5JLAA

Crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
257
Chain Sequence
ASAEFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRVARATGGKTLVLDVGEDASVTAAANEVRARYGVADVLVNCAGVLQRTLPPGELAQREWDVVSRIDLRGTYLCCAAFGAPMADRRRGSIVNIASVAGMRSGPLHAYGPAKAGVISLTETLAGEWGPKGVRVNCVSPGFTQTPALERGFTTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPVDAGYLIAGSWAAYGGLRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of putative short-chain dehdrogenase/reductase from Burkholderia xenovorans LB400 bound to NAD
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Isomerase
molecule keywords Putative short-chain dehydrogenase/reductase
total genus 94
structure length 257
sequence length 259
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jlaA00
4RPHA 1YO6A 3AUSA 3UICA 1K3TA 2DBQA 4WE3A 2Y1DA 3X2EA 3U62A 4IDFA 3A14A 1NQTA 3QWBA 4FJ1A 1WLYA 1A71A 3DZJA 4GMGA 1Y8RB 1JAYA 1Z82A 4A73A 4HUJA 3WLEA 5CDGA 3ON5A 3PYXA 3I4FA 4UUNA 5IZCA 1LDEA 1T4DA 4BKQA 3GRKA 1NVTA 1AN9A 1SCUA 4PLYA 4TMFA 4OOEA 4J1TA 3PHLA 4KZPA 3ITDA 4XYBA 4XQCA 1B3RA 3ZU3A 4UAGA 3WNQA 3UGKA 3B20A 3RUCA 2O4UX 4QXMA 5COBA 3LZ6A 3JYPA 2BKAA 2WE8A 3AW9A 4NPCA 4YT5A 3HDJA 1UP4A 4IGEA 4P22A 1EEHA 1UDCA 5TNXA 1SOVA 2WDZA 1P33A 3PIDA 4OIMA 5GMOA 2ZTLA 1DPGA 3PQFA 4TRNA 4IM7A 4GBJA 3F4LA 4DPLA 1RM0A 4YB8A 2IZ0A 5C7OO 1XA0A 4DQVA 4XQEA 3RASA 2Y67A 2IZ1A 3I6QA 1OMOA 2W90A 2NTJA 4E0BA 1LSSA 4RZHA 1W8DA 1GZ4A 1QV6A 2PNFA 1Z73A 1V9LA 5JBIA 1C1DB 4RF3A 2G1UA 3Q1LA 1UXGA 5CFZA 2QQ5A 3PHJA 2Q49A 5CAEA 3R6DA 2NNLD 4IGFA 5AXDA 2NU6A 3UKOA 3FPLA 1BVUA 1K6IA 5TC4A 4Y67A 2B37A 3JQBC 2POQX 4C7JA 2UDPA 2X58A 1UXHA 4M49A 4NBVA 3LC2O 3NT5A 4K26A 3SBOA 3COSA 2BRUA 3UCXA 2ZYDA 4ALIA 2JKVA 2D5AA 5T67A 4L4XA 4WLVA 1DRVA 4QQRA 1A9ZA 1ZK3A 2HK7A 3WYCA 1C0IA 1DC6A 5CDSA 3WSVA 4CMAA 1FDTA 1HEUA 1SOWA 4OYRA 3D5TA 4BQRA 2OP0A 3H3FA 4CLXA 2VHZA 4NFSA 1XIVA 4TSKA 4CPDA 3NDRA 1T1RA 1U3UA 3TSCA 1H9AA 3RUEA 3NGLA 4YT4A 5T57A 4D42A 3IS3A 3C24A 2C0CA 3GVXA 3I5MA 3PHIA 5EESA 4IJVA 1T2CA 2JL1A 4NDNE 1M6WA 5JDCC 3VPXA 5IZCC 2PD3A 3STHA 3OH8A 4QTZA 4XYGA 1EK5A 4Y8VA 3RVDA 1KVSA 2FZEA 4B4WA 1QV7A 3PZBA 3E6AA 4W9NA 4RF4A 4K6FA 1IY8A 4JJGA 4LSMA 4YT2A 4ALKA 4N5MA 3ZGYA 1AE1A 3ZWPA 2JCXA 3FPCA 3SC4A 1H5QA 3OA2A 4CLHA 1X15A 4BS9A 1C0KA 3D0OA 3KYCB 4IBOA 1ZW1A 5U4QA 1RM3A 1QMGA 1VM6A 1NPYA 2JD0A 4W9NC 4BGIA 4FOOA 1NWHA 3ZWYA 2CDBA 2NTVA 3K30A 3T4XA 3ZU4A 2AQ8A 5B12A 5K9ZA 4NU6A 4YAJA 4UUMA 3IKTA 1ZJYA 3C1TA 3AM5A 4WOKA 5DP1A 2NQ8A 4NZ9A 4IQ0A 1B26A 2EHDA 3IC5A 3AOGA 4PLVA 1NP3A 2VN8A 2VT2A 3T7EA 3DXFA 5IN5A 2BFAA 4B8ZA 2DBVO 1N1GA 1E6WA 1AUPA 2FSVA 3TL2A 3JQDA 1NNUA 2HU2A 2Z1NA 1OI7A 3MJCA 5DN9A 1ZIDA 2RCYA 4DUPA 3L9WA 2OP1A 1XELA 4KTTE 4MP8A 4KDFA 1NASA 5BSEA 3GNTA 3TPCA 2X9NA 4I1IA 2Q3EA 1GYPA 4CV1A 4NMHA 4J2HA 1HDOA 4BNZA 3UCEA 3T4EA 2QHXA 4UVEA 1NR7A 3ROKA 4E6PA 1YWGO 2X22A 2HAEA 1PX0A 3LVFO 4ZQGA 3GH3A 2VUUA 4TKMA 3QVTA 2VWHA 1WZIA 5AXAA 3GEDA 3JQ9A 4G2NA 2OGUA 1KC3A 3HFGA 3ZV3A 2DBRA 3VZRA 1Y5MA 4JP3A 1W0CA 1ZSVA 2CF5A 2FSSA 3JQ7A 3EVNA 3LC1O 3ENKA 3MWEB 1N9GB 3QVXA 1I30A 4N18A 3ZWOA 1ENZA 3S8MA 3DOJA 5A1TA 1YB1A 1ORRA 3C1OA 2Q46A 2GPTA 2UV8A 1BVRA 3CUKA 4LISA 1K89A 2JCYA 1J49A 3GFGA 4NK4A 1NPTO 1I0ZA 1U8FO 2VWGA 2NV6A 4B7UA 1O6ZA 2GO1A 2QYTA 4J9UE 1LUAA 4KUEA 2VHYA 1LQUA 3UOGA 1OC2A 3ZHZA 3INTA 2YHIB 1U4SA 1PJSA 2AHRA 5JPIA 1IB6A 3SLGA 1EQUA 3RJ9A 1WWKA 4TROA 5JDIC 1VL8A 3EC7A 5TS3A 4M87A 1QRRA 3VTZA 3RFTA 2BGKA 3DONA 3DHYA 4BGEA 1I32A 1MV8A 2DQ4A 1GYRA 5EN4A 3DWFA 4J7CA 2WWRA 4QSMA 2Y93A 5HS4A 3ZWMA 1DLIA 5JDCA 4BV9A 1VSUA 2W2LD 3VPSA 4TVBA 1F0YA 1YRLA 2P2SA 4XCVA 3TZQA 3M1AA 3L07A 3WTCA 1DFIA 1DAPA 3D3EA 4IZHA 4BB5A 4A5OA 4YT8A 2WD7B 4OAQA 3X2FA 5L53A 1A4UA 5EQDA 5DZSA 1M6HA 1FF9A 1W4ZA 3WGYA 1JDJA 1R4NB 1HDXA 4JXKA 4W82A 2PV7A 3DMTC 3PWZA 1Y81A 1SNYA 1BXZA 4L8VA 3F46A 3WNVA 1P9LA 3EUWA 4UUPA 5JE8A 3KV3O 4H3VA 2HMUA 4PRKA 4YPOA 1LLCA 1I2CA 5COQA 5FWNA 5BSHA 1ISIA 1P45A 3JQBA 5TIIA 1GAEO 2HDHA 3M2PA 1M76A 3PTZA 4OM8A 3FNEA 5JDIA 4HNHA 1JKFA 5JAQA 1YVEI 3ZCXA 4L75A 4RPKA 2ZQYA 1YL5A 2Q1WA 3QIVA 3LT1A 3G3EA 2ET6A 3FD8A 4RVDA 4BMNA 1U5CA 1H9BA 4AJEA 3OEYA 3DZFA 4RV9A 3PEFA 5ER9A 4A2CA 4BO2A 4R16A 1ZEJA 3HG7A 3PYLA 1DIRA 4JIGA 3HDQA 5DCUA 1DB3A 1VKOA 3H7AA 1ZSYA 1WMBA 1ZJZA 1EFLA 2ZTVA 4RPJA 4CMCA 1Z45A 4F45A 4BL5A 1BGVA 1G0OA 1R0LA 4XRRA 3KEOA 1SBYA 4F46A 2IDZA 4YJHA 5KCZA 1QLHA 2AQIA 4IQ8A 3ZWXA 1ADGA 4HY3A 1FMCA 3OMLA 3LLVA 5JCJA 2GN9A 4R9SA 2EJVA 2J3HA 1MG5A 3AI3A 4GSLA 1H93A 3E82A 4HWKA 3ZHXA 4B7XA 3HE3A 4OOFA 2QW8A 4IDAA 3K5PA 4TQGA 1YQGA 1I5RA 3BHIA 4IPTA 2HMVA 5HS6A 1NFRA 4NU5A 4CV0A 4JNKA 2VRBA 3BTVA 1IPEA 1E92A 1ADFA 4ID9A 3UF0A 4BKUA 4FQ8A 4HV4A 1HSZA 2GR9A 4FGSA 2B35A 1MA0A 5K0ZA 4NFYA 4OSPA 3CMMA 1AXGA 4EYEA 4W7HA 2FPPA 5G0TA 1WZEA 5JFOA 3KOUA 1ZSNA 1ADBA 4XGIA 4GSKA 1Z7BA 3U5TA 1HWYA 1Y7TA 4PG6A 4TVOA 3EY4A 3UW3A 1Y8QA 5JAZA 1NFFA 3OBBA 3OFSA 1RYEA 4UVIA 4E5PA 1NPDA 4ZRMA 1Q0QA 5JY1A 5IJZA 4HFJA 5I9NA 3GVHA 1GADO 3GNQA 