5JLAA

Crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
257
Chain Sequence
ASAEFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRVARATGGKTLVLDVGEDASVTAAANEVRARYGVADVLVNCAGVLQRTLPPGELAQREWDVVSRIDLRGTYLCCAAFGAPMADRRRGSIVNIASVAGMRSGPLHAYGPAKAGVISLTETLAGEWGPKGVRVNCVSPGFTQTPALERGFTTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPVDAGYLIAGSWAAYGGLRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative short-chain dehydrogenase/reductase
publication title Crystal Structure of putative short-chain dehdrogenase/reductase from Burkholderia xenovorans LB400 bound to NAD
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Isomerase
total genus 94
structure length 257
sequence length 259
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jlaA00
2QX7A 4CV0A 3W8FA 1H9BA 1ADBA 2ET6A 5EQDA 3V1UA 5EL0A 3UW3A 1EE2A 4XEHA 3O26A 3L4BA 3DONA 4Q3AA 3IDSA 1KVSA 2VHWA 4GMFA 4DYDA 1C0PA 1MUUA 3CMMA 4IQ8A 3S55A 5GY7A 1YJQA 3NTRA 4IM7A 3GDGA 4RVUA 2A92A 3IUPA 4R68A 5IDXA 3C85A 2NVBA 3ZWAA 2Y0CA 2PGLA 4JJGA 1BVRA 3NEPX 2P9EA 8LDHA 4M87A 4M55A 2G0TA 2VNSA 4HFJA 5TT1A 4R4JA 2RIRA 1BMDA 1LDMA 1LSJA 2B69A 1X15A 4NBWA 1UXGA 3S2FA 3E1KA 4NR0A 2FR1A 2DQ4A 3JCZA 1CDOA 3D4PA 2B5WA 4XYLA 4NK4A 2I9PA 4DYVA 3FWNA 3GVXA 1WVGA 3F1KA 2QW8A 3KYBA 2GPTA 4CR7A 5F1KA 5L4NA 4GSKA 4UEJA 1LTHR 1R6DA 2Q1TA 2XXBA 4TWRA 2P2SA 4OOEA 1LDYA 1GDHA 1BVUA 3DOOA 1PJ4A 3ETGA 4JP3A 2HDHA 1JKJA 1HDGO 3GR6A 1HSZA 4GVXA 2C5EA 5G0UA 1NP3A 3DB2A 1I10A 2GUGA 2YZ7A 2X0IA 1E3EA 3TQHA 1JKIA 1B7GO 4KDEA 5I9LA 4FIZA 4YACA 1DXYA 1E3WB 2GN8A 1U7TA 3FN4A 1GZ6A 4IUYA 2NNLD 1GEGA 3P2YA 3RFXA 4GLLA 5DULA 4DLAA 3JTMA 4PG5A 5JBIA 1N7HA 4NI5A 1RM4A 3JV7A 1XSEA 3DZKA 5FEUA 4LN1A 2P9GA 2VQ3A 4QX6A 3WB9A 4GWGA 1B8UA 2BI7A 2WD7A 3AOEC 4KQWA 3AWDA 4YRBA 1EVYA 1Z6ZA 3GOHA 1DOHA 1E3WA 2AQHA 2BH9A 3RUDA 5C7OO 1NXQA 1UDAA 4J90A 2HRBA 3QIVA 1QG6A 3LU1A 3VDRA 2NTVA 1WZEA 4HADA 1NBOA 4YTEA 1T2DA 4R54A 4EITA 4RZIA 4FFLA 1OC2A 3OJOA 1ULUA 3GPDG 4UVHA 4CLXA 3DZJA 4W9NA 4CMHA 2Z1NA 2OBNA 4PLFA 4YT8A 3NDIA 4Y67A 1HLPA 1NQ5A 2QYSA 3HB4X 3K8ZA 2H1SA 4A5OA 4RVDA 4A7PA 3VPFA 4A2CA 1VLLA 3FSRA 5K6AA 2YQ5A 3PP8A 4EUFA 2OHXA 4J1TA 4BUCA 4DGSA 1N92A 1H6DA 2Q50A 2W98A 1N2SA 4ZVVA 1OMOA 1NYTA 3ADPA 4TMFA 2JAHA 4LMRA 4WOJA 3ZNQA 1WZIA 3ZHBA 1HDOA 1VJTA 2IYOA 2J8ZA 4CMAA 4X54A 4EJ0A 1DPGA 6LDHA 4UVGA 4YT4A 2B35A 4FSHA 3WSWA 5A3VA 3JYNA 2NM0A 1XG5A 5JS6A 3LSYA 1ZO8A 5HRUA 1T24A 3E48A 4Z9FA 4XD2A 3EZLA 2UDPA 4R3NA 3NV9A 3WBBA 3UH1A 1IE3A 4TZKA 5L4LA 1WP4A 1TT7A 3ZV3A 2EG9A 1KVRA 4W82A 4W4TA 2EERA 3N74A 2BGMA 4J6FA 4DQUA 4R01A 1U5CA 4IBOA 1GTMA 1MXHA 4ALMA 5TJ9A 1XWFA 4C7KA 4IDCA 5BSGA 2RHCA 2Y1OA 4D43A 3KSZO 3PHGA 4LSWA 5CDTA 3C7AA 2C29D 1EUCA 4OM8A 3L4BC 3FPLA 1C0KA 3UF0A 1EBFA 4FFRA 4EBFA 1W0CA 1O89A 3IJPA 5KKCA 3IP1A 4NIMA 1X7DA 3VH2A 3ZCXA 2ZIZA 3NTOA 1H6CA 2PKRA 2GRAA 3WJAA 4LMPA 3VVBA 3BMOA 1GV1A 2HMUA 4WEOA 5TT0A 4U5QA 3PIIA 1D3AA 2HAEA 2ZYDA 4YA6A 4FQ8A 3DTTA 1F8FA 2JD0A 1GPDG 4L75A 3QVTA 3UCFA 4OGWA 2ZTLA 2FSSA 3PZRA 4OH1A 1DFHA 1TT5B 4J49A 1GZ4A 4D79A 1D1TA 3VZPA 4OL9A 4RVHA 4ZICA 3KETA 2DBRA 2VT3A 5I8WA 1PGOA 1A27A 4YR9A 3LLVA 2VUSA 2VOEA 3RBXA 3VC7A 5TS3A 4NJMA 1SO8A 2OORA 3ETDA 1N1GA 3CEAA 3TFOA 2AEFA 3UVEA 4KP7A 3RUAA 1I33A 2UAGA 1ISHA 5JC8A 3Q6IA 2X6TA 1TT5A 4PLGA 5L51A 3JQGB 3MJSA 4N54A 4YQYA 4AJEA 1GPJA 4P4NA 2PKQP 1HE2A 4OJNA 1HDZA 3P5SA 4WLNA 4ND4A 4D44A 1A9YA 5KJ6A 1IULA 3PFFA 4FGWA 4MOWA 2EWMA 4NJOA 3I9JA 4PLTA 3SX2A 3U4CA 3V2HA 1NAHA 1YB1A 5A04A 1M76A 1ZIDA 3PIDA 4NZ9A 3I3OA 2C2XA 5EIOA 3VZRA 5EPOA 4B4VA 2IYPA 1D7OA 1ZXBA 3ICPA 3ZNNA 1Z74A 2BGKA 3JQGA 3KUXA 4PGFA 1AHIA 1ML3A 3H7AA 4AJLA 1JVSA 3WGGA 4E2YA 1LU9A 4ZN6A 2FPPA 1ZMTA 4B3HA 1GYQA 1SB9A 4XA8A 2C7GA 4WLUA 2GDZA 1ULSA 4GGPA 1GZ3A 1RWBA 2Z1MA 3MCVA 4O5OA 3KEOA 1MG0A 2FHSA 3GA0A 4J2OA 1ZJYA 3PXXA 1N7GA 5B37A 3QJ5A 1DC6A 2NWQA 2B4TO 3QWFA 4GX2A 4HUJA 1RPNA 4XWYA 2B5VA 4XX0A 1VKNA 3K96A 1L7DA 4B79A 1NFFA 2VTDA 3IKTA 5K6AC 4HBGA 3DL2A 4I9UA 1LNQA 2X4GA 3H8VA 5U9CA 1H0KA 3WGQA 3HB5X 1GAEO 2E6UX 4BKOA 1HWYA 4CQLB 3MOIA 1V9LA 2EKLA 4DBVO 3UUWA 3ENKA 1XHLA 1LQUA 1QYXA 3AW9A 1V35A 1PZFA 4HWKA 3D3WB 2X9VA 1V3VA 4N7RA 5CEJA 3EK2A 1C3VA 3LK7A 2HUNA 3GGGA 1YGYA 5JLAA 4XZ3A 5JDCA 3F4LA 3INTA 2HMVA 1XIVA 2FR0A 1A7AA 1HXHA 3SEFA 3O9ZA 1KOLA 1UUFA 2ZB7A 4NMHA 3OJEA 3RUFA 4CQLA 5TX7A 1U3WA 5KVCA 1LC3A 1G0NA 3FR8A 4O63O 2X8LA 4PLVA 1YB4A 1YBVA 2V6GA 3OM9A 1LLUA 2X7HA 5A5FA 5B4VA 4PLWA 3D3WA 4ZA2A 4QO8A 5C37A 1W73A 4IQ0A 3ZU4A 1LEHA 3ZWMA 4ND3A 1WDKA 3I5MA 1JW9B 3VOSA 3GG9A 3WJ7A 1MB4A 1T26A 1KYQA 1PGNA 1HSOA 3G49A 3BYZA 4YJFB 3MTGA 1A72A 2WWRA 3GFBA 3HUDA 2PZKA 2G76A 3ZN2A 3M1LA 4NFSA 4FOSA 2BI8A 1K6XA 4BKPA 2IODA 3BMQB 2WDZA 4IY1A 1B0AA 4RVGA 3VPSA 4BNGA 5KJFA 2G82A 3FWZA 4R3WA 2G17A 3ETEA 4M89A 5TRTA 2OP0A 3WLEA 4BB6A 5B1YA 1CETA 3QVXA 1YB5A 1XCBA 3OMLA 5DDIP 4DPMA 1K2WA 4IINA 4YJFA 1W4ZA 1DRVA 3HADA 4GPD1 3TFQA 4R51A 4FCCA 4J0FA 5I7EA 4N18A 2NQTA 3BMQA 2WTBA 2NQ8A 3X2FA 3SJ7A 4B4WA 4DQVA 3GNTA 2O7SA 2GNAA 1IL0A 2JCXA 3TZKA 4J7XA 4RDIA 2EJWA 4AJ4A 3CUKA 2O2YA 4Q3EA 4GGOA 2W2LD 2O7QA 