 5KNCH 3GUZA 1ZJWA 4NXNB 3ZLBA 1H3EA 2JIQA 3SJ7A 1ULZA 3O93A 1X1BA 2ZGVA 1FDTA 3AYXB 4GP7A 4JKIA 5AXCA 5K5EA 4BV8A 2FVXA 4D9NA 3EVTA 2ZAOA 3B3FA 1FYXA 1UDAA 2I6XA 3QUBA 4W1PA 5B58C 4U2CA 2OBMA 3AP3A 2NO6A 1JYSA 3EQ9A 3QJYA 4JMLA 5ERYA 3SEZA 3C8DA 5IDQA 2IZOA 5L3RA 3TNYA 4HZUA 5CXUA 4TZKA 1ML4A 4ZA2A 2A1IA 1Z4OA 2BVNA 1N2ZA 4PZCA 4C6TA 1X70A 2EP8A 3WQHA 1E69A 1J8VA 3D4LA 3U39A 4JUCA 2I22A 4IM7A 1Z7YA 2HDOA 2WJ6A 1CBUA 4QREA 3SDZA 4JHXA 2YOGA 1JS1X 1SC4A 1YUMA 2CXXA 2WYOA 1V3QE 3DBRA 3I58A 1U2SA 5A9TA 4CDGA 5KB3A 4H1UA 2X7JA 2QUBA 3ZDCA 1JV2B 5ALIA 5LZ7A 1QORA 3ZE2B 4A8PA 3CSUA 3NANA 1EYZA 4WEQA 4ZP1A 3CR7A 3NKLA 4WCVA 4TT8A 4KBGA 4RMHA 2DOKA 3RUAA 1DDIA 2V7TA 1L5LA 4TL9A 1RAHA 2GYUA 2XUQA 3KYDB 4JLAA 3A06A 3AEQB 5LP6B 1OXBB 2DWOA 3VX3A 1YJCA 2RKBA 1SUAA 4AP6A 4KFSA 1ZU5A 4HRVA 2BZGA 2W2KB 5K8CA 3H1GA 5GV8A 5F7JA 4IIXA 3T5CA 3R8XA 3NT4A 4JFAA 3I5XA 5C4IA 2FUG6 4NBLA 5BMVF 4V0KA 1KQOA 1H65A 3KKNA 1L9XA 2E4UA 1I10A 3OETA 3JQCA 4TL6A 1EWTA 1I14A 3CMCO 4CKEA 1YE3A 4DXHA 3ZHUA 1DAHA 5IABA 3HUTA 5KYNA 1HDOA 1HH4A 2IGBA 1WPQA 2AJDA 3DJYA 3M6VA 3TZEA 2WJ4A 2HNBA 3VOAA 2WIKA 2DHCA 3P2IA 4LKRA 5CPBA 5HUJA 4ND2A 1NUTA 3WB9A 9LDTA 2BE7A 1FFBA 2YV2A 2QMYA 3QOWA 5HW0A 1L5KA 2A0XA 4FLFA 4OUDB 1T35A 2O8FB 2QPLA 4BO9A 1EEHA 3GQVA 3ZWQA 4ALJA 1D2MA 3IR5A 3BREA 5G3YA 4AKIA 4JBGA 1U8AA 5LQNA 4ZEMA 4C7BA 5ADVA 4FWBA 4PAOA 2FMXA 2FZKA 4FFOA 3SIXA 3VNQA 6AT1A 1XD8A 3TQSA 2WUEA 3AR7A 4PV7A 1B93A 3D4BA 4PN3A 1Z75A 4NSNA 1E2JA 3D3WB 1OB2A 4GI5A 2EWMA 2TS1A 4MW5A 4QO7A 4HAYA 2CVPA 3FKJA 3IIIA 5AR1A 1QYRA 2JB9A 3BIWA 1VJTA 4LY3A 1UJ4A 3MTEA 5K0BA 1VLHA 3VAAA 1UWVA 1X7XA 3A1FA 3LO5A 5BSRA 3EXIB 4FWTA 3OQVA 4UAGA 3S5UA 4DIBA 4C6SA 5JV5A 1U8UA 4LYJA 4DR2B 3EZYA 4JXKA 1KMNA 2AOUA 1KEZA 2JFVA 3H2GA 4OU4A 3FJYA 3O21A 3IVRA 1QVVA 4DJAA 5KEIA 5BO5A 2J9ZB 4FOOA 3WLKX 4ZZ2A 2AMFA 2G67A 5F4ZA 5FTMA 2RHLA 2XE6A 5G0SA 3REQA 3FWKA 4QDTA 3W4IA 3WYBA 2FU5C 2VDMB 2ZAMA 4N49A 1Y3HA 4YMVA 3OMXA 5T6BA 3UB2A 2IZ5A 2ATXA 1Y37A 3LC2O 4KI7A 4NMXB 1U2PA 3C98A 1FP7A 4QBHA 5B6JA 1WPGA 1HDRA 4D2IA 1EVKA 4FGUA 3W5DA 4FDVA 2REQB 3GNLA 4AUKA 3AI1A 2NUTA 2W2QA 3N0VA 3RWOA 1LNSA 2EFCB 4ZEXA 3FYDA 1GRCA 4MHOA 3WIEA 5J43A 3HSKA 1YVRA 4TUYB 1DJOA 4D74A 1TCAA 1T3ZA 3RC9A 3MWFA 3QU2A 1IUKA 3ND6A 3K4QA 