5JLAA

Crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
257
Chain Sequence
b'ASAEFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRVARATGGKTLVLDVGEDASVTAAANEVRARYGVADVLVNCAGVLQRTLPPGELAQREWDVVSRIDLRGTYLCCAAFGAPMADRRRGSIVNIASVAGMRSGPLHAYGPAKAGVISLTETLAGEWGPKGVRVNCVSPGFTQTPALERGFTTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPVDAGYLIAGSWAAYGGLRRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative short-chain dehydrogenase/reductase
publication title Crystal Structure of putative short-chain dehdrogenase/reductase from Burkholderia xenovorans LB400 bound to NAD
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Isomerase
total genus 94
structure length 257
sequence length 259
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jlaA00
3V8BA 2WTBA 4DMLA 1G0OA 2J6IA 2EERA 1U4SA 3KSUA 4RQTA 1ID1A 4XIYA 3TZQA 4FJ0A 4ZQBA 5BR7A 3LT1A 4WECA 4J2HA 3V1UA 4EJ0A 1ZCJA 2ZB8A 2RIRA 4II2A 4HKTA 1ONPA 1U9JA 1DC6A 1E6EA 2J3HA 4IS3A 1DC5A 2EXXA 1GPJA 4URFA 2NLOA 5B4TA 2GO1A 5I9MA 4K28A 2PLAA 2HK8A 4R5MA 5DOVA 5JAZA 2W8ZA 1A7AA 2JD1A 2DVMA 4BNWA 4E5KA 1XU7A 5G0WA 4GGOA 1PZHA 3A1NA 4UEKA 3U09A 3VDRA 5TS3A 4DL9A 1DAPA 3HB4X 3RIHA 3ZZNA 4J4BA 3LT0A 1L1FA 2A9FA 4DLBA 1U3TA 3ORFA 3DBHB 1VL0A 1Y81A 2RBEA 3S1LA 3LLSA 1VE9A 2D3TA 4YAGA 1PWZA 3I9OA 3ADOA 4IQ0A 4LSMA 1BXGA 1LEHA 1VL8A 2C7GA 3JYNA 3QE3A 2JL1A 3OIGA 2I67A 4I5EA 4XEHA 4CUKA 4E4YA 4BGVA 4RPJA 2WE8A 4GH5A 4X54A 5DP1A 1Z75A 2VUSA 1YL7A 2Y68A 1CJCA 4CMGA 4E5PA 4KUEA 3I6IA 4PVDA 3U49A 3HN7A 1ADCA 4IMRA 1NHWA 3AUTA 3GHHA 2VOEA 2A35A 4XYGA 1XDWA 3JQDA 1LLCA 4CLOB 2V6MA 1DHTA 1WMAA 3GEMA 4WK6A 4E13A 1FK8A 1U2GA 5IDYA 3VVCA 3ON5A 3T4EA 1LSOA 3HHPA 2EJWA 2Y1DA 2WE7A 3OIDA 1CWUA 1IPEA 1YBAA 1PJCA 3B1JA 3GY0A 3I9MA 1HWYA 2G1UA 3RKRA 1R4NB 2WD7A 1AXGA 4CLRB 1YB1A 3B20A 4FFMA 4PZEA 3WTBA 5K6AA 3OQBA 1YB4A 9LDBA 3QWHA 3VPSA 1ZJZA 1E3IA 5HTOA 3JQ9A 4YVFA 2X0IA 4YJHB 3WQQA 4CM5A 4DXHA 4WLVA 4W7IA 5KJFA 1UXJA 3BAZA 4HP8A 4H7PA 1UAGA 2NVBA 1H93A 3PYMA 4EUEA 3RU7A 4PG5A 4JBIA 4MVJG 2OXIA 3EW7A 1BDBA 3AFNA 1AHIA 3AY7A 3KSDO 5T5QA 3GGOA 2ZYGA 3JYPA 1TT5A 3I6QA 4Y67A 3GZ4A 1UXKA 5U4QA 3DBLB 1JTVA 1J4AA 2AG8A 1PS0A 4GX1A 3WGHA 4M89A 1HE4A 4BO9A 1O0SA 4CLEA 1CIVA 4R1TA 4RQUA 2CMDA 2VHVA 1XEAA 4KWIA 1A71A 2X1HA 4NHEA 5ENDA 1MXFA 2FPGA 4JCOA 4AJEA 4AJ1A 1TB4A 2VT2A 4NJMB 1NQAO 3GGGA 3K30A 1HDRA 2WYUA 3CUKA 4GVLA 1I32A 2BGKA 1CERA 2Y93A 5JO9A 1HLPA 3KO8A 2PD3A 3P2OA 3DEYX 1RYDA 4KOAA 3K73O 4TVOA 5H81A 3DMTA 2PGDA 4PLZA 2XOXA 5IZ4A 3FR7A 1JLLA 4QECA 1PIWA 2Q1SA 4OOEA 1T1RA 4D46A 4IDDA 4I8XA 3JQGB 2HUNA 5ER6A 4L9RA 5ITWA 5BSHA 3UCFA 4R9RA 3MJTA 3RC7A 1H0KA 5C5IA 2C29D 3P19A 1OAAA 1OZAA 4I5GA 2D0IA 4PFJA 1A4UA 4CV1A 1E1NA 4BQPA 4IDCA 3WX0A 1ZW1A 3F5SA 1MB4A 1NFFA 1YOVB 1C0KA 2DAPA 3GEGA 3GQVA 3ZU3A 2IYPA 5JYDA 1C3VA 4YWJA 3ADPA 3FPCA 3KETA 1HKUA 3UICA 2C0CA 4FB5A 2NU6A 2HMUA 5DBFA 1ZVMA 1I24A 3FN4A 3VDQA 1K6XA 3INTA 5K6AC 3FNEA 4XDZA 3OA2A 2P9EA 1R6DA 3JD3A 1TLTA 2QZ9A 2HJSA 1GQQA 3JQ9C 4HBGA 5JYEA 5EESA 3DZFA 4OQYA 3INRA 2X8LA 3RJ9A 1EVYA 1BWSA 4WLOA 1HDGO 4ND3A 4RPGA 1I33A 2ZYDA 1QLJA 1P9LA 4RVUA 4BQRA 1J0XO 1SEVA 2R2GA 1FDSA 3EZLA 4RVHA 4P38A 4D45A 3GAZA 5AXAA 1ZXLA 2O7QA 1XHLA 3PHIA 1F06A 3LLVA 4G65A 3GR6A 1RM4A 2VWPA 1U8FO 4WJZA 1EEHA 3JTMA 4B7CA 3NTRA 1LLDA 2X0RA 3AY6A 3PHJA 3PYXA 2YJZA 2DKNA 3ZWYA 3W8FA 1PZGA 4NG5A 5IDWA 4Q3NA 3SJUA 3KXDA 3GMSA 5CEFA 2GZ1A 1GCUA 4IBOA 1EQUA 2NNLD 1P1IA 3BYZA 3OHSX 4XB2A 4AJNA 3VPFA 4NK5A 3RWBA 4CMHA 4Z6KA 1BVRA 3EHEA 5B1YA 1WNTA 4FFNA 1U3VA 4N54A 5ADHA 4RF2A 4GX0A 1HL3A 3D4OA 1Z7EA 2IRWA 3UCXA 3L0DA 4GKVA 5KJEA 1LRLA 4CL3A 4U5QA 2E4AA 1JQBA 1YO6A 4A2CA 1LC0A 2I99A 3ZHXA 3R0IA 4J4TA 3QWBA 4PCVA 2O4CA 2Y1EA 3D4NA 2JFGA 5A02A 3LQFA 5GZ3A 1ENYA 1QYCA 3OBBA 2VWGA 3DBRB 2FPPA 4BNYA 2X9NA 3P7MA 4PG4A 1VLLA 4XX0A 1OC2A 3IS3A 1V9LA 1WPQA 1B8PA 2CY0A 3OSUA 2O3UA 5EQDA 1MG0A 1U4OA 3AFMA 4XJSA 1HTBA 4CUJA 2F1KA 4WCFB 1SPXA 2NVUB 3ZW9A 1XSEA 1FDUA 2O2SA 2Q99A 3QLJA 4TROA 1XG5A 2H9IA 1U28A 1I30A 3D64A 3LF2A 2Y1FA 3PDUA 1I3KA 3EY4A 2XF8A 1CQIA 2I65A 4BIIA 4JJGA 2BELA 3ENNA 5IG2A 4PIVA 4FPXA 1I0ZA 1GZ6A 1FDTA 4QO7A 4ID9A 4MINA 4LN1A 4Q9NA 3RFXA 2VHWA 1E0DA 1SB9A 2W2LD 4MVJD 4R1SA 1ADBA 4B4WA 1BW9B 1V35A 5I9NA 1B2LA 1ZO8A 3F1LA 3N74A 4J49A 4Q3AA 4R16A 4XQGA 3RUDA 4LSWA 3VZPA 4Z9YA 3WIEA 3BMCB 4R1UA 1YBVA 3H5RA 4Y98A 3HDYA 4E5YA 2DM6A 5F5NA 3VPGA 4DWVA 1K0UA 2VOJA 3DHYA 3G1UA 3A9WA 1YXMA 1QYWA 2GR9A 2VZ9A 1YKFA 5FFFA 3QSGA 4J3FA 1ADFA 5JC1A 2EEZA 2YFQA 4D3FA 5T6BA 4QSMA 1C0LA 2Y1OA 1DIBA 1XU9A 1OFGA 3ZI0A 4YQZA 1AHHA 1H2HA 2NU9A 3VTFA 3FBTA 1I2BA 3IUSA 1P1JA 2X5KO 3W8DA 4ZQEA 4Z0PA 1VI2A 4R3NA 3U4CA 3HNPA 4DBVO 2ZTUA 1KBZA 3BMOA 5JBIA 5A3VA 4LCEA 1VKOA 4WNIA 1K5HA 3M2PA 5A1TA 1WVGA 4S1VA 4LGVA 3ONEA 4B3JA 3PZRA 3ZWPA 5KKCA 3I5MA 5BNIA 1YQXA 2O3RA 4RPKA 2D2IA 2EGGA 2NV6A 4WLEA 3C7AA 2BI7A 5IN5A 1U2DA 4RDIA 4WLUA 4DPMA 1YDEA 4EW6A 4FGSA 3PWKA 5EQFA 4EGFA 4ZHSA 5AXDA 4BMSA 4GBJA 3QJ5A 2DTXA 4GSLA 3ZV3A 2WJPA 2W2LA 3Q9NA 4MVJA 4UEOA 1P1FA 4IS2A 3I23A 5A04A 4BKOA 5KCZA 1EE9A 2DBZA 3RUIA 4YXFA 2LDXA 4D0RA 1R4MB 