4CM1A 4PRKA 3DXFA 4PN3A 3AU8A 3HDJA 2DLDA 4FBGA 4QT0A 3RBVA 3WS7A 1H9AA 3L9XA 5KVSA 1H2BA 1Q1NA 1YOVB 4TKMA 3RFTA 3RQSA 3KB6A 3UAGA 4AJIA 2AE1A 3F5QA 3G0OA 4HFMA 2WYWA 1X0XA 2EP7A 2Q2WA 3JQAA 1R4MB 3JSAA 3S8MA 4WPGA 2H5LA 3TNLA 4RF3A 4I08A 3MWDB 1LLDA 1O8CA 3PHHA 1JDJA 2I99A 4JJIA 5DZSA 3VDQA 4DL9A 3A1NA 5KJCA 1VJ1A 2R00A 3PGJA 1E7MA 1XU9A 4BV8A 2RHRA 3U9LA 1ID1A 3GZNB 3E5RA 2CZCA 2D2IA 1F14A 4IDBA 1U8FO 1YOVA 3UOGA 1DLJA 4MP3A 3VZSA 4JJFA 1P1RA 1B8VA 5HBRA 1H94A 3OQ6A 3KOUA 5HWSA 5AVOA 1GY8A 4R5HA 1IPFA 4JX8A 1L1FA 4JK3A 1ENOA 1OOEA 5TJHA 2GD1O 1YH3A 1PWXA 3TWOA 3A06A 1QORA 3DBLB 3GZNA 1PZGA 2H6EA 1UJMA 2B4QA 3A28A 3U4HA 1KETA 4JIGA 3GG2A 1I2ZA 4FR5A 3PVZA 3R3JA 4EGFA 3DZGA 2OUIA 3AM4A 2DAPA 3GUCA 4UULA 2YDXA 1XA0A 2AQIA 1PZEA 1KBZA 3OIGA 4PFJA 3BTVA 5IDQA 3DTYA 2CF5A 4U0JA 3D1LA 1ZZEA 1PJCA 1T25A 3RC9A 4J4HA 3DBLA 1DFGA 4YYZA 4WECA 1QYDA 1XQ1A 1SEVA 4NH4A 2PLAA 3T4XA 5GZ1A 2JJYA 3FD8A 1LDGA 3VHRA 1P44A 4IDGA 4IZIA 4BGEA 2PH3A 5T67A 1YS4A 4CM5A 4TROA 3EVTA 4L9RA 2PZMA 3S1LA 3MZ0A 9LDTA 3L6DA 4RF5A 2JL1A 1FXSA 2J3HA 2DC1A 4MJLA 1XR3A 1K5HA 2WEKA 1DC4A 3O4RA 5JDCC 3U62A 4JBIA 3AUUA 2ZB3A 3WYBA 4RQTA 4I1IA 2RH8A 4Q39A 3GLQA 1EVJA 1JWAB 4BKQA 1R0KA 3LT4A 3OJ0A 4CM7A 4A10A 1JLLA 4CUKA 3CZMA 3OSUA 4KTTE 3ZU2A 4BNKA 4UEKA 1I0ZA 2O3UA 2UUPA 2X0NA 2Y68A 4IMPA 4NG5A 1UZNA 3IS3A 5FF9A 3VPGA 4XQEA 5I9NA 3G79A 1ZXLA 2F00A 3LC1O 4IIVA 5IZ4A 1ARZA 2C0CA 5L53A 3GDFA 3P19A 4I9NA 3KM0A 4CMCA 1TEHA 5C5IA 1SAYA 3QP9A 4OKIA 3IIEA 4CLEA 3OH8A 1U5AA 2AA3A 4UVIA 5IFLA 5COBA 4ALKA 1KVUA 1Z45A 1FF9A 3NRCA 3Q9NA 2AG5A 5KCZA 3VZQA 1DAOA 4ID9A 3I9OA 4LRTB 4XIJA 4XQCA 4RZHA 5TQVA 3H6KA 2HK7A 4MVJE 3LF2A 1HDRA 3QY9A 1K0UA 1ONOA 5BQFA 3RBZA 1Y7TA 4U8GA 4FJ0A 3ONEA 3H9GA 1PJBA 2BHLA 4II2A 2YHIB 1PEDA 4P8RA 2UUOA 3Q3CA 3VVCA 4BNTA 4JQCA 4AJ2A 5I7FA 4J3FA 1DHTA 1DIAA 2GZ3A 4IJKA 2OXIA 2XOXA 1LRJA 5F21A 1B26A 2QYTA 4FFMA 1K3TA 2AG8A 2NTJA 3ZWOA 2PH5A 4EDFA 3H3JA 3EMKA 2YFQA 4IXTA 1AGNA 1NTOA 1PGJA 1ZK2A 3PK0A 5IXSA 3JQFA 2NU8A 2EGHA 3ZWWA 3T7EA 1OAAA 1U3TA 3E9NA 4GVLA 2CNBA 4MP8A 1DEHA 4KUEA 5JMWA 2O4CA 1GCUA 2Q49A 3ANMA 4F6CA 5A02A 4CLOA 1SOVA 1N5DA 4D41A 2Y1CA 1PJLA 2I66A 1H6AA 2D4AA 3DFUA 2ZTVA 1C0IA 2PKQO 1Z82A 5T8KA 3VTFA 3ZHYA 1TI7A 5DBGA 5L9AA 4UUPA 1YQDA 4A03A 4IZHA 1E77A 1C14A 4L0QA 3GK3A 3UFXA 5HM8A 1EQUA 1UZMA 2GERA 2VYVD 4MKRA 3PYXA 1YE3A 2VZ0A 4IJUA 1JA9A 4J16A 3JQEA 1PIWA 4K6CA 3TZHA 3ZV4A 3U0BA 3RAJA 4CL3A 2D5AA 4BMNA 3ANNA 4LVCA 3WIEA 4NK5A 4BV9A 5J23A 2I76A 1WWKA 3NGXA 3PI7A 4L4SA 1HF3A 3ST7A 2Q4BA 2VT2A 3C7CB 3JQ9A 5CPFA 2ZK7A 1KVQA 4Q3DA 1WMBA 5KKAA 4DPKA 2DFVA 2ZB8A 4OO3A 4AJNA 3TF5A 1GD1O 3DMTA 5A9SB 3OJFA 4XDZA 5F3RA 1YJ8A 1B15A 3KSUA 2IZ0A 4QFCA 3WGOA 3DHYA 1ZKMA 4MP6A 1CYDA 1MA0A 3DC2A 3B20A 3D5QA 4OQYA 1X13A 4PG8A 4IDFA 3BXXA 2DTXA 3K6JA 4R9RA 4BNJA 3ZWCA 2Y66A 3QQPA 3N7UA 3WBFA 2AMFA 5GMOA 2CDAA 3LQFA 1YDEA 1EUZA 4NBVA 4DPLA 1U4OA 4BO2A 1MX3A 4BO8A 1QYVA 1BXGB 3UHAA 5A9SA 3PEFA 1NR1A 5ICMA 4FPXA 3GVHA 1M6HA 4PZCA 1Q7CA 1ORRA 4G2NA 4CL8A 3Q11A 3IKVA 3O38A 4LCEA 4I5FA 1TA4A 1V3UA 2R2GA 4YAEA 1DBVO 3GHHA 2OL4A 3L77A 2WD7B 3ZU3A 4XGNA 3ZWNA 2PFGA 1T2FA 2AW5A 3ZGYA 4RF2A 1U3VA 3JQBC 1BXGA 1ZEMA 2B83A 1O6ZA 3V8BA 4A26A 4EEZA 1H5QA 2ZTMA 3JQAD 4DA9A 3OEWA 3I9KA 3A4VA 1KVTA 2WJPA 4CQMD 3WIDA 3CSDA 2B36A 1BXKA 1DC3A 4RO0A 4F3YA 2IZZA 4Z0TA 4D3SA 5JAIA 3DHEA 3WOHA 2I67A 1QKIA 3C8MA 4WJZA 3H9JA 5DCUA 1RYEA 3BAZA 3DZHA 3SLKA 3K2BA 3EDMA 5A03A 4KMSA 4EJMA 4W6ZA 2VHXA 4E0BA 2IRWA 2WD8A 1RM0A 2FN7A 3QWHA 5EINA 4OOFA 3GNSA 4M54A 1HTBA 4DIOA 1SEPA 1ONNA 3F1LA 1XGKA 4NQZA 3WG9A 5ER6A 4CMIB 1IHXA 5JO9A 1J4AA 2WE7A 3IUSA 2GN6A 1YXMA 4U7WA 4WNCA 5FI3A 3CMCO 5HS6A 1LX6A 1N9GB 2W2LA 3JYOA 1TB4A 1LSSA 3DAGA 1E1KA 5G0SA 2IDZA 3S2IA 1Z73A 3NT4A 1P0CA 3PDJA 4ZQBA 3QA9A 4BO1A 3AFMA 2P4HX 5EERA 3WX0A 1P45A 5JY6A 1ZW1A 4XGKA 3UCXA 4R1NA 4GX1A 4TVBA 1NNUA 4CMIA 2J6IA 1PS8A 4BO4A 4BNUA 2GCGA 1ISIA 1DIGA 3JQFC 4QO7A 1MC4A 4FFPA 3RVDA 3IOYA 4DC0A 3V2UA 1D1SA 1GQYA 4AJKA 4B7XA 3I1JA 4XYGA 2HK8A 4YCAA 3B6ZA 2QZ9A 1N9GA 4IXWA 4FJ1A 1LDBA 4O6VA 5U1PA 1VM6A 3UICA 5TGDA 1GL3A 2DFDA 3KYDB 3LC7O 1NFQA 2C20A 3GMSA 1I30A 3IQDB 3C1OA 5BT9A 5KJ1A 3VH4A 3JD0A 4PLCA 4BGIA 5DOVA 4GL4A 5T8KC 3E9QA 1LRLA 2VN8A 3NDRA 3OIFA 2HMWA 4TRJA 2NTNA 3PZBA 1VSVA 2BF7A 1BGVA 2IEBA 4KOAA 2NLOA 3INRA 4AJPA 4LGVA 3I52A 2YJZA 4FB5A 3KYDA 1HDXA 4IPTA 4Z9YA 3ZZNA 3I9MA 4ND2A 3DEYX 4RPGA 3BMOB 3I4CA 3ZW8A 3HDHA 4XRGA 3OICA 2Z95A 2X5KO 5A05A 3W6UA 4CM4B 5K0ZA 1HZZA 1F17A 1UXKA 1IZ0A 1HE4A 2AHRA 3BZUA 2X22A 1ZMOA 3I9NA 3OECA 1SCUA 1MFZA 1WW8A 4WE3A 3GVPA 5F5LA 1O9BA 1K6JA 1J5PA 1NWCA 2FP4A 3WLFA 2ILTA 1NVGA 3JQ9C 3CXRA 2G1UA 1EMDA 2F1KA 3DR3A 1UXHA 5ITVA 3IAHA 3F6YA 4QXMA 3PPIA 3ROKA 8ADHA 5HTOA 3DMTC 1EFLA 4ILKA 4G5HA 4N5NA 4NFHA 2V65A 1B3BA 1HLDA 1PL6A 1SZJG 2ZKLA 5K9ZA 4CM4A 3UGKA 4KWHA 4YEDA 3QSGA 3DAFA 3I23A 1MG5A 1PL7A 4NJMB 1ADGA 2IXAA 2ZYAA 2PZJA 3WXBA 1A9ZA 4K6FA 4HNGA 3RD5A 2EKQA 2OP1A 4CM8A 3JQ8B 1U3UA 5MDHA 3GHYA 4KQXA 4Y98A 2OO5A 1UP6A 3MEQA 4JP2A 3HN7A 5ENVA 3VKUA 4JNKA 1CQIA 3SC4A 4LISA 5AOVA 3NX4A 4XJSA 2GLXA 4OXYA 1UH5A 