1SCKA 3TRJA 2RSLA 5I7EA 2QTMA 5IUJC 4ZVNA 3CZ5A 2JZOA 2AVDA 4EUSA 1YA4A 2BI7A 2C9OA 3KDSE 5LDGA 2FZEA 1QAQA 3TIFA 5HM8A 4MA4A 5FLKA 3AVVA 1QC5A 3IGFA 3D0RA 1ES9A 2O3JA 4P32A 2WF7A 4ZEWA 1DI0A 5ISMA 4B6JA 4ZOLF 1KS9A 1RJGA 1E8NA 1UKZA 3DVLA 3WOVA 3Q72A 1AXGA 1PJSA 1RKVA 2FLKA 1CHNA 2UYYA 3E7WA 1CD5A 4HNHA 4FNGA 4I4TB 2DERA 4NMLA 5E6SB 3J7AC 1B6GA 2YXPX 3L6RA 3V4FA 3AZOA 3T06B 3R77A 1H23A 3IP8A 4EPYA 1FJXA 2EP7A 2ROQA 3OY2A 2H4YA 2UZ0A 3SBXA 3VNAA 4OHOA 3WSWA 4LYYA 1C2TA 2YVQA 4JJAA 3DVSX 4OHMA 1KSJA 1Z0JA 2PSFA 3CLKA 4GIBA 3VU0A 4M0PA 2VTBB 3QH4A 1JYFA 2XBMA 4CEIA 4MRVA 1U8EA 1CQPA 4W9RA 5CLLA 1Y42X 3SYKA 3AVQA 3NOQA 5BT9A 3V4SA 5BQXA 1M6VA 1XXLA 2QM3A 4QYWA 4BLUA 3ISJA 4RVUA 4U00A 3H99A 4YV7A 3U6BA 2WJVA 5EJMA 4U0KA 1G1MA 1CJVC 4HGPA 1FNNA 4JJGA 3FWPA 1GCIA 4EPWA 4CTJA 1UANA 1WXXA 1NR7A 3QFHA 2YHAA 2VBFA 3V7WA 1PFVA 4EZBA 3QVXA 3HKDB 4XR9A 1Z2DA 2WTEA 1PNVA 4N5MA 2IOQA 3EVAA 1CERA 1I4DD 2B69A 2NIPA 2VBGA 1OREA 1V9SA 3E81A 5A71A 1N2BA 4IFIA 2LBPA 4PNHA 1NSTA 2ADMA 2HCFA 3VPBA 3MXTA 3DULA 5JAOA 2A30A 2PMCA 2G5TA 4GGMX 4HS9A 4F7WA 3ZY2A 3HDGA 3G0HA 4MUMA 4P4NA 5B2FA 4FSXA 2FPSA 3I2GA 3VU1A 1BRMA 4Y6GB 4OLAA 3QE2A 1TAUA 4OI1A 3MSCA 5AHXA 3S7ZA 3AM1A 4OHBA 4ZPXA 5GWXA 4I81A 3IAHA 3I76A 2I2BA 1CLEA 4GO1A 3EARA 3GJ6A 2J6HA 5F2EA 1Z83A 2QDKA 1GZUA 4X6LA 4Z4HA 2JJ1D 4LXYA 4MA0A 5BR4A 5K0ZA 1SKYE 2ZZNA 5G4KB 1A5ZA 1MX5A 4LRXA 1C1XB 4TV8F 2YVAA 2O3SA 3FDZA 3ZE6A 4JOSA 5B55A 3Q5GA 2YN2A 1XMQB 2VNJA 2QBYB 3ZWAA 1A95A 1TL7C 2H4JA 1SAYA 1VI6A 4WBXC 1ILEA 1FSSA 1SVOA 2BKXA 2BM8A 2QD5A 3D3JA 3HBMA 3I4LA 1U7HA 3MINB 3K2EA 1YS1X 2CMHA 2CLKB 3UOAB 1R37A 1X8LA 1ZD4A 1QRDA 1SA0B 1XVTA 2PANA 4OL0A 2XYGA 4P7KA 5EXXA 5TPZA 4AO6A 3F1KA 3I92A 4MS3A 1VYVA 4DV7B 1W29A 2ZIXB 3PQ5A 1UINA 4XPIB 1DAMA 4I50B 3BL5A 2CZGA 1TM5E 3FI9A 3WWOA 3SQNA 1AKQA 4KR0A 2JEOA 3OM9A 4GL2A 2YZ7A 1C7QA 4HNTA 1NNSA 1YFKA 2FFHA 2PMWB 2ANCA 3DMRA 4KGXA 2DP4E 1P31A 3GZNB 4OK5A 3BJEA 5D3KA 1RWXA 1Y1PA 5B3JA 3ON5A 3WK5A 1DV1A 4HWGA 4YI3A 2HU8A 3A58B 1ESEA 3TVTA 1OWNA 2E89A 5B1IA 1DFIA 3ENZA 3CNHA 4JN6B 4C04A 3UCFA 4M4SA 1H2FA 3JTEA 4IDNA 2PRZA 4NL4H 3KPVA 1DIGA 1P2TA 2ECOA 2HD4A 1SHUX 3ZZUA 1NUQA 1NMZA 2NQ8A 3BZWA 4TN1A 2EC5A 2HXYA 3EGIA 3M1IA 3B51X 4G86A 4RA9A 1UBMS 2QP3A 1NVVQ 4M54A 2W37A 1QB8A 