4MVJF 1MLDA 2HRBA 2NACA 1U3WA 5KJCA 1NYTA 1VJ0A 5T6BA 3CEAA 3RFXA 5DULA 4RCVA 5KNLA 3BMQA 2O2YA 3DHNA 1T26A 5I8ZA 2VTEA 3F5SA 4CMBA 2A94A 4XYEA 5CPBA 5LC1A 4JCOA 3DZGA 2NVWA 3EHEA 4D44A 5CDTA 3V1YA 3ZNOA 3GG2A 4NBUA 5KIAA 3ZHBA 2VZ8A 4YJGB 4KUHA 1C14A 1A4IA 2QG4A 3NTRA 3H6KA 1X7GA 2H9IA 3HWRA 4GKBA 4Q39A 4E2WA 2EXXA 4K28A 2VUTA 5FI3A 4BNFA 5ES3A 2UUOA 1PS8A 3ST7A 3GGOA 2RH4A 4CV3A 3KLPX 4XEHA 4KWIA 2A9FA 3W8EA 4EUFA 1NTOA 3BA1A 4CLEA 4P8RA 5U1PA 3ROMA 2XXBA 3HJAA 1R6DA 2AE1A 3IJRA 4M8SA 1PR3A 4JBHA 4J6FA 4XYMA 2PFGA 1LA2A 3C1AA 3PPIA 1LC0A 1E3WA 4BV8A 3W6UA 1O5IA 1YB5A 4AJKA 5I7EA 3OSUA 1DRUA 2J3IA 2EGGA 2AQKA 3IP3A 2H63A 2PR2A 3U09A 1A5ZA 2JAPA 3DR3A 3AFMA 3D4OA 4EJ6A 2GNAA 4RL6A 4PLCA 1E5QA 3AI2A 2I3AA 1O9BA 3F3SA 2J5KA 1SO8A 1YE3A 2GDZA 4BO1A 2QIOA 4QT0A 4EJ0A 3PDJA 1V3TA 2Z5LA 1UZNA 3GZNA 4J0FA 1VLLA 1KS9A 1NHWA 4R5HA 3DC2A 4P4LA 3WGHA 4RJTA 3UVEA 2GN8A 1YB4A 4LW8A 2GZ1A 5IAAA 3ZWNA 3AWDA 3NJ4A 4ZVVA 4ZJUA 1Q0LA 4MVJD 3RU7A 4RPLA 3PQDA 5A5EA 1O8CA 3PQEA 1ZVMA 1XQ1A 4YA6A 3A1NA 3I9OA 5TF4A 1F8GA 2JD2A 2X4GA 2ZB8A 4NI5A 4XX0A 5A3VA 4CLDA 4EUHA 4MP6A 4XGKA 3GEMA 3TNLA 5L7YA 4EW6A 5F3RA 1EVJA 2VYVD 2Y1FA 1NWCA 2WMDA 1LLQA 4MO2A 2EP5A 4IZIA 1R4MB 2C5EA 3VH4A 5AVOA 1D1TA 3O38A 5A9TA 5LCXA 1VJTA 2B5VA 4AICA 4AVYA 4MVJI 1EZ4A 4LCJA 4P4NA 2Y1OA 4FFLA 1EK6A 4BO8A 4DMMA 2J5QA 5IXSA 1HYHA 3RC7A 4AJOA 4Q3NA 4BKOA 4BOYA 1E1MA 4AJHA 3EW7A 3VZSA 5FF9A 3HFSA 4AJIA 3OP4A 2WEKA 4BMVA 4EBFA 1Z74A 2YW9A 3RC2A 4CL8A 2JJYA 2C59A 4KQXA 2VZ9A 4R5MA 4JGBA 2OMEA 4WK6A 5DBGA 3I23A 4ND2A 2E48A 2BHLA 1ENPA 4CMIA 4E2YA 1ZH8A 2FWMX 4ALNA 3Q2KA 3RKUA 1JVBA 4F3YA 5I9LA 3L4BA 4BO5A 2QYSA 3WGQA 3F47A 3OQBA 4MOWA 4PZEA 5AXCA 2A35A 5KVQA 3G1TA 1G6KA 5L4LA 2X0NA 2DU8A 1C1XB 2IE0A 4E13A 5I8WA 2D3TA 3BAZA 4RO0A 2O3UA 4L74A 3CXRA 5F1PA 1ADCA 2O3SA 1WP4A 1G0NA 1XU7A 4IDBA 1L7EA 5CG1A 4L0QA 1LLDA 4L9RA 4PLFA 3SJ7A 3E48A 3H3JA 1E7MA 1DLJA 2OHXA 3INRA 1C1XA 4G5HA 2YHUA 3JQ8B 4GL4A 2EERA 4D3DA 3GPDG 1TLTA 4HX5A 1ONPA 4NK5A 3UAGA 2DUUA 3HADA 1LSUA 2DFVA 4IUYA 2IRWA 4XYLA 1Y6JA 5EINA 1YL6A 2IYOA 1QR6A 3TZ6A 4CMEA 1CQJA 4F6LA 5K6AC 1N7HA 5DBFA 1NX6A 5G0WA 4XD2A 1QORA 3KETA 4OMUA 1ENYA 3JD1A 5F1KA 1K5HA 1GZ6A 1PWXA 1RM5A 2AMFA 1F8FA 3ULKA 4MPDA 2ZCVA 2A92A 1LSJA 4RVFA 3GN1A 1E7QA 2EIHA 3O03A 3OA0A 3CZMA 1YBVA 2XXJA 1O89A 1MP0A 1A7KA 4TRRA 4D0RA 4Y9DA 3NUGA 4X54A 4XB1A 2W8ZA 4R69A 3TZHA 1PGQA 1YOVB 4FC6A 1E7RA 1VL0A 1YDEA 1LJ8A 2V6FA 1MX3A 3MJTA 1V0JA 1ZCJA 3NTQA 3LF1A 1WVGA 3O4RA 4R68A 5JMWA 1VE9A 4BNGA 1U2DA 3GQVA 3TZKA 1N5DA 8LDHA 3HNPA 2G82A 2D4AA 2TMDA 3F6YA 1X7HA 1EBUA 4TRJA 1ZMOA 4ZQHA 1CF2O 4PFJA 1SZJG 1N1EA 2UUPA 1HDZA 3TDKA 4Z0HO 3SJUA 1RKXA 1HZZA 2YDYA 2BD0A 1MXHA 1LLUA 3AOEC 3GHYA 1MUUA 4W4TA 2ZB3A 4AJ1A 3QW2A 1JA9A 2RHCA 4O6VA 4XR9A 4Y6PA 5L9AA 3BIOA 3K6JA 5KWEA 3JQGA 5G4KA 4ALMA 4L73A 5CG2A 1WW8A 1C0LA 3TJRA 3WWYA 4TKLA 2R6JA 1JN0A 4IJKA 1X0XA 5EMHA 3D1LA 3WB9A 4FFNA 3IKVA 1XEAA 2VHVA 3UCFA 3AM3A 3IIEA 3DBHA 4XB2A 4AG3A 4CLOB 5HA5A 1GQQA 4XWYA 5THQA 4WLUA 4R4JA 1JKIA 4A10A 4DL9A 3W4KA 3BXXA 2OOSA 3KVOA 5ILGA 1HE3A 1EBFA 2W98A 3LK7A 5EJ2A 1H2BA 5G0VA 4EEZA 1J4AA 5CEEA 2LDBA 3KXDA 4CQMB 3ADOA 2UYYA 1JTVA 5DOZA 5JO9A 1CETA 3KHUA 5B4VA 5T8KC 2CSUA 3KTDA 3RI3A 3OIDA 4GAEA 4HFNA 1E5LA 1YH3A 3ZWBA 6LDHA 1GZ3A 1LDMA 5EERA 3KM0A 1QYWA 4FW8A 4E32A 1B16A 3GAZA 3PYMA 3GZ4A 1GCUA 2AEJA 1B2LA 3H2SA 1E7YA 3V2HA 2VQ3A 3NTOA 4J4TA 1BW9B 2B4QA 4U7WA 2FY8A 2VYVA 3ETDA 2JHFA 1NVMB 3WYEA 1U2GA 1J6UA 1ARZA 2QRKA 1CDOA 4Z0PA 5TT1A 5JW6A 5HTOA 4PLPA 4QECA 4KDEA 2GCGA 5HWSA 2J8ZA 2BGLA 1PJCA 1IYZA 3RBVA 2P91A 1F14A 4PGFA 3EYWA 1GL3A 3W1VA 3IAHA 2P9GA 2RH8A 4HNGA 3M6IA 4CM1A 2PTGA 5DCYA 3VHRA 4NJMA 3FI9A 3JQ8A 3ZWCA 3CPSA 3QQPA 4YEDA 1DEHA 1SB8A 3FWNA 3MZ0A 3JD0A 4K9DA 2FMUA 3D4NA 3PLRA 2JD1A 5DT9A 1WMAA 4DVJA 4RVUA 1N2SA 1XHLA 3GMDA 5COAA 1QYCA 3E9MA 4BNJA 5BR7A 5CHEA 5ER6A 1B8PA 4HBGA 1GD1O 4O5OA 4RLHA 3IUSA 2C07A 4E2XA 3PXXA 3BMCA 4PRLA 3I9KA 4O63O 1U5AA 3WSWA 1XG5A 3FTPA 2AG5A 4GX5A 4BNVA 3C85A 1PS9A 1TT5A 2VHXA 1T25A 3L0DA 4HP8A 2P9CA 3K73O 1P1IA 1X1EA 4XDYA 3U4CA 4R1SA 5JCXA 2PGLA 1KVRA 4J9VA 2C2YA 2BMAA 4GH5A 3FWZA 3PI7A 2O23A 1PZHA 3R3SA 2XPCA 1P1RA 4GWKA 2D1YA 4UULA 3W4IA 5C7IO 3EMKA 4E4YA 3SC6A 4E33A 4PZCA 5L45A 4HKTA 3GVIA 4J1SA 1PJBA 1B14A 1A72A 4IDEA 1FDWA 1ZK1A 2PLAA 4CMEC 5B37A 2XOXA 3FCOA 3ZW8A 3C7DB 3FHLA 4IINA 1PL6A 4NFHA 1HTBA 1RPNA 4N5LA 4XIJA 3FSRA 3WR5A 2D2IA 2Y68A 5DF1A 4ALJA 3CSDA 3OJFA 3KYDB 2EP7A 2VTDA 2CNBA 3WMWA 1WPQA 4YQZA 5ICSA 2YFQA 2YZ7A 1UXKA 2I99A 3QWIA 3E5RA 4J4BA 3FBTA 1M2WA 4RLSA 3L9XA 1UAYA 3DBLA 4MIYA 2GF2A 4FC7A 4IDDA 4KUGA 3C8MA 1T1SA 3KSDO 3KB6A 4MVJE 3WFJA 1P77A 4I8XA 1X0VA 4HXYA 1KYQA 1SC6A 2FN7A 2VNSA 3BTOA 4XGNA 4U0JA 5JS6A 4LCEA 2JFGA 4IDGA 1O0SA 3DAGA 4ESOA 1Q1NA 1JVSA 2G0TA 2DC1A 3JQAB 4BNYA 4QUKA 1DFHA 4Z9XA 2WD7A 1DC4A 2GSDA 3QWFA 3WGIA 3DMYA 1S6YA 4FR5A 4ITUA 4FFPA 4FB5A 2WD8A 4ZN6A 4CR6A 2D5CA 4ZQBA 5HRUA 1KY5A 3D7LA 3GUYA 1GV1A 2OL4A 2IEBA 3GLQA 