3HFGA 3GAFA 3CH6A 4FN4A 4RLHA 1P33A 3QWIA 3WYCA 5IG2A 5JXWA 3JQ8A 2YYYA 3NJ8A 4RORA 3OETA 5CFZA 3G1TA 4YBZA 1A4UA 3HHPA 1EK6A 2UYYA 1IPEA 4MVJD 4Y6SA 3FRJA 3ROQA 1P3DA 3WWYA 2P91A 1HETA 1SB8A 1SNYA 2FOIA 4ROSA 3TSCA 3U4IA 4JBGA 4E12A 2VYND 4YAIA 1U1IA 2JFFA 1J6UA 5A1TA 5JFOA 3INGA 3HWRA 5G0WA 2Q45A 1NR7A 1E0DA 1ZH8A 4JGBA 3CZRA 1NX6A 1E1NA 1I2BA 2DBVO 2VRCA 3HZZA 4CMKA 4LVUA 1NFRA 3F4BA 2RH4A 2Q1UA 2O50A 2Y1DA 1D4FA 2BFPA 3LZ6A 5JMPA 5KNLA 5DP2A 4ZQHA 3TPCA 1CRWG 4XCVA 3PDUA 4XYBA 1AN9A 4LK3A 1UDBA 1Y9AA 3QVOA 1NPDA 3ZV5A 1ISMA 3UXYA 3AM3A 1O94A 3O8QB 2ZYGA 3MJEA 2QHXA 3BA1A 4W9NC 3M2TA 2QIOA 2PK3A 5IDYA 3JD2A 3JQCA 5HA5A 1BSVA 3LLSA 2FR8A 3BHJA 5DBFA 4AVYA 1N1EA 4PVCA 1VE9A 3NAQA 4WKGA 4XRRA 1RKXA 2JKVA 3K2EA 5IN5A 4RQUA 1EQ2A 4ZGWA 3AK4A 5L40A 4ITUA 4FOOA 3AM5A 4MKZA 1PQUA 1ZSVA 7ADHA 4FFNA 4IS3A 2AXQA 1PJSA 3O8QA 1BXZA 5KOIA 1MV8A 4ALJA 1NHWA 1SOWA 3WGZA 3ITDA 3TRIA 4XIYA 3GDOA 1Z7EA 3GVIA 4BNIA 5T6BA 3KRTA 2DU8A 1Y81A 2HRZA 1GUYA 4GKBA 2O3JA 3GEGA 2B37A 1NQAO 3KO8A 3CKYA 3HDQA 4EW6A 5JC1A 1I3NA 3GGPA 4F6LA 4QEDA 1E1MA 4URFA 1ZJZA 2EIHA 2VYVA 1XEAA 3JYQA 4NBUA 4RLSA 5EMHA 3I83A 3K73O 3RFVA 1XYGA 3JQ7A 1WXDA 4KWIA 4CV3A 3MJCA 1ZVMA 1KERA 2VHZA 4J1SA 2J5RA 3T4EA 3L6OO 6ADHA 4Y8VA 1OZAA 4YRAA 1DIBA 2C54A 1YQXA 4ZRNA 4AG3A 4JLWA 4BIIA 3LYLA 4RPJA 1YVEI 4Z3DA 1HYHA 4PLYA 3LF1A 2UVDA 2O23A 3WNVA 1WAMA 1H93A 3EUWA 3WQQA 4MDHA 4BGUA 1LLQA 5BSFA 3MJVA 4MVJM 1YL6A 1ZFNA 2UV8A 4R1TA 2ZCVA 4W99A 3Q1LA 1SC6A 1NPTO 1AXEA 4M49A 3UN1A 2W90A 5BR7A 5HS4A 1UP7A 5TLSA 4HFNA 5I7VA 1WMAA 3DFZA 3LT0A 4BNZA 4D42A 1WPQA 1RM3A 4TKLA 1E6UA 4GWKA 2O48X 1TXGA 3WGTA 1N8KA 3WTBA 1P0FA 1GADO 2LDBA 3TZCA 4KDFA 4ZD6A 3JQAB 2C82A 3K5PA 4ONEA 1HKUA 4E30A 4CQMB 3K30A 1RJWA 5ENDA 3WFIA 4IJVA 1LSUA 1ISGA 1I5RA 2PNFA 1E3JA 2HKIA 2LDXA 5BNFA 3WDSA 4DVJA 4MVJI 3HQ4O 3GGOA 1K6IA 3L07A 1AHHA 5COAA 3D3EA 3FF4A 4OKNA 3QRWA 4AJHA 3PLRA 2ZJ1A 1R66A 4NBRA 4MVJF 3VPHA 4TVOA 4UREA 3ZV6A 4CQMA 3PHLA 1V3TA 1E5LA 1GQQA 3WMWA 2PR2A 1F06A 3TZQA 1K89A 4QFDA 1L7EA 1YBAA 3F5SA 3ENNA 3L0DA 2HMSA 2DPGA 3AI2A 1ZK0A 3CE6A 5U4QA 3VKVA 1VJ0A 2DUUA 5CP8A 3K31A 1PR3A 1UAGA 3W4IA 4BB5A 2W4QA 1IYZA 1E7QA 1UR5A 4BMVA 1LRKA 1GYRA 4O0LA 5TNXA 1ZSYA 3GEDA 1B14A 3TL3A 2J3KA 4ZQGA 2AEJA 3I4FA 1U28A 4ZHSA 4L4RA 3EY4A 2XF8A 4OYRA 4UUNA 3NUGA 3EVNA 3Q2KA 1QP8A 4AICA 2YDYA 3E82A 4R69A 1YDWA 1KEWA 5CG1A 1E1LA 4R1SA 1I2CA 4CUJA 4ND5A 3TOXA 1VL0A 4K26A 3OBBA 1G1AA 4DQXA 4F45A 1WDLA 2PZLA 2B4RO 4DBZA 2O2SA 1NVTA 3G17A 4Y9DA 4WNIA 1IY8A 4B7CA 4ZJUA 2JFHA 4XB2A 4NFYA 3LC2O 2EP5A 3QV1A 5G4KB 5GZ3A 4D46A 3RCBA 1W8DA 3ZWPA 1VL6A 2X9NA 3OFSA 1T2EA 4WLFA 2GYYA 1Z7BA 4M8SA 2PGJA 1Y8RB 2X1HA 4MVJG 2AQKA 5IN4A 2Y05A 4A0SA 5KVVA 2V6MA 3ZDFA 3PLNA 3N58A 3VTZA 1YL5A 3H9QA 2Y93A 1LSOA 2DT5A 5EESA 4KTVE 3MJTA 3GN1A 4PLPA 4IIUA 1XQ6A 5AXBA 1P1JA 5G4KA 3PJFA 3EW7A 4J9VA 3WWZA 3HSKA 2P4QA 1FDVA 4XYMA 4YWJA 5G0TA 1QRRA 3H2ZA 4L4XA 1YONA 1PZHA 1HZJA 1DHRA 3B70A 4L74A 3SXPA 5C7IO 1Y8RA 2BGLA 2JD1A 3V1TC 1B3RA 4BVAA 3JQ6A 3DO5A 4CPDA 3UCEA 4O1MA 2Q3EA 3E9MA 5KIAA 3RWBA 1QLHA 4QUKA 2CFCA 4MKXA 4OMUA 4MVJP 1HT0A 5JAQA 3ADOA 4DTIA 3GNQA 4L76A 4P22A 3ZNPA 3ICCA 4Q3BA 5G2OA 4MINA 5AXAA 2A4KA 5A5EA 4OHUA 4CJXA 4E2WA 3B1KA 3GFGA 4Y6RA 2D0IA 5TF4A 4FS3A 1GR0A 2DTDA 2PGDA 4F46A 3SVTA 1KY4A 1E92A 5JCXA 3LVFO 2B0JA 1ADFA 2CDBA 3M1AA 5JY1A 3FR7A 2A35A 3SLGA 3JD3A 4XKJA 4S3MA 2GSDA 3RKRA 4OIMA 4R41A 1X0VA 3P7MA 4E5PA 1QMGA 5T57A 1GV0A 4OSOA 1I24A 4BQPA 2Q4EA 2VRCD 1Y5MA 2DUWA 5EQFA 4O59O 3F46A 2W2KB 3ZW9A 3I9LA 4D45A 1H6BA 3T7CA 4EYEA 3ZWYA 2D5CA 3E03A 3F47A 2VWQA 5THQA 1J0XO 3C3XA 4RPHA 3I6QA 4J1NA 3V2GA 3E8XA 4ZQEA 3WGYA 4GX5A 2JCVA 4Z9XA 4E5NA 4GQAA 1PWZA 2CSUA 4AFNA 4CLHA 5BNTA 2EW8A 4BO9A 2YQ4A 4PG6A 5DCWA 3H5AA 1ISFA 4RGBA 3WQSB 1PTJA 2W2KA 2JHGA 3MJ4A 3C1TA 1LDEA 4I5EA 4NNJA 4B8ZA 9LDBA 3SBOA 3DBHB 2C59A 4CLOB 4W7HA 4BO7A 4BO3A 1PGQA 1DAPA 4J7CA 1J49A 3ROPA 4MVJA 4B8WA 4ESOA 3KVOA 1QXSA 1SPXA 5B4TA 2DM6A 1DJQA 1VKOA 2X23A 3AY3A 3FPCA 4DLBA 4E5MA 4IGEA 2VYNA 3W6ZA 2Y1EA 4E32A 1OBFO 2BELA 3BTUA 2HJRA 2WYUA 4B4OA 3RIHA 4EI2A 4KUHA 4R1UA 5LDGA 2DPHA 1MXFA 1E3SA 2IXBA 3TOZA 1B16A 2BLLA 1M67A 4TSKA 3DBHA 3PWSA 2R00C 5FYDA 1VRWA 4OXKA 1S6YA 3WNQA 3GF4A 4TRNA 3DHNA 5ILOA 3ORFA 1ZK4A 4BNWA 3STHA 3ONFA 2BRUA 4UVEA 3TDKA 1HE5A 3Q0EA 3RC7A 2O3SA 2AQ8A 2CD9A 2FPIA 4FDAA 5F1OA 3OP4A 1UXIA 3PFWO 2HQ1A 4OXNA 4UVDA 3ZHZA 2GF2A 5H82A 2PY6A 4J0EA 3K92A 1P9LA 2QG4A 2X9GA 4IDAA 3WSVA 5DNAA 1ADCA 4Z0PA 4CM6A 3COSA 1F8GA 2V6FA 3PYMA 3V5NA 1E5QA 1DO8A 3RKUA 1HDYA 4I8XA 5T5QA 5AQ1A 1E6EA 2NADA 4Y6PA 4BNNA 1LDNA 3D64A 4IGFA 4Q3CA 1BHSA 3B1JA 4IDDA 4EUHA 2C2YA 2O3RA 1E7WA 1OFGA 5CPBA 3H5NA 1MGOA 3E6AA 4XGIA 3EC7A 3WR5A 4YRDA 4BS9A 2DVMA 2X58A 3QW2A 4H3VA 3ZI0A 2VWPA 3BMCB 4AL4A 1ZCJA 1T2CA 4XB1A 2IE0A 4ALNA 3NYWA 3HJAA 3W8EA 3EYWA 3IC5A 4HX5A 3QE3A 1C1XB 3NT5A 3LT2A 1ZEJA 4E4YA 2VCYA 4C4OA 4DREA 2EXXA 2QRJA 3WFJA 3PTZA 1YWGO 4XJTA 3HNPA 3VH3A 4EUEA 4G65A 3BTSA 3U09A 1LBEA 1RYDA 1DJNA 2Q99A 1Q2XA 3BMCA 1G6KA 1E3LA 2CDCA 4B3JA 3H3FA 4QQRA 1EDOA 1MP0A 4LW8A 1ENPA 5GZ6A 3H9UA 2DBZA 4E3ZA 1I3MA 