2ZRQA 4M9CA 5JMPA 1WNTA 3BH0A 3M9XA 3COJA 4M0KA 3C8UA 1XDUA 1E3IA 4KWCA 3II6X 4MVJA 4MWBA 1ZMOA 2RB5A 5ERGB 4KXYA 3K9LA 4PFKA 4D02A 5LQAA 4B34A 1TO1E 1JX6A 1Q7TA 3PNYA 1GUBA 4PC3A 4PG8A 2WAYA 3ADOA 3GVPA 1XCOA 1W5FA 4CT5A 3IEXA 4BUCA 1GPLA 3GLRA 3Q3HA 4RVSA 1PAUA 1Z68A 1KYVA 5C80A 3ZVMA 4RL6A 2J59A 3C6XA 5FO1A 2UUCB 3HDQA 3NHZA 4MKGA 3U37A 1DL5A 1EFHA 4RDXA 4KFCA 2IHTA 3WK8A 1TMYA 1PEYA 2AG6A 5EE9A 4G5HA 5B58T 4AJKA 5G0VA 4FW8A 3VKFA 3FZEA 1SXQA 2QVCA 4A8TA 4ARZB 1EA7A 2P4QA 4IUYA 1K5PA 1Q3HA 1W34A 2XQIA 4KP7A 1ZK2A 2DETA 1E5QA 2YIVX 2I7TA 2I6TA 2VSFA 1RYHA 1N3BA 2R1ZA 3GCGA 3G5AA 1YS4A 4LJ9A 1N3YA 1QIFA 2QQEA 5IT5A 4K9DA 4MV8A 1Z16A 4YN3A 5M34A 3N87A 2OXTA 4KRXA 1SBHA 2X0RA 3L6DA 4ARAA 2W58A 1W4CA 1U28C 2VJAA 2WWFA 4KLAA 1L7VC 2QNRA 4GD3Q 5COQA 2VAPA 5F3RA 4CMHA 3PC8C 5G1NA 3GLIE 4PHHA 2O3QA 1XRMA 1SKUA 3OCUA 4FU0A 2R97A 1W8IA 1DKOA 2C2ZA 2R62A 3ABSB 1JHQA 3PNVA 4G24A 4MJXA 4MUKA 4OKSA 3KP1A 4FFLA 3QPDA 4G37A 5DJ5A 2J30A 2IDJA 2DG2A 2YOFA 3LUJA 4LJSA 4MIYA 3NV7A 1RXEA 1UK7A 4PZUA 1FVXA 4LE2A 5I9LA 3HVIA 4Y2HA 3LUPA 4MVJD 3EBOA 3GP5A 3HBJA 5ITSA 1Z7GA 4A91A 1O0CA 2P6NA 4ER0A 2FSPA 5AI4A 4FYWA 4YREA 2JAUA 1BTOA 5H4GA 4IGAA 2OT3B 4DA6A 3F3YA 3IERA 1RAIA 5JALA 5JASA 1U90A 1C1YA 3LG2A 5GOTA 1Z73A 3PE3A 1T9BA 4G8CA 1RMTA 5G2OA 4LYFA 1N5OX 3DDHA 1FCJA 3R5JA 5K3DA 5C1PA 3HPRA 1NW4A 1OZFA 1EGMB 1NURA 3D4NA 3JR3A 2PDAA 1G98A 3DL2A 3P4XA 1LX7A 3DOHA 1CDDA 3PGMA 2GILA 1H2ZA 2PIAA 3WBKA 2V6MA 4YY3B 4E4RA 3K0SA 2OHVA 5CR9A 1IBKB 2DCUA 2UZIR 3TKAA 1WEHA 4EABA 2V6BA 2C9MA 3IUPA 1M34B 2FEWB 2EYQA 2VPIA 5AHKA 5EJIA 2R85A 3M9LA 4B4KA 1UKCA 1X80B 3T7IA 3R24A 1RRCA 2NN3C 3ESAA 2EW2A 4OQDA 2RGYA 5I5GA 3RK0A 2PGLA 2W5UA 5K3OA 1JRLA 4UHDA 2GRUA 4AS3A 3KQTA 4YXFA 2DEUA 2CNDA 1GNPA 4AJOA 2MYPA 1OBVA 1JB9A 1PK8A 2VXCA 4ND5A 1DCFA 1SWVA 4NX2A 1YCFA 3I64A 4PYLA 2EV9A 1OHHA 4FKBA 4GLBA 1JLSA 1VI5A 1DMRA 1Y98A 1U04A 2LTAA 2X1HA 1CWUA 3KXPA 1INLA 5FPYA 1UT8A 1RI3A 3PWZA 4A5SA 4F5ZA 5JZBA 5LM3A 5A5VA 4Q9NA 3GFVA 5IVDA 2Q29A 3WJ2A 1W88A 3GHHA 4EUFA 1TVCA 3U4CA 3K1AA 2OXRA 4I5EA 4ZC1A 1BO6A 1AS3A 3TRHA 1R7RA 1NOKA 4JZYA 4KK4A 2G0AA 5DMXA 2WPNA 2BR4A 2HIHA 2HK7A 3HG7A 5DASA 3G23A 4B31A 4JXJA 5D3QA 3F90A 4GDFA 2CEAA 4I4NA 4Z7QB 2BJWA 3PDIB 1DEHA 4EMUA 2PD3A 2DB3A 2P0YA 