4YJDA 1HSOA 2B37A 3KYDA 1Z74A 2BHLA 4BMNA 2G82A 1ZK1A 3PHLA 3MEQA 1GUYA 3L4BC 5A5EA 3KM0A 3ZWBA 3K8ZA 1QYVA 2GSDA 5TQVA 5TSDA 1N8KA 1EE2A 4CM9D 5KTKA 4AG3A 3D4PA 3NDIA 4ZN6A 5HWSA 1JA9A 4QO8A 1ARZA 5DDIP 1M66A 4XA8A 5L4LA 1L7DA 1K2WA 1PL8A 2DUWA 1Z82A 3E82A 3ZU4A 4OKIA 4LRTB 5DBIA 3JQ6A 5ER9A 3ITKA 3DFUA 3KRTA 1SEPA 1HE2A 5JO0A 1OI7A 5JLAA 4BNGA 2HMSA 1NM5A 3MJCA 1F8FA 1TI7A 3AI3A 2GASA 3NX4A 3ZWAA 1PEDA 3ONDA 3D0OA 5IAAA 1HDZA 4CMJA 4XGKA 3S2FA 3GC6A 4O63O 2BKAA 3DDNA 4RZIA 2EHDA 1DHRA 2EKPA 4XYMA 3SX2A 5TIIA 2CSUA 2IZ1A 1BSVA 5TC4A 1E7YA 3RC9A 2EV9A 2C59A 1DFHA 2FZWA 1V6AA 1PU2A 3TZ6A 4UVGA 3E8XA 3OP4A 2Z1NA 1HE3A 5ITVA 1GCOA 4U6SA 4J6FA 1PZEA 3IP1A 2Y0EA 5I7EA 1HRDA 2NVWA 1P1KA 3GN1A 4L4XA 4MKRA 3RBVA 3WNVA 2Q45A 4Y6RA 1N2SA 1FDVA 2PA3A 3SEFA 3COSA 1X14A 3ANNA 3K2BA 3ZNOA 4D7AA 3E9MA 3ZGYA 3GVPA 1KC3A 8ADHA 4E3ZA 4FJ2A 2YHIA 3FF4A 3GVXA 2NACA 5I7SA 2NWQA 4JP3A 4R01A 3ICPA 4WLNA 2O3QA 1U5CA 4CM9A 3D5TA 4E30A 4B3IA 3RBXA 1DAOA 2YV3A 2RHRA 5C7OO 4XIJA 1QV6A 3NDRA 1K89A 1J5PA 1JAXA 4EZBA 4QXMA 3BXXA 1WAMA 3LDHA 1PR3A 4DLLA 2P4HX 3WWYA 4J91A 4ALMA 5CDYA 3PZBA 4K1LA 1NR1A 3RD5A 2PNFA 4GPD1 5TX7A 1P31A 1LJ8A 3FTNA 4CM4B 2GCGA 2X0NA 2V65A 4DPKA 3GZNA 5G0UA 3WGZA 4RJTA 4BHTA 2Q1UA 4CMBA 2J3JA 3LF1A 1C1XB 3V5NA 1EFKA 1J49A 1TXGA 3RUAA 4GLOA 3ZCXA 1D3AA 3W8EA 5COQA 3JD2A 1IZ9A 2D5AA 3DAPA 1JKIA 3DHEA 3AW9A 3VH3A 1DEHA 4BNUA 1ZKMA 4BO2A 1M6HA 3JQ7B 2OHXA 4ZD6A 1PSDA 1HYHA 2F00A 3UF0A 4IPTA 2YHUA 5T8KC 3SJ7A 4YJGB 3GF4A 1O95A 1E3EA 3WGGA 4LMRA 1HYEA 5T57A 2HMWA 3HE3A 4KUGA 1CEQA 1E3WA 5L95A 2O7SA 3MOGA 3TZHA 3ZWMA 2DT5A 2IXAA 4YA6A 1D1SA 4YACA 2ZIZA 5ENVA 3Q9UA 1XIVA 1LQUA 4AJ4A 3U62A 4QUKA 4ZRMA 5B4UA 4IDEA 4IJVA 1BHSA 4NFHA 3AU8A 5FI5A 1XELA 1MA0A 4GLLA 3V1YA 2AMFA 1BDMA 2J5KA 1X0VA 4AJPA 3UCEA 3BTOA 3P5SA 4TZKA 3NT5A 1VJ0A 3OFSA 3K5PA 3U0BA 3O4RA 1PS9A 4TWRA 1VJ1A 3O8QA 4DIOA 2B83A 2YDYA 2G5CA 5A3JA 3JSAA 4HY3A 1W8DA 1G0NA 2X6TA 3BTVA 4XQ9A 5JDIA 2H63A 4RF3A 1DLIA 3ZHYA 2I66A 3JYOA 3TRIA 5FWNA 4YBZA 1WWKA 3BZUA 1GY8A 4TQGA 3TOXA 3I9LA 3WOHA 4CQLA 4EUHA 4L76A 5CG2A 5A9RA 5L45A 4PG8A 3SC6A 3UHAA 1ZEMA 2CVOA 2PKQO 3JD0A 2FHSA 4R51A 5JE8A 2ZB3A 2FP4A 1VJTA 1ZBQA 2BFPA 3RUHA 4AL4A 2EJVA 1PL6A 2Q49A 2YYYA 3F9IA 1MLDA 3QY9A 3ZWVA 3ITDA 3GRPA 2UV8A 5THQA 3KBOA 2BRUA 1LXCA 4Q3DA 4YB8A 3K92A 3PXXA 2PR2A 2EP5A 1V3VA 3O26A 2QQ5A 1NPDA 2PK3A 3CINA 1SOWA 3F46A 4WE3A 1EBFA 3ICCA 3NUGA 5HS6A 1EVIA 3DWFA 5DN9A 1F8GA 3JQAD 4YJFA 2WEKA 3VZQA 5AQ1A 3TF5A 3KEOA 4WCDA 4O0LA 4A03A 4KQXA 4INAA 1S7CA 4M86A 3I83A 3WLEA 4JK3A 3QVOA 4LW8A 2HMVA 4L4RA 3RC2A 3MJVA 1I3LA 4R54A 4E5MA 4O6VA 2V7PA 2AQKA 3KYCA 4GVXA 1S6YA 4GGPA 1N92A 3ZV4A 4CUZA 5BQFA 1CRWG 2YQ4A 4UVEA 2DBVO 2QRJA 4PLYA 1PJ2A 2PKRA 3NDJA 1E5QA 1ZK0A 3CZRA 3QWFA 2VNAA 4BMVA 1P77A 5GY7A 4HWKA 2NTVA 1PJ4A 2AEJA 1X0XA 2AQ8A 2G0TA 2I3GA 3E9NA 5CFZA 1C1DA 2ZB7A 2P5UA 1QSGA 1H2BA 3D3WB 4WEQA 4L74A 4E0BA 2NQ8A 3C8MA 4EI2A 1ZK2A 4HFJA 4BNMA 4ND4A 1GD1O 3TL2A 2IE0A 3AUUA 3IL2A 4W82A 1F17A 4IQ8A 3S8MA 3NKLA 1QR6A 1KETA 1U3WA 2YQ5A 4E2WA 3T4XA 1O5IA 1EQ2A 3PGJA 3DOCA 4R68A 2Y67A 5JDIC 3C7DB 3OJLA 3VPHA 2POQX 3HQ4O 4RPLA 3GVHA 3A28A 3AY3A 4FFPA 1B26A 1AXEA 5KKAA 3JQAA 3GN2A 4MVJI 1NASA 2C7VA 2PGJA 3JYLA 2NTJA 2IZZA 3WB9A 3DTTA 4W4TA 3E03A 4YCAA 1F14A 1T2CA 5HBRA 5JAQA 1XGKA 4OOFA 4DLAA 2AE2A 1Z45A 1HYGA 2HK9A 3JCZA 5DP2A 1ZK3A 5F3RA 4IIVA 1LSUA 1LU9A 4R3WA 1PGOA 1I3MA 1DPGA 1RM3A 4UUOA 5L40A 4BB5A 1Y9AA 3GNSA 3ROMA 1QV7A 3ST7A 2AEFA 3GUYA 1E5LA 3DB2A 3OA0A 3VOSA 4AJKA 4CMIA 4UVIA 2O4UX 2G76A 1R15A 1N1GA 4XRGA 2BMAA 3BHMA 4RLHA 5FI3A 2ZCUA 4RZHA 2X9GA 4ZU3A 3ZV6A 4BB6A 1X7HA 1GR0A 2HQ1A 5I8ZA 3H2SA 5ILGA 3IP3A 3UN1A 4NDNE 3GK3A 4IZHA 1E3LA 1KVUA 1XR3A 1HDXA 4I9UA 3JYQA 4J0FA 1E6WA 2A4KA 4OXKA 3DAFA 4I5DA 1Q7BA 4WPGA 1M75A 3EUWA 2GRAA 5FEUA 2JFHA 2O50A 1BXKA 1K6JA 5H82A 4JXKA 1LDEA 5CEEA 5HS4A 3OQ1A 1F12A 4YR9A 4NZ9A 4XJTA 4B4UA 2IXBA 1PQWA 3U9LA 3V1TC 1RWBA 4NI5A 4AICA 2GN8A 3L4SO 2BGMA 1YL6A 4AJJA 1PGQA 1PQPA 3FSRA 2Q4EA 3WYEA 4U0KA 1XWFA 5MGBA 2V6GA 5COBA 1C0IA 1UXHA 3I9NA 2VHXA 3DOJA 2CF5A 5KWEA 3DBVO 3PGXA 4IXWA 1ISGA 1NQTA 2HCTA 2GN9A 1DLJA 3TQHA 2P91A 1K6IA 4A73A 4FJ1A 3H2ZA 1MV8A 3L07A 2YUTA 4CJXA 4YAJA 5JNLA 5CEJA 4EJMA 2WYWA 1T1SA 1P45A 1QYXA 5CP8A 3PLNA 4FCCA 3OJ0A 1ZNQO 3H9GA 3IQDB 1JW9B 1U3UA 1U7TA 1IYZA 3ASVA 1UP7A 2GNAA 4HNGA 5EIOA 3ZWNA 2RHCA 3ROKA 1P0CA 1H6AA 2LDBA 2I76A 1HF3A 3FR8A 1VC2A 4DQXA 1BXGB 4AFNA 2B35A 5AVOA 2BFOA 1T4BA 1PJLA 3F3SA 4UEJA 1HE5A 1P1HA 4CL8A 3DBRA 1A7KA 4YEDA 4CM8B 2NUAA 4XB1A 5GZ6A 5L7TA 4DQVA 1P3DA 1NPYA 3QQPA 4DIFA 2HK7A 2WSBA 4EBFA 3PQDA 3FD8A 3L6DA 3K9QO 4BNKA 1IULA 2W2KA 5TGDA 5CDTA 3RJ5A 1D8AA 1ZK4A 3OMLA 4AJHA 4Z0HO 4PLFA 1Y6JA 3D3EA 1YQDA 2OMEA 2I3AA 4BNLA 5EL0A 8LDHA 4W9NA 1PTJA 1UDCA 2Q2QA 1NPTO 1OC4A 4BO1A 4ROSA 4G5HA 4KDEA 5DNAA 4GX2A 2Y1GA 4HX5A 4XYBA 1AGNA 5JAIA 3MJ4A 3TWOA 3TDKA 3W6ZA 3OICA 2WD7B 1NAIA 2CVQA 3LZ6A 4FDAA 3G3EA 2DBQA 1EBUA 3AOEC 1CQJA 4FOOA 3U4HA 5EINA 2VWHA 1GZ3A 3N7UA 2EF1A 3NV9A 3TN7A 4CM7A 3OIFA 3TFQA 1GQ2A 1LTHR 3G1TA 4DREA 1NQOA 1SZJG 4W7HA 2PTGA 4C4OA 3LT4A 4FN4A 1ZSNA 