4B7UA 5FI5A 3TJRA 4CODB 2I6TA 1C1XA 3QLJA 2A9FA 1PR9A 2I5PO 4WLOA 2X5JO 5L7YA 2HLPA 2YW9A 3GZ4A 5JCJA 1PU2A 2O3TA 1KEUA 2NUAA 4CV1A 4DIFA 2OBYA 3WTCA 5IZCA 2RAFA 2IZ1A 3FBGA 1PGPA 3C7DB 1EVIA 1W6UA 4U6SA 3TZ6A 1NM5A 4FFOA 2EF1A 1YQGA 3NDJA 2JAPA 1D8AA 1DRUA 1CIVA 2P5UA 4W7IA 4RPKA 4LSMA 4E13A 1UXJA 1Y9EA 1VI2A 3W4JA 1ZK1A 3DQPA 4BNYA 4CMJA 1ONPA 1PJQA 4FGSA 2E82A 5C7LO 4JBHA 1RM5A 4MVJH 4RPLA 3AUAA 4ZRMA 3ZU5A 5L7WA 2NVWA 1JU9A 2JD2A 2Y99A 1VC2A 2FRDA 4Z0HO 4P4LA 2Y0DA 2E49A 4YQZA 2PA3A 3PJDA 3RASA 1I3LA 3AOGA 2CUKA 1R0SA 1EE9A 1I3KA 1U2GA 1NAIA 3LDHA 2SCUA 4XR4A 4DRYA 1C1DB 1M6WA 1GCOA 3GUYA 4J43A 3CTMA 1V0JA 5LC1A 4BNVA 3ZH2A 3NT2A 3AI1A 4NBTA 3ABIA 3KSDO 4JCOA 3R1IA 5ER9A 2VUTA 4TZTA 2VNAA 3KXDA 4RF4A 5DCYA 3BIOA 2X0RA 3VPXA 1GQ2A 1I8TA 4L73A 5THKA 1JWBB 1P77A 1T1RA 1U7HA 1IOLA 3QVSA 1EZ4A 1ZSNA 4DC1A 3U4DA 4NU6A 4PG7A 4ND1A 3OHSX 3MOGA 4TQGA 4PG4A 3RU7A 1C1DA 3IP3A 1JAXA 3H5RA 1T2AA 1XKQA 3VH1A 5DF1A 4PLZA 3QWAA 2VWHA 3LT1A 1Q0QA 5A9RA 2V6BA 1SBYA 4E2XA 4WK6A 5TSDA 3PJGA 5TC4A 4U0KA 3GVCA 2JHFA 5CHEA 1CF2O 1QYWA 3W4KA 4ALLA 3H4VA 3HN2A 3KZVA 1A4IA 2HO5A 3AUTA 3L4SO 4IMRA 4RVSA 2D3TA 2WM3A 4EJ6A 1Y8QB 1KC3A 1CWUA 1GU7A 5JSFA 1NQTA 4CMEA 2Y67A 1HL3A 1EUDA 3NTQA 3SJUA 3FCOA 4NPCA 3U3XA 2GGSA 3PQEA 4BNMA 4BKRA 5C3MA 1MC5A 1KEPA 3GC6A 2D8AA 4YT2A 1YL7A 3DDNA 2YUTA 3ASVA 3NJ4A 4NU5A 3OQBA 4R5MA 1JVBA 5L95A 2QRKA 2YV1A 4HY3A 1Q0HA 4CM8B 4RV9A 3PWKA 3ITKA 3Q9UA 3FI9A 3ZWXA 1G0OA 1IZ9A 1KY5A 2VWGA 1WDMA 4RJTA 2E48A 4XDYA 3M2PA 1HYGA 1Y8QA 2NV6A 5A4DA 2Q2VA 4CM9D 4ZQFA 5EN4A 1Q7BA 3CIFA 4BNLA 3RI3A 1GUFA 1EBUA 3BHMA 3DBRB 1ISJA 3AFNA 4FC7A 4QSMA 5JDIA 1KEVA 1JKFA 1QLJA 2VHVA 3GMDA 5KJEA 1DLIA 1U2DA 3AY6A 1CJCA 3H2SA 4J7UA 5L7TA 2HCTA 2NACA 3D4NA 2FY8A 4H15A 1FJHA 2Q46A 3RC1A 3GRPA 3AY7A 1P74A 4LRSB 5JO0A 4U6QA 3GRKA 4J9UE 1Q0LA 2XAAA 3DBRA 1ZUD1 4YAJA 2GR9A 1LLCA 2WSBA 1PQWA 2CVOA 1IHYA 5ES3A 2GN9A 4WCDA 3KLMX 2D1YA 3TL2A 4CLRB 2XXJA 2ZTUA 4TRMA 2QRLA 2Y1GA 4D3DA 4GKVA 3RUHA 3U5TA 4RDHA 4NDNE 4YDRA 3WICA 5B4UA 1JQBA 1LQTA 4XQGA 3RJ5A 3RU9A 1AUPA 1TLTA 5IZCC 3W8DA 3I6IA 1BG6A 3FNHA 4GH5A 2P5YA 4HNHA 1Y5RA 5ADHA 2EEZA 2BKAA 4E2ZA 4HFRA 3R6DA 3RSHA 2WMDA 3RUIA 3EGOA 4BHTA 4CLRA 5IF3A 1DB3A 1OI7A 5ILGA 2Q2QA 1CQJA 1PS0A 2HSDA 4MO2A 4P4GA 3KBOA 2PV7A 2J5KA 3BTOA 4J4TA 3EAGA 4G81A 2CVQA 2Z5LA 3D0OA 2DKNA 4M1QA 5L3ZA 3BMNB 4BKUA 1I01A 5H83A 5BSHA 1YBMA 3OA0A 4EEXA 4LCJA 3KYCB 2EGGA 1MLDA 1V8BA 3NKLA 4S1VA 2VTEA 2AE2A 1UZLA 4YJDA 2JFGA 1AE1A 2Y1FA 5CDGA 1U9JA 4D7AA 2EJVA 3KHUA 4A27A 4BL5A 1T4BA 1LA2A 1PJTA 3PQFA 1NPYA 3ROMA 2OZPA 2J3JA 3BMNA 4BMSA 1V6AA 3OIDA 2NU6A 4J4BA 1DC5A 2PWZA 5JPIA 3QHAA 4INAA 3K9QO 4Q3NA 4BO5A 4DXHA 1LJ8A 3H9EO 3KYCA 2P9CA 3D4OA 4YJGB 4B4UA 5JAZA 5T64A 5JNLA 5LDHA 3FNFA 7MDHA 3OEYA 3FNGA 3JQ7B 2PD4A 3GPIA 4E21A 1O5IA 2CVZA 1HEUA 2GZ1A 3AI3A 4B3IA 4BOYA 2HK9A 1E6WA 1BWSA 1Y6JA 1OC4A 5A3JA 2OGUA 4YJGA 1R37A 2DBQA 1ZK3A 3VAZA 3IL2A 3DWFA 4OQZA 3JYLA 2QQ5A 5F5NA 3ZWBA 3WYEA 2YY7A 1H2HA 3BHIA 3RC2A 4D0RA 2O3QA 4UEOA 1R0LA 5TIIA 2H63A 5G4LA 1E7YA 4FD3A 5COQA 4CMEC 5KTKA 1U4SA 5AXDA 3IMFA 3UKOA 2OFPA 3CINA 2I3AA 2ZATA 2CY0A 2HMTA 4XYEA 5DT9A 4BNFA 1EK5A 4CMGA 3OF2A 2BFMA 1IB6A 5IDWA 4BNXA 1HRDA 5JCJD 4FJ2A 2HJSA 1I32A 2BFOA 4KUGA 3WGIA 4K9DA 2C07A 1B8PA 1ENZA 1Q7GA 2PTGA 2I3GA 5IJZA 1QSGA 3RUEA 3OA2A 4L8VA 2W8ZA 1QV6A 4MPDA 4DUPA 3HG7A 3PWZA 4I9HA 4Z3KA 1EFKA 1KS9A 5FFFA 5JDIC 2FSVA 4R9SA 5KWEA 4WUVA 3IJRA 4PRLA 4R16A 1P1KA 3KV3O 2Q1SA 4YJHB 1ZBQA 5AYVA 3L6EA 2WE8A 4RL6A 3ANLA 2C5AA 1ZNQO 1GEEA 2CMDA 1P1FA 3HDYA 5IXYA 3ASUA 1YKFA 4UUOA 1LI4A 4YT5A 1PX0A 2PD3A 3S2EA 4CUZA 4WASA 1XDWA 5B12A 3D5TA 1T4DA 1NQOA 2J3IA 1HYEA 2E4AA 4MIOA 1X14A 5ITWA 3DOCA 4HKTA 2ZJ0A 4YJHA 1TVEA 4WLVA 1UAYA 1PQPA 1X1EA 2POQX 5H81A 4CR8A 1GUZA 3RJ9A 3MWEB 3C1AA 1F0YA 3U49A 3F3SA 4WEQA 3ONDA 4J1QA 3ULKA 3RUCA 2FPGA 4FW8A 1ENYA 4YPOA 3ZWVA 1BDMA 3HE3A 4I5GA 4K28A 4NHEA 3AU9A 3DBVO 3GEMA 3O03A 4BQRA 3PGXA 1WNTA 5FWNA 1A71A 3KTDA 4WGGA 1BW9B 4TRRA 2E37A 4WCFB 3DOJA 5ICSA 3PQDA 1P1IA 2XPCA 3P2OA 1R15A 5KVQA 5JYDA 4Q9NA 3FTPA 5CAEA 3G3EA 3X2EA 4GI2A 1VSUA 1JAYA 4HP8A 4E31A 2VRBA 4AJOA 5CEFA 2BD0A 3DZFA 2NVUB 2P68A 2BMAA 3GQVA 4CR6A 1BW9A 4J2HA 2QZZA 4WCFA 2PD6A 2GASA 5CDUA 1R12A 2NU9A 1HE3A 1GFSA 1VL8A 3SC6A 4PVDA 2A94A 3V1YA 4II3A 4WOKA 3WQRA 3JD1A 2HU2A 4IS2A 1Y1PA 3AJRA 1R4MA 1GYPA 2ZQYA 4K1LA 2OMEA 4HV4A 1M75A 1S7CA 1WLYA 4QECA 1PL8A 4YAKA 4DLLA 4IDEA 2NVUA 3EZYA 2O4UX 4ALIA 3FHLA 3R0IA 2J5QA 1QR6A 5JE8A 3PYLA 1A7KA 1NHGA 1PJ3A 3FBTA 3ZHXA 2H9IA 5BSEA 1Z75A 3M6IA 4GSLA 1DIRA 3TN7A 2AEMA 1FMCA 1IUKA 4E33A 1DSSG 3ON5A 5DP1A 5AXCA 5F1PA 1KIFA 1O95A 1E7SA 2BFAA 3ZNOA 4CM3A 1DFIA 1FDSA 3DZIA 1DDOA 2RCYA 4UAGA 3CPSA 3PHIA 3R3SA 2VUUA 1CEQA 1JTVA 5EJ2A 1F12A 5MGBA 4MIEA 1LC0A 1XLTA 3C24A 4OSPA 4N5MA 1DIHA 4YAGA 2X5OA 5A06A 1P1HA 5JYEA 4MIYA 2VZ9A 2D59A 1LUAA 4BNHA 3MTJA 5CEEA 1EVZA 3F9IA 2ZCUA 1PJ2A 3RROA 4AJ1A 4Z6KA 1UP4A 5JW6A 4I5DA 4P38A 5I8ZA 1FDWA 4JXKA 2NSDA 4YB8A 2GN4A 1AXGA 3B1FA 3FTNA 2VHYA 3AUSA 4E5YA 2CF6A 3E5MA 4DMMA 4CM9A 3GN2A 4GX0A 1PSDA 2NU7A 4DWVA 4N5LA 3S2GA 4J91A 3JQBA 