2O48X 2D8AA 2ZYAA 1U3VA 4DC1A 5JC8A 4PG8A 3G17A 5L51A 2Q50A 4AJNA 3MJEA 1Z6ZA 1DIBA 3ZWAA 5JAIA 3MJSA 3BTUA 1IZ0A 1LQTA 3BHJA 2GZ2A 1EDZA 1UP7A 4E5KA 4MKRA 4A0SA 4MKXA 5AXBA 4UEKA 3QLJA 3WS7A 2C54A 3OHSX 1NFQA 3UH1A 1AXEA 2B36A 2I9PA 4DIFA 2X9GA 3TWOA 3ZV5A 4FD3A 4NIMA 4DXHA 4EUEA 1DJQA 2BH9A 2VOJA 1DXYA 1GUYA 4OQZA 1PL8A 3UUWA 4QFDA 3TQHA 3BMQB 4W7IA 4WGGA 3P7MA 2AXQA 1M75A 1ZK2A 3LQFA 4RVGA 1PWZA 3JD2A 2R00A 3CIFA 5EPOA 2FR0A 3DBVO 2AE2A 4OKIA 3S2FA 1Z7EA 2A4KA 3P5SA 3WQRA 4BVAA 2JFFA 3OICA 1WAMA 1ISHA 4EJMA 3ABIA 5H82A 1V8BA 4NBTA 2CFCA 3QJ5A 1LDYA 2OBYA 4AJJA 1KVQA 3V2UA 2EKLA 3Q2IA 1R0SA 3LSYA 4O0LA 4Y6SA 1ISJA 4I5GA 1PSDA 4CMGA 2AEMA 4RGBA 4PLHA 3U4DA 3S55A 2UAGA 3OJEA 3E03A 1B15A 4Z9FA 4EITA 3S1LA 1CWUA 2ZKLA 4UVDA 4F6CA 1HRDA 1U28A 2AEFA 2DPGA 4IXWA 3VH2A 1I36A 3H2ZA 1Y8RA 2VCYA 1HDYA 3RKRA 1DO8A 1GU7A 3LYLA 2HQ1A 1U3TA 1GCOA 2FPGA 1ULSA 3QVSA 3U49A 3D5QA 1TEHA 1P1KA 3WBBA 3E8XA 3K8ZA 5T8KA 1FDUA 2HLPA 3RU9A 1J0XO 4P38A 5THKA 2Z1MA 1LDNA 1O95A 2NVBA 2YV3A 1V3VA 3E18A 3FF4A 4J91A 3ASUA 4HFRA 1HXHA 2ZK7A 5A4DA 2PKQP 5A9RA 1GY8A 1A7AA 4J7UA 3KUXA 3ORFA 1I3KA 3K9QO 1SEPA 4IMRA 3U3XA 4EDFA 1YS4A 3GVCA 1YQXA 2PD4A 4YJFA 5ILOA 2VWQA 3QSGA 3ZNPA 4RF5A 4UUOA 5GY7A 4CM6A 2CZCA 4R54A 4GX1A 5TGDA 5FEUA 4RQUA 4PIVA 2E6UX 2YV1A 2X23A 3WJ7A 3BMNB 7MDHA 1XKQA 3AUAA 3MEQA 3GPIA 4YJHB 1R15A 1EVZA 4ILKA 4CUZA 3QWAA 3DZIA 4UEOA 3RAJA 5A05A 2O7SA 1UDAA 2GN4A 3FN4A 1ZUD1 2IEDA 4BGVA 3ZV6A 1E1KA 1YJ8A 4ZRNA 1D3AA 4CQMD 3AY7A 3HZZA 4II3A 1HDGO 4PN3A 5AQ1A 4HFMA 2JCVA 2BI8A 1OZAA 4FSHA 5KVCA 3D4PA 3GFBA 1PJQA 4M55A 5IDQA 2V7PA 4CUJA 1GQYA 3I9MA 1UXJA 3UN1A 3LT0A 5A06A 3HUDA 3NGXA 2J3KA 4CM9A 4WCDA 3S2EA 1ZK4A 5ADHA 3ZH2A 3A4VA 4LVUA 4Z3KA 5KJFA 4OXKA 1R4NA 1ZXBA 1BW9A 2NADA 3EAGA 4RQTA 1T24A 4PG7A 1MFZA 3ZNNA 3JQ9C 1ZXLA 1F12A 2YHIA 3UFXA 4CV2A 3B70A 4UVHA 3QVWA 4IDCA 1YDWA 4DLBA 1EDOA 3DOCA 1PGOA 1HETA 1SEVA 2WJPA 3DZHA 4MJLA 4B3HA 3R1IA 5A3JA 1IHXA 2ZIZA 1KEUA 1QLJA 4Q3EA 1HKUA 1DC5A 1AGNA 2OO5A 3N58A 4AFNA 1IOLA 4U8GA 5ITVA 4FGWA 2P9EA 3G79A 1U8XX 1E3SA 1TXGA 4OSOA 4XZ3A 3MCVA 4UVGA 2YQ4A 1KOLA 1YONA 1BMDA 4WPGA 4WCFB 1XLTA 2I65A 4MINA 5GZ3A 1BDBA 1NXQA 1JKJA 1JW9B 1TB4A 4WCFC 3RUHA 5A03A 2AG8A 1JQBA 3P2OA 4L76A 5TT0A 9LDTA 2R00C 1VL6A 4N7RA 5IFLA 3H9UA 3NT2A 3I1JA 3EZYA 2Q99A 3DTTA 2WSBA 4MIOA 2YFHA 3JQCA 4LRTB 5BNTA 3AUUA 4FOSA 3JQGB 2C5AA 4YBZA 2VWPA 3JD4A 3A06A 4L4RA 4OGWA 4OQYA 1R0KA 5A9SA 4DLAA 3VPFA 1C1DA 4XRGA 5FFFA 2PGDA 4Z9YA 2FP4A 2PZJA 2RIRA 4LMPA 1EVIA 4CMHA 2HK9A 4IS2A 4XJTA 2P68A 2IODA 5IDYA 2BFOA 4GVLA 1ML3A 1LEHA 1WXDA 3DAPA 4OH1A 1GR0A 3R0IA 4DQUA 2I67A 3QWHA 5IG2A 2NUAA 3WTBA 4QO8A 1CERA 2EJWA 4DPMA 4BO4A 3ONEA 4ZD6A 5TQVA 3GA0A 3TOXA 3V1TC 3KYDA 4I9NA 1PZEA 5F5LA 1M66A 3LT2A 4AJ2A 4R1NA 3NYWA 2J3JA 2W2LA 2O2SA 1U9JA 1YOVA 3NAQA 2JAHA 1PZGA 4JLWA 4YQYA 5CPFA 4Y98A 3W8FA 3F1KA 1LSOA 2OZPA 3NEPX 3VKVA 4O1MA 2DT5A 4YYZA 4D3SA 2NSDA 3K2BA 1EQ2A 2P5YA 3ITKA 3F4BA 4XJSA 3ANLA 4GPD1 3ETGA 4O59O 3O9ZA 1XDWA 4BGUA 3ZU2A 4IJWA 5IXYA 3D64A 2E49A 3Q3CA 2XF8A 2E37A 3TF5A 4WLOA 2GERA 2W2KA 1XGKA 1KY4A 3I83A 3HHPA 3QV1A 4OO3A 1MC5A 2OXIA 3RBZA 1GEEA 2G5CA 3OECA 2Q1UA 4CQLA 2DBZA 3WOHA 4RPGA 3JYLA 2BLLA 3KYBA 4FPXA 3JV7A 5ENVA 2ZCUA 2RHRA 2CD9A 2WYWA 1NQAO 4ALLA 2HUNA 1EUDA 1I8TA 1N92A 3RQSA 1YBAA 1SPXA 3OJOA 3CH6A 5KTKA 3SVTA 3GUCA 3DZBA 5L3ZA 1LRJA 2RAFA 4BB6A 3I3OA 4E5NA 1PZFA 2B0JA 2CY0A 1D4FA 3RUAA 3PGJA 2G76A 4RVSA 1JWBB 4G81A 2P4QA 4JP2A 4RDHA 3W4JA 4BNUA 4BO0A 4B4OA 5BQFA 4JJIA 3T7CA 4GGOA 1N8KA 1K0UA 1P1FA 2O3RA 5JNLA 1W6UA 3PGXA 3QP9A 3U0BA 5TX7A 3V8BA 2R2GA 5JYEA 2B83A 3HN2A 3GGPA 1E3JA 4Y6RA 4BKPA 5DP2A 4FFMA 1YKFA 2HRZA 1XR3A 5F1OA 2B4TO 2WM3A 4YAGA 1VRWA 1E7WA 2IYPA 3RUDA 3UHAA 4DYDA 3DHEA 4Q3CA 1YXMA 3WG9A 5DDIP 1N9GA 1LDBA 4NJOA 5JAMA 2OBNA 1YBMA 2PH5A 2Y1EA 4UREA 4B3IA 4C4OA 1V3UA 2BI7A 4B3JA 4QFCA 2Z95A 1X1TA 3DDNA 5J23A 4H16A 4YR9A 3LLSA 1YJQA 1ISFA 4OXYA 5G0SA 1U7HA 2HO5A 1HL3A 1FDVA 1T2FA 1K6XA 3N7UA 5IN4A 5BNIA 1Y9EA 2NU9A 2HSDA 5I7VA 3LC7O 3RSHA 1TA4A 4KWHA 5G2OA 1P74A 4DA9A 1P1JA 5I7SA 1VC2A 4CM3A 4YAKA 4WCFA 1PS0A 3DEYX 3NDIA 1ZMTA 3SXPA 4CMKA 1UZLA 3JQ7B 4E12A 3JQEA 1GPDG 5KKAA 3GVPA 1IL0A 4DQXA 3PDUA 2AW5A 4J4HA 3DBHB 3PIIA 5FYDA 3AK4A 1NM5A 4MVJA 1NQ5A 3WMXA 2QRJA 1IHYA 1P0FA 1WDKA 2ZQZA 1HLPA 2LDXA 1OBFO 1I24A 3KRTA 3I9NA 1PGPA 2FOIA 1QYXA 3KLMX 4Q3BA 2GLXA 3RIHA 1NHGA 3NV9A 3TN7A 5L4NA 4E30A 3H9QA 5KVVA 4R9RA 1I2ZA 2GYYA 3OJ0A 5KJEA 4E3ZA 1DDOA 3KBOA 3KSZO 4D46A 1BXGA 3Q9UA 2CDAA 4WJZA 4XR4A 4I5EA 2NM0A 4FN4A 3VPGA 1DIAA 1R16A 2F00A 1EFKA 2DTDA 2ZB4A 3LT4A 5TSDA 1L7DA 4JQCA 3CKYA 5DBIA 4GVXA 4R1UA 3DMTA 1QYDA 2C82A 3IDSA 4BIIA 4URFA 3TZCA 3GOHA 3Q0EA 3VDQA 1XSEA 4BNNA 5A04A 1Q2XA 2O3QA 2CF6A 1DRWA 2HK8A 1U4OA 2PGJA 3H5AA 4C7KA 5BSGA 4CLRA 6ADHA 4QEDA 2VYNA 2QX7A 5EL0A 4CM9D 3TOZA 1E7SA 1SB9A 4Q3DA 1FK8A 3I4CA 3DBRB 1B3BA 3S2IA 2GASA 5DCWA 3GDGA 4GI2A 2HJRA 1KBZA 5MDHA 2BF7A 4MVJG 4J0EA 5BNFA 5KJ1A 2VRCA 1E6EA 3K2EA 4D45A 