1ZS9A 4R51A 3CBGA 3RYCA 3UG7A 2O2JA 2HL6A 3M89A 5DI3A 4NS4A 3ZDBA 1XDDA 3NJ8A 4TTVA 1ID8A 1G9XA 2WMNB 1JDUA 1R6XA 2EEPA 2GJSA 2R1TB 3DMTC 2VSNA 1SBYA 1O94A 1JJIA 1BN7A 3U0VA 4IV8A 4Q9JA 1XNRB 3LD9A 3E22A 3EZ2A 4G4IA 3USES 2OENG 5TGZA 4EI9A 4X91A 2UXDB 3EQZA 1H94A 3A1UA 5BMVB 2JKZA 3HYCA 1OZGA 3DPIA 2PRIA 4GGPA 4RADA 1WB9A 1YRHA 4NCIA 4A0RA 2JLSA 1CUFA 2VHCA 4E5VA 1QIMA 1XLUA 3LLUA 1NP3A 1H93A 1UM9A 2ZYIA 2JGRA 4Z0NA 1ZJ4A 4IQGA 4BL5A 2OE2A 3RS2A 2FLVA 3NP7A 3VR2A 1NBWB 4DIFA 5CA1F 5IU6A 1DO8A 2CLLB 4RHFA 3TCXB 3OX4A 4KLZA 1XNGA 2NZ2A 4MPJA 1BRTA 1L1QA 4UAUA 1GQYA 1SNYA 2G4CA 2NVWA 5FR2A 1IY8A 4DFDA 4YRSA 6REQA 2SKDA 4IJUA 3KR0A 1AF4A 3OM8A 3OTHA 4Q3OA 4R9RA 2FSVC 3IAEA 3G0GA 5G53C 4LF7B 4PU0A 4U7PB 3DC2A 5BT8A 4HLQB 2E21A 1K92A 1TEVA 2WJZB 3G79A 2J3IA 4LTMA 4NDZA 4X20B 4DSOA 4CI0B 1ZUNB 2PYIA 3E70C 5KWIA 3C3XA 1M2OB 1VYTA 2VXOA 2ANBA 2O8NA 3K2BA 1SU7A 3L0ZA 2ORYA 1P9RA 3H18A 1F7VA 4Z53A 8MHTA 3ANNA 3U44B 2O0MA 3DCNA 4JEHA 4DV4B 1L7OA 1CK4A 1U3UA 2XUHA 3AERB 1SC3A 1YVUA 1N6KA 4KK3A 1YF3A 1G9SA 1Y6GA 3IAAA 1UKYA 1A5TA 1MT3A 3V2IA 1O94D 1XK6A 5BRJA 1SEPA 2JDIA 2Q1UA 1TQ4A 2ZT8A 1FUEA 4G2TA 5EC8A 1IXZA 1GCOA 3ZCRA 3DEJA 2H57A 1SULA 4AYTA 1ZH8A 4QPCA 5IARA 2ZANA 4TS1A 5ESDA 2IYUA 4PRKA 3I8XA 3H1PA 5FI0B 3EFOA 2OOKA 1T8RA 2AT1A 2J08A 4XZ3A 2QZ4A 2ZTVA 1U0TA 1FLVA 4FYHA 3V00A 3UJHA 4I6EA 3T3HA 5KO2A 4WZZA 3JQFA 3PQEA 1J7JA 3B6IA 3N07A 3FIJA 4N8SA 4YUZA 3V6MA 1KRHA 3GGCA 2QTTA 2Z95A 2XX3A 4EHFA 1L5SA 2DBZA 4Q3KA 1OTYA 5JTTA 1T6XA 3UVEA 3ZI0A 1O9GA 3R0QA 2DR0A 3DHYA 3WGNA 2G63A 4CHTA 3HKCA 3P9KA 4LNUB 5BP7A 1U63A 1V5WA 1XP5A 2BFEA 4HPJB 4OREX 1N2XA 4LRQA 2C4KA 1N7GA 1ORVA 3NVDA 3I52A 3TZQA 2IDMA 3ZLTA 5TQJA 3GXOA 1KP9A 4CM5A 3UHJA 3SC2B 3CF4G 3OPQA 4TGLA 3C3DA 4CIAA 5JAUA 4RMIA 4EGAA 3DZGA 3FLMA 1NIPA 5BUQA 2Q3DA 3FSGA 4FMDB 4S35A 1XQWA 1R64A 1Y48E 1R8JA 1JU9A 5EJAA 2C98A 3DFZA 3HWRA 5DIZA 1KJNA 2RHHA 3NYQA 3TR0A 4JI2B 1K8RA 2A1UB 4OHVA 4WX2B 5C37A 4DE5A 1I3LA 1QRSA 4I5GA 1GNRA 3GLVA 3VTZA 4BIIA 1NVAA 2FEXA 3WSVA 3RFXA 1R88A 1O95A 4I9UA 5CDFE 5ICEA 3FZQA 4FXOA 4XUGB 2JDID 4GE0A 2NGRA 3RYHB 1QVRA 5TT1A 1QJCA 2N0SA 3RUCA 2IYQA 5CB4B 1R4MA 1RP7A 2X77A 1R12A 5DW0A 1YA8A 1L7NA 2HX1A 1PR6A 2DHDA 2O5VA 4OGFA 1L3CA 1TQ2A 4M98A 4TTQA 3ZGXA 2XPCA 3RHFA 3ZK7A 