2OL4A 1E92A 1ZFNA 2PWZA 2YV2A 1MG5A 1R12A 1N9GA 1ISIA 1R0LA 2AQHA 4XWYA 1GZ4A 4XQCA 3CSDA 2FR1A 3JQFA 3Q3CA 4QX6A 2X5OA 3PIIA 4B7UA 1NVMB 3IMFA 1T2AA 3OEWA 3VVBA 3E5MA 1DFGA 1LDGA 4R9SA 5DCUA 2JKVA 1LLUA 1Y8QA 1E3SA 2PY6A 4BNJA 3D1LA 4M87A 2PZJA 4ITUA 3ZU2A 3WJAA 3RFVA 4M1QA 4E21A 2DLDA 3FNFA 3NJ8A 4A0SA 1A72A 1NFQA 1Y5RA 2PKQP 3H3JA 1ENOA 4GWKA 4PLVA 1WDLA 3QVSA 4OO3A 5IXSA 1ONNA 3NAQA 4WCFC 3DOOA 1NWHA 1Q0HA 3EMKA 4PLCA 3I4FA 1A5ZA 3GG9A 5CHEA 3B1FA 2XXBA 3BMQA 3CIFA 3L4BA 4H15A 4PGFA 2X0JA 4W9NC 2QIOA 5LDHA 3CH6A 2HJRA 1KEWA 2GZ2A 4AJLA 4CMEA 1RJWA 3GPIA 3CKYA 3HSKA 3RU9A 4CV2A 4RV9A 1AE1A 1WZEA 3SXPA 3WSVA 4OQZA 4HNHA 3Q11A 4MO2A 4Q3EA 1LQTA 5F5LA 3AUAA 4MDHA 3EYWA 4AJIA 1B16A 2WWRA 1GTMA 5THKA 3WLFA 2FSVA 2FOIA 3QVWA 4MPDA 5TNXA 1Y9EA 3LYLA 1UJMA 3ANMA 4DC1A 1D7OA 3IKVA 1YE3A 3U5TA 1WP4A 3UGKA 5T64A 4CQMD 3V2GA 2FSSA 4Q3BA 5L4SA 2OUIA 1DFIA 1KVRA 1GAEO 2DTEA 3W4JA 1B8UA 4IDBA 1JN0A 3GFGA 3M2TA 1ZH8A 1WXDA 1AUPA 4A5OA 4J1QA 4FR5A 3E5RA 5C3MA 1E77A 1EUZA 4RL6A 3RBZA 3C1AA 1A9ZA 3AM5A 4H3VA 1FF9A 5KJ1A 3JQFC 1Q1NA 1X1EA 1YONA 4IDAA 1Y8RA 3ZNPA 4BNNA 4NBVA 5JW6A 2ZK7A 5IN4A 1RYEA 3HB5X 5T67A 3JQ8A 4E2YA 4RCVA 4PZCA 5G4KA 3WNQA 5BNTA 3L6OO 2R00A 3KZVA 4MIYA 2D1YA 4PRLA 3SLKA 4B7XA 4PG6A 1H6BA 5BSEA 3HFGA 2A92A 4BNVA 2JCYA 2CD9A 2WYVA 2ILTA 3S2GA 4XRRA 3PDJA 5A9SA 4DTIA 3W4KA 5JAMA 3UUWA 3WGQA 4BNFA 3HJAA 3OJOA 1WDKA 1A9YA 1LBEA 2AXQA 5IFLA 2E37A 4E32A 3H7AA 2DUUA 2FR0A 3HDQA 5F1PA 3F4BA 4RVDA 4MKXA 1I2CA 1GUZA 2EWMA 3C3XA 3TL3A 3PK0A 2H5LA 1M6WA 1ONOA 4JJIA 3ZV5A 2H6EA 3I9KA 1MFPA 2PFGA 3GDGA 4JBGA 4NH4A 4XD2A 2UYYA 3OJFA 2VYVD 3MTGA 3VKUA 4CMEC 1DIHA 1JKFA 3OJEA 3PQFA 4CQMA 4B4OA 1YWGO 2E6UX 4GMGA 1ZSVA 4XCVA 4ZQGA 2NU8A 3WGOA 4YYZA 4A7PA 1GUFA 1GU7A 1OBFO 2C2YA 4Y8VA 3IJRA 4J43A 4BGIA 4RO0A 2B36A 1PL7A 1ISMA 2AHRA 4HFNA 5JMWA 3Q6IA 4TRJA 4L8VA 1ORRA 1PGNA 4J90A 4FD3A 4TRNA 1I8TA 2NTNA 2PH5A 4MIOA 4QEDA 3OM9A 2DPHA 2VZ8A 2GN6A 4IJUA 4CM6A 1RM5A 3BIOA 2GF2A 1I2ZA 5T8KA 3DMYA 3D5QA 1WDMA 4PZDA 3OH8A 4B79A 3ZH2A 1F0YA 4D41A 5JY6A 3CTMA 1QORA 4FFLA 4TZTA 4OAQA 3KB6A 4KZPA 3WFIA 2P9CA 4EYEA 3PI7A 3I52A 4PVCA 1QP8A 1JWBB 2C07A 4E2ZA 2UVDA 4IXTA 3EC7A 4IGEA 2IZ0A 4UUMA 3DZJA 4BNXA 3FRJA 3MTJA 4KTVE 3WDSA 4WOKA 4ESOA 3BMNB 1DO8A 4YT2A 3IKTA 5JSFA 1E6UA 4YT8A 1HT0A 1X15A 3RAJA 2J3IA 2R00C 2NADA 4OXYA 4RPHA 4YDRA 1NAHA 4BKUA 1P33A 3GPDG 5C37A 3TJRA 3ZW8A 3GGPA 3G17A 1Y7TA 2VYVA 5DCWA 3WYCA 1QMGA 4L0QA 1MXHA 3SC4A 4F46A 1FMCA 1XA0A 2ZATA 5DCYA 4CLDA 3CXRA 3BMOB 3G49A 1U7HA 4OKNA 3C24A 3IOYA 2VTEA 4ALKA 2E82A 2PH3A 3WWZA 2OORA 1DJNA 4N5LA 3JD1A 4MP3A 1TA4A 1GV1A 3DO5A 4N7RA 1ULUA 3ZNNA 1B14A 2VNSA 4Y6SA 5G0SA 4EITA 2CDCA 2GD1O 3QV1A 4OM8A 3WGYA 3ZHZA 2QYTA 3DZHA 3AU9A 1QG6A 1HDYA 1UZMA 1WZIA 4YQYA 3OQ6A 1W4ZA 2B69A 4WASA 1UR5A 1KYQA 1GV0A 2PZMA 5BSGA 1DDOA 5JS6A 1PWXA 5I9LA 2OBYA 4FFOA 2ZYAA 1YRLA 1O89A 2ZTVA 1KVTA 1Q7GA 1KY4A 1OOEA 2JCXA 3Q2IA 3A4VA 3KYDB 1XYGA 4B8WA 5CDUA 3CEAA 3H6KA 2B5WA 1EK6A 2W90A 4TKLA 1R37A 1ADGA 1UP4A 3H9QA 3PJFA 2DU8A 2O2YA 3G0OA 4G2NA 4BS9A 2VQ3A 4CMKA 1DJQA 4IY1A 3UXYA 3GNTA 5BNFA 4A27A 2J5RA 1YVEI 1LLQA 1KEPA 2FPIA 4DIBA 2OO5A 2FN7A 2ZTLA 1LUAA 4Z9XA 4BO4A 2VUUA 3X2EA 2CFCA 2GERA 4N5MA 3Q2KA 3MOIA 5J23A 3I1JA 1H6CA 4K26A 1TT7A 4IINA 5DT9A 1P44A 3CE6A 3WQSB 2CUKA 1ML3A 2WMDA 2PZKA 3C85A 1T25A 2IDZA 2YV1A 5A03A 2FRDA 4OH1A 4JNKA 4J1NA 3RKUA 4RF4A 3GFBA 4PLGA 4F45A 3QW2A 1PR9A 4AVYA 2P5YA 4CV0A 5EJ2A 4GSKA 4O1MA 4J7XA 4NBWA 4LISA 4UUNA 3PRJA 3EDMA 4KTTE 6ADHA 3DR3A 3AUSA 2Y1CA 1W6UA 4BGEA 3GOHA 4CMCA 3EZYA 3ENKA 3WSWA 2HO5A 1PQUA 3JQBA 4FGWA 4NMHA 1Y5MA 3H9EO 4XR4A 1E3JA 2JAHA 4I5FA 4EJ6A 1J6UA 3DBHA 2XPCA 3DZBA 5CPBA 1D4FA 4WOJA 1UDAA 3H5AA 3TOZA 2WDZA 1SO8A 4DMMA 4J7UA 3GT0A 5G2OA 4QQRA 3GDFA 1YL5A 1EUDA 4XGNA 2DTDA 4K6FA 1V3UA 4U8GA 2SCUA 4JJFA 5C7IO 1DIAA 2YHIB 5F1KA 4YRAA 1T4DA 2JAPA 4M49A 3G79A 1U1IA 1NX6A 2X4GA 3B70A 4KP7A 2O3SA 1RM0A 4BOYA 1LNQA 1M2WA 1PJSA 4CLOA 2AG5A 3L77A 4NU6A 4RGBA 2CDBA 1MUUA 4G81A 1VSVA 2C20A 2PV7A 1UXIA 2A94A 2HAEA 3MJEA 4I08A 3KUXA 3PWZA 3R3JA 2G17A 1PJQA 2GN4A 4Q3CA 2DBRA 4TSKA 2DFVA 1R4NA 3KSZO 4MP8A 4CLRA 2OBNA 2E48A 4BVAA 1N7HA 2B4TO 1E7SA 4RLSA 2YZ7A 5FYDA 1SOVA 1KC1A 4DPLA 1KERA 4YJHA 4CLHA 2JCVA 4TVBA 3OECA 4F3YA 1E1KA 1R66A 5EN4A 5I8WA 4JX8A 4OHUA 4DA9A 3DHNA 2DC1A 3STHA 4BO8A 3OF2A 2HMTA 4JGBA 4RORA 2JD0A 2Q46A 1ISFA 3O9ZA 1VSUA 3ETEA 1Q2XA 4ND2A 2OOSA 4C7JA 1H9BA 3CZMA 1YB5A 2O3JA 4FC6A 4UVDA 4LMPA 3NEPX 4U0JA 4WNCA 1E3WB 3AWDA 3KHUA 5GZ1A 5KVQA 3WTCA 4PLHA 3DBLA 7MDHA 5EMHA 1DOHA 5LDGA 3RVDA 3W6UA 1E7RA 1DC3A 2Z1MA 9LDTA 1EDZA 4OXNA 4BGUA 5I7FA 3JQBC 1NVTA 3WGIA 3QWAA 5AXBA 1VRWA 1JKJA 1LI4A 5IJZA 3GEDA 2JHGA 4NJMA 3WS7A 3VHRA 2X5JO 2VHYA 4HFMA 4N18A 3NT2A 4NJOA 3VZSA 4BO3A 3VPXA 2WD8A 2Y0DA 5B12A 4BO7A 1CYDA 1E7MA 6LDHA 2RAFA 1W73A 3O8QB 1GYQA 5TLSA 3HADA 1ZZEA 3VH2A 1KOLA 3NTQA 4OSPA 3F1KA 4FS3A 1GEEA 4LVUA 4RVGA 4WGGA 4P4GA 4DGSA 5IZCA 4CLXA 1Q0LA 4Z0TA 4XQEA 2VUTA 3JQGA 4M8SA 1EFLA 4HV4A 2QW8A 3EAGA 4J1SA 2C5EA 4CQLB 3QRWA 1EZ4A 2JD2A 4A26A 3DAGA 5DBGA 4S3MA 3QHAA 4O59O 1YOVA 3LC1O 3GH3A 