2WYVA 4DIBA 3JYPA 1BTOA 3E18A 1QYCA 1BRMA 1X1TA 4XQ9A 3PJEA 3Q2IA 2FWMX 3A14A 1XELA 3QVWA 2YV2A 3FNEA 3KEQA 4ZU3A 2RBEA 4XR9A 4PZEA 5LCXA 2JCYA 3AOEA 2IEDA 1NASA 5I9MA 4UUMA 3G1UA 4CLDA 1U8XX 5G0VA 3QWBA 1T1SA 3GAZA 3NGLA 5A9TA 2TMGA 3DMYA 5DOZA 4KZPA 5CDYA 4BGVA 2EKPA 3JD4A 1CERA 4CMBA 2FZEA 4E6PA 4YVFA 1DRWA 1M66A 2EW2A 3KLPX 3OJLA 2YHUA 3H65A 5JAMA 1M2WA 1X7GA 1UDCA 3WGHA 1FDTA 4E5KA 1E3IA 4GAEA 5L45A 4D3FA 1LXCA 1A5ZA 1R16A 2EV9A 3DZBA 2Y0EA 3DAPA 2C7VA 4RVFA 1X7HA 1B2LA 4A73A 2G5CA 4IJWA 5DBIA 1YO6A 4AJJA 4C7JA 4OAQA 2TMDA 2VOJA 4QTZA 4JROA 1PS9A 2YFHA 3W1VA 3JQDA 3EHEA 2ZB4A 1NWHA 3HFSA 2X0JA 2GO1A 3GY0A 2VZ8A 4EZBA 1EEHA 2YV3A 4M86A 1P31A 5IAAA 2YHIA 2X86A 3PRJA 1FDUA 3D7LA 4JN6B 1YRLA 1SMKA 1I36A 4GMGA 1R4NB 4YXFA 5L4SA 4BO6A 1C0LA 2DTEA 3PHJA 4CV2A 4H7PA 5CG2A 4RCVA 2OOSA 5CDSA 3GH3A 4FC6A 4PZDA 5I7SA 3OQ1A 2GZ2A 3GT0A 2I65A 2FMUA 1NVMB 4PCVA 4PIVA 2ZQZA 4WCFC 4IQGA 1FK8A 4H16A 1HDCA 4D0SA 2FZWA 2V7PA 4PLHA 1XU7A 4DMLA 4HXYA 2EHDA 3L9WA 1O0SA 1R4NA 1KC1A 3A9WA 4GLOA 1JN0A 5DN9A 1VPDA 4WLEA 4BO0A 2Q1WA 1E7RA 1QV7A 5BNIA 4GBJA 3WMXA 1MFPA 1BDBA 1EDZA 2R6JA
chains in the Genus database with same CATH superfamily
4CV0A 2J9FB 3W8FA 1ADBA 1GSOA 2JHAA 4ZVNA 3NHRA 4TSFA 5HZKA 1WY7A 2WT4A 3AF2A 4H17A 1SKBA 5KUTA 2ZRDA 5SYAA 2IYRA 3GLFE 2E5WA 2VJLA 4MO9A 1G5PA 4MKHA 1XZKA 3IDSA 1KVSA 2VHWA 3OU7A 4GMFA 1V4NA 4DYDA 2UYQA 4GYKA 5GY7A 2X5XA 4QEKA 3VU0A 4FMDB 3ESZA 3H0CA 3NHAA 4IM7A 4Q05A 3IUPA 3SF0A 4D4GA 2C83A 2JJQA 3QEKA 4DRZA 3VC1A 4IIJB 3W8NA 4AP6A 2Y0CA 5CT5A 1V47A 1O95C 2QTZA 1BVRA 2ZOSA 3NP9A 3Q8XB 4OUDA 4M87A 4I19A 4O29A 4C4AA 4NX2A 4R4JA 1WHTA 2FVXA 1PAUA 2RIRA 3FOAA 4QNRA 2B69A 1SU4A 1GNSA 5CTAA 4UTXA 3E1KA 3M5DA 3P0FA 1P7WA 4RV4A 1QIGA 3UMMA 1MR3F 4RQAA 1Z16A 1A9XA 1NW7A 1XLTC 4DYVA 4EGJA 4KXLA 5K8TA 3OZCA 4GVPA 2JCBA 1TF2A 1T35A 3UJAA 4XWKA 4CIBA 2XJ4A 5AW1A 4CR7A 4QDXA 2DHEA 1TMYA 3ETCA 3T9FA 1Y7HA 5F1KA 5HJ5A 3IR5A 3FM9A 1Q0UA 2P3QA 2WHYA 4UEJA 4DM4A 1U63A 1PT6A 4OOEA 4ZALA 5IT5A 2QR5A 1GDHA 1W85A 4Q48A 2GCEA 3NFRA 3ETGA 5ALWA 3EDCA 1ZVQA 2DFTA 4MQ4A 1JKJA 2J7KA 3MG9A 3T7AA 3ZXYA 3PL5A 3RS9A 2BP7A 2WG0A 3GR6A 4UTVA 2RK4A 3OFKA 1HSZA 4RDXA 2C5EA 1XHFA 1Z0DA 4PONA 1FQOA 3G8BA 3A7DA 3KUCA 3N2GA 1JEOA 4D5GA 3CA8A 1ZLXA 3KKMA 3FTFA 2X0IA 4HQOA 3KXPA 5EUMA 3IMGA 3A9VA 4CKZA 1UWCA 2XBLA 1E8DA 3KUUA 1DXYA 4WBXC 3REQB 2G25A 4X5OA 4AB1A 8GPBA 2WM2A 4NMXB 1VE7A 1NVEA 2UZ4A 3WB2A 2NNLD 1AMUA 2BZ0A 2IU4A 5DULA 5FHRA 4P53A 5JBIA 1N7HA 4NI5A 4YO8A 4EFKA 3JV7A 1MO6A 5FEUA 5JBQA 4YAOA 3FUUA 5B3KA 1SD1A 3AVOA 4MR9A 4B6FA 4QX6A 3WB9A 2JJMA 2BH2A 2YHBA 4JASB 2AMJA 3IPAA 1ZH4A 1M5RA 1P91A 1Z0KA 2R48A 4L57A 4KQ6A 1J97A 1EVYA 2HIHA 3GOHA 4YV0A 1DOHA 4PAMA 3G9ZA 5ICFA 5CLFA 3D8NA 2BZ1A 2HA4A 3RUDA 1NF3A 2XAUA 1V1JA 1CB0A 1NXQA 1P5RA 4CDMA 1IHDA 1G21A 2IIQA 5IKOA 3WC4A 1RQNA 3MLBA 3WKCA 2HCRA 4HDSB 3DR5A 3LU1A 5DASA 1FA9A 3C97A 2CLSA 2DR2A 1Z0AA 1WZEA 2QUBA 4EITA 4RVOA 3SC3A 4IIDA 4FFLA 3GPDG 1PL0A 2H7XA 2OENG 5FFMA 4B3FX 3VI4B 2XGJA 2X4IA 2C88A 2Z1NA 5EAIA 5CDFE 4ZOLF 2Q27A 1ZNWA 4I4CA 4Y30A 4EQ6A 1ONSA 3F73A 1CW2B 3I4LA 1MABA 3ZVNA 3ICEA 4YCBA 3N0TA 1DQPA 1QC5B 4HDNB 1CK4A 1J2YA 3O2SB 4AAYA 2OB2A 3PSAA 4WA7A 3KEMA 4Z9BA 5KWJA 1OYVA 4M21A 4MS3B 4YJ2B 3B12A 3FSRA 1C9EA 3ET4A 3PP8A 4M7PA 2X0FA 3SHTA 4BAZA 5K6AA 2NYAA 5JVDA 2YHSA 3B89A 4AZ0B 2Q50A 3OWXA 2BRUC 4OYLA 1M6VB 1LK5A 4BC0A 4R40A 1QH8A 3SWWA 1MEEA 4NS1A 1K9VF 1Y7PA 2OECA 1TIBA 1L5HA 4EJSA 4O2AA 1EP1B 5B6JA 4BC1A 3H2HA 3GGJA 4LMRA 5F3WB 4WOJA 2ZJ7A 5C4MA 4LDAA 5KTOA 2CHGA 4JUBA 5LQNA 2XOKD 3OCJA 1XMOB 4FOTA 4JIMA 5E3IA 4UAJA 3L84A 3OQMA 4RZ3A 3DE1X 1TUGA 2QMZA 3WSWA 2RGWA 4PWYA 3PEWA 1GU0A 1KI6B 2I4TA 5JS6A 3ETHA 5HRUA 4YUVA 3F8SA 1JSZA 1J8VA 2VTKA 1PYOA 3ESXA 1Q15A 2BEKA 3WYGA 1DWOA 5IARA 1SXJE 3WBBA 1CPYA 1WKBA 2Z6UA 1TT7A 2IYEA 4GOMD 2EG9A 1GWNA 3ZV3A 1X1DA 1OW3B 4W82A 1WU8A 3ZEIA 1X9IA 1L5MA 5JPCA 2EERA 3C3YA 1E0JA 3N74A 2BGMA 4N82A 2BFBA 4Y2GA 1XTPA 4DQUA 2YH2A 2BUBA 1EEXB 3W2FA 2FEMA 2RC6A 4IDCA 5BSGA 1UANA 4D43A 1GTJ1 1FU8A 1HG0A 2GHRA 2WJ3A 1N3YA 4QUIA 4UNIA 3WHLA 5HCIA 4J0CA 4LOJA 4MLZA 1VLJA 4NPHA 3PDWA 2O8DB 2CN1A 4OM8A 2YJ6A 3L4BC 4HPJB 1OT5A 3ABZA 1P62B 3DEHA 3OY2A 2VDJA 2AVNA 5D3QA 1EBFA 2R85A 2AG6A 4JHLA 4POOA 1O89A 4U2KA 1KQOA 2J46A 5ESRA 3IVRA 4I1YA 4D9HA 1YASA 2I6GA 2VF8A 4RJ2A 4RQBA 3VH2A 4X60A 3N2KA 3NTOA 4JJ8A 4BECA 2AFHB 3I04M 3AFIA 2NPOA 4M0FA 2PZAA 3VVBA 4D9MA 5KNDH 4K88A 5DHAA 2FW1A 4KO8A 1WB5A 5D87A 4PYJA 1SC3A 2HAEA 3L06A 1P18A 1V26A 3TB6A 3V1LA 4N6OA 3T5TA 1GPDG 4KITB 1G20B 1PEAA 4Z9AA 3RGWS 3FWPA 5HJ2A 4EW3A 2G08A 1KFEB 3NNNA 3GLSA 4ENUA 4OGWA 2MSNA 2E5FA 2ZTLA 2FSSA 2YZKA 3P97A 2H3EA 3PZRA 4OH1A 5K01A 1DFHA 3PEYA 4KDCA 2QYOA 1GZ4A 5EUQB 1IXSB 3D2LA 1CQJB 1G5TA 3KT3A 3L7OA 4D79A 5KYYB 1QONA 4LRWA 4RVHA 2J48A 4YRCA 1SVNA 2AN1A 3H1EA 4N7MA 4QGHA 2HLDA 4Q37A 1KQNA 4MRMB 4DMRA 3VC7A 1GTSA 2QS9A 1FNCA 2AI1A 4ER6A 3NC1C 3L1IA 3T0GA 2OORA 3B3JA 5BSTA 3ES9A 3IIKA 1NONA 1OAKA 1UBJS 2XT6A 3GCWA 3MMSA 3R5XA 2QVCA 2LIPA 2HWUA 2GRUA 4FGZA 4G5XA 4K87A 5JC8A 3Q6IA 3JQGB 4PC6A 1U8AA 2X8JA 3WKAA 2QPOA 