2J6IA 3ANNA 2VNAA 1KEVA 4MIEA 2Q2WA 5JYDA 2DTEA 4TZKA 3WLFA 5EQFA 2D59A 4WUVA 1DAOA 3NKLA 1DC3A 4BNHA 5L7TA 2PKQO 1HF3A 3HN7A 4IQGA 1CIVA 1KVUA 1RJWA 2Y0DA 4FJ0A 1J5PA 2X7HA 4GX2A 4KQWA 3P19A 2X86A 1C3VA 3DB2A 4QO7A 3OQ1A 1W73A 4OL9A 5TRTA 5KOIA 5L4SA 2X0IA 3F9IA 4WLNA 1XCBA 2Y66A 3ZW9A 1PIWA 3FNFA 1EUZA 1DFGA 1L1FA 3FBGA 3ENNA 2I3GA 3H9GA 1GEGA 5A9SB 2ZATA 4FFRA 3VKUA 3JYNA 4ZGWA 1P31A 3VAZA 5HM8A 4W6ZA 3RUFA 2AQHA 3Q11A 4YTEA 4R3WA 3EDMA 3Q6IA 3ZZNA 3KEQA 3WGZA 3B1FA 2GRAA 2JFHA 1V6AA 3CZRA 4Q3AA 3QRWA 3PWKA 2F1KA 1BTOA 2X5OA 4UEJA 3ZHYA 1E1NA 3VVCA 1IPFA 4Z3DA 1IE3A 1KEWA 4YXFA 1BDMA 4W99A 2IXBA 3DFUA 3GR6A 4GKVA 4R3NA 3NT4A 3ROPA 2P5UA 4S3MA 2OORA 4D41A 4OHUA 1KERA 5L95A 2CVOA 1EE9A 3IUPA 2DKNA 4LK3A 4B4UA 4GGPA 3WQQA 3H5RA 4CM7A 1FJHA 4LN1A 1R12A 3AI1A 3H9EO 3MOIA 1HSOA 1UR5A 2OUIA 4N54A 2HJSA 4YCAA 3WQSB 4BUCA 2PWZA 5C7LO 2PZKA 2VOEA 2HMSA 4WECA 4P4GA 3PJDA 4FIZA 1E3LA 4M1QA 2Y05A 2CMDA 2YV2A 4JBGA 3DAFA 2ZJ1A 3GEGA 3FR7A 2FRDA 4AJLA 5LDHA 3TFOA 4NBRA 4BO3A 1B8VA 1JWAB 4E2ZA 4OKNA 3C7AA 4R51A 3D3WB 2RBEA 3OIFA 1E1LA 4DLLA 1R37A 4EGFA 1OAAA 2Y0EA 3DZKA 5CP8A 3BMNA 1H6BA 3INGA 4XQGA 3VZQA 5CEFA 3VPHA 3MTGA 3G1UA 2PZLA 4DIOA 4U6QA 3JQ6A 3ZU5A 1XQ6A 5A5FA 3OM9A 4CLRB 3H4VA 3A28A 2EKQA 4YJFB 2HMWA 4BNXA 1BXGB 4D3FA 4WKGA 5IZ4A 3JQAA 4TRMA 1ZK0A 3AFNA 5A02A 2X8LA 1CEQA 4HADA 3E5MA 2J5RA 4IXTA 1WDLA 1NR1A 1BWSA 4J1NA 3ICPA 3PZRA 1V35A 3VC7A 4CM8B 2X0RA 5G4LA 3I9LA 4EI2A 3I6IA 2X1HA 4PLWA 5G0UA 4U5QA 2HMTA 1PL7A 2DUWA 4CM5A 2G17A 2CDCA 4M89A 3AU8A 8ADHA 4PG5A 4LSWA 3PJEA 5U9CA 4IIVA 1DOHA 3N74A 1PQUA 4DYVA 2NLOA 3JQFA 2I6TA 4N5NA 4ZA2A 3OEWA 1BG6A 2C20A 3JYOA 1AHHA 4YJGA 4DPKA 3NX4A 1Y1PA 1NVGA 4MVJH 3AY6A 2PY6A 4GWGA 4NJMB 2DM6A 3L6DA 4PCVA 1D1SA 4ZHSA 5LDGA 1FXSA 1ZZEA 5T64A 2Y1CA 3R3JA 1KEPA 3I52A 2JHGA 4A26A 2FR1A 4BO9A 1TT7A 5TJ9A 4YRBA 4JROA 2FR8A 2QZZA 3IL2A 2E82A 1LX6A 4PVCA 2ZJ0A 3BMCB 1ISMA 3GK3A 3PFFA 4D43A 3QA9A 4U0KA 3NJ8A 1Q7BA 5ITWA 3H65A 1PGNA 3GHHA 1NAIA 2O50A 1HE4A 2V6GA 2B5WA 3FR8A 4DGSA 2UVDA 4KOAA 2GD1O 3F1LA 1Y9AA 1PJTA 3FRJA 3HB4X 4EEXA 1LI4A 2NVUB 2B69A 2YQ5A 4PLGA 4ZICA 1UZMA 4PLZA 1K6JA 2NTNA 4NHEA 1OOEA 1T2EA 1CYDA 1NAHA 1DJNA 1PGJA 1OC4A 2EF1A 1NBOA 1TT5B 3GN2A 1DBVO 3WDSA 1UAGA 3H9JA 4R41A 3ETEA 4PLTA 4WNCA 1CQIA 4BQPA 2X9VA 4BNIA 1BHSA 1Q7CA 1TVEA 1EVYA 2X6TA 2Q1SA 3TFQA 4I08A 5B4TA 4E5YA 1HZJA 3ANMA 3QVOA 4ROSA 4R01A 1JU9A 3ICCA 1Q0HA 2VZ0A 1Y8QB 2H6EA 2C2XA 2BELA 1T2AA 4FFOA 3VDRA 1PR9A 3O8QA 5MGBA 2GN6A 3AU9A 1P3DA 2O4CA 1E77A 4RVHA 4DIBA 5KKCA 3AM4A 3WIEA 4BHTA 4NNJA 4JN6B 2DPHA 2EEZA 3HDHA 1KETA 3PJGA 2DAPA 1ZBQA 2ZB7A 4PG4A 4AL4A 2NQTA 3W6ZA 1QYVA 4CJXA 4DBVO 2I5PO 3O26A 4BO7A 2YDXA 1RM4A 2PH3A 3KSUA 1LNQA 1UJMA 5C5IA 5CDYA 5I9MA 4WNIA 1NQOA 2GUGA 4GMFA 5CEJA 1DIHA 1GDHA 4YRAA 4EZBA 3PHGA 3V2GA 3RJ5A 4QX6A 4D7AA 3IP1A 3M2TA 3JTMA 4Z0TA 1VKNA 1YL7A 3EK2A 1ULUA 2Y99A 2YUTA 3L6EA 1KIFA 1GUZA 2ZYGA 1RWBA 4CQLB 5C37A 3PJFA 1ZEMA 3M1LA 1TI7A 3ZV4A 4YAEA 1ZNQO 4D79A 4IIUA 3IOYA 3ZWWA 4CUKA 1UH5A 2NU7A 3GY0A 4KTVE 3RC9A 2NWQA 3EZLA 4YACA 2VRCD 2O3JA 3B1JA 5CDUA 3C3XA 4I9HA 3KYCA 3PFWO 3TRIA 4MKZA 3WFIA 3JYQA 1RYDA 1DSSG 3VVBA 1A9YA 4LVCA 4YVFA 1D8AA 3VH3A 4CM8A 3WGTA 3ZDFA 4II2A 3JSAA 1UDBA 1C0PA 4JK3A 2EKPA 1H2HA 2V65A 4I5FA 4YJDA 1PU2A 4IS3A 4IMPA 1EE2A 1KC1A 4XIYA 4WLEA 2Q4BA 3MJ4A 3RWBA 5ICMA 4H15A 2WYUA 4A27A 3NDJA 2Y0CA 3GMSA 4WEQA 4ZU3A 1G1AA 3MJVA 2Q1TA 4TZTA 3GGGA 3OJLA 3PK0A 1LC3A 4BKRA 4J16A 4G65A 3IQDB 1N7GA 3OF2A 3S2GA 3AUTA 1PJ4A 2VHWA 4S1VA 1B7GO 5JMPA 2ZTMA 3BZUA 2PKRA 1F06A 1H94A 3A9WA 3LDHA 9LDBA 2EWMA 5DOVA 2W4QA 1MB4A 1HE2A 3H5NA 1E3WB 2I76A 3WJAA 1CJCA 1E0DA 4J90A 3E9NA 4BO6A 5C3MA 1VPDA 3K92A 3QE3A 1MC4A 3OETA 4FCCA 3EVTA 4TWRA 1XWFA 2YY7A 2V6MA 2QRLA 5B4UA 2DLDA 2AA3A 3JQAD 4GQAA 4FBGA 5GZ1A 3AY3A 1BRMA 1PQWA 1ZFNA 3VH1A 5L40A 1MFPA 1LTHR 3FNGA 4R1TA 2EW2A 3K31A 3GAFA 3RUIA 1DHRA 1ZO8A 4MDHA 1U7TA 3KO8A 1GTMA 4KP7A 3DO5A 4J7XA 5JLAA 4RDIA 4FS3A 1MXFA 3FNHA 4BNWA 3JQFC 1SAYA 5AOVA 4CR7A 3CMCO 4NQZA 4B4VA 4Q9NA 3B1KA 3TL3A 4CM4B 2VT3A 1BXKA 3U4HA 3F5QA 1H6CA 3ZWVA 1WNTA 2PK3A 4ONEA 1X14A 1E3EA 2H5LA 1PJLA 3GNSA 5JY6A 2YYYA 4DTIA 4A7PA 5JSFA 5FI5A 1CRWG 1B0AA 2EV9A 2WTBA 3BHMA 4FJ2A 1DHTA 1B8UA 1ID1A 4J2OA 4D0SA 1PJ2A 1VI2A 1MG0A 2CUKA 1EUCA 1R4MA 1LRLA 3EGOA 3O8QB 3UXYA 4BNTA 4IY1A 3WBFA 1H6DA 1F17A 1ONNA 4MP3A 1P44A 3SLKA 2I66A 4JX8A 3GDOA 2IZZA 3CE6A 3GT0A 3L6OO 3JD3A 3HSKA 4XDZA 4ZQFA 1IULA 3SEFA 4CLOA 1GFSA 2FHSA 1LBEA 2H1SA 4Z6KA 5AYVA 5T5QA 4WEOA 5I7FA 3WGGA 4WASA 1I2BA 1T4BA 2O3TA 1EMDA 4ND5A 4B7CA 3WIDA 2X5KO 3RFVA 4CQMA 1QG6A 1ONOA 4CMIB 1K2WA 5IDWA 5ENDA 1QXSA 2HKIA 2Q2QA 4JJFA 4PVDA 3B6ZA 5DNAA 3VZPA 4A03A 3CINA 3PP8A 4BNMA 4NG5A 1GQ2A 3FTNA 3G0OA 1I10A 1VJ1A 5BSFA 2O7QA 1A27A 1IUKA 1GPJA 1I3NA 3AJRA 3DBLB 5KJ6A 1Z75A 3ONFA 3VTFA 3DBRA 3ZI0A 4J1QA 4ND4A 5JCJD 1GV0A 3V1UA 4JBIA 1X7DA 5GZ6A 4BMSA 1LRKA 3PWSA 1SMKA 3GRPA 4H7PA 4BNKA 3GZNB 4GX0A 1XU9A 2ZTUA 3GG9A 1VSVA 2GGSA 3WYBA 4K1LA 