4P98A 3C16C 3ICPA 3NBQA 4UC0A 4P4SA 2VDJA 5H81A 5EHXA 3N2EA 5IH3A 2H1WA 2R7KA 1ZUWA 1L8AA 1BXRB 1V3VA 3KLBA 2V8BA 4Q3NA 5IUKC 5TDHA 1SXGA 4JI5B 4EGQA 1OT5A 3AM5A 1ZN8A 4RJLA 1PYOA 4GX2A 1LRJA 5HDQA 2WHYA 4L2IB 1R0CA 2P91A 3U49A 1W6UA 3B6ZA 3T5GA 3G0BA 1QX4A 2CLDX 1QG2A 2RG1A 4B32A 2F9MA 3WMGA 4F4UA 4Y9UA 2F59A 3SQMA 3ZNQA 4PRZA 1HE5A 3A6KA 4M89A 2AEFA 2AFIE 2E37A 1JHAA 1Y80A 1KWKA 1CRLA 2ZVPX 3LBIA 3PC6A 3EMDA 3L5OA 1O8BA 1P18A 3CUYA 3M49A 4FYYA 2IEIA 2BW0A 2GBLC 2IS6A 1P9LA 1Z5PA 5JZVA 3GDOA 1GPAA 5CB6A 4ZV9A 5EZYB 4EEZA 2JI8A 1FUKA 4LDNA 3A1CA 3LBYA 5LIRA 2BFFB 3FSGD 4MW7A 3BSWA 3RFTA 3DF9A 1E64A 2PUTA 4I55A 1ZI6A 4A7PA 2I62A 3SSOA 3S40A 1SG9A 4BNTA 1Q7GA 5B7GA 4MW4A 3EXFA 4C88A 3LS2A 4G1FA 3LVQE 5ULLA 3E9RA 1TVEA 2HSEA 2RHTA 1DUSA 4YDQA 3BDVA 3OLXA 2CL7X 4R54A 4DV1B 3IV7A 1WZCA 2GVDC 4WKBA 1WXWA 1WJGA 2QTAA 2IZ6A 3KKQA 1SHLA 2D7CA 5FOSA 3V1TC 5E6RA 3CB4A 2JBAB 3VAYA 1P1RA 5FV4A 2V5VA 2J3EA 1GYRA 3NZEA 4ZVOA 2QT0A 3HB1A 4J1SA 3IQIX 1QLHA 4BO4A 5KWJA 3PNKA 2IH4A 3PJRA 1V1MA 4L5JA 3T9BA 3ESRA 4K0KB 4JR0A 4WMLA 3GPCA 5C8YA 3RUFA 3TX6A 3N0TA 1Z5ZA 1D4OA 1IZ8A 5JZOA 2HYDA 2FE1A 3FUTA 3GLHA 3TAUA 5L3SB 1KPGA 2K2WA 4DKJA 4TV8B 1DPGA 3R9KA 4CTKA 1NU6A 1ETUA 2QMQA 1QG0A 2QL6A 2TECE 4GYJA 4BKQA 1QH1B 3EVEA 4BO1A 3UENA 4DNPA 1SZJG 3S0JA 2HMAA 1P4AA 4LW8A 4ND8B 4E4YA 1I9GA 4Y1RA 1SJ9A 1EBFA 2J3QA 4EY3A 1JHDA 1TT5B 1HLFA 4NHOA 4K2HA 1IK6A 4E14A 1APBA 2RE8A 2FDCA 1ECJA 2HO5A 2P78A 4YJ2F 4W8OA 1QBGA 5KYUA 4NCXA 2FOIA 3ZZ1A 3LUBA 2RIPA 4PHTA 5KX5F 3L4JA 4ZANA 5MN4A 1FUIA 3KSMA 4FFSA 4FFBA 3GA0A 3IAFA 3KJHA 3WLOA 3K4HA 4C7XA 2BFMA 3CB2A 3WJ7A 4YP9A 3O0DA 1G16A 1GT6A 4BX2A 2YASA 2ZJ5A 2JD2A 5B2ZA 1G3RA 3RUDA 1LQUA 1XAIA 3MJVA 4BFSA 2PX4A 4CGZA 5SZIA 3Q0TA 1I1NA 1TNDA 4B3JA 3AXSA 3IKTA 1YU9A 3AF1A 2DCMA 1MFZA 5J4YA 3SI7A 5K6TA 3TS1A 2Q6TA 1OFGA 5IDXA 3BTUA 1YL5A 4WNAA 1PYGA 2R8YA 3O3MB 4IHJA 3CLRD 2BE9A 4HX5A 4JJ7A 3FPCA 3NX4A 4D8XA 4TYNA 4ER7A 3B7WA 3PXUA 4M38A 5IJ9B 3IDQA 1AC5A 1UT6A 1Y9AA 1J8YF 2VVTA 3SVZA 3WWEA 4O5AA 1LCIA 2XOEA 3H2BA 3QQPA 3R76A 3EXAA 1NYRA 1X0XA 1ZVMA 4S1VA 5B2EA 1UAGA 1GUDA 3MK31 3DOFA 3BMQA 4D4LA 5IAOA 5JSQA 2C1EA 1ABFA 5DF1A 2W6PA 1DFHA 2GZ3A 2I6UA 2DR3A 5FBLB 5T3UA 3U60B 3LWBA 4IZOA 1GAQA 3VKVA 2FA9A 3O90A 4NLLA 4ZFNA 2I4TA 