3DOFA 3CNEA 4BUZA 4P4NA 4GZ5A 4W1RA 2H0AA 4F4DA 4F97A 1HDZA 4NE9A 1U2RA 1T0IA 1A9YA 5HUJA 1IULA 2REBA 1RZRD 4YMTA 3C5VA 4FGWA 2FOXA 2R5NA 4MOWA 2EWMA 4NJOA 4RXUA 5K3FB 4HNVA 4G9GA 2IPMA 3SX2A 4BLSA 1UZUA 3V1NA 1EFDN 3KFLA 3A1TA 2C58A 4Q3OA 2FDXA 5CVDA 3STWA 5A04A 5ISMA 1N36B 3I3OA 2IYPA 1J8MF 3PTLA 5LQUA 2R8OA 3DQQA 2Y1XA 4W8HA 1DKPA 1W1UA 4JYPA 4AZWA 3ZCVA 3BE5A 4QKQA 2ZCJA 4AJLA 2XCUA 1R00A 1DO2A 3BERA 4Y2UA 1IHPA 1KP2A 3FI0A 4N8SA 1SU8A 2GT1A 1FMLA 1GYQA 2HHJA 4XA8A 1M1ZA 1XXLA 2YZNA 3DYIA 3ORQA 2C7GA 2Y2UA 3OU6A 2ODWA 2IOHA 1D9XA 3BCUA 4LXQA 4P98A 4ZOLA 2BCJQ 4IIGA 2EARA 4KMMA 3ABSB 4FOLA 1P5HA 2W2VA 1T91A 2SNIE 3WJ1A 4PBSA 4TSFD 1E32A 2DGDA 3DXZA 1ZCAA 1N7GA 1DAGA 1A8HA 1L7PA 4C89A 5K5EA 2QV0A 4GX2A 4I55B 3M3PA 4XUDA 1MGPA 3VAYA 2XA2A 3K96A 1RTKA 3V7WA 3L43A 5BURA 5C4GB 2FA9A 2P8JA 1WZ2A 1XVAA 4UARA 1NXVA 2IGTA 4O3FA 4I9UA 4WSOA 3WMFA 4DWWA 2JJ1D 3C43A 1UT8A 1Z28A 4DCCA 1A8SA 1H3NA 2E6UX 1ZPDA 2R11A 2GEKA 2WWIA 3DXXA 1ELOA 4CQLB 3L8FA 1E5DA 1AG9A 4L4YA 1FPQA 1V9LA 2EKLA 4YMIA 5LXTF 3ZDRA 1J39A 3AW9A 1V35A 2CHVA 4OHWA 1P5ZB 1VI5A 2XUJA 1KZYC 1LNSA 4LV5B 2V9ZA 3D3WB 4YIKA 1SHLA 4MEBA 2R8RA 3EK2A 3G0IA 5JWOA 2HUNA 1OR8A 4X8OA 2B6HA 3RTCA 4U3JB 4XZ3A 5JDCA 5AVTA 3JZAA 1OHHA 5J2UB 3C74A 3C3DA 2GZDA 1QIHA 3R23A 4I50B 4Q0MA 2JCGA 1SKYE 3FTQA 3IMEA 3DDCA 1JHVA 3OEED 3PD1A 3UUGA 1DXHA 3JVIA 5L3VA 3RUFA 5CB4B 1CTQA 3ZLVA 5ALKA 2MCFA 3ZHSA 4KQJA 1LC3A 3RAPR 3FR8A 4X90A 2I55A 4C0JA 4F3CA 4QFMA 3AKYA 4HN4B 5JRDS 2GM4A 1GNRA 4IEFB 2ATIA 1M0TA 2QLBA 3JATB 4FNAA 3GBSA 5DX1A 2QNIA 5DYGA 1U0NA 4DILA 4RAQA 1L5NA 1S4MA 2V0GA 2O07A 1I2MA 3WLIA 4OP1A 1WDKA 2FFHA 4W5RA 4DIUA 1VE6A 3H9CA 4YMGA 1MB4A 1K6MA 4TV9F 1T26A 3MPUA 4HEA1 1Z5GA 4QHYA 4GRIA 1BHQ1 2VFAA 4FQ7A 3BQMB 3G49A 3N53A 4AMUA 1NNSA 3MTGA 1FSZA 1A72A 1ZP6A 3MTIA 5I9SA 1G2QA 2G76A 1E0SA 3VZDA 4YIHA 3OTOB 4FOSA 4RS4A 1K6XA 3I0ZA 10MHA 2IODA 3KQYA 2WDZA 4LDPA 2O8EB 1KYZA 4RVGA 5KJFA 3IP6A 2F8TA 2G82A 3FWZA 1L5ZA 2RE8A 2FN3A 1D8TA 4ESEA 1NDQA 4M89A 5EFOA 4QT4A 1XROA 3QJYA 1R8XA 1XJ5A 5FUXA 3DT8A 4G25A 2QTRA 3QVXA 5TQJA 4D9GA 5HP4A 2HXYA 4OUKX 3OMLA 3N2LA 2VHCA 5DDIP 2O52A 3RG8A 1U0JA 3WLLA 4DPMA 2D4HA 1WB4A 4GPD1 1ODJA 3TFQA 2A7QA 3ZQ4A 4BV2A 5IWAB 5LWHA 2PZGA 4GOOD 3CZ5A 1YKSA 2NQTA 4LUCA 2Z5VA 4UM9D 3BMQA 4DQVA 4WZBA 4F2WA 2WM8A 3GNTA 2ZJAA 2GX6A 2ODPA 5ALJA 2GNAA 1S5PA 3FZNA 3TZKA 4AW9A 4J7XA 1ZL0A 3R20A 4RDIA 1ILEA 4IDPA 4G0NA 3CUKA 2Z98A 1RW4A 1E3TA 1UJ5A 2O2YA 4GGOA 2OZLB 4PANA 2O7QA 4CM1A 3DXFA 4PN3A 1VSBA 4DANA 1C7QA 2DLDA 2JIMA 2VUHB 1EUYA 2JK1A 1FNSA 4B0OA 3A3KA 2H85A 2J7PA 2MT9A 1YOVB 1IJBA 2EQAA 3UAGA 3GOQA 2PCJA 3TSZA 1ZWKA 2JARA 4HFMA 3JQAA 5JEDA 2JB9A 2Q2WA 3E1SA 4PX3A 4Y6QA 1XQ9A 2VDVE 5HQ3A 3IOCA 2R4UA 2WF6A 5IEJA 1ZYUA 5C8XA 2H5LA 4QM6A 4RF3A 2ATVA 3RLIA 2XBMA 2Q4DA 5FPPA 1JDJA 2I99A 1E98A 1S2IA 1AK2A 2G71A 2JBAB 3A1NA 3VSEA 2OBXA 2RC5A 1VJ1A 2R00A 3A2LA 1E7MA 1KHTA 1PWYE 5CCEA 4EHBA 1HKHA 3TNDA 1QMPA 4M0MA 4ZOQI 1ZAYA 1ID1A 2F90A 2O05A 3E5RA 4UHFA 3WY9A 5SY6A 3FOEC 2HT1A 4OXQA 3ZKWB 2FFRA 4IDBA 4LWQA 4BTVA 3AF1A 5F64A 16PKA 3FDFA 3CF4G 4G1CA 4E2FA 3A6HA 3GRZA 1L3IA 5CGQB 4RTLA 3CLVA 3KOUA 4LHXA 3HVKA 4B3CA 1QDUA 3P0HA 1QWSA 3QYJA 3R7LA 4DCOA 1GY8A 3A1EA 4EW1A 1K8QA 1L1FA 1V9SA 2ADFA 2Y4OA 1J33A 2W6IA 3AR5A 2GBLC 1OOEA 4YCDA 5I51A 2GD1O 1YH3A 1O77A 1E2IA 5LZ7A 3TWOA 3BWBA 1QORA 3OCXA 3S70A 2IHUA 2ORVA 3DBLB 2QWXA 1DCFA 3GZNA 3OIUA 4A23A 1VJGA 1NW5A 1RLTA 2H6EA 1OZHA 4XM2A 1I6WA 3SKYA 2B4QA 1ZN9A 3U4HA 1KETA 1GPLA 4FR5A 3PL1A 4WESA 3ZS8A 3DZGA 3IRVA 2ZLBA 3MTQA 3TBKA 1JIKA 2JEOA 2V5AA 2FPWA 4ZZIA 1XA0A 1MNAA 1JXOA 4GOXA 2Q5IA 1A82A 1KBZA 2QX4A 5IDQA 5JFTA 2FF7A 3PXCX 2GVDC 1Z15A 2H07A 1L6IA 1GQOA 4U7TB 5AUQA 3L18A 5LL6P 2Z6AA 3NV7A 3PC7A 2E7ZA 4DXDA 4Z99A 3OMXA 3SYNA 3MB5A 4WECA 4YYZA 5LXTA 4MKIA 1T1IA 4BFLA 5CUQA 4NH4A 2PLAA 3T9DA 4JU9A 4EG7A 1ATZA 2C4TA 4RADA 3VHRA 2PH3A 5T67A 5NULA 3TTSA 1TVKA 3C6MA 5ITSA 2A1UB 2PA0A 2GA8A 3A05A 3ZLTA 1P1BA 3V8RA 4TLMB 3G8CA 1E18A 1WZNA 3W7AA 2DC1A 1HFWA 4MJLA 1K5HA 4N65A 4ZT6A 3KFVA 2VA8A 3IHLA 5AKHA 3Q7RA 4ENSA 2ZB3A 3KUDA 4RUKA 3TNYA 4CE6A 4RFVA 5FB3A 4I1IA 5B3JC 4HX9A 4RE5A 3ZIDA 2X0EA 3DYBA 4I6EA 4Q39A 3E3MA 4B87A 2AIRA 4BKQA 2QL7A 1KK2A 4RD3A 3MA0A 4IZOA 4CM7A 1IXZA 5JMOA 4CUKA 2HLDD 1YJXA 1W1IA 4J75A 5D5HA 4KTTE 4EY5A 4NYMR 2O3UA 3ZHVA 4M9ZA 1XMJA 4NG5A 5LMNB 4LECA 4N3CA 1YS1X 1W5TA 4TV9A 1JHOA 1PQYA 3H42B 4IIVA 5IZ4A 3H2IA 1ARZA 2CNKA 3GDFA 4JWTA 4ARVA 3P96A 5KC8A 3S8EA 4L16A 3AEUB 5ALPA 2VCHA 4XH9B 3AIKA 3K09C 1KXZA 3RSQA 1YJAA 3MPOA 2QX8A 4ECAA 3OQNA 2AN9A 4UUAA 4KNYA 4OKIA 2F4VB 1NE2A 4LZLA 4UPDA 2G1KA 4CLEA 4UVIA 3CE9A 1ANKA 4FHDA 1Z45A 3UMCA 1OVMA 1SUCA 3NRCA 4MYDA 2OVBA 2V4UA 2CJWB 2ZJ3A 1R1DA 4LDZA 5LMUB 2AKEA 3AVTA 1T34A 2Q9UA 1Z36A 2JVKA 3IERA 4P9NA 1BOOA 1C1HA 1E9AA 2PWPA 1HDRA 1QNLA 4UM7A 4HHEA 2FV8A 1ONOA 5DMXA 3RBZA 4U8GA 3WWPA 3ONEA 2I2FA 4ND6A 3D02A 3H9GA 1DINA 1O8BA 1V8PA 4CDNA 3Q3CA 3QYFA 4LMAA 3EDYA 4BNTA 1M83A 1I7DA 3VMFA 3TLMA 1JE0A 1DHTA 3ZDDA 2K7FA 1MENA 1R5JA 5DYNA 3X44A 4W9MC 2FWIA 2R3SA 3JWGA 4KN6A 1HNZB 2XVMA 3HBFA 4C05A 3JWPA 5LIRA 