1DIGA 3PYLA 3INGA 4MVJM 5IXYA 2UDPA 4YPOA 3ZHBA 4NBUA 2VYND 1U8XX 3TFOA 5ICMA 1Z7BA 4CM8A 2Y99A 5A5FA 4B3HA 2QYSA 4J2OA 1KEUA 2DFDA 2EG9A 4D44A 1BG6A 5JCXA 2J8ZA 3LT2A 5F1OA 3HUDA 4LRSB 3DFZA 1UUFA 1GPDG 4XGIA 4DC0A 4YJFB 4R1NA 1LRKA 3PIDA 4GWGA 1U5AA 4NR0A 3WIDA 5BSFA 3ZWWA 5KOIA 1JVBA 3RSHA 2FY8A 2XAAA 4O5OA 1XCBA 3GRKA 2AE1A 3PFWO 2VHZA 1Q0QA 1YQGA 4ND1A 3W1VA 2YW9A 3GA0A 4ZGWA 1QLHA 5HM8A 3KYCB 1YBMA 4W99A 3S2EA 4ALIA 4PN3A 1XQ6A 3HDHA 5CG1A 2O3TA 4IDGA 4P4LA 4GX5A 1UAYA 1O6ZA 3AOEA 3HWRA 5U1PA 2FZEA 3WYBA 3UAGA 5JPIA 2ZKLA 3AI1A 2GPTA 1KVQA 4AJ2A 1KS9A 1C1DB 3KLPX 2QZZA 1N7GA 1N1EA 3T7CA 4P22A 1IB6A 3R1IA 3B6ZA 2Q4BA 4E5NA 4IJKA 5GMOA 5JXWA 4JN6B 4CODB 3IDSA 2C2XA 1NVGA 1C0PA 1CETA 2NM0A 1SNYA 1UDBA 3NGLA 1PGPA 2VYNA 3H3FA 1QRRA 3BTSA 2EKLA 5HA5A 1DXYA 5JFOA 3JQEA 5TRTA 4ALJA 4EUFA 1YH3A 3BA1A 3WBBA 2J3KA 4M55A 5IZCC 1LRJA 2HLPA 3QVTA 3GLQA 1DRWA 4PG7A 2EGHA 4IZIA 2RH4A 3VAZA 4Y6PA 3FWNA 2PD4A 3U4IA 3M1LA 3JQAB 3UW3A 4OSOA 4W6ZA 5H83A 4MJLA 1Z6ZA 3IAHA 2P68A 3WMWA 3AOGA 3ABIA 3PHGA 1B0AA 2RCYA 4UREA 1HLDA 5FF9A 1XLTA 5DULA 3KLMX 4TRMA 3NJ4A 4RF5A 3GMDA 1JDJA 1ZMTA 2B4QA 1LC3A 5L9AA 1DRUA 3VZRA 4D0SA 4JP2A 4ZA2A 3E6AA 4WCFA 4YAKA 2NVUA 3RC1A 1B3RA 4P4NA 1IUKA 2TMGA 2UAGA 3ANLA 2VZ0A 4Z3KA 4ZJUA 2Q1TA 3SLGA 3IUPA 3M6IA 3L9WA 4R41A 1EDOA 3PHHA 4CMIB 5L7WA 1X13A 3RUCA 4BUCA 1T26A 2CVZA 3N58A 3HG7A 1LX6A 1IPFA 1NXQA 3A14A 3LSYA 1Y1PA 3DZGA 3OEYA 4MP6A 3GVIA 3H9UA 4CMAA 3LK7A 4DRYA 1BW9A 4I9HA 1V3TA 3MWDB 2UUOA 4RVFA 4DBZA 4F6LA 2BLLA 4JBHA 2BI8A 2H1SA 2P2SA 4WLFA 5CPFA 2GYYA 2WM3A 3BMCA 3FWZA 2OGUA 1HZJA 1YJ8A 3GNQA 2VCYA 3H9JA 5LC1A 3X2FA 5TJ9A 2Y66A 5AOVA 2Q50A 3PVZA 3PP8A 5DF1A 1YS4A 2E49A 2J5QA 5B37A 1JVSA 2W98A 4IMPA 2HRZA 5TF4A 1T2FA 1NQ5A 3D7LA 4QT0A 3PEFA 1VL6A 2AA3A 2EW8A 2VRBA 2Q2WA 4RDHA 3RROA 1P74A 4ZQHA 1I01A 1TT5B 1T2DA 5ES3A 1NYTA 4II3A 2AQIA 2GGSA 3IC5A 4DUPA 2CDAA 1JWAB 4NNJA 1ULSA 5IF3A 2VRCD 2VWQA 3UOGA 3L9XA 1BVUA 1W0CA 3TNLA 1BGVA 1HDCA 4D3DA 1EMDA 1EUCA 2B5VA 5TT1A 4UVHA 1UP6A 3C1OA 4NFSA 2NQTA 4YRDA 1UH5A 5CDGA 1LDNA 1MGOA 3MCVA 4L73A 4CR7A 3VKVA 1ZJYA 3DMTC 3PQEA 1A27A 4FSHA 1O9BA 1R0KA 4QFDA 4GI2A 1IY8A 4ZRNA 4A10A 4D79A 3H4VA 4R5HA 1HDOA 1X7DA 1O8CA 3VC7A 1BTOA 4K9DA 3CMMA 2EW2A 1R4MA 3EGOA 3FPLA 2BGLA 1R0SA 4ILKA 4DYVA 2O23A 2QRKA 5G4LA 4ALNA 3FHLA 4FQ8A 2D8AA 4E31A 3ROQA 2IODA 4GAEA 4JQCA 4FFRA 1B8VA 2EIHA 1H5QA 2BFAA 3W4IA 3UH1A 4C7KA 2X7HA 4XR9A 2ZJ1A 3JQCA 4GKBA 1FDWA 4EEXA 1SMKA 3RQSA 2W2KB 4WEOA 3T7EA 5TJHA 4DYDA 3PTZA 1E7QA 2X58A 4E33A 5L3ZA 3K6JA 2VRCA 3TPCA 4B4VA 3M1AA 1RKXA 3ASUA 3PJEA 5IDXA 4BV9A 5JMPA 1R16A 4OJNA 3PPIA 3RUFA 1ZUD1 1LSSA 4YAIA 3WICA 4OYRA 1YGYA 1E1LA 3DQPA 4J4HA 1MP0A 5KVCA 2BFMA 3GHYA 5F21A 1B15A 4UUPA 4PLTA 1GDHA 1E1MA 1G1AA 3U3XA 5K0ZA 4GL4A 4BNIA 1C14A 3DC2A 2FWMX 1CDOA 4IQGA 3FBGA 4J9UE 1PS8A 3BMNA 2B0JA 4NBTA 3WJ7A 3LC2O 2VTDA 1XQ1A 3AI2A 3HN2A 4NQZA 5DOZA 5CDSA 2EKQA 1M67A 4KWHA 3UFXA 1P1RA 1YDWA 2HU2A 3HZZA 2OZPA 3JV7A 3ONFA 1N9GB 1ZXBA 3SVTA 2HDHA 3V2HA 1IOLA 3LC7O 4TMFA 2HKIA 2CF6A 3ZN2A 3EVNA 4YT5A 4HXYA 3RUEA 4TRRA 4XDYA 1ENZA 3H65A 2ET6A 4MKZA 4J16A 1GL3A 4HUJA 4IGFA 2P9GA 5EPOA 4R69A 1HXHA 3BHIA 5TT0A 4MVJF 4YT4A 3U4DA 5JDCA 1Y8QB 2AW5A 2R6JA 1SBYA 4CM4A 4E6PA 3WG9A 1KVSA 2I9PA 2X86A 4J7CA 3K96A 1SCUA 3K31A 3KTDA 4I1IA 1D1TA 1GYPA 1TVEA 3WXBA 3F4LA 1UXGA 3PLRA 3Q1LA 3RFTA 4KQWA 2QX7A 4P8RA 4CM1A 4WUVA 3F6YA 5AXCA 4ONEA 1HZZA 5L4NA 4Y9DA 1C1XA 5DZSA 5U9CA 1UZLA 3EK2A 4NIMA 3ZDFA 5ICSA 1XKQA 4BO0A 1T24A 4J9VA 3RI3A 3S2IA 4L75A 4U7WA 1V0JA 4FBGA 1OMOA 4LVCA 3BMQB 3VH4A 3R3SA 3AM4A 3JQ7A 2AEMA 2B4RO 1QYDA 1L7EA 2JFFA 3B1KA 4MVJH 2GLXA 1EK5A 4YJGA 3ZU5A 3KOUA 1PJTA 2VT3A 1IZ0A 5JY1A 3DZIA 3DTYA 3UVEA 4KMSA 4I9NA 4ZVVA 4CPDA 3QP9A 2IEBA 1WMBA 3F47A 1NTOA 4BKRA 4IJWA 3DXFA 2XXJA 5L51A 3AJRA 4IIUA 4E12A 1SAYA 1DB3A 2D5CA 2DPGA 3PJDA 5LCXA 3ETDA 3AM3A 1HSZA 4J1TA 5IDQA 3UKOA 3OETA 4F6CA 2PD6A 4R4JA 1BXZA 1GYRA 2VN8A 3MZ0A 3HDJA 1JAYA 3ZWXA 4XZ3A 1YJQA 3H8VA 5JCJD 2QG4A 2ZB4A 4FOSA 7ADHA 5MDHA 2GUGA 1IHYA 2GZ3A 4BV8A 1KIFA 3PWSA 3QA9A 1HEUA 2CZCA 1I5RA 4H16A 1O94A 2UUPA 5KVVA 4YAEA 2RH8A 4ALLA 4TKMA 5A06A 5A05A 1DIRA 4LK3A 4EDFA 5L7YA 4RVSA 5BT9A 3E48A 1Y8RB 4D43A 1LSJA 3ROPA 1T2EA 4J0EA 5KIAA 4M54A 1VM6A 3CPSA 3JQ8B 4BKQA 5G4KB 4MOWA 1H6DA 3NYWA 3C1TA 4FW8A 1GADO 1M76A 4JLWA 1ZSYA 1ISHA 3QWIA 2OP0A 4IUYA 2FMUA 1JU9A 4NU5A 4AJOA 5JDCC 3O03A 3GDOA 2IEDA 3GAFA 4PLPA 4BNHA 2YFHA 3LVFO 3KEQA 3NGXA 2ZJ0A 5CAEA 2YDXA 5A9SB 3KV3O 3ZNQA 4BNTA 3WBFA 1VKNA 1NWCA 4FIZA 5KJCA 3EVTA 4GMFA 2O48X 3ZWCA 5K9ZA 2X9VA 2BD0A 2V6BA 3O38A 4OL9A 4IDFA 5A4DA 4MVJE 4OIMA 4EEZA 2HRBA 3FI9A 2EP7A 1KEVA 3Q0EA 5COAA 3WMXA 3I3OA 3QIVA 3FTPA 1IHXA 2BF7A 1HETA 2IYOA 1GQYA 2X23A 1KY5A 2JJYA 2PZLA 3E18A 4KDFA 5KVSA 3RCBA 2C54A 4L4SA 4BO5A 4KUHA 1I10A 1X1TA 4MVJP 4BL5A 1H94A 1B3BA 2ZQYA 2I5PO 1IE3A 2I6TA 2NU7A 5I7VA 1B7GO 5EERA 4CQMB 4K6CA 1LDMA 2YY7A 4CR6A 4E2XA 4MIEA 3RASA 2QRLA 3A06A 1IL0A 5JCJA 3DL2A 4N5NA 3WGTA 4UAGA 1N5DA 3AK4A 3V2UA 4UULA 4QFCA 3FNHA 4Q39A 2BH9A 1EVZA 1LA2A 1MX3A 1WW8A 4OGWA 4YTEA 1MC4A 2Z95A 2C5AA 3NRCA 1DRVA 