1U1IA 3ROQA 3GDFA 4B79A 3DOOA 5HBRA 3IMFA 3PHHA 1LU9A 1ZKMA 3ASVA 3L77A 7ADHA 2C29D 3PLNA 1UUFA 1OFGA 3RC1A 4ND1A 1E3IA 4E31A 3DQPA 1FDSA 1PQPA 1UP6A 5TJHA 2FZWA 3DL2A 3PRJA 4FDAA 2WE7A 4XQ9A 3Q9NA 2QZ9A 5JC1A 1M67A 5B1YA 1X13A 2Q45A 4MVJM 2TMGA 3HB5X 4J3FA 2WYVA 3AOEA 4PZDA 5TLSA 3WX0A 3D3WA 4E5MA 4OXNA 2EGHA 3GF4A 1H6AA 5BT9A 3LU1A 2VYND 3WICA 5H83A 3L4BC 2C7VA 2X0JA 4I5DA 5H81A 1QP8A 1GYQA 1O94A 1T2DA 2PA3A 4CR8A 3ADPA 4AJ4A 4GLOA 4BNLA 5JXWA 1XYGA 3JCZA 2NVUA 1QKIA 2CVQA 4DC0A 3BTSA 4GLLA 4B8WA 4M54A 4RF2A 5IDXA 1I33A 1QSGA 1S7CA 3DTYA 3BMOB 4YDRA 3WGOA 4E21A 4OJNA 1HYEA 3ZN2A 2FPIA 1JAXA 4U6SA 2VUSA 2XAAA 3L4SO 3K96A 1KVTA 2PD6A 4DWVA 3LF2A 3ONDA 1Q7GA 4LGVA 3WXBA 3QY9A 1GUFA 5L7WA 3OQ6A 4RZIA 3NRCA 1YGYA 4LRSB 1UXIA 1PJ3A 2ILTA 3BMOA 3C7CB 4M86A 5KVSA 1ENOA 5IF3A 3U4IA 3CTMA 4CMJA 4XA8A 2PZMA 4LMRA 2OFPA 3W8DA 4MVJP 4IJUA 4ND3A 1I3LA 5F5NA 4AJPA 2B4RO 3KZVA 4K6CA 4J49A 4WOJA 4YWJA 4ZQEA 1I3MA 3DFZA 3V5NA 3P2YA 2V6BA 3PVZA 4CM4A 2D0IA 2P4HX 2NU8A 1WDMA 2W2KB 2CVZA 3GC6A 1HDCA 1HDRA 2X5JO 4RORA 2YJZA 4YRDA 1IZ9A 4NR0A 1LXCA 4YAIA 3E9QA 1R66A 3MWDB 3E1KA 2DFDA 2DVMA 1HLDA 3MOGA 3RCBA 4CODB 3RROA 2EG9A 5G4KB 1BSVA 2EW8A 3SX2A 3RBXA 4INAA 2Q2VA 5EIOA 2Q4EA 4I9UA 1I01A 4DRYA 5F21A 4KMSA 1ISGA 1AHIA 3G49A 4CL3A 4DREA 2E4AA 2HCTA 2SCUA 3HQ4O 4NH4A 4XKJA 3ZNQA 2GZ3A 1PEDA 1HYGA 4DMLA 1Y5RA 1MGOA 3OIGA 3U9LA 1LDGA 3HDYA 1JLLA 2C7GA 4L4SA 1P1HA 1E6UA 5JO0A 2Y1GA 1H0KA 3WWZA 2BFMA 1D7OA 1HT0A 1DIGA 3IJPA 4WLFA 3I9JA 1PTJA 1HE5A 2DTXA 4J43A 3QHAA 2BFPA 1YQDA 3VOSA 3RD5A 2BGMA 4DBZA 5K6AA 1P0CA 3H8VA 4NBWA 2IXAA 3BYZA 3MTJA
chains in the Genus database with same CATH superfamily
3AUSA 3TIGA 1K3TA 4L27A 1IPHA 3FG9A 1X7XA 4TYMA 4D5GA 2DBQA 3VQTA 2AR0A 3SM9A 4WXMA 2DX7A 4FW9A 3U62A 1NQTA 1T36A 1DX4A 4FJ1A 1WLYA 1A71A 4LDAA 2JCSA 1X7XB 3ELBA 5LIRA 3X0DA 4EJSB 4HDNB 3Q40A 2HSEA 2X40A 1XC7A 3ZD7A 1GGNA 3HL0A 5CDGA 3AUFA 3AEKB 1QQTA 2N1BA 1E4YA 3BIJA 5A6SA 1LPAB 2R1TA 3PU6A 4LOAA 5IZCA 3R9XB 5JROA 1T4DA 3WMGA 4BKQA 1HH4A 2BGNA 2ZYTX 1NVTA 3EXHA 3OMXA 5K0FA 4CEJB 2J9FA 2VK8A 4N39A 3NHLA 1GQRA 4X41A 1COWD 1Z9BA 3IELA 4X65B 2FGKA 3ITDA 4KZPA 5DWDA 1RQNA 3H5OA 5K3DA 2HSWA 5FPSA 3FYUA 5KOYA 3WNQA 1CQJB 1LK0A 3LUAA 1C9YA 4MWTA 2O4UX 3EIFA 5FOTA 5DN6A 3FOWA 4OHXA 4BRSA 3H11A 3AW9A 3D59A 3QGMA 4I3FA 4JJ8A 5TNXA 3O8CA 4RDCA 5ITSA 2BH2A 4Y0VA 1ZCZA 1KY3A 4EZEA 1PFQA 4LOKA 3QTBA 4JUBA 5A0TA 1SIBE 2ZTLA 1DPGA 2IYQA 2VCEA 3QLTA 2PU5A 2F43B 3HA7A 1R00A 5ED4A 4LJRA 4MUKA 1WW3A 5AVTA 1WS6A 3LBHA 2IZ0A 4ZDKA 3EW9A 4QOGA 4CI0B 4JUCA 4M1YA 4OVKA 4AZ3B 1KYYA 2OGSA 3Q5GA 4EJ2A 2JDID 4DQVA 4MEBA 2WABA 4K6KA 4XQEA 1E4VA 3AERA 3I6QA 4AQDA 2NTJA 2B94A 3ILXA 4GQBA 5BUCA 4ZKDA 3JXEA 1RVDA 1HYBA 1XL0A 5BPHA 2BE7A 1NA5A 2FI1A 4EB6A 3I34X 4TXNA 5JBIA 1QGOA 4NXNB 4RF3A 3QBDA 1NXXA 2MSCB 4TYWA 3T41A 2AFIE 2QQ5A 3PHJA 1SXJA 3BDAA 2NNLD 5AXDA 2OQRA 4XXHA 5B1HA 2UZ0A 1RYBA 1FYXA 2OCKA 4INOA 3GPCA 4UD2A 1AKEA 3LUDA 1K8ZB 1BS2A 2W5UA 5H3CA 4D80A 1LPPA 1EUDB 1BVUA 1G9TA 1K6IA 1L5MA 4OCZA 2NVOA 1UC8A 2YN0A 3E9EA 4PPYA 3VC2A 4BFSA 4E46A 4BTEA 1X7YB 3WBKA 3KTAA 3EVGA 1UXHA 4URUR 3TZEA 4OXXA 2V0CA 2DECA 3VR4D 5K3SA 1YRBA 4E4RA 3UCXA 3C87A 3ZY4A 1XRRA 3EFEA 2OCPA 3ESRA 1Z5WA 3RLFA 5KNCH 3AESA 3NHYA 1I9CA 3GU3A 1JXAA 1TDJA 4QM7A 2D5AA 2P6OA 3NOQA 4WN9B 4UDYX 5H7XA 2QM0A 4FONA 5KYYA 3GV0A 3L8HA 3JARB 1RJEA 3M6UA 2OKGA 4AG6A 4YY3B 4IOMA 4YMSA 4DSZA 4QRHA 2WP0A 2TYSB 2XQKA 3L1KA 3V33A 1XVAA 1JQ5A 2G71A 3I42A 2HXSA 3GLTA 4OP2A 3FJ1A 4HB4A 3G8CA 1RBQA 1XZDA 1C8VB 2D06A 3NGLA 3PF9A 3LUBA 4RA9A 2BGTA 5T57A 4G1BA 4JKOA 2BBOA 4JU9A 2GCEA 1RHJA 2ZSBA 1M6WA 1BFUA 4W1RA 5CW1A 3V34A 2PD3A 3I6MA 4A0HA 1JHRA 1D6JA 4QTZA 1EK5A 1WZCA 2R4TA 3D7MA 4YJ3B 4ZKEA 1KVSA 4JVOA 3RS2A 1TZBA 1UK7A 2B98A 4OEHA 3V4ZA 5IBCA 2BF4A 3FFTA 4MDFA 1IZ8A 1RMYA 1VZ2A 4K6FA 1E5VA 1BWQA 1KMHB 4ALKA 3E27A 2ACEA 2QS9A 3QMWA 3SE0A 4C0QC 1X1AA 2E21A 4BX8A 4QZVA 1AE1A 2CFTA 2B8WA 3SC4A 3ITNA 1RABA 2ZS8A 3N2YA 4F1WA 2KPOA 5AW7A 2O8BB 1OVMA 1R0XA 4KQEA 3CB2A 1C0KA 2BM9A 3FOZA 1Z18A 2DCUA 3NIDB 4PBRA 2PIDA 1RFGE 1AQNA 4RA6B 4W9NC 3OQOA 1I1NA 2GZHA 4GZMA 4BGIA 2R1VB 4H6WA 1IATA 2XDQB 3LY5A 2ZUTA 1QGUA 5BOSA 3ZWYA 1ZD1A 3GEPA 1K3FA 3MYYA 1NY6A 4WKCA 1OYVA 4ZDIA 3OKFA 4WMLA 4WERA 3IKTA 4UUMA 4C7OB 1G8KA 3I6YA 1AKWA 5EE0A 3AM5A 4TTPA 2G4VA 3ACDA 3QUBA 3FM9A 4YHBA 4NZ9A 2QBYB 1PFWA 4DNPA 1C9NA 5B30A 1O97C 1SBNE 4B6QA 4MUNA 4FX5A 2MYUA 3AOGA 3IVGA 2C84A 2GBFA 3VR4H 4AXBA 1G21A 1NP3A 3DEAA 3E1SA 3SN6A 2V96A 3LWBA 2VT6A 4TKUA 2WWTA 1YZHA 3TW0A 1WUJS 1COWA 1CZHA 1X7ZB 2DBVO 2BFAA 3HKDB 1P2DA 3RRFA 2FSVA 3TL2A 2WNIA 2Z1NA 2LPMA 1ZOIA 3A3KA 5JQGF 1ZIDA 2RCYA 2H3HA 2RHHA 4LYDA 5FLEX 4BX3A 4DUPA 1NN5A 3KOMA 4MQ4A 4OHKA 2H7VA 4MICA 5GQSA 3TPCA 1A9SA 3HCFA 4EVQA 3HBLA 3UOWA 2GTPA 5B36A 2FSVC 4LDRA 1GYPA 3DTVB 4CV1A 1F20A 2C92A 2O5VA 3O75A 4J2HA 2OM2A 2XAUA 1HDOA 4TT8A 4CL0A 5DCLA 3MT8A 1JUDA 2QHXA 4UVEA 4EO7A 3FJOA 4RXTA 1OB5A 3PKZA 2X22A 2HAEA 5IVDA 2V6JA 