1DKUA 4IKOA 4QBHA 1XYVA 1N6HA 5JD6A 1BD4A 3UH0A 2QYTA 3DV0B 1J0BA 2X14A 4LBWA 1YA6A 2G70A 3LXMA 2GM9A 4EDFA 2KBFA 2YWBA 4EB8A 3EMKA 1GAXA 4WVLA 4DUGA 1NXPA 1QRDA 2Q29A 2APJA 2R7KA 1AHPA 4UE3S 4MDEA 2EGHA 2LP4Y 2YXPX 2XTAA 3T7EA 1XZQA 1BEEA 2W9XA 1NMXA 1CDZA 3PR2B 1PLKA 1Z2DA 1RAEA 2CNBA 4WXHA 1EIZA 4R8VA 4RSGA 1DEHA 3HM2A 3LC0A 1T3ZA 2PWAA 2IHBA 4KUEA 2O1SA 4CG3A 5AM2A 4V1CA 4P81A 3FDZB 1WHSB 3P5BA 2SKCA 2PO5A 4WXYB 5DSTA 5EPEA 3Q9SA 4QVKA 1SOVA 2BF4A 3CWZA 4Y1RA 4Y6LA 3HI6A 3ET5A 4PYRA 1PJLA 2I66A 1U6KA 2D4AA 4LHVA 4X7RA 3O5AA 4L8LA 3DFUA 1USGA 2PLWA 4ZC1A 2ZTVA 3IB6A 5DLQC 1C0IA 1LBHA 4PCUA 3TGPA 5T8KA 3KP1A 4MR7A 5HMLA 4Z1OA 4RWZA 1YQDA 2KM1A 2CC2A 4A03A 4IZHA 1E77A 1F2UB 2W0MA 1LCIA 5I9IA 1IQPA 3GW8A 5KYXA 1OLSB 1SZDA 2Y71A 2GERA 4OHFA 5K4AA 4MLDA 1QRTA 1B0PA 1YVPA 1EFRA 1JI3A 4HPWA 5F73A 4RJJA 4YBRA 2VZ0A 1XMVA 3IQEA 3R0ZA 3CRQA 1R6XA 3JQEA 4TXLA 2C7QA 4LQCA 3A4YA 1YMQA 3F6RA 1JG7A 3I2KA 3U0BA 3ZV4A 3Q8LA 1OXVA 1YACA 5DW0A 4ZEVA 4ABTA 1OA0A 4NK5A 3KZOA 5B1HA 4CHGA 3ST7A 1HF3A 3WLNA 2CBGA 3C7CB 3T9AA 3EEOA 1KVQA 3KU1A 2F8LA 1WMBA 5JD5A 2ZB8A 4CKWB 3BKWA 1RQ7A 4JU8A 1QJ4A 1W4CA 5C1IA 4OJMX 2IBSA 2ZWAA 1UBEA 3G0BA 3OQPA 3P4UA 3UWDA 4QYWA 2QYHA 2J3MA 5F3RA 4XUGB 1NBMA 3ZGNA 1KMNA 4XDGA 1IVYA 2IZ0A 3KSUA 4MB0A 2PUHA 4D3XA 3DHYA 5BNWA 3NTLA 3WMEA 3MLEA 4I6JA 3D5QA 1LWNA 2Q5HA 1U8ZA 4PG8A 3WRXC 1F3LA 3K6JA 1ECBA 4CKCA 4R9RA 4MRRA 1L1QA 4KPUA 5AKLA 2AMFA 5GMOA 4TL8A 4HGRA 3ZYZA 4ZZ0A 4AS1A 1U4OA 3HXMA 1QYVA 4CEIB 1XX6A 5A9SA 4CF3A 1L7AA 3OOHA 1Z8FA 4FPXA 3ZK8A 3OD5A 1M6HA 1NKVA 1Q7CA 1L4UA 1XKLA 5H4HA 2EHJA 1YZLA 5KNDA 4BMDA 1FTNA 1G7SA 1PR6A 3FCCA 5EVJA 1NL3A 4LF9B 2QM3A 4I5FA 2QUZA 1J42A 5HJEA 1FEZA 4R2HA 1J8YF 1LV8A 3WZMA 5JFGA 5AOAA 1KQGA 4YV1A 2WD7B 3ZU3A 5EJ9A 1E9DA 3ZLBA 1US8A 4QVGA 3DUWA 2PFGA 4R2XA 1Z34A 1LF5A 4ZYWA 1U3VA 4YJKA 5DTMA 3KQHA 1JQDA 1JR3A 2HBRA 3FCSB 4DCVA 5TPZD 1ZEMA 3PXBA 4BBZA 4OQQA 4RFSA 4HG2A 5E3JA 4A26A 2PXXA 4V03A 4LG1A 3WGMA 3ESQA 4HSGA 4LOAA 5F78A 3Q8MA 2G0AA 3JQAD 4C6SA 1Z0UA 5BWOA 2ZYIA 2WJPA 3WDKA 3GRUA 3THWB 2B36A 3PITA 1XRQA 2QAJA 1A1SA 1WXXA 3L6UA 4RYLA 5HGJA 4RO0A 3VOBA 3HY6A 2IZZA 4JELA 4Z0TA 3DHEA 1KDPA 2I67A 2XA9A 3C8MA 1R7RA 1UBOS 4D96A 1RYEA 1OB2A 4YP1A 2Q5CA 2HK6A 3VYVA 2NYVA 3TW8B 3KYJB 3R6GA 5A03A 3PUZA 4EJMA 3SICE 1O6BA 3I58A 2PHZA 4LXIA 5K3CA 3RWMB 1BNCA 2GNPA 1NSFA 3UMFA 4G09A 4KWCA 4JLVA 2ZXFA 4NY1A 1T6NA 4ZT7A 3QWHA 4ZTUB 4OOFA 2IYXA 2I33A 4M54A 1WS6A 5JADA 1UZAA 2B78A 4OA5A 4D3YA 5KOYA 5C0OE 4H31A 4WKBA 1GAWA 4PSUA 1THGA 4PR3A 1ONNA 1SVMA 1XGKA 3AL3A 3F1LA 5ER6A 2XECA 3UGQA 5J47A 3A6JA 4CMIB 4JUCA 2B4YA 4B84A 1K88A 4JOQA 1CUWA 1J4AA 2C3PA 3D4IA 1SKUA 1NQVA 2P2YA 5IBQA 3L7MA 1CZRA 4WNCA 2Q1XA 1WBDA 3SOPA 1T5TA 1OH8A 4WXMA 3QFRA 3NT4A 1T8YA 3QA9A 3TKAA 1Y9ZA 2P4HX 2Y9PB 1AS3A 1MQ9A 2OWDA 2P9HA 3AFMA 1ULAA 2J87A 3O2QB 2WFZA 4HNRA 5HK9A 5GWXA 4ARUA 2CLOB 4XGKA 4Z49A 4R1NA 1ZU4A 4MAMA 3SD7A 4R1MA 3ENWA 5EMLA 1M0WA 3EQ2A 4NZYA 1QG4A 2GCGA 4DC0A 4QO7A 3QPWA 4F21A 5H4GA 3WA7A 5H80A 1GQYA 4HNSA 3I1JA 1F5SA 2MJLA 5ALGA 5T4FA 4BN5A 3FETA 2E4YA 4O6VA 5U1PA 3OZAA 5E1OA 4BFSA 2WMOB 2G9UA 3K1AB 2MSEB 2IXFA 4RJKA 1AA9A 1E4YA 4F96A 3PENA 2EL9A 1OAOC 2E2WA 2Q4RA 3IODA 4MGHA 4BFTA 2YY5A 4EYOA 1KMHB 3GMSA 4LXTA 1NQXA 3BJRA 1GDTA 4ZMRA 5C8VA 1PNRA 1E1QA 3VPCA 2GEJA 4ZYZA 3HJTA 2FZCA 3SC2B 3AF6A 1Q0PA 4DV6B 3UC5A 3X2SA 2D0OB 3NDRA 4JUAA 3VR1A 2HMWA 2YMPA 5C1OA 1BRTA 1ULBA 1QCZA 3ER6A 1VSVA 3PZBA 4S12A 2WSMA 5CYOA 3SZGA 4TKVA 2XE8A 3LUBA 4WNYA 3INRA 4OFBA 3KTAA 5ALLA 5DX8A 4LGVA 1N6PA 3SLRA 4D8VA 6Q21A 3OC0A 1MB9A 1O5OA 4QG7A 2X2EA 4P7FA 3DEYX 1V45E 4R2LA 5B7NA 2NO5A 3KZXA 4BVJA 1PK9A 4AWAA 1ZVJA 5F51A 1J24A 3OICA 1IONA 4FT4A 4AN0A 5HHTA 1HZZA 1IXYA 1HE4A 4L8WB 5JSZB 4RFLA 1KI8A 1IPHA 1WW8A 1IIRA 2GPJA 3P2MA 1O9BA 3BXOA 1J5PA 1U1FA 2FP4A 2QTVB 2ID8A 1FSGA 4QQ8A 1RI5A 1JKMA 1NKTA 3JQ9C 4RPIA 2I62A 3E4CA 4K9KA 4ZCPA 2G1UA 1N77A 3W2GA 2BMEA 3E2IA 1UPBA 3UT5A 3VJKA 4W5HA 3VO2A 2EX4A 3F6YA 4QXMA 4M99A 4DBLC 1H3EA 1AGRA 3DMTC 4O4IF 5E2AA 1R9JA 4TQUS 3RW9A 1R3DA 4E7OA 3RYIB 4HJXA 4NFHA 2QN1A 3IV7A 3MVEA 4AI6A 1B3BA 1PL6A 4D6PA 1G60A 4LKOA 3QEBZ 2Y9MB 4I4TB 2BFDA 3UGKA 4CM4A 4DR2B 2VBCA 4P80A 4YI3A 1MG5A 2DY0A 3FHOA 1QH0A 2C4MA 2QL6A 1ADGA 1U8UA 2IXAA 3IQFA 4NTZA 3AEZA 4FSXA 3CZAA 5DXAA 5HFJA 4Z7QB 5EJ5A 4YK7A 3MNFA 5TQ0A 5HUHA 2ZVJA 4INZA 3BDVA 3M9WA 5LA6B 4Q02A 2OO5A 3D3NA 3IELA 1UP6A 4FKBA 2FSFA 3SXUA 3QU9A 4XM1A 2PUBA 1OLUB 3LQ4A 5BW6B 4L0CA 4JP2A 4EYGA 4IOKA 4JNKA 1CQIA 2C03A 3SC4A 3CLTD 4UNQA 4UHEA 1FNDA 1GN9A 4XJSA 2F3SA 4YRFA 2QT0A 2GLXA 2MYTA 4S1PA 4CKXA 1BXRB 3FTEA 1CZKA 4A5SA 2HUPA 1GZ7A 3WYCA 5H7XA 1UDXA 3RF6A 3WK5A 1XTJA 4HDRB 3NJ8A 5L3SA 3G2IA 4B32A 4DMHA 3G1TA 2I4IA 4JOSA 1EK6A 3CVVA 2UYYA 1L5YA 3K5WA 2B82A 1TA0A 2DWPA 4RTQA 1GNLA 3OLWA 3W5CA 1AQNA 1B6TA 2DFLA 5E9AA 5A4IS 4JEMA 3WWYA 1P3DA 2P91A 1AUVA 1SB8A 2FPPB 3OOSA 3TSCA 1Z83A 3U4IA 1BHO1 3L0SA 2PT7A 4JVNA 5IMBA 1J6UA 4C9BA 5A1TA 3C8UA 2EFYA 2RB5A 5JFOA 4G0XA 1G3QA 3LV8A 3ZYCA 1MC8A 3INGA 3HWRA 3C3CA 4GE3A 1QUEA 4C0WA 4TZ6A 1ZH8A 4N5HX 3WRVA 3TZLA 1Q20A 2ODQA 1V9CA 3FUWA 