5AYVA 3JD4A 4XYLA 2QHXA 3P2YA 4PRKA 3NTOA 3WQRA 3GUCA 5L53A 1AN9A 3BHJA 1NR7A 3BTUA 3D3WA 3ETGA 4XYEA 3VTZA 2Y0CA 4BNZA 1UZNA 2ZQZA 1SC6A 1MFZA 4OMUA 3DONA 3DZKA 1PX0A 1NFRA 2D59A 3LU1A 4ZQFA 5ILOA 4NFYA 3NT4A 4HADA 4BO6A 3MWEB 1BRMA 1I3NA 3VH1A 2TMDA 1DSSG 1E7WA 1LDYA 1Q7CA 2JHFA 4PLWA 2P4QA 2Z5LA 3PFFA 1DC4A 5G0TA 1GEGA 1GFSA 3FCOA 3CMCO 2X22A 4D3SA 4NPCA 1A4IA 4LCJA 4D42A 1QKIA 2HSDA 2DQ4A 4NK4A 1FJHA 4XKJA 4CV3A 4Z3DA 5HRUA 3K2EA 2CNBA 1Z73A 4B8ZA 3KYBA 3HFSA 1SB8A 1H9AA 2ZCVA 2NSDA 3MJSA 4BKPA 5KNLA 1ZMOA 4YRBA 2Y05A 4Z9FA 2Q1WA 4JROA 3S55A 5JC8A 1WLYA 2W4QA 2ZTMA 3PJGA 4JIGA 5C7LO 2OP1A 1CF2O 3E1KA 1TEHA 3C7CB 1V8BA 2OFPA 3I9JA 3GVCA 1PJBA 1G6KA 1ENPA 1NHGA 3TZKA 2C82A 2D4AA 2V6FA 4DQUA 3GG2A 3ULKA 4WKGA 2PGLA 1X7GA 1EVJA 4NBRA 3GZNB 4CM3A 1RPNA 3KVOA 3FNGA 1MC5A 4IM7A 1DBVO 1P0FA 2GDZA 1BMDA 1NP3A 4DVJA 1VPDA 1FXSA 5KJ6A 4HFRA 5B4VA 2Q2VA 2Q3EA 1NBOA 1PZFA 2FR8A 4CR8A 3E9QA 3H5NA 4U6QA 3ZWOA 1NNUA 4GQAA 4QTZA 4FC7A 5G0VA 3SBOA 3IJPA 4ZICA 1QXSA 1ZIDA 3WR5A 3QVXA 3L6EA 1LDBA 1K3TA 3TZCA 3R6DA 5A9TA 3IIEA 1ZEJA 1I36A 3WFJA 3TSCA 4ND5A 1ISJA 1PJ3A 3F5QA 1PGJA 3I4CA
chains in the Genus database with same CATH superfamily
1JDBC 5B55A 1OU4A 1N6LA 1P9RA 3WP1B 1Q7RA 3H7IA 1X6VA 3G9UA 4DMLA 3L6BA 3U4GA 4XFDA 3SDSA 4WT7A 4ZVMA 1U4SA 5HQ3A 1GRQA 3QLVC 4Y1FA 1ID1A 3F5MA 2PVCA 1T5BA 2OZEA 4B76A 3LT1A 2R84A 3RV4A 4OQNA 4I8IA 2YRXA 3NIDB 1FSSA 3FLEA 3RK0A 4EJ0A 3RVNA 4OD0A 2DCUA 3WRXA 4GOJA 3T3MB 2ZBQA 3HKDA 1VJ5A 1S0UA 1E6EA 4IS3A 4RBNA 3TOVA 2ODAA 5JNSA 4KCGA 5DNEA 5MN5A 3RSZA 1EUYA 1KDOA 1GPJA 1TUGA 3LQ2A 1SXIA 4URFA 1M2JA 2O2HA 2C5GA 2NLOA 3F6CA 3ZDEA 1VP3A 4LOKA 5HFAA 5ALIA 3WHIA 4BJ5A 2HK8A 2TMYA 1VMAA 3EUFA 1NQVA 3G2IA 1A7AA 4P34A 4QXOA 3SF0A 4B31A 4E2FA 1ZWLA 2DVMA 1D6JA 4BN4A 3TD9A 1N8SA 1PZHA 4N47A 5HJ7A 1RHMA 5CCBA 1XQYA 3BSWA 4BB9A 2N46A 1UDWA 3EH1A 2C2MA 4FSDA 1KDYA 4R0MA 3A37A 4OI1A 2BMDA 3ZZNA 4J2TA 1WV1A 1ZLYA 1GWNA 2ZRBA 5C5CA 5K0FA 1LV7A 1LQ2A 2HQOA 2JEYA 2G0AA 3V1LA 3W5UA 2ZJYA 5BSUA 4DLBA 5LQNA 1Y81A 3CXUA 1DWOA 1W0KD 3IHLA 2OSVA 4UUQA 3S1LA 3UT5A 3EBOA 3V4RA 3MBOA 4RHYA 1PWZA 3I9OA 3K8OE 3UM9A 1T36B 4IQ0A 4LSMA 1LEHA 2C7GA 2IUTA 2IYEA 3LCUA 3OIGA 4I5EA 3MAJA 5B6JA 2YY6A 2GBLA 4RPJA 2JH9A 2DETA 4D25A 1CBUA 2IOHA 4KUEA 3DTVA 1LNSA 1QO9A 3KOOA 1R7RA 4UTOA 1L0BA 2XMZA 3AIMA 3ESZA 4PVDA 3HN7A 3U49A 3TLMA 4IMRA 4LUCA 4HNUA 3AUTA 2Z8ZA 3HV0A 1OI3A 3EZ6A 4UFPA 3DKIA 2FOLA 1DHTA 3FB4A 2FE4A 4L0MA 3K05A 3WLAA 3WKAA 1GSOA 1WMAA 1NUUA 4D0LB 1TCVA 4WK6A 5ALDA 2BR5A 1TMKA 1QGZA 2IKSA 3FX2A 4G0NA 3VVCA 2HHHB 1LSOA 2PIDA 4Q00A 4CIDA 2WPDD 1YBAA 1J00A 1WTCA 4ZAFA 1IBCA 4TVKA 3U17A 3UMRA 4EJSB 3PIRA 5TPWB 3P0FA 4D02A 4PX5A 421PA 1KRHA 2DR0A 5I8PA 2O0MA 5A4FS 1XRNA 1MVLA 2GYVA 3MNFA 5KX5F 1JG4A 5K6AA 2YVQA 3WZMA 1XCLA 4UU1A 5EZ6B 1YAJA 3QWHA 4A4DA 3QX8A 5HTOA 4EPWA 3JQ9A 3ZJ4A 4WD3A 1T1EA 3EZXA 5GM1A 1HTWA 2GN0A 4A92A 1AHPA 2C00A 4WLVA 1Q3TA 5KJFA 1WRBA 4GXQA 4HP8A 5D84A 2V9PA 3RVMA 3L8GA 2NVBA 4WBNA 4J6EA 4U9IS 4EUEA 4F2WA 1PBTA 3KL4A 3FFWA 1LJUA 1B23P 3JQRA 3DE1X 3EW7A 2MINB 4I19A 5CM2Z 2PWAA 3H8WA 3UUEA 1BDBA 1J8YF 4TTQA 4YRTA 1S9DA 4QLBA 3AFNA 1AHIA 1VFPA 1CUSA 2G08A 2ROQA 2BFBA 1YAHA 3KSDO 3JYPA 5T5QA 4NOLA 1N2ZA 3LCMA 2KM1A 1GUDA 2FJ0A 4Q3LA 1WUJS 4FFBB 4MCAA 4R8MA 2ZJFA 2H1OA 2ALJA 3DBLB 4JFAA 4MR8A 5EIFA 3NHRA 1K3UB 3OQVA 4AMGA 1PDOA 121PA 5HXAA 1DEAA 2QTAA 5J1TB 1PS0A 3IKLA 1JDPA 3WGHA 5LNK6 3RVLA 2ZS9A 2NG1A 1P4JA 3I30X 4YMVA 1O0SA 2FQQA 3AEXA 2CMDA 2VHVA 3O75A 3SYNA 2AG6A 4ZDJA 5BMVB 2G72A 3SZUA 2VT2A 1TRKA 5JS7A 3E9RA 1PT8A 4OQXA 3PJRA 3IV9A 4KIGA 3WL4A 2HOQA 1HDRA 2WYUA 5DCLA 3NBMA 1NVAA 2Y93A 3EJWA 5L3SA 3KO8A 1UJ6A 1SXPA 4YAFA 2CZGA 1YZHA 1JG1A 4JZYA 1G59A 3G9TA 2PH7A 2C9BA 2ZVQX 4MW7A 4JCCA 4QECA 5KB3A 1POXA 4B47A 4JI7B 3R7AA 1JT2A 3T1OA 4D46A 2JIZA 1DTWB 2YXDA 1QP4A 3WV5A 4ZT7A 2QTVB 2H65A 5TB5A 3I09A 3TBKA 1Q1EA 4F3NA 3UCFA 4R9RA 3KVYA 2VKQA 3MJTA 1NVXQ 3RC7A 1RZVA 4ZVNA 1OZAA 4OQFA 1BX0A 1SKYB 2OK8A 2B3TA 4CKBB 4LKRA 1E1NA 1ETUA 1QVVA 2ETXA 1P5FA 3KDSE 1BE6A 2FPRA 4IDCA 1ZW1A 1YJ5A 3Q0IA 1C0KA 2DAPA 5G3ZA 2AFVA 1B6TA 1H5NA 4XUEA 2FMTA 1XTRA 3P0RA 4MICA 5JI2E 3V33A 1O4VA 4FHFA 3OMXA 2HF8A 4B3GA 1Q3KA 4GC5A 1W6RA 1RQ2A 2GCOA 2H92A 2C1XA 3VU9A 2HLNA 4FB4A 2EFGA 1K66A 1EP3B 1CJBA 5CD9A 5FULA 2P9EA 2JATA 1Z5GA 3MIZA 1TLTA 1NVUQ 1T0JB 2B7BA 3A11A 1P39A 3Q7TA 3I39X 4JI6B 4DE5A 1XE3A 5KNCH 4M0EA 4QDZA 3EEFA 5EESA 4DZZA 1Y3FE 2JA2A 1X92A 3GEBA 1F1JA 1G41A 2VXYA 5HGXA 4E08A 2AC4A 3P5BA 1H85A 4HUQB 4IW3B 4L2IB 3RJ9A 5KYTA 4ND3A 5LB2A 1I33A 2ZYDA 4KO1S 3TTYA 2G1AA 4RVUA 4BQRA 2MTBA 5KC9A 3T9BA 2W6JD 1FDSA 4RVHA 4KMOA 1HEYA 1RAHA 3B6EA 2CWDA 3P0HA 3NTXA 3K5WA 2K4MA 5IT4A 2PRZA 3MMSA 4H77A 1QIMA 2VPXA 2KJQA 1H2WA 3PHIA 5EWJA 1RKVA 2FHPA 1F06A 5EUBA 5J4HA 5JSZA 4GKKB 3GR6A 1L5RA 3KQTA 4A15A 2QRUA 2VWPA 5ALQA 1I4DD 1VPVA 3AFIA 3IOBA 2LP4Y 3LPCA 2IPLA 2YFKA 3O1LA 4MX8A 3QU9A 5FB3A 1RXUA 4NCKA 3A2LA 4G1MB 3HJUA 2QN6A 4DR6B 2YZMA 4D3XA 3GDWA 1E5XA 2C1ZA 5HMLA 3UK1A 1ZIXA 2GEDA 1TW3A 5ELLA 4EQ6B 4QPPA 3SGLA 4NCNA 4NG5A 4PV7A 5IT9A 1KO7A 2GCEA 4QDJA 3SJUA 2AFIA 4ZT6A 