2FG6C 1VFPA 3GH3A 3P2EA 3ER9A 2VWHA 4IOJA 2HHLA 4K6HA 4J2TA 1E0SA 5AXAA 3JQ9A 4G2NA 4ZDWA 2OGUA 2VQDA 4X7BA 3ZWKA 2IF0A 3VZRA 3IDZA 4G4SP 3V1KA 4JP3A 4L5CA 1ZSVA 4TQUS 4MKGA 3QVXA 1SQ5A 4N18A 3LC1O 4MCHA 2FZGA 3ENKA 4WBSA 3ZWOA 1I30A 4Y6GB 3T1NA 3S8MA 3AL2A 4OK3A 3TQIA 3WLQA 2VSFA 2GZSA 5AVUA 1ORRA 1USWA 2FLVA 3D5EA 2DR2A 1ULTA 3QYFA 4V1CI 1RXYA 4ECAA 3R4VA 4IGKA 4RNCA 1ZINA 1J07A 1E5XA 1TD9A 1ECBA 1W1UA 1C7ZA 1UM9B 2E85A 2YMQA 4GHWA 4NK4A 1O6ZA 3SSNA 2ZTHA 3WYDA 4B3BA 1T8SA 2QYTA 2JK1A 2J0VA 3LKVA 1UDRA 1C8LA 1XD2A 2X76A 5CDHA 4Z4IA 5P21A 4AUKA 4HLUC 3DL4A 4B46A 4F4FA 3INTA 2FB9A 1U4SA 2KB0A 2AHRA 2RDMA 3QNUA 2AF4C 5CK5A 5JPIA 3S1SA 4HSEA 3RJ9A 4Q4JB 2H9YA 4NS1A 3O92A 2GPWA 2G28A 4Y30A 5G3ZA 1Y1KE 5E2AA 2O8NA 2BGKA 2BI4A 1IDOA 3Q41A 5JAUA 1I32A 1MV8A 2DQ4A 1GYRA 3KLNA 4QDUA 5KOHB 5EN4A 1EAYA 2IIBA 3WKAA 1S8FA 3AKEA 1XFDA 2WWRA 4QSMA 4XWAA 4PINA 5TGZA 3OOYA 1CT9A 3TSAA 3BEDA 2BM0A 5EJEA 5LXTB 3SYNA 4GXRA 5IW8A 3ZWMA 4E14A 3W06A 4BV9A 1L4NA 1I80A 4IH1A 3QKTA 4HRAA 5CT9A 4TM7A 2HXYA 2HB6A 1SA0A 2P7HA 2LD4A 1LNZA 1BCSA 4QUEA 1NUPA 1G20A 4XCVA 1DFIA 2IPNA 3D3EA 3OD5A 5FKJA 1XJ5A 1YZYA 1RJFA 4X8MA 2VRWA 1LPOA 3C5WP 4FI3F 1K6MA 4Q3LA 2FEWB 5DHTA 4OAQA 4CDMA 2BGUA 3UWMA 4ZXFA 2WIAA 2DQYA 2FK7A 5EQDA 4EAAA 1U4NA 1ULHA 5FWXB 1SVSA 1R4NB 1YS2X 2I8CA 3VX4A 3X43A 2XCTB 3TKLA 5L6LB 4W82A 3B52X 4FYYA 1ZD2P 2IYVA 1SNYA 4UUAA 1BXZA 3CSSA 2AJLI 1P9LA 4DT1B 3M5PA 1YJCA 4UUPA 4X6YA 1AH2A 4JLDA 4H3VA 3FFWA 2HMUA 1Z6AA 2D5LA 2PCLA 1C9EA 2XNDD 1Z4LA 2E4UA 1NVKA 1BEEA 3LUKA 3Q3IA 2GWRA 4WBNF 4BP8A 1R2QA 1YIAA 2WF9A 2ZAGA 1J97A 2FEOA 1KP9A 4K3UA 2FE1A 3OO1A 1IIBA 2GI4A 2NU7B 1T5DX 1LBTA 3FNEA 5JDIA 2AZ4A 3N8NA 1JKFA 4FLFA 3B38A 2PXCA 3UJAA 3U16A 1OU0A 4RSRA 2QAJA 1VGRA 3WSTA 3GP5A 4MI1A 1YVEI 1O9GA 4L75A 1AUVA 2FN9A 4RPKA 1QMPA 1FC0A 1IG3A 4Z1MD 5K6RA 3IAAA 1GKYA 3QXCA 1YDMA 1ATZA 3R2JA 5FOSA 2ET6A 2MYTA 5HKLA 2HWXA 4F56A 1MTOA 2D62A 1Z5ZA 5UKDA 1XQ9A 3WMEA 1ETUA 4AJEA 5LLDA 2QDXA 4HK4A 4K9KA 3OEYA 4UDOA 3DZFA 3SPXA 2ASVA 2B8JA 2ZBVA 4M8IA 4O4LF 4O8ZA 4S12A 4DWWA 1P0MA 3HP4A 2V7XA 1Y48E 3HG7A 1YQUA 4C2AA 3SD7A 4BB9A 2CLLB 2NU8B 3E9CA 4HAOA 2XMRA 4TUYB 4RTKA 2IS1A 2FPGB 1ZSYA 1HPLA 3IPCA 1WMBA 3CWCA 4FN5A 4GLJA 2ZBUA 4CMCA 5IAOA 4GMXA 1YK0A 4X61A 4R0MA 2RONA 3CTPA 4MUJA 1ZGBA 1W52X 2CK3D 1BGVA 3C3AA 1WUTA 4ARCA 5H0IA 3ZS8A 5BWCA 1IK6A 4LHZA 3TDMA 1Q0ZA 1SBYA 1TJ3A 2AQIA 1SD5A 2ZUSA 4HXFB 1P7YA 5CX4A 2OGWA 2O2IA 1FMCA 2WYOA 3PQ6A 5JCJA 3WKEA 4R9SA 3RSFA 1DC8A 4YRSA 4GSLA 5LU9A 4R1QA 2FVYA 4I1VA 4JFRA 3WHLA 4C0XA 1PDWA 3E82A 1FYDA 3KSBC 4BE4A 1E9DA 1T6BY 3BK1A 3VKGA 4TQGA 1YQGA 2HQBA 3UJ8A 3GRUA 1D4OA 4Y2JA 5HS6A 4BVLA 4CV0A 4G3XA 3BTVA 3O3NB 4C07A 3PQ3A 5EVJA 3MWJA 4RE5A 5IVIA 3G8DA 3OEHA 1FMLA 1HSZA 4FGSA 4HV4A 1BWPA 1MA0A 1O54A 4JJAA 4UD6A 2JBAB 2DHQA 1XTBA 1AXGA 1ZHFA 3BBLA 3CMMA 1IVNA 2FPPA 1CD5A 3NBQA 4X91A 5G0TA 1WZEA 3DCYA 5KX5F 1W36B 4Y7DA 4DV4B 1D9ZA 1ZSNA 3CZ4A 4KGZA 2PV0A 4XGIA 4GSKA 3ZJ5A 1L5QA 4IFEA 2BEUB 4KRXA 2NMVA 4PG6A 4WJKB 2P4SA 4ZU1X 1U7XA 3R3ZA 3UW3A 4AMZA 1Y8QA 3RJZA 4JQOA 3VR6D 4EGSA 4GPZA 1RRPA 1A8SA 1RYEA 4UVIA 5JAZA 2RGYA 3QUQA 4ZRMA 5JY1A 4B3MB 2HF8A 3I04A 3BGSA 1QFMA 2VHQA 3D7NA 4XM1A 1GADO 2VYQA 3GNQA 4MVJF 1MLDA 1KE1A 2NACA 1P18A 1U3WA 4FYKA 4RENA 5FPYA 5KJCA 5K0BA 4QJ5A 5DULA 4WZBE 2O2YA 2WSIA 4RANA 2QLJA 3RDPA 2ATIA 4CMBA 3HZHA 4RACA 2GEVA 3BF7A 2C98A 4QBGB 5GGXA 4ZZ0A 2G9UA 1IZZA 1X7WA 3OJCA 5EP3A 1WXHA 5CDTA 3V1YA 1BMFA 5E38A 1T0UA 3X44A 3V4SA 3KL4A 4GZ3A 3O8DA 4DVGA 4U9HS 4BQFA 2RB4A 4YJGB 1N33B 4KUHA 2C99A 2HU5A 3NWBA 5JWOA 2QENA 4U2CA 2I78A 1A9XB 1JG7A 3PVCA 4XCXA 2PLNA 4QXAA 1R0WA 1X7GA 3PD1A 4GKBA 3F74A 2J9FB 4N49A 2D13A 1GL6A 4Q39A 4YMUA 3T9DA 2LIVA 2EKDA 3R9XA 5EYPA 5LMZA 3NKVA 2PLRA 4K9SA 4G5OA 4R8SA 2GKGA 1NIPA 4N3AA 4CV3A 2XWJI 4XEHA 2XUGA 3L6BA 3CLTC 2IUUA 4X3PA 1VPWA 2AYZA 3BD8A 3JWGA 3CH7A 3GCZA 4P8RA 5NLLA 4CLEA 3HJAA 2JFZA 1ST2A 3H0EA 1T1JA 4Y3UA 4XYMA 2OCXA 2VIIA 3PA6A 3ETHA 3ZGOA 2A0XA 4M9QA 3C1AA 5HQJA 2Q4DA 5FNZA 3ROEA 2YXEA 5LOVF 1S8AA 3DT8A 4I4IA 4BV8A 5L3SA 1JYFA 3EAQA 1CJKC 5I7EA 2CHFA 4L8WB 2QSJA 3OSUA 2FW7A 3DOFA 5HIAA 4CEJA 1OU4A 5EMLA 2AQKA 3IP3A 1ZLXA 2FPXA 4FNAA 4AP5A 1IQ0A 4HPJB 1HMPA 2XZDA 4K46A 4EJ6A 2ZSHA 2JFWA 4RL6A 1QHEA 4B35A 3A1UA 5SY6A 1E5QA 1X8XA 2I3AA 3A9UA 3B8EA 3FCYA 5K0TA 2XB2A 3KJXA 4INJA 1K98A 2V7UA 2ZI4A 3HVJA 3GB9A 1N5LA 2OO3A 4UCFA 3KKMA 2XTZA 3Q7RA 3VOAA 2ID8A 2P1RA 4LSGA 3N2KA 3CS3A 1ABFA 1H2XA 5LYJB 4EJ0A 3AONB 3PDJA 4MQEA 4IQFA 3HEMA 4D9KA 3DULA 2YQZA 3D7KA 4FQ5A 2WAOA 1N6NA 1DO0A 2XMCA 3WGHA 5BSVA 4G0WA 3BFKA 1LPMA 1VKZA 3B3QA 3ICOA 2BHTA 4LW8A 4MCJA 5IAAA 1MDFA 1D09A 4V03A 3OQVA 3PXUA 1AF4A 4JL6A 2HRRA 3GQBB 3BGWA 1A9OA 1C5KA 2VK2A 3DE1X 4MVJD 4EG8A 4D1YA 2UUBB 4KN5A 4J3JA 3SDSA 4WY8A 5DYGA 2YY6A 1XQ1A 3A1NA 3I9OA 4FYPA 4KYVA 1S01A 3CKLA 3MN1A 5SZJA 3IR5A 1XT6A 2JD2A 5ITZB 4XX0A 4CLDA 2PKWA 5HMMA 1WOMA 3TNLA 4XOIA 2BZ0A 4ZEOA 2QLBA 4EW6A 3HCNA 1DTWB 4P2BA 1RD4A 1NWCA 2HTFA 1W8IA 