8OHMA 3JZDA 2ADOA 1XPOA 2NU9B 1B7GO 2AHRA 4OHZA 2C2HA 4X1IB 2WU1A 2Z3WA 2VCYA 3KXLA 4M0UA 1KK0A 4B6PA 4B3MB 4RMJA 3SJCA 1IEXA 1NBEA 4QLOA 4RK0A 4XQEA 2W00A 2QRPA 2XNDD 4OBBA 4OI0A 1N77A 2J0UB 4ER6A 1LDGA 2X8LA 1ZIDA 4RVHA 3LCCA 4PPNA 1WMAA 2V4ZA 4K86A 1EINA 3QIAA 3HP7A 4QDJA 3JQDA 4D92A 1DC7A 3QX7A 4JUFA 3ZYZA 3BFXA 4MRNA 2QDXA 1ZPDA 4L8WB 1UJMA 5DOZA 2YL2A 3KOXA 3VA7A 2DUJA 2YQ5A 2YX1A 1NVDA 4JL6A 5DBHX 4WKOA 5KAPA 3HEBA 3KAPA 4OQPA 5KJCA 1DBPA 2XF2A 3MCAA 4M1YA 3DOUA 2OKGA 4NMWA 5E38A 1Q15A 5HXAA 1LU9A 4QYSA 4RHYA 4KR7A 5BR7A 1DG9A 3WWDA 2QORA 3JARB 4G0PA 2ZS7A 5MHTA 5FV7A 2H9YA 3ESXA 1H66A 3L0IB 2AMJA 4CM6A 3DR3A 3AZQA 4AICA 1VLVA 4XWYA 4JX8A 2AG1A 4QEKA 5B53A 2YV1A 4DAOA 3W1EA 1GGJA 2PWPA 4YPFA 5H80A 3VR6D 4AQ7A 4ZC8A 2AVNA 4ALIA 5HKOA 3WGJA 1UFVA 2QLLA 3RC2A 5KYWA 2AUTA 1EK0A 1K5DA 1LLQA 2C2YA 2C58A 2Y66A 3E1GA 3EODA 3MLAA 4MS4B 4Z0TA 4K05A 2CKDA 1GAWA 3UHAA 1SZCA 2XE7A 4HAWA 3W0LB 3HO1A 2NSHA 1P1FA 3N8KA 2NYRA 4LV6A 1OX4B 3E9DA 5K8IA 4DMHA 1XROA 4MUAA 4MVJI 2AC2A 3SJAA 2XB4A 3IE1A 1JPVA 4OHFA 4RS3A 3AVYA 3BIFA 3O7MA 5KYYA 1KI6A 1MG0A 3AJ8A 4AF7A 4C4YA 3LZCA 2YC2C 4HZGA 4MYHA 2XBUA 4JC8A 2H2FA 4BIMA 1B8PA 1GLNA 1DFGA 3DHEA 4P7BA 4R1LA 3AB3A 1GA6A 3C7AA 4YK7A 2GM4A 3EPJA 4EUKA 1YRYE 3AR6A 4M99A 4CG0A 2OBLA 4D98A 5TS3A 2Z8YA 2HQBA 1MQAA 2YHSA 3NYRA 4IUBS 1FYVA 3ICVA 1LNQA 5DTJA 4YMSA 4Z86A 2R5NA 2TRSB 1C7IA 3D3NA 1JDPA 2D4AA 3L49A 3P9NA 5DM70 1O0SA 4NJEA 2I5PO 3FMPB 3KD3A 1E2QA 1Y3BE 3EWIA 1E1LA 2V97A 4WLVA 1FSGA 1ZGJA 3K2IA 3QWIA 5H3LA 4D9HA 5TEWA 3IUYA 2G5PA 5DNYB 1LI7A 2PGOA 1QDLB 2WE8A 3EZ7A 3KKLA 3A6GA 821PA 1IVSA 2ZU0C 2XCSB 3MWEA 4MRMA 4MZDA 1K7SN 3A05A 4YRAA 5KU1A 5SY9A 1N2CA 2P9EA 3BGIA 2D6FA 4HI0E 2YIDA 3A6PC 1BD3A 4FHFA 1LBHA 5F7ZA 3SIWA 4PS0A 1OFUX 1A82A 3P0JA 3MJFA 4DIKA 2C95A 3KV1A 3RQIA 4PHCA 1G20B 4DNOA 1MVLA 3JATB 2ZT5A 3OC0A 2EKLA 2EAUA 4FX2A 4R40A 5L9AA 4BNYA 4P3XA 1JECA 1JFVA 1LS1A 1C14A 2DQ4A 2CJYA 3C5CA 2X76A 4KJZA 4KXMA 1P44A 4QXQA 4IIUA 4WASA 4CCAA 5FX2A 2VDKB 2XNKA 3FSJX 3W5UA 3RI3A 3UPDA 3OWHA 5EQTA 5EFOA 5FEUA 5D85A 1SU6A 3BCRA 1WUHS 3ZD6A 1MAAA 4LJ8A 2BMEA 3ZGNA 5LP6C 3UAYA 3G6KA 4B80A 4BMPB 5KIAA 1T34A 1I1OA 2IYWA 4NAUA 4BLWA 3RWMB 1GXSA 1C41A 2BMVA 5DYIA 1Z88A 4V38A 1WU8A 5HHTA 4DLZA 5LNK6 1BE8A 4D4IA 2C57A 