1PR6A 3K5HA 3GMSA 4BLTA 2BKXA 4RTPA 1QQAA 4TXHA 4PICA 2B21A 1EQUA 2NNLD 4QULA 4F6RA 4LEIA 2OV4A 5JAHA 3KSAC 4AJNA 3DQQA 2QV0A 2NV2B 4CMHA 1MAAA 4ZYZA 4C6TA 5BYBA 1BVRA 1JEOA 2I6GA 3ZCQA 5B1YA 2JHPA 3RAEC 1LGYA 1CQWA 4N54A 4WN9B 5ADHA 4PTZA 2ICAA 2RGXA 5HKAA 1RI5A 4FE3A 1NP7A 4Q6WA 4NENA 3C98A 1Z17A 4UTXA 4Y2VA 5AKLA 3V6LA 5C51B 2GZMA 1F0PA 2BAGA 3L0DA 1R6VA 5DTJA 3RHSA 3UNXA 1RAIA 1JQBA 4A2CA 2I99A 3SFTA 5FTLA 4AG6A 4FUQA 4RJKA 5FPTA 3O8NA 2XF2A 5IBCA 1UKAA 3EUAA 3SJBA 2R6CA 5A02A 3LQFA 2MT9A 3T7SA 2V1XA 5IW8A 3PCTA 2O8NA 3HXTA 4F5DA 3N8DA 2FPPA 2ANCA 4QUBA 1C7FA 1VCOA 1VLLA 5KKNB 2RGGA 1OC2A 3IS3A 1WPQA 2RC6A 4PSDA 5IF9A 5J2TF 2CY0A 3F6SA 4C4PA 1X86B 2O3UA 5EQDA 4GLBA 2M6KA 1MG0A 4XJSA 2OHOA 3CNNA 1EA5A 4ER7A 1Y5LA 2F1KA 2W0MA 1SPXA 2O5CA 1FS5A 1JG6A 2CB9A 1XSEA 4CCAA 3BQNB 2YIDA 1T9DA 4CT0A 3QLJA 1T1IA 1PEAA 1KMCA 1E1CA 3NV7A 1E18A 2VQEB 4H7HA 2YIVX 3LF2A 1I3KA 4GYYA 4HEHA 2BJWA 4BIIA 4NCIA 1EGHA 1O5TA 2GBPA 2A1TS 3JVVA 4C76A 1VB3A 3MAGA 1AJEA 1YS1X 5K3BA 4QO7A 4WIAA 3ZCPA 4S2EA 4ID9A 1UMBB 1V7ZA 4X6YA 2QVXX 5SZHB 2JFXA 3BFXA 4JMLA 1TQ2A 4RLFA 1SB9A 1E0DA 3C8ZA 1ADBA 3FB1A 5YASA 4MAAA 1V35A 3ITEA 4EVRA 1B2LA 1ZO8A 2AB0A 4M1TA 4IUCS 4R16A 4XQGA 3VZPA 1CIPA 3JAWB 4LSWA 3IBTA 3H8JA 5LBTA 4G0ZA 3B1YA 3PXGA 4LWZA 1SOAA 2LTAA 3FYUB 5DYGA 1YUNA 3IAXA 4LJRA 3BZWA 3HDYA 2XYVA 3N2YA 2HXGA 4K40A 2UUCB 3QOWA 2ZR9A 1G3UA 1WVIA 3TI7A 3A9WA 3HU2A 1LH0A 2VHQA 5M7EA 2VZ9A 4OLJA 2FXVA 5HNKA 3QSGA 1THGA 3QE4A 3PD1A 3RBAA 3N6VA 2EEZA 2YFQA 1PK7A 3HUUA 1XZCA 4GBED 3DH0A 1OXVA 3S7ZA 4QSMA 1C0LA 4JXXA 4KDCA 1DQRA 3N86A 1XU9A 2AXPA 4YQZA 1IHPA 4LJ4A 5BV1A 1VKRA 3EF1A 1AHHA 3D54D 3D7NA 2XJ4A 3GROA 3WIBA 4A91A 3FBTA 1I2BA 2ZLBA 4X45A 3AX6A 1P1JA 1QVAA 4ODIA 4ZQEA 3V8PA 4IO0A 4A82A 4BEWA 4R3NA 2UZ1A 1CEEA 3E70C 3HNPA 1ZHFA 3FTEA 3BMOA 4TWZA 4I1PA 3UV7A 2ZAMA 1VKOA 4F2PA 1AK2A 2NXJA 1JSXA 2Q8NA 3AI7A 3AQIA 3OC6A 2NN3C 4C06A 3IDZA 3N6XA 1O6BA 3ONEA 3OZ7A 3VR3A 4OI0A 3RGGA 3RVQA 1ZHOA 1UMCA 4DDHA 2IHZA 5BNIA 4RFSB 1TCBA 1XMIA 4YC7A 1CF9A 1FLAA 2D2IA 2EGGA 2IL1A 2JBAB 2G8LA 2C57A 2KX7A 4UE2A 4WAUA 4AS3A 5AJWA 1QHHB 2V58A 3C6BA 2R5FA 3EOAI 2ATCA 3K4HA 1YDEA 4RDIA 4WLUA 5E1MA 5EQFA 5F77A 1PFWA 4BIMA 1I5OA 1UBNA 1PHRA 4BMSA 8MHTA 4L27A 2F8SA 2W2LA 4OFWA 3OJCA 4GOKA 1P1FA 5AK6A 2EBFX 4MLPA 5E6RB 5A04A 5KYGA 5KCZA 2O2DA 4OHVA 3AR2A 4B6EA 3ABRB 5LOVB 3R24A 3BRWD 4QG7A 2DBZA 4XWAA 4YXFA 1BX3A 5KINB 2FFJA 2C3MA 1NC3A 2AC2A 2B37A 2EX0A 2JF0A 1SKBA 2P7HA 1QRAA 2NX2A 2QQFA 2QY6A 1V5EA 1VIMA 3BCHA 1FFWA 3PHLA 5LDDC 4Y2RA 1Z6GA 5DJ5A 5GOTA 621PA 1WTAA 4NCXA 3DLHA 4O33A 3K8ZA 2GSDA 3HJNA 1OHHA 2WU3A 2XADA 5GM2A 1YD7A 1EE2A 3IMGA 4JNCA 2VBFA 4CM9D 1FYXA 1FIUA 3KPUA 2QD2A 2ZU6A 1T35A 2X5XA 3I9V6 1XMPA 1YDMA 4U7PB 1L7VC 2VNJA 2MMGA 4QO8A 4ZN6A 5EJ4A 1I5EA 2R60A 4G9BA 1AG9A 1K8YB 1KH1A 4G8CA 2F8MA 1PL8A 3IQZA 3OUTA 4Q4JB 5L4LA 1U0FA 4B6JA 1N2XA 3DMGA 4OKIA 4Z4HA 3L0YA 3AKEA 1W34A 4ZZ1A 4DB4A 4AO8A 4AS1A 3I5UA 5DBIA 1MO3A 1Z5PA 3JQ6A 5SYAA 4Q1FA 3DGFC 3ITKA 3OQIA 3ZJYA 3EXHA 1RXIA 3N2GA 3AVVA 3P9CA 3D0QA 3E3AA 1CUEA 1TI7A 2X1LA 3KTFA 4PWZA 3SXUA 3TW0A 3O3CA 2REOA 3F8SA 1NI5A 2ONCA 3CZ9A 4PR3A 5BR8B 3DL7A 5G53C 1PEDA 1NVBA 2X3UA 3JRWA 4JJEA 2G6TA 3E7DA 3H97A 3QFSA 4PGGA 1TJNA 1ZJJA 3B1ZA 4O63O 5LU9A 3DDNA 3PFIA 5AVJA 1R10A 2EKPA 2IZ1A 4HRYA 2XUGA 1BSVA 2XWJI 4X20A 5TC4A 5KNDH 1PFVA 5EXTA 2JAUA 1A8HA 2HZ7A 3MGAA 4TUYF 4W1QA 2C5HA 4D26A 4Z1MD 4QASA 3TZ6A 2HRDA 2VSOA 1HE3A 1N2CE 3OP4A 3AJ9A 1PZEA 2Y0EA 5AKZA 4L4XA 5JH7A 1YKGA 3BXOA 1XYVA 2IYYA 4PHHA 2WT4A 3WNVA 2YN0A 4Y6RA 1FDVA 2ODQA 3RGWS 3N8IA 4MV8A 5FLYA 3T38A 3R4CA 5IKXA 3GLFA 3K6SA 3R2JA 4PZZA 2HHAA 1OGYA 4IKPA 4K9OA 1KHHA 3LXUX 2KLHA 4E3ZA 1XQXA 1G98A 4FJ2A 2JFQA 4FDLA 4JP3A 2PR7A 4R01A 5AMXA 3RTBA 1HYBA 2XUFA 3K0AB 1IIRA 1SVKA 3AINA 3C5WP 2QMQA 3D5TA 4N4AA 1AV7A 4ZYVA 4DA7A 3ANSA 1N2BA 1MZPA 4F9TA 5D1HA 1QV6A 1RT9A 3ONWA 3BXXA 3TGWA 1PR3A 4UE6A 3LSTA 4DLLA 1QHXA 5DYNA 1J0EA 2WUDA 4ALMA 4K1LA 3Q0TA 1RLUA 1CNFA 2D13A 3JQPA 3HJGA 2LE0A 3RD5A 4GPD1 5B3JC 3EZ2A 4HPWA 3KYIB 5TX7A 1MZVA 4IOMA 3TK1A 2VUIB 4L57A 4R7GA 5KNBD 4UMDA 1OT5A 2QMUA 3B5IA 2GCGA 3TLXA 3EIOA 4DPKA 3GZNA 1UWCA 3UMMA 4ZTZB 3IAUA 4EENA 1RI4A 1SVLA 4MV0A 4F86A 1EXWA 3F9RA 5AW7A 1UJBA 3BK2A 3MCZA 2XE8A 2Q1UA 2J3JA 3C4JA 3LF1A 5BV8A 1RABA 3A7DA 4KBFA 1R0WA 2WYIA 5CVTA 1ZAYA 3I62A 1XQWA 2B99A 4YRZA 1EFKA 3D6AA 4B43A 3TAXA 3I58A 2MYUA 1J49A 4PE5B 3UOAB 1J70A 3I04M 1Y89A 4FNAA 1IEVA 4RHCA 5CNIA 1XLVA 1H23A 4J75A 2QQGA 1IZ9A 3U4MA 2KBFA 2PMFA 5CVDA 1UBKS 3DHEA 4EFNA 4F91B 3L41A 3H2JA 3W90A 4V1CA 3IR7A 1NT4A 1X8LA 1ZKMA 3JQ7B 1N6PA 4Q3OA 4KQ1A 3K0BA 2J48A 2X19A 4V0RA 4OHBA 1LBHA 2WHXA 4IPTA 1Y1LA 2WLTA 2Z3VA 3GF4A 1JQ5A 3L8HA 1E3EA 1RIIA 4MWBA 3TNJA 2Q3DA 3G6WA 2XZOA 4K6GA 2HMWA 3RRMA 3W7BA 3TSAA 3LK6A 4BNDB 1E79D 1F4LA 1CEQA 4YCBA 4Z4CA 4PZLA 4ME6A 1TCCA 3O21A 1YR2A 5JXIA 2IXAA 5E95A 3RS0A 2ZIZA 2N42A 1IY0A 1LQUA 2JIMA 3KKZA 3ZWQA 4HXGA 2XUPA 3O84A 3QLVA 4MW9A 5B4UA 4IDEA 4IJVA 4X60A 3A9VA 4HYYA 5HBGA 3RHTA 1YHZA 2ZB2A 3NU1A 3RNLA 3PQ5A 3H87A 4E5UA 3QI2A 4GLLA 2CXNA 3V1YA 3MTDA 4TV9A 4JOCA 3THXA 