2YJ3A 2BL4A 3NCTA 3W3AH 2DG2A 3FSJX 3U31A 4AF8A 1DGQA 4DQKA 3VH4A 2V9ZA 1TQHA 3KPWA 4S2EA 1QE3A 1TCAA 1UFRA 5A9TA 5JZBA 2YWEA 3A2MA 1KY2A 1M5RA 2B5VA 5T6MA 3K70B 1CB0A 1EZ4A 4MQFA 2B7LA 1IN7A 1UJ6A 1CC1S 2GILA 1ZGAA 2WJHA 4MS4A 4MR8A 5IXSA 4AJOA 4BKOA 1OH7A 2GBPA 3RYHA 4C3VA 4IUBS 4KXMA 5I51A 5HCUA 5FF9A 3HFSA 4JP5A 2H52A 3OP4A 4RABA 2G0AA 2YW9A 2ZAMA 1RLUA 1FUKA 5HOEA 2R84A 3P2IA 3AV3A 4DG5A 4HLUA 1T0IA 4KQXA 1EE1A 2VZ9A 5FTWA 1RBZA 1W49A 2F2TA 1EX9A 2OMEA 4KL8S 4WK6A 4ZVRA 1QQBA 4ND2A 5T7BA 3QX3A 1K08A 4J0QA 2BHLA 4E08A 4E2YA 4PX9A 1U9IC 1SCKA 4HWOA 1EWYA 2GN0A 1PV2A 3B53X 3Q2KA 4G63A 4LV6A 4TVKA 5KNCA 1SKAA 5AM2A 4H18A 3L4BA 1W6RA 4F04A 3F47A 3OQBA 2GBLC 5DNWA 2PZ8A 3IEUA 4UZFA 2OV2A 1HBJA 5L4LA 4AO8A 2X0NA 2AOTB 2WJYA 3DE0X 3LCUA 4BPRA 4E13A 1D0VA 1XK6A 2AR9A 2RC5A 2XJ4A 4L74A 4RO0A 5BUZA 3CXRA 2QD4A 1E9EA 1XU7A 2QZSA 4IDBA 5CG1A 4G5RA 1YZGA 1A88A 3REOA 1DOAA 1ORVA 1LLDA 1GRRA 4PCAA 4J3NA 3RSLA 3ZK7A 4L9RA 4ER7A 1RXWA 4FWBA 5FCDA 3IODA 4UXHA 3SJ7A 1DV1A 3N5KA 1C1XA 2GESA 4G5HA 2EATA 2C7OA 3JQ8B 4KKVA 4IXNA 1U2RA 4LYEA 3TRDA 3PEUA 5DE3A 5JVDF 1XBTA 2WKSA 2B2CA 3GPDG 1JQEA 4D6XA 2FV8A 2VQ6A 3UAGA 3DT9A 1GZUA 3HADA 2R8ZA 2JFBA 4N8DA 4JT9A 4Z1MA 1QRUA 4BBAA 2ZJ5A 5CT5A 3QNWA 1TUBA 1TZ2A 3K09A 1YL6A 2HA4A 1N2ZA 1FVHA 5E7MA 1D5WA 4CMEA 4F6LA 2PO7A 5K6AC 4GOND 3NNSA 1N7HA 5DW0A 1NX6A 1YU9A 2O7VA 3LL7A 3UHFA 4AKTA 3PNVA 3TGWA 2VDJA 3V7YA 3UAOA 4JI2B 5F1KA 2XVAA 2AMFA 4AO7A 3EAFA 3VPCA 1V47A 4FSXA 4RVFA 3G59A 2PEYA 2OENG 3FIJA 3GN1A 1ZISA 3EF0A 3IVRA 3AHIA 2RJNA 1E7QA 4TSFA 5CK4A 3N8HA 4KQIA 3CZMA 2R5NA 3UFBA 4BDSA 2DXIA 1CY7A 4PSDA 1AVTA 2V59A 4BZQA 2ZRKA 4KU4A 2C4KA 2P79A 1WRBA 4DDUA 3TR6A 5D3QA 4I50F 4QE3A 3S81A 1ZUNA 3JZMA 4X54A 5HX7A 4J0HA 1CZUA 1S2IA 2PL3A 2W8ZA 3C8ZA 1Q6YA 1J1IA 3KJQA 5IK2A 4TXMA 1PGQA 1YOVB 4FC6A 3TSYA 3ZY5A 4CGYA 4YRMA 1ZR2A 2V6FA 4EG0A 1YDEA 1AKMA 1SWVA 1Z6YA 3N2NA 2WV7A 1UOOA 4I99A 5EIWA 2IOYA 2ACVA 2DWPA 3LF1A 2H5EA 3N0VA 1DAGA 1KIMA 1JJVA 1VE9A 4CNQA 5JMWA 4OJTA 5KEIA 3GQVA 1I4LD 3HNPA 1M2HA 1K5PA 3P96A 1W47A 4R31A 4C22A 4NWIA 3KPUA 4B9AA 4EPXA 3KQVA 3OIUA 1X7HA 4I1OA 3STUA 3O8BA 4TRJA 3O3CA 1JBQA 2EG5A 4ZQHA 3STXA 4PFJA 1EVQA 2VK4A 1LBIA 3H42B 3BHNA 3L1JA 3ZE1B 1XP5A 3MT0A 4DRXA 1SVUA 1EH5A 1NI4B 4HRVA 1F2TB 3VDNB 1LLUA 1G5PA 4RZ3A 1V11A 3IP6A 5HOQA 3MT7A 1RAEA 3MUFA 2RHCA 3DLHA 4LXHA 2QMYA 1HMYA 1FP6A 4WBNB 3JQGA 4DRXB 1M9NA 5E6SA 1W4BA 1C0LA 3K53A 3IO3A 4LX0A 1FQOA 4TKLA 1JN0A 3TJRA 3WWYA 5EMHA 3RVSA 4GFDA 1QAOA 3IKVA 4FYXA 3IR7A 4IV8A 3U44B 3AM3A 3RC3A 4ER0A 5FH9A 3LUPA 4AG3A 3LPDA 3RSSA 3ND9A 3VYVA 3N2GA 4DBLC 1W88A 2H1LA 3KHTA 5GOZA 2Q1YA 4RETA 3RNOA 5DHPA 1SJ9A 3RVQA 2WF6A 5C8XA 2SNIE 3NEAA 1AGRA 2YIJA 5G0VA 3WL5A 7ABPA 1FPMA 5C9ZA 1UADA 1XN4A 4QU8A 1C2YA 1R6XA 4TMYA 5CEEA 3OT1B 2XTNA 3W8NA 5K3EA 3ZVNA 2QN1A 5D7BA 4D3ZA 1V1MB 2FPLA 1WTCA 5JO9A 3B48A 4XUEA 2IV7A 4BB0A 2A9JA 4GAEA 1ZHHA 4GL2A 2GKOA 3JRWA 4S04A 4XWTA 3TTYA 5JCJD 1GGEA 3ZWBA 1M8FA 2PQ2A 1GZ3A 3RTAA 4WJLA 1EXDA 4CIBA 1J9ZA 4FW8A 3IBCA 1WJGA 1CSEE 3EB9A 3PYMA 3TZBA 4E1BA 1ZDMA 2GJKA 4QT4A 4Q4LA 3GRRA 1GCUA 2AVDA 3KALA 1YRWA 5I5GA 5K3CA 1FLNA 3W6PA 4AYTA 2JLVA 1BW9B 1X8KA 3W7VA 1RQGA 1FUUA 2VYVA 1NC3A 4U2KA 5FNVF 5B3JA 1XZ8A 5FTMA 3TRJA 2BONA 4Z0PA 4AMBA 3CX4A 2IBMA 1VJ5A 2VZLA 1Y4DE 4P0QB 3VUEA 4Y2YA 2HF2A 1IYZA 1MVLA 3ESXA 1UMCB 1GL3A 3ZDRA 4CQNA 4YP1A 1UC5B 2P9GA 2O52A 1TVCA 2VAXA 3VHRA 2QPTA 2VPWA 2GMWA 3JQ8A 3D8RA 3CPSA 3ZWCA 3RIMA 4M9XA 5CVEA 2ZAYA 3AHJA 1DEHA 1T6XA 3NALA 1FMJA 4P7FA 3TEMA 3D4NA 2DUNA 4K9RA 4ZU6X 4HEA6 2HEGA 3GLFB 5ELLA 4OX9Y 1YVDA 4HQKA 4XDHA 1V1RB 1XHLA 3GMDA 5SZIA 3O8RA 1JG4A 1AKVA 1AB5A 3WHPA 2DLCX 1B8PA 3FLAA 3PSHA 1UK6A 3BDVA 4RLHA 4AS1A 1JFLA 1OX6A 1R0CA 1EGMB 3BB4A 3CIOA 1GQFA 4ED9A 5D5HA 1UDWA 3AX6A 4YRJA 1U9CA 2XMQA 2YYZA 4XI9A 2W43A 3OZDA 4LGMA 2X13A 2GBLA 3NBMA 1IY2A 1GUDA 1J0CA 3M6FA 2VHXA 4MV6A 4A2WA 5IKMA 1T25A 4XB6B 5KQLA 1LS1A 4HP8A 4DV3B 2A1TR 3K73O 2ADMA 3ICEA 1VL5A 3RSGA 3U4CA 2ASEA 2XA9A 3SP1A 1N0HA 4W5OA 4I1UA 4R1SA 1KQFA 3SIWA 1KJZA 2C2YA 2W2OA 1B1AA 1Y1SA 3EZNA 1KH2A 1DI0A 1XJ0A 4DA4A 4XW2A 1ZX1A 1ODJA 1PJZA 1SK9A 3PI7A 3TM4A 3DD5A 3V4RA 2ZUDA 2OPHA 1PZHA 1VA5A 2MOKA 1WP9A 2RI0A 5EIFA 4BE9A 1P1RA 4QBTA 3AVXA 4RMHA 3QI2A 1L4UA 1SVKA 2HIMA 3W9SA 2NZWA 3IGFA 3H87A 4PXAA 1B73A 4E33A 1QK3A 1CNEA 4HKTA 4JEMA 3E4CA 1M6EX 1YVRA 3PEVA 3PUWA 3HA3A 1RCFA 4L50A 4QHYA 5A4FS 1SD1A 1ZK1A 2WRZA 2ZS7A 4RK1A 5FBWB 1FFCA 4CMEC 3T7SA 3NVKI 3LNTA 5H8WA 3FHLA 4BVFA 5FWXA 1S1CA 5A4MS 1TW2A 1T5SA 3FSRA 1CUIA 4UCXA 1QE5A 2Q9CA 1FLDA 4XDGA 4K81B 1L1RA 3CSDA 1E9VA 1LJLA 3KYDB 5ITZA 4MW5A 5A4AA 2W83A 1FLAA 4L28A 1VDZA 4MI6A 3LKZA 2WAAA 4L8GA 3FA2A 2YFQA 3G2HA 2YZ7A 5AJVB 4CU2A 4M7PA 2I99A 1VJDA 3KQQA 4J4BA 1ZD4A 1M2WA 3B6JA 4IMIB 5JQGB 1UAYA 3D02A 2AHOA 1N0VC 3JASB 4FC7A 5JHGB 1PWYE 4QASA 3CH5A 3K5WA 4Y0AA 4E5PA 1M1XB 2O2JA 2KMLA 4KUGA 4EABA 3K15A 5DH9A 3KB6A 3C6XA 3WFJA 3UXEA 2AC7A 1P77A 1Y9JA 3FAKA 3SJZA 3F6BX 3HDGA 1ACLA 2GDJA 