3EAFA 3EA0A 1XP5A 3HRHA 1SQFA 4IYRA 3UA3A 4B3BA 4BMCA 5C35A 4CTJA 5EP4A 2O50A 2VQDA 2Y1DA 1JG3A 5I4KA 5JMPA 4FMCF 1WMSA 2QX6A 1DDGA 2JLBA 5DV9A 4D4LA 4KC0A 3P9XA 4E88A 4HN2A 3F6PA 2GAJA 4WFQA 2FPRA 1YS9A 3QKIA 4ABYA 4INOA 1L5OA 4OHVA 3LP6A 4JLNA 3FRIA 2DFNA 3QVOA 4H08A 5K0ZA 4P3PA 4PO9A 2XWQA 2IYUA 4FNOA 4QRIA 5CVVA 2KB0A 3OKCA 2VZLA 2ZE8A 3AM3A 4GBED 4AIIA 5EWLB 5J5CA 4BBJA 2ZYGA 1EX6A 2QHXA 3QVGA 3M2TA 2QIOA 2BR4A 4WBSA 4X9XA 2HI0A 1IEWA 4HAWA 4EY8A 3HJFA 4LJ6A 4JP5A 5DGHA 3EPHA 2XWBF 3QXSA 4AVYA 5BN4B 4PVCA 1VE9A 4XRRA 2NW6A 4PRYA 5HF8A 4B1FA 4ZGWA 4EUNA 1TKAA 3AK4A 3S1SA 5L40A 3ICQB 4K2HA 4FYIA 3FPBA 3AM5A 3DH0A 2JBWA 1KDVA 2C92A 2GHIA 1KPIA 2B8WA 1QB8A 2O2HA 5C34B 7ADHA 1RFGE 1GKLA 4W8GA 3TEFA 3G2NA 4HVLA 1PEKE 1PKEA 1RAAA 2WHPA 1DG1G 3EXHA 2WHXA 1MV8A 4HYTA 1KGDA 5AI4A 4ZC8A 2CV1A 3CNBA 5H9VA 1NBMD 4QJ4A 2V7QA 1KAMA 1JS1X 1SK9A 1PDOA 2P75A 3UKJA 3MTBA 4YMVA 4IFBA 4XIYA 3SHWA 3JVVA 4CBVA 2YZ2A 1HT1E 4MRSA 1P3Y1 2HRZA 4B85A 4UEQA 3M34A 4GKBA 4REQA 2WJ4A 4KBFA 4BB9A 4DRXA 1NQAO 5JAHA 3NNDA 4O2LA 5DWDA 5L6LB 1IBKB 4O2BB 1LZKA 1I3NA 2JGFA 3H1TA 4RZUA 3VNUA 1SQ0A 1RMQA 1N2OA 2DQSA 4PHTA 3WLKX 4DNQA 1ZJZA 3LUJA 1AKUA 4E7PA 1CFJA 1GTL1 2WKQA 3IMKA 3DE5X 2G9RA 3RR2A 2GTIA 2V45A 4LRXA 2YR0A 5EPUA 3JQ7A 1WXDA 4Q93A 2F1RA 4NOJA 1VKRA 1P6XA 1KZGB 1L1RA 1V8ZA 4QREA 4Y9UA 2M6LA 3T4EA 3T9BA 1CUXA 2XCQA 2B1JA 3MGGA 1M73E 1N5JA 4B7ZA 1OZAA 4ZHQB 4HQKA 3LLMA 1YQXA 3LRPA 2Q6VA 4AG3A 5LBTA 4BIIA 3OUZA 2C9BA 4B83A 3ROEA 1STOA 4L22A 2AOUB 2BBSA 4PLYA 1U98A 3THSA 2UVDA 1OH5A 2O23A 3WNVA 4ZJZA 4GG1A 3WAJA 3AZQA 5C18A 4O4IA 1LLQA 4OBWA 1AIPA 3WAGA 2QD5A 3KAJA 1YL6A 4QU5A 3SZMA 4KJXA 1WPGA 2ZTSA 3SKVA 2ID4A 5IBRA 1SC6A 2NXCA 4LF4B 3G7UA 3COVA 3ND9A 4MRPA 4KVAA 1E5VA 1SQGA 3R3WA 1UJ6A 1WDWB 3L0BA 3TW0A 3BOSA 3DFZA 1AY0A 2FP3A 3ZHOA 1F6WA 1WPQA 1XK7A 2F3UA 4UJ5A 2O7VA 1D5CA 3DKKA 1K8RA 1E8NA 2YJGA 4GFDA 1T1JA 3C6XA 3DT6A 1P0FA 4K8OA 1IEXA 2HQOA 2QG6A 1SHTX 4MV5A 3LPLA 4PQYA 2FNAA 1TAUA 1GTG1 3E7DA 3W06A 4AN4A 1RP1A 4G24A 4MQ6A 5IH3A 2C82A 3K5PA 4ONEA 5KBYA 3H4TA 1HKUA 1W75A 1WDTA 4X3CA 5F77A 4CQMB 4DCJA 1RJWA 4QPCA 1T3HA 3WFIA 2AC2A 3WI7A 3I5AA 5FBRB 1IK6A 3FYCA 2A5DA 1APBA 2GYWA 3ETJA 3HKEA 4RVNA 1X7WA 2PNFA 2Z3VA 1E3JA 3FPEA 2HKIA 3D6FA 3IAUA 3OZIA 1AHNA 1VA5A 1L7NA 1XCJA 1JLRA 1ZIYA 2RDMA 5K51A 3HQ4O 5JH7B 3K9HA 2IYNA 3K0KA 5DHQA 1XDUA 1ABBA 4QNNA 3JARB 4L9WA 3D3EA 1ZUWA 4TLLB 1IN8A 3FWHA 3H5VA 3JRNA 3QRWA 4OKNA 1L4KA 2NUBA 4AJHA 1WCXA 4OXRA 4MVJF 1S3GA 1ZJJA 1S8AA 2GVZC 4UREA 3IBFA 1GJRA 4KQMA 4P3XA 3EC2A 5FUVA 1MPTA 3M6VA 3CF6R 4RKYA 3PHLA 2QZSA 2W7TA 2VSFA 2IF2A 1RE0A 2DPYA 5ECYA 2RJ3A 3J80A 1OIXA 3KKOA 3VYUB 3OAAA 1CRPA 1CUZA 1K89A 4QFDA 2PJRA 1KI2A 2ZWOA 1T4MA 3F5SA 4N0DA 4RHCA 3NHWA 2HMSA 4L7VA 5EMMA 3VKVA 1COWD 3HXQA 1DG9A 2DUUA 5IPFA 1QZUA 1UKYA 3K31A 3MMXA 4LC0A 4P0PB 4A6XA 1XKTA 1UAGA 2P2LA 2JH3A 1ORHA 1RIIA 1UF9A 2P7IA 4OXIA 5A3SA 4BMVA 1JDZA 1E2LA 1GGKA 1DC7A 1DAKA 3D3KA 4INJA 4O0LA 3S29A 4EA9A 5TNXA 3W5VA 1ZSYA 2V1XA 1E1QD 3GEDA 3L01A 3SVZA 1DV2A 1SCIA 1U0FA 3A9RA 3K9GA 2J3KA 1NLYA 1EM8A 2AEJA 3D6NB 1TA9A 2E6KA 3N8NA 4JI0B 2IPXA 3EY4A 1XI2A 4G4JA 4OFWA 4MIKA 3WRWA 1QP8A 3ITNA 2V9CA 1GG8A 1BS2A 1KR2A 1PCXA 2B7CA 1Q1ZA 1DJLA 3CVOA 2QSYA 4FIDA 4MEJA 2HRCA 221PA 3A1WA 1KY2A 4CUJA 4CYMA 1UMCB 4BFVA 4BZXA 2OFXA 4KVGA 3MRXA 2YTZA 4CG0A 1O94C 1N7IA 1R0CA 3AUJB 3LNTA 4N41A 3RLFA 4DBZA 2MINB 3PRYA 4PZ0A 3EZNA 5JCPA 3CYFA 1JPJA 2FR8C 2OOKA 3DLIA 2X40A 1OTYA 4NFYA 4MV9A 5G4KB 3TLXA 4D46A 4EEKA 5CBKA 2NXEA 4ZCQA 4LJSA 3A9TA 5IK2A 1ESDA 2X9NA 3D6VA 1W96A 1X19A 1Z5OA 2NQ2C 3HFJA 3CPJB 4G63A 1UBHS 4O0MA 4Q7LA 4XWGA 2OLEA 1ZL2A 2X1HA 1AOXA 2W5UA 2AQKA 1KBOA 4C4PA 3ZDFA 2X2FA 2Z8YA 2JDIA 4ZVQA 3WXMA 4BFXA 3AEKB 2ISQA 1P2UA 4W63A 5D85A 1DZ3A 5D2CA 4L0DA 4TS9A 1H1LA 2P30A 4DMUB 3H9QA 3EZ2A 5JAUA 5EESA 4KTVE 1Y1RA 3LRTA 4IF4A 4ZAXA 2H16A 3FHCB 4Z5XA 2QAGB 4HSEA 2EBWA 3WWZA 1XALA 1R6VA 3QEMA 4XYMA 4YWJA 5BVGB 5IJ0B 1PR4A 4ZT4A 5FJIA 4DV1B 2WUWE 4L4XA 5KDLA 4JR2A 1P8JA 2VLBA 4S24A 2H1RA 2FI1A 4L74A 2JD1A 2PTHA 5JCOC 3KELA 2ZULA 1VXOA 2IL1A 3FMPB 2QDKA 5KIAA 3GLIE 1YR2A 2R6R1 4TGLA 1QLHA 1UXOA 4QUKA 1JPUA 2ZJ8A 3DL0A 4MKXA 3FNQA 4C0HA 3U7HB 1IRIA 5CJJA 4KXQA 2V0CA 4C7MA 2FTKE 1IH8A 1FYWA 4F7DA 5EYPB 4MINA 1EFCA 5C51B 2WV7A 5AXAA 4L3OA 1EIWA 4OHUA 1T36B 3PS9A 4E2WA 4QGGA 2DERA 4PCAA 5KYKA 4EPVA 5CXUA 1L5KA 2X1VA 3LQ1A 1BWPA 3SVTA 1KQFA 3C48A 5B36A 1E92A 4GDFA 1C50A 2CDBA 4R8MA 1MH1A 2JEZA 1R8QA 1UKVY 3AFGA 4MB2A 4ND8B 3SLGA 3THRA 4CIAA 1EU1A 4FILA 5KOJB 4S3MA 5FA8A 5JZ9A 4R41A 3QH4A 3MXTA 5K2MA 3KVVA 4Y1FA 1TQ6A 4WWHA 3ZTYA 2XW6A 4YYEA 5IJ9B 3AGQA 5B6PA 1OWMA 1S96A 1OJ7A 1ZIXA 4HMPA 4HAIA 3G8AA 2P27A 4WJLA 4K9PA 1P7ZA 3EOAI 1GV0A 2JKZA 4BQPA 4WA8A 2MHCA 3GJ3A 2A9QA 4G5OA 4U9IS 3ZW9A 1CNFA 2HFKA 2J0SA 4WVFA 1L3BA 1A7JA 3MCAA 1TC1A 3ZWYA 5BT8A 5D51S 3VYRB 2JFOA 3I6QA 3FKJA 7MHTA 1QF6A 4GX5A 4EG4A 1JHAA 1EP3B 2XR1A 4ZANA 4WKOA 3R74A 1WP9A 3HVHA 4LBYA 1XZFA 3LYHA 1P1CA 2D54A 1N8SA 1X70A 3QPUA 1PWZA 1MA3A 2CWWA 4AFNA 4NLLA 3SGLA 3WISA 1OBHA 4JLUA 4JI8B 2ON6A 4PG6A 2OFWA 1CJTC 3HVIA 3L46A 1ISFA