1ZRMA 5I7RA 1YZLA 4AJPA 2XZDA 3ESYA 3P5SA 2VH2A 4LWPA 2QLLA 1YHNA 2FMFA 4DLKA 2YIJA 3DVAB 1NBWB 1C50A 2Q6LA 4DIUA 4LYHA 1W93A 3O4RA 1PS9A 4JLMA 4TWRA 3CZ5A 4EB6A 1UMKA 3O8QA 2AJCA 5A5DA 2ZT7A 2G5CA 1NRXA 3Q8KA 5A3JA 1JHOA 5TQ0A 1V6SA 2RB5A 1W8DA 1RC1A 2IOQA 1MU0A 3AC0A 4QUHA 1P72A 4PZPA 2J41A 5FR2A 5JDIA 4E1AA 3Q8XB 3WQBA 1DLIA 2IK8A 3BMXA 1PLJA 2CBXA 1EJ2A 1OBVA 2B8TA 1TFRA 2V96A 2YINC 3EBPA 3O4JA 4YBZA 3LQ1A 1SQGA 3NBZC 4K9SA 1ORHA 4M0LA 4EMTA 5MF6A 1IQ0A 4L76A 5CG2A 3L8FA 1ZQ1A 3REGA 3WRYC 4PG8A 1ZEMA 1ZMRA 3PNQA 4I1OA 2CVOA 1PZNA 4OPMA 1OKKA 2PKQO 2FHSA 3PGA1 5I3ZA 2CXSA 2Z6VA 4F7DA 1OI2A 3QY9A 3ZU6A 2WC1A 5KTSA 2QUAA 3GRPA 4PPYA 1GKLA 5LB4A 2E55A 5EPUA 5BRJA 1Y9DA 1C3XA 4EYSA 3TLAA 2JH8A 1FP1D 1CUDA 1WCIB 1ZNWA 3O26A 3QTBA 5FLEX 2YXBA 1P0MA 1SHZA 1AF7A 1X1AA 4C3VA 4WE3A 1C7QA 3KJHA 1OH6A 4IIEA 2FKNA 4KQCA 2RKWA 4IILA 2A1UB 3NG1A 2WJJA 4KQXA 4TYQA 5BVGB 4P80A 4Q1DA 3OCZA 3FFXA 3AHJA 1FNSA 4PFQA 3T5PA 3GPCA 3E8MA 3QVOA 2O06A 1QDEA 3WI7A 4K0KB 1QH8B 1KEEA 3ND9A 2NU7B 2VXOA 3KAQA 3L6RA 3OMWA 2FFRA 3BS4A 4S1OA 3RC2A 2GVNA 2B25A 2R9VA 2ZJAA 1O95C 2G80A 4O6VA 1SHKA 5EJ8A 4ZP1A 4C08A 1NC1A 1ZUNA 5EVJA 5BQFA 4KK3A 4UVEA 2XGGA 2DBVO 4PLYA 2D8MA 4IUBS 4KLAA 3CA8A 1UWKA 1XDGA 1C0EA 1DAGA 2ISCA 3ZXSA 2VNAA 4BMVA 3STTA 2E3JA 5K0NA 1R64A 2IV7A 3THRA 1HX7A 2VAMA 1HUQA 2AQ8A 4GBMA 1ZITA 3HMQA 2WFZA 3E9NA 4IX9A 4XFKA 2FWJA 3ZCSA 1QSGA 1R3DA 3I5AA 4KW7A 5GPBA 3D3WB 2HT1A 3T3HA 1J1UA 2V7EA 2XRFA 2VPWA 2NQ8A 2AR7A 1KR5A 2HV9A 4HFJA 5C8YA 2K2WA 4NAHA 2QTHA 4Y2UA 5KHLB 2VZEA 4A0HA 4XWWA 1RLOA 4AN4A 4Z2YA 1OH8A 3S8MA 4IQ8A 4ZVUA 1BH6A 1KETA 1UMDB 2J3EA 5L6MB 2IPNA 3EASA 2H4FA 1WEKA 4DM3A 1EEXB 1HMYA 3NBFA 7REQB 4ZOLA 3PL5A 1L4EA 4D80A 4LDQA 3LBYA 3EMVA 2DQKA 2FW8A 2VP4A 3C39A 5JXJA 5KYKA 5DHSA 5CBPB 2Q4DA 4RPLA 3A28A 2CJXA 4DV2B 3DBOB 1X80B 3SEAA 4KJXA 4JV5B 1W4BA 1NASA 4YH1A 3CX4A 2C7VA 5IVDA 3JYLA 1JFVA 2HCFA 3DEJA 3H5WA 1D04A 5C4IA 1XYYA 2XBUA 4UPDA 5JVDB 1V7QA 4WKPA 3UMCA 2YXNA 3WB9A 5L3RA 4OHWA 4W4TA 5CM9C 3SHQA 1NNSA 4NZPA 1UM9A 5IVHA 3CNOA 4OK3A 2WR8A 2E2WA 2Q6KA 3HYRA 4QOFA 1SIOA 3G2MA 3PDIB 1W581 1Z45A 2HK9A 3JCZA 4M1OA 1J33A 3OESA 3TYXA 1F3OA 3JX9A 4MLCA 4OP2A 1B0ZA 1FCJA 1VA5A 4KO8A 4C1NA 3HZHA 4R3WA 3O8OA 5FQNA 2NNWB 3R7FA 3KQNA 3W5AA 3EFOA 1E4YA 2PWBA 1N32B 5L40A 3UAVA 4BB5A 4DSTA 3RU3A 1Y9AA 3GNSA 5ELMA 3UENA 3GLRA 5AW1A 4AJKA 4G4SP 4UVIA 4DSOA 3HNRA 3W5IA 2G76A 4GYJA 1R15A 4O2AA 4MDEA 3DEHA 2BMAA 5FI3A 4RLHA 1QHFA 4LA4A 4CF5A 1AOXA 2PHZA 2JJMA 4H6VA 1Z8FA 3QYPA 3FVRA 1RBMA 4ZU3A 3ZV6A 4GRAA 5D3MB 3X43A 1ZUWA 2EGUA 3H2SA 3E53A 4OSEA 5K45A 3AP2A 5CB4F 1RWNA 1MH9A 3PFGA 4IZHA 1P60A 1SQSA 3W1WA 4Z4EA 2CL6X 2BEVB 3CVXA 3WGUA 3A7EA 3B1XA 2O5EA 4U2GA 2VA9A 1M75A 2GD0A 4WPGA 1C9JA 3IULA 3M6XA 1J97A 2IUUA 2GRAA 3PKIA 2JFHA 1JJ7A 1UBCA 5JOQA 3KB1A 1BXKA 2Q4TA 4RMGA 1L5QA 1CEXA 3LRXA 4NPHA 3MINA 5H82A 1B0PA 3MG9A 3DT8A 3E7WA 5C18A 3LUPA 2JDID 4FNGA 4GZ5A 1SCQA 2FFAA 1NP6A 4OXXA 2BTOA 1QGUB 4U2EA 3M6FA 1L3BA 5GP1A 2XHZA 3TINA 3UXHA 4EHIA 4HDKB 4M8NE 4NMMA 5E3HA 3C3YA 3EMDA 3DA8A 3TIIA 1PQWA 1UKVY 2G63A 3TM5A 1YR7A 4N0DA 1TTTA 2PN1A 1WLSA 2C4UA 4IJMA 5HQ3B 1PGQA 1UEJA 3FSRA 5BXQC 1PUXA 2Q4EA 3EA0A 4M9QA 4CZ2A 2JGMA 2GILA 5HKBA 1HGXA 2YCBA 2AN3A 4DJTA 1UXHA 4QNNA 5EUCA 5IAOA 1LW7A 1ZH6A 3CEJA 4ZJZA 3W9BA 2PQ0A 3FPFA 2QM7A 3HKDB 4KXXA 3VKFA 1NOIA 4FYXA 3QBJA 2Z6UA 3KPVA 3OM8A 1A9PA 1ISGA 2HCTA 4FJ1A 4EJFA 3NXKA 2Z6QA 4CKCA 4DCMA 1GZUA 2RKOA 4ENSA 4QL3A 2ZEJA 5JNLA 2NO1A 1D0IA 3Q3JB 4BQOA 5CEJA 3ZVMA 2WYWA 3DM9B 4TTPA 3O93A 1QYXA 2OK7A 3BC1A 4QBGB 4FCCA 4OU5A 5FOTA 1QR2A 1YZNA 3G88A 3CRZA 1JW9B 1U3UA 1U7TA 3H9GA 3IQDB 3DULA 2FZ4A 5HILA 3TSYA 3FHTA 3MW8A 2RHCA 3WVNA 2JZOA 2MOKA 4DZRA 3UT5B 1U0LA 2EARA 5DNVA 3D1JA 1EGAA 3D3QA 1FA9A 1SKYE 3CX8A 3VR4H 4UCWA 4WY5A 3IO3A 4LGYA 4M1KA 5CX1A 5AVYA 4LC0A 1E0SA 4LVOA 5ALXA 5EWMA 3CNBA 1PJLA 1NJFA 1P1HA 4RENA 3UK0A 1A7KA 3VYRB 1EWQA 1UK7A 2ZUFA 4YCLA 1P80A 3DTVB 3QQPA 5AUOB 2WSBA 2A59A 2IHYA 5IAJA 3ZGOA 1TK2A 2M6RA 3BB1A 3IPXA 2PDAA 3ZTTA 4BYGA 4PGHA 1BXRA 5FKJA 4BWFB 5CDTA 4ER3A 1ZK4A 2A6PA 3OMLA 1RYZA 5AWFC 3Q85A 2JB9A 4ZOEA 3RFCA 2OMEA 4I50F 3LWZA 1KAQA 5DBEX 4AMBA 8LDHA 1CULC 1EFAA 2JJ8A 3QKWA 4F21A 2P9FA 4BO1A 3MF4A 3NPAA 3PTAA 4G5HA 1JIKA 2QENA 1V9SA 4KIWA 4UM7A 2VA8A 3W5JA 1LPSA 5FOSA 4AO7A 4O4IF 2ZTSA 3EOBI 1VXRA 4YJ3F 3Q10A 5JAIA 5CTJA 4U4AA 1UKZA 5IT0A 5C0OE 3W6ZA 4AKEA 4F56A 1E20A 3TBFA 2WJZB 1T9BA 3PQ8A 3I37X 1NAIA 2CVQA 4ERXA 4F9GA 4C4SA 4UTNA 4QU9A 2P2ZA 5DISB 3TAUA 2W8BA 4RELA 1E0KA 2DBQA 1P9NA 3FDIA 1SC1A 5JASA 4KR7A 1EBUA 3G82C 4LHXA 1XOIA 3U4HA 3BG5A 3COPA 5EINA 1GZ3A 3N7UA 1X77A 2Q3BA 5KQLA 4YMTA 4CM7A 4WBNB 2B1IA 1QZZA 3TFQA 4RKQA 1GQ2A 1E58A 2ORYA 2YZKA 4NRDA 1GITA 1SZJG 2KQUA 2PTGA 1JHQA 3L4KA 2OSBA 3S40A 2PWZA 1MG5A 2HDWA 1XC7A 1XTVA 4GMXA 4Y2TA 1ZX1A 1CR1A 2BFBB 4AWXA 5KTOA 1CZUA 1S3GA 1Z4IA 2CHEA 2QAJA 2XECA 3A1TA 3STWA 3UB2A 1QUFA 4EABA 1GZ4A 1HYQA 3B6KA 4MR8B 2ZR8A 4UAUA 4B34A 2FR1A 3BWXA 3EIEA 3MFYA 3RRYA 3Q3CA 5I9TA 4BE9A 3ECAA 2AI3A 1Z7GA 2IYTA 2YOGA 1U3GA 3ZE9A 2HNKA 3IR6A 2F1RA 3SYRA 3RRXA 3G7NA 2OG1A 3PNOA 