3UK2A 1U0NA 4PCUA 1Q14A 4YJGA 3OICA 3RG2A 3USZA 5HRAA 2D54A 2QA5A 4LGCA 1KDRA 1C7RA 2X41A 3S1LA 1ESNA 1TTPB 4EKEA 4QO8A 5CA1B 3UBMA 3PEEA 3FB1A 3GVCA 4CR6A 2PA3A 2FFQA 4G63A 4KG7A 2B0CA 2UYGA 3ZHXA 3IBGA 4HGYA 1TRKA 4RNCA 4X54A 1Z07A 2PH1A 5AVVA 3GGPA 4RSGA 1T5HX 2IXFA 1BE1A 1JTEA 1Y5MA 3EHDA 4YRTA 1KGSA 2ABWA 2A58A 3HCDA 5EY5B 1EP2B 5AICA 3AEYA 3W1VA 1JA1A 3GPBA 4OYLA 1JHYA 5JZMA 2XI4A 1JJAA 2ZXFA 3GHYA 4PLTA 1T5OA 4DSAA 2ZRLA 4L4RA 4Q3AA 2HLHA 1Q22A 4L4YA 4DSUA 4G5XA 1XD9A 1IM8A 1SUDA 1JU4A 4R1NA 4BNVA 2ZRPA 1K8ZB 2WJ3A 3H8VA 5DVZA 3QF4A 4EITA 2OCPA 4IG4A 2O6HA 2HMYB 3H9CA 1DJQA 4AWXA 4BB9A 1G1AA 3BXOA 2D0DA 4UNNA 3R75A 3SJBA 1R5JA 4G6ZA 5JXGA 1WZNA 2YYZA 4NWIA 4P3PA 5I9BA 4DSTA 3HXQA 5K6RA 3WDMA 5FP0A 1WZIA 5JYBA 2UYQA 4S1NA 3A6FA 1OI3A 1T8PA 3DZFA 1JQDA 2ZE8A 3KB2A 1DJLA 2O7RA 4PNPA 3ZWKA 2BM0A 3JYNA 1LBQA 1S01A 1UXKA 1JL3A 4MVJH 4HDRB 4U63A 3WBBA 2VDLB 1VFPA 4NZZA 4XYMA 1D0IA 3M5CA 1YTUA 3CEMA 5LBTA 5JS7A 1VA4A 3GDGA 3GLTA 2Y1EA 4BNKA 3FCOA 2CZCA 1X1EA 2JASA 4L8YA 5CT4A 3SCZA 4AUMA 1WBBA 3V80A 3R8FA 3ZHRA 4KAAA 3EEFA 4OP1A 2GJKA 5EGSA 3X1YA 1E5XA 2A0YA 1U7PA 3ICCA 4JQYA 4DRYA 4X44A 1L5ZA 3VYUB 3R44A 1CF4A 5BOSB 3RVSA 4Q19A 4BNWA 2A78A 3G5LA 4IF6A 1ISHA 4W63A 2A84A 2GM3A 3UJAA 1RM5A 3B8HA 3OO0A 2Q3HA 4L8LA 4BGEA 1ISJA 3HU2A 2XNCA 2O06A 3AUTA 1YMVA 1AD2A 3Q4GA 2JAHA 1ZP6A 5LZ5A 2PN1A 3LQKA 1R00A 2V5UA 2A9KA 4JJEA 5ANRB 3OU7A 5F1PA 5TB5A 2QVYX 2IV3A 4TXJA 4MV7A 5CBPB 5J2TA 4E1VA 4HQ0A 1P5FA 1OX6A 1YR9A 2ZBUA 1FFCA 4X85A 1M8PA 1SZDA 4PBTA 4FHZA 4WZBA 5DK6A 4RESA 1WF6A 4MEBA 2OMKA 4LXTA 1CUAA 4K81B 4YNBA 2XUIA 4BGIA 4ZDKA 5IKPA 1XG5A 2W2LD 4IIEA 4V3CA 2XWBF 2C4VA 3A9VA 5BW5A 3ZDDA 2C3MA 4EYOA 3AFHA 4KNVA 1ZSVA 2JI4A 2X7XA 3RRXA 3U80A 3SVTA 3L4KA 2J32A 4XWGA 2AUMA 3G9XA 2BTOA 4ZVPA 3U19A 2XYHA 4Q3BA 4AO7A 3CZ4A 3R3WA 3JS5A 3N0XA 2BMDA 2FV8A 3IP5A 4WY5A 1VMDA 4B76A 2FI1A 1IY2A 4HH3C 4H18A 4IV0A 5GPBA 1QRTA 1TJ3A 5F7XA 5COBA 4YPOA 4BLRA 1N4DA 2VF7A 2W6JA 2DPGA 10MHA 1C4OA 3I62A 5LUAA 1CS0A 1RWMA 3OZXA 1MJ5A 2ZJ6A 3EISA 4HAZA 4UM7A 4PSCA 4IYJA 1AZSC 2BFWA 5PGMA 5BURA 3IURA 1RJ9A 4U8GA 4EYKA 4K9QA 2OHFA 5IYZA 2E4WA 2XDWA 4BAZA 4G65A 4CMIA 1M8KA 3VZSA 3DONA 4RTKA 4H7KA 2IHZA 5FWXA 3LT4A 4YAWA 4G4SP 2W6CX 4R1MA 2NV2B 2JFQA 4ALLA 2QL9A 1ABBA 