1OU0A 3VOAA 3GDHA 5C1PA 2HF9A 2WIDA 3R0QA 3GRCA 3RYCA 1D5CA 1K27A 2ERCA 1NNI1 2IFTA 3GCWA 4PFKA 4R1QA 5DCUA 1Y3IA 5BWLA 5HSGA 3K0SA 3MMZA 4NAUA 3V7NA 4HS4A 1IOWA 3FVWA 1A69A 1CX9B 5GJWC 4AULA 2ZJZA 4PRZA 4IOJA 5L3SB 1OREA 2OBBA 3ZU2A 3FPEA 1PFQA 2AYZA 4K9RA 4M1QA 1DAFA 4R3UC 3RFVA 2CVFA 4PIPA 2BV3A 4G4JA 3T15A 2EBHX 3NJ8A 1U9YA 2J87A 1JG3A 1A72A 2OQRA 1AHNA 2R4QA 3KC2A 3RRJA 3H3JA 4GWKA 3L7MA 4PLVA 5BNZA 4Z53A 3RNOA 4PQRA 4EPTA 4RHEA 3PS9A 3H1PA 5ABPA 1KI6A 2TMKA 2X9LA 3HUTA 3I4FA 3NBKA 4JL8A 4PLCA 3ID6C 4NMXB 3GG9A 4JB3A 2HIAA 1GAWA 2F1JA 2I0FA 2VF4X 3BMQA 3IELA 4KKVA 4Z7JA 3ZBQA 2QIOA 1VYTA 3CH6A 4D8WA 4AJLA 5LP6F 2W2XA 4XVQA 1ECPA 1BQ3A 4JB0A 3K0FA 2R2AA 3P1JA 4RV9A 3TW4A 1WZEA 5IDVA 3Q11A 4Q3EA 3EPPA 2GCOB 3SQMA 3AUYA 2IT1A 3TIGA 3VU9B 4QOSA 4MDHA 4F3TA 2IS6A 2A0UA 5DSXA 3UH0A 2B4YA 5EIBC 2FCRA 4OK5A 3WLFA 3U2QA 5TNXA 3QVWA 3UC9A 1H2ZA 4Q7KA 3A25A 3ANMA 4EO9A 1NBEA 1SK8A 3N87A 3IKVA 3OOHA 3GRVA 4ZCMA 1W8IA 1IAVA 4CG0A 5EMLA 3RC3A 3KZMA 3ESXA 3FH0A 4LJ8A 5D86A 5KWVA 1A04A 1WP4A 3L5OA 2GK7A 3IQHX 3P45A 3ZXXA 1MB9A 2OD7A 3PGKA 4MUKA 1QO7A 1BQ4A 1EHIA 4ZXPA 3W5SA 1GAEO 3GMIA 5JD5A 2IU6A 4LXQA 5LVAA 1ZESA 5EE1A 1DJMA 1R27A 1XJ0A 4ARVA 2XCOA 1ELOA 2WA2A 1XQ9A 1WXDA 1TAGA 2QE6A 3S81A 2C83A 4J1QA 5EWJB 1I14A 1XALA 3MT0A 1KFEB 2GDJA 4F4IA 5C3MA 1EUZA 3N3AC 1PL0A 2Q07A 3GFQA 1OFTA 2ZT8A 3DR5A 2GOYA 4IFTA 5JJIA 1Q1NA 4KRGA 3ZNPA 3VVMA 2BGNA 3A8TA 1NDHA 1WU8A 4I0WB 4NBVA 3VR5A 4BNNA 5DN6D 1Z68A 4YHHB 4CVNA 2I4NA 1DT5A 2COKA 2VO1A 1AZWA 1U63A 2R00A 2CYCA 4PRLA 2D1YA 3DLIA 4B7XA 2AFIB 1Z62A 1BE1A 3H2GA 3V1NA 4IGAA 4TSFD 3VNQA 1H6BA 1H3EA 4TWJA 4X95A 1M73E 3LM8A 1AMUA 1RRVA 5DYYA 2JCYA 4ARSA 4BLQA 2WYVA 4BNVA 4E70A 5A9SA 5JJ5A 5CXUA 3VFDA 1GG9A 5E2AA 1YFKA 4P81A 4LQ4A 5FPSA 3SR4A 2HQBA 3WGQA 3WYFA 4ZJPA 3HJAA 3VO2A 2GNPA 2Z83A 3OLYA 4BMCA 4C6TB 1A9YA 1IHOA 1LBEA 3OFVA 4LF4B 2PBFA 4NQRA 3A6FA 3H7AA 4LMBA 2DG2A 3HDQA 4BFSA 3R3VA 1E2JA 5F1PA 4QM6A 1ODJA 4NENB 2GVDC 1K08A 5HJ2A 4IIHA 5I9BA 4QRHA 4K6OA 4LZAA 3V3KA 4AECA 3S2YA 1WY7A 2BUCA 1QQ5A 3SZOA 3G2LA 1MT3A 3K09C 3PK0A 2OYSA 4DJFC 1M6WA 3WZLA 3FXAA 2HSJA 4HRVA 2QXYA 2WWGA 3I9KA 1FW6A 2UU9B 3D8TA 4G5OA 3OJFA 4JSTA 4ZT5A 2QN9A 5LMUB 4KXVA 1XZJA 4ZQIA 1TU3A 2RHGB 1FTGA 2H8GA 4WI1A 1ZSVA 2ONKA 4DZTA 4YV2A 2FPPB 3GRZA 1Z0KA 1Y4DE 4G25A 3W2GA 4ENVA 1GU7A 3C6MA 5TPZD 1ZHHA 3HR8A 3M34A 4OHZA 3T7TA 4BGIA 2H7VA 5KYYA 4RTJA 5CH5A 4PYOA 4HB4A 3N75A 3N5CA 2HSWA 4LBZA 1PGNA 3LOPA 4COOA 4J90A 3PNKA 3LUAA 2GM4A 1K88A 4GL2A 4JT4A 4TRNA 3PA6A 3OJXA 1I1OA 3LZDA 4TVSA 3ECCA 1E1CB 4DCGA 1M1YA 5HX7A 2KBEA 2DPHA 1RAFA 5ALKA 2XQKA 2VZ8A 1L5ZA 5CVJA 1RM5A 4UATA 3BJMA 3RT7A 4DNOA 5E38A 3ND7A 2ZI7A 3DMYA 4B83A 3LRPA 1RADA 1CZKA 1J56A 2IUEA 2CE2X 4RK5A 3D6VA 4V24A 4JC5A 2NYVA 3BH6A 5FBRB 4S1WA 5ILQA 3HXOA 2GHTA 3CTMA 3AHCA 1ZH4A 2JLSA 2ZPTX 3EGXA 3H0EA 3KB6A 1O6FA 3NB0A 2XCUA 3QPVA 4HYTA 4QRDA 3PI7A 4DEYA 4HS9A 4PVCA 2DGDA 2XB8A 4Y9TA 4KR0A 4QOHA 3SZMA 1G6HA 4INJA 3KDAA 3W6NA 4K86A 1BKDR 4BNXA 2CFRA 2IZ0A 2OV1A 4H08A 2IBSA 3DWIA 1ODCA 3LBAA 4TYPA 4KTVE 4FKBA 4NTZA 4RUKA 4S0ZA 4WOKA 4ESOA 2J0EA 1EDEA 1EJ0A 2H06A 1WKVA 2RGAA 2V0NA 4YT2A 5JSFA 1X15A 1L5YA 5BSMA 2ZJOA 2PRSA 5A3RA 1DZIA 2ZIXA 5DTRA 4BKUA 4I3FA 1MAHA 1P33A 3EXFA 5KTTA 5C37A 4WESA 4IQ4A 2GXQA 3TJRA 2YN2A 3Q7EA 3HYLA 3BBLA 2VYVA 2JFVA 1ZD9A 1MB3A 1PV1A 1W0JD 5GINE 2QRPA 4JY7A 4MIKA 2ONJA 3D2CA 3VYTB 1CRPA 5BSTA 4OXRA 3HPRA 1E3DA 4PHCA 5DCYA 4EK9A 1QLWA 2UZ1B 3JVIA 4FYHA 5CIWA 3K1JA 3JQQA 3BMOB 3G49A 4TYWA 3ZIAA 4OKNA 3IOYA 4ALKA 1KMHB 1FYFA 1HLFA 4NBKA 5DM60 4HG2A 4D6YA 1QOZA 1XEWX 1Q74A 1DXHA 1GV1A 1TA4A 3DO5A 4MP3A 5B3AA 4JI1B 4F2HA 5IKEA 1AQNA 2GF9A 2QVBA 3ZNNA 1UMCB 2DLCX 4JEHA 1XN1A 2VNSA 1YCHA 5G0SA 3K9LA 2PJRA 2CDCA 4CHTA 5IJWA 3B6MA 1KXJA 1WA5A 3ZHZA 4D4LA 3FG9A 1NZDA 1TK3A 3W2IA 4ZDKA 2B5OA 1RS0A 4C20A 4Q4CA 1UZMA 5BOSA 3OQ6A 1VTKA 3JRNA 5EHNA 1CD5A 2VJAA 2BDTA 5FUVA 1LK5A 3F73A 1QRSA 1OYOA 2RDMA 5JS6A 1PWXA 5DHRA 5I9LA 2OBYA 1U7UA 1E0AA 3N0VA 3PX7A 3WHKA 3DUWA 2ZTVA 3EBLA 1KVTA 1U2ZA 2HGZA 2ODNA 1CV2A 3GUHA 3KHKA 1Z2PX 1OOEA 2I2DA 1U8EA 1SURA 3R5JA 3UAZA 1I6KA 2JCXA 1BIFA 1ZPDA 1E69A 1E94E 5KWJA 2L42A 1SCJA 2H51A 3P96A 4XH9B 5A6VA 4DLYA 3EH2A 1EK6A 1IHUA 3BJRA 3UJHA 1HE1C 4TXLA 1FVXA 1ADGA 4JX9A 2YVKA 3SN6A 4BS9A 2O2YA 3G0OA 1DC8A 4L9WA 4ZOAA 2DSNA 5CLFA 1V5IA 2ZFUA 3HO6A 1J06A 1T4GA 1B41A 4A27A 2VF5X 2CHUA 3G85A 3BGWA 4K87A 4LZLA 3R7WA 4M83A 4NE2A 3RS4A 4DIBA 4L85A 4BO4A 3FMFA 4LRWA 1ZL0A 2GPAA 3L93A 1LWOA 2PGAA 3P27A 2C5LA 3GO4A 3V2IA 1IM8A 1GCGA 4R7ZA 3X2EA 4C43A 1H4SA 4N5MA 4PO8A 5IULC 1A95A 3I1JA 2HJGA 3OPYA 4FCWA 3CVVA 2VSNA 4KIUA 2OZVA 2B20A 4BRSA 5DT9A 1P44A 4F3CA 3CE6A 4P3OA 3OQIB 4J1TC 2RMKA 5GV8A 5BO5A 3T4UA 3EXHB 4HLCA 1G5QA 3W7AA 3WQSB 3N2GB 1AKRA 3RHFA 1HI9A 1DV1A 1T25A 3SXUB 2PUAA 5IKMA 4KQGA 5IC6A 1LV8A 4LXYA 1W5AA 2OCAA 3CW9A 2A9KA 4FDTA 5P21A 4JVMA 4RF4A 1N9ZA 3QW2A 4A8JA 1OLXA 5KPDA 1PR9A 1DKLA 4JUCA 3NZEA 2P5YA 4B5LA 5BXYA 4HVAA 4ZYXA 5L3QB 2QYOA 2HIMA 2A14A 3HCPA 3DW3X 3LDUA 4UU7A 3SXJA 2BEJA 3PRJA 4X20B 3B38A 1GVHA 2APJA 1Z5UA 3MHPA 1XNQB 4CQNA 4GI5A 4CMCA