2AFHB 4QLBA 3KKKA 5JFTA 1YZKA 4NEQA 5L4SA 3CKMA 1Z29A 5IZ4A 2QN6A 1ZIXA 2CC2A 1RLOA 4QUBA 1FLAA 4X65B 4B73A 4EUHA 1L5YA 4FCTA 5CDYA 2ZCJA 2DUUA 2V98A 2LUOA 2HU7A 1VE7A 3FB4A 4XSGA 5KYKA 2JCBA 3HN6A 1JR3E 1FZQA 4L08A 1JAIA 4N0DA 1QS0B 4PO1A 2LZ0A 3ZV5A 4EQ6B 1L7BA 2VS1A 1Z4NA 1T1SA 2XSZD 2VSOA 2MMCA 5CHEA 4HH4A 3EF3A 1QYXA 2X58A 3IMKA 3NTOA 3BIOA 4Y0VA 1ZRNA 5K7SA 2JZCA 2IU0A 5K0GA 2PZFA 3IILA 1AK2A 1I5OA 2E1RA 3OCVA 2R751 1MC8A 3PUIA 2GK7A 1O96A 2YJNA 1QG4A 4CBVA 5C8YF 2XLBA 1TMOA 1NVEA 2I78A 2X14A 2ZIGA 1ODKA 2ZUDA 3NAQA 3R74A 2Y77A 4RM3A 2C4TA 4M6WB 1SRQA 4QUEA 1U6KA 4N5IX 3TQFA 1DTSA 4TM8A 1SVIA 3PYMA 4RK4A 2AG0A 3M6XA 3U16A 1CE8A 1Y7LA 4L3WA 4KR6A 5DP1A 4MP8A 3FDXA 5FPPA 4CCSA 4JLUA 3TLCA 4TL7A 3HN2A 4MJLA 4A6DA 4LJ6A 1DQNA 3SXUA 4YJ2B 2PUAA 1NW5A 2D06A 2AN9A 3V42A 1QHFA 3FHTA 4N3GA 1KSHA 1S7CA 1XHLA 2BEWA 1YR3A 3PHHA 2W98A 1Z25A 2AS0A 1IEWA 2IIBA 4FYVA 4DLAA 2D62A 3JWHA 4ER5A 1PN3A 3E3NA 3DTVB 4HDAA 5BYBA 3KB8A 2OYCA 3VNBA 1AV6A 4M1SA 1KFEB 1H05A 4G84A 1OLXA 2C3OA 1TEHA 2D8MA 1G5TA 2KE5A 1W4AA 3LKDA 3NUGA 4HGQA 4R69A 4COOA 1NN3A 2PFSA 2VPZA 3C3KA 5AVKA 4BRUA 1PU2A 4I6GA 3FYUB 2H1FA 3KELA 1YHNA 1XL0A 2FR8A 7REQA 2GWHA 4FE4A 3W6ZA 3I1YA 5K05A 4O4JA 1ADBA 3KJGA 2YW9A 3GH1A 1VMKA 2Z2XA 3C85A 1ZL2A 4ZDIA 3QLJA 1U9CA 1UPFA 4WXRA 3F96A 3WX0A 4M0CA 1XTJA 1M2EA 4LV5B 1NAHA 4PS1A 1TEXA 1NJSA 1UMCA 4R3NA 5DU2A 4OHUA 1RJWA 2WUWE 4IHJF 4MULA 4QUDA 2I3GA 2IYNA 3OFNA 2VH2A 1M1XB 3QYPA 2NX2A 3IHLA 4UU7A 4X1YB 3KSAC 3ZJUA 2HBYA 5T41A 4XJVA 4RTOA 1RBQA 4TLEA 2D2XA 3GAFA 4G9EA 2A9OA 5BNWA 3A3YA 3WRWA 3LLSA 4IXMA 4KKVA 4UW9A 1UFRA 1VBNA 4Q34A 1OSNA 4UPVA 3RU7A 3K8ZA 2ZWIA 3I2FA 1FS6A 3R5XA 3MGKA 3RGWS 1PGNA 3JQRA 3KVVA 3M9WA 4LS3A 3QNWA 1GPBA 1HOXA 3W2TA 2YY6A 2QGZA 3SS8A 3NEPX 1T4CA 2FGKA 2PKRA 3IYLW 1CP3A 2HLPA 3F5FA 3GELA 2E1PA 4M49A 2YRWA 3RBXA 3FI0A 3BAFA 4FYMA 4JSRA 2VA9A 3SDSA 5BSVA 3ETGA 1UOOA 4QPPA 4ZYVA 3QWHA 2XMBA 1T0PA 2EGGA 2I80A 2QLNA 4GG1A 3C24A 5CYOA 4N40A 2QM7A 1RZUA 4MA5A 2C5EA 4U2EA 4TMTA 3DKIA 1TYCA 1Y1TA 4C0LA 1Z4JA 1Y34E 4C29A 2PE5A 2CY0A 5E1BA 1E9VA 5JR3A 4GR4A 4OHPA 2FG5A 4X1KA 3K9FC 5BPHA 4TXLA 2QYTA 4XIFA 1CVIA 4AJHA 3OTIA 1HKHA 1PFWA 4WQMA 2HR1A 1LW6E 1MQ9A 2Q5HA 2YCBA 2ZIUB 3MTGA 4RO0A 3VHQA 2GLTA 2SCUA 3JQ8A 3PC2A 2HGZA 5I7RA