2J0EA 4I8XA 4Q7JB 1KYQA 2VO1A 3WZ2A 4KN9S 3SHVA 5M7EA 3G5AA 2JGLA 4RY2A 4ZHQF 2JFGA 1EB9A 3NVDA 1YS1X 4QLBA 5CXQA 1Q1NA 3V2IA 1JVSA 4EITA 3JQAB 4YRKA 3UPUA 4I9FA 3GP3A 5JYBA 1W4LA 2DHDA 3D6NB 3G5TA 3RU2A 1JBKA 3DMYA 3T5DA 5BW4A 1JHUA 4FFPA 3LTEA 5LIPA 2CL6X 4YP0A 4ZT5A 4D74A 2D5CA 3BXGA 4ZQBA 5HRUA 3JYHA 3UK1A 1NW8A 1C41A 2IEBA 5HIIA 1UM9A 1U3VA 3OBIA 3GO4A 3P9IA 2ZJFA 3PUKA 4EW2A 1E8NA 4MUIA 1NN0A 1U2ZA 4EPRA 1W87A 1IHOA 3A3OA 1OKKD 1Z6ZA 1DIBA 2ZWAA 3NHFA 5DM1A 4GI5A 4X20B 4ACBA 1ZUHA 5JAIA 1P5FA 4Q4HA 5AJZA 1N5OX 1TZMA 1UP7A 1ZVJA 2WJAA 4RV5A 5G3YA 5AXBA 2PEZA 1M1YA 4OQMA 4UEKA 4M37A 3OHSX 1OIXA 4CETA 1YFZA 1NFQA 3CLUD 5EP2A 3MINB 5F35A 5LNK1 3FIUA 4BBJA 4DIFA 3TWOA 2Z6UA 3G0GA 4DXHA 4OJKA 3CVWA 4I8DA 3GCXA 2BH9A 2MSEB 4MJXA 4UCQA 4LXUA 4CT0A 4NG4A 2XMDA 4ZYUA 4W7IA 2QM7A 4YRTA 1ZONA 2AXQA 1KQPA 1ZK2A 3LQFA 3FMGA 1GGVA 3JD2A 2PWPA 5LLSA 5EPOA 2FR0A 3KZNA 1G19A 2AE2A 4OKIA 3S2FA 5KB3A 3P5SA 4A15A 3AR6A 5KPDA 2RGBA 4WNYA 5ICCA 1JDVA 2JFFA 1BQ4A 2WUEA 3ABIA 5EFOA 3A6HA 1V8BA 3TVYA 1LDYA 3N7AA 2V5AA 2Y0BA 5J2UB 1OGYA 5CLJA 3ZD6A 1QWOA 1N9KA 2EKLA 3PS9A 1R0SA 4GKJB 4Y1FA 4NAHA 1ISJA 5FHRA 1PSDA 3S2UA 4RGBA 1JSXA 3QYAA 3TXYA 4PLHA 4OUDB 4H6VA 3S55A 3D7RA 3E03A 3ZGLA 1DAHA 1KI6A 4CTJA 2HWWA 4DZTA 4E09A 1UQUA 1Z68A 5HR5A 4D8UA 4UU1A 4JQYA 1U28A 2GK6A 1JFFB 2IGBA 2W11A 3R5TA 1R9GA 3TOSA 3TIFA 1N5MA 1TCBA 3GEHA 3GLIE 1CUGA 1QG0A 3VM6A 1PLJA 4LQCA 4M0MA 3OTIA 5DU2A 1VHDA 2HQ1A 1S2DA 3W6NA 4CN8A 1NDQA 5BV8A 2WLSA 5AKYA 1GCOA 2WVHA 2JEYA 4BRWA 2C5HA 3UATA 4PYOA 3ZXIA 2V7QA 3D5QA 3NAMA 1ICEA 2CCKA 3T1HB 1WF6A 2ZIEA 3E8XA 3K8ZA 5FOWA 4AU1A 5T8KA 4HVLA 3IHKA 5CGZA 4FDUA 1CFZA 2P9ZA 2R8EA 3G9UA 2X8JB 1N2CE 3HY4A 1KTIA 3H2JA 3IE2A 5IWCA 1JYSA 3FF4A 1ZM3A 4HFRA 3OPQA 1TRKA 2BM1A 3CB4A 3Q72A 4PGAA 4QAJA 4U7FA 5F23A 5LMCA 1QZZA 2B6NA 5A9RA 1GY8A 4KFRA 3AUKA 1A7AA 5C51B 1QRSA 4CIYA 3N2LA 2IS6A 5LQKA 4RULA 3ORFA 1XTQA 1VCIA 4GGMX 2C3PA 1QONA 1EM8B 1J8FA 2R79A 3ESZA 5SV2A 1SELA 4IMRA 3U3XA 5CA1F 1P1BA 1YQXA 3N1UA 4LF8B 2PSEA 3IBFA 3IDFA 2GPBA 5JYDA 3ZNPA 4FE7A 4HEHA 2QRVB 1K7YA 2RARA 4RF5A 4GMDA 3NANA 3WV5A 5GY7A 2GT1A 3FRHA 5EJ5A 4GX1A 2QYHA 3AIMA 1UMDB 5FEUA 3NNNA 2INGX 2IP4A 3LY7A 1ECFA 4N4AA 3P71T 4QL3A 5I7RA 3BMNB 3DEJA 3L0YA 4MRAA 1LW7A 1Y7IA 2VJOA 4JEHA 3GPIA 5JD3A 2J85A 3I76A 4KQ1A 4NZPA 4DEVA 1SXIA 5D6NA 3I0MA 4N76A 3QXGA 5LQCA 3KFLA 2ZIXB 3RFCA 4C4YA 2QLFA 3IVMA 3K0AB 1OXMA 3AESB 2GN4A 3HCDA 3NI2A 3VYSB 3VNSA 3QU2A 4OFXA 3O2JA 4TWIA 5HIJA 1PFKA 1YJ8A 1D3AA 2E55A 3STYA 4NDAA 4CQMD 2C3OA 4EJFA 3ORSA 4OAOA 2C4VA 4MYTA 2IOFA 4II3A 1UT8A 2HV8A 3PDHA 4PN3A 5DEIA 4HFMA 3F6EX 4GI1A 3IAUA 2JA2A 3QE4A 4Q9LA 2R11A 4REOA 3D4PA 3ZCQA 2WU1A 1E2UA 2VDLB 3W1EA 1GQYA 3M82A 2ZRAA 2ZWIA 1D2RA 1OWPA 2J3KA 1NSYA 3N8KA 4XOUA 2VXBA 1Q0PA 4GIBA 3CKKA 3LP8A 3KVYA 1O94C 1YRYE 2RHJA 4ISBA 4MGZR 2C97A 4IX9A 1D6MA 2FOLA 2HRQA 4NV3A 3W9BA 1Z56C 2ZRLA 5KJFA 3IEPA 3B5EA 4OXKA 4I50A 2DEUA 2Q62A 4FYVA 1BW9A 2VLBA 4J07A 3HXQA 2I9KA 3T1VA 4DJAA 2NADA 2ZZNA 2ZJAA 2YASA 1OH6A 2OQIA 3IVAA 1QJCA 1ITZA 5KU7A 2PX5A 1UBNA 4NC9A 3KTAB 2A5JA 1QK4A 4IDCA 3K6SB 3BH6A 3CU5A 4L2IA 1MX1A 2HHHB 3V7WA 2Z4TA 1YB6A 1F60A 2C9CA 1P8JA 1DKPA 4DXAA 1ZOPA 1H3EA 3DZHA 2QXTA 4MJLA 3VNAA 4KPGA 1JXMA 1OFVA 1P9NA 5DYYA 1IHXA 3E3NA 4M1WA 2X9QA 2YWBA 3N2EA 3OZIA 2CLFB 1DC5A 5ANRB 2OO5A 3CSUA 4INZA 4MYSA 1OH5A 5GONA 1JR3E 1SD2A 4LHSA 2J0SA 5ICGA 5ITVA 1U8XX 3EWAA 2IYSA 3DSRA 3HJRA 3L49A 4OSOA 4TTSA 5GVRA 4MAAA 2I1WA 1E2FA 2OHOA 3LP5A 1BMDA 3RANA 1VE1A 4WCFB 1XLTA 4GRDA 3IQZA 4K9NA 3TW8A 4WCFC 1IJEA 3BCRA 2BUCA 3I2YX 1JQBA 2V6IA 2B9EA 2F17A 4L76A 4RJLA 1B6TA 4B75A 3U44A 4GR9A 5LZ8A 3E8MA 1FYVA 2UYQA 3I1JA 3P0HA 5A6SB 3BM5A 3KP1A 1C7EA 4F1JA 5KTNA 3NEJA 3H2BA 2YFHA 4F5ZA 1NF2A 3LZDA 3Q3EA 4WZAA 4BRZA 5HILA 1KSFX 4KV7A 5E7IA 3U3JA 3JQGB 2C5AA 2DCMA 1HZZC 3BREA 4KE9A 3FPGA 3K3PA 4L4RA 3QE9Y 2ODPA 3AWIA 2QI9C 2BOVA 3BK2A 3VPFA 1NI3A 5FFFA 1Y8AA 4AG5A 3TSOA 1REQB 2RIRA 1BJKA 2PPVA 1YNSA 3OLCX 4JVNA 2BMEA 3UA3A 3ZK8A 4D8VA 1ID8A 1SVIA 5DX0A 1K7XB 5KYKA 3S99A 3EDOA 3HZOA 1JHDA 2NG1A 3IURA 4MQLA 1AMOA 3L0SA 4ZMSA 1RE0A 1Z07A 3RTDA 1LEHA 1WXDA 3A25A 3FNIA 3NB0A 4TQAA 3R0IA 4HBZA 1GSHA 3GGJA 1P3Y1 2BUAA 1YU6A 3DB1A 3QWHA 3WTBA 3EXEA 1PP4A 2R5WA 4UM5A 5LYJA 3L7JA 3OOSA 3P8ZA 1VQ1A 3IMEA 5CH3A 4QUIA 4ZD6A 5AI6A 5TQVA 3GA0A 3WLOA 3LDAA 2WIGA 3UZUA 1NT4A 4O4IF 2HGSA 1X3LA 3LD9A 2FMXA 1GLNA 1PZEA 3DV0B 4LRUA 5FR1A 1FSGA 2ZOSA 4AJ2A 2VA8A 4R1NA 5JV5A 3EH2A 2J3JA 2FMKA 2AXNA 3QU7A 4H0FA 3RG2A 1YOVA 2PBRA 2WJVA 3E3LA 5JD6A 1S2GA 1GTZA 1PZGA 1SPBS 2JAHA 3LLUA 2YHAA 1MV5A 3PNYA 4FMPA 4NPAA 5K6TA 2J0UA 2QX6A 3DUFB 3UJNA 3E58A 3NEPX 2CLEB 1J2RA 4BMXA 1TGYA 4MWZA 1EQ2A 4JYZA 1UBEA 1GG8A 5AH0A 4ZEWA 3RG8A 1NV8A 3ETGA 3DVAA 5JEEA 1XDWA 4BGUA 3JAMA 1A95A 3RT7A 4GNKA 5BNWA 2E49A 1IRXA 2XF8A 5BOVA 1U0JA 5JSZB 2E37A 4D0LB 3PDCA 1HT2E 4RKFA 1V43A 4W1SA 4ZCLA 4OO3A 1UINA 1VP3A 4FVTA 3SBDA 1X1QA 3K5HA 3K9FC 3L05A 2H2WA 3HUEA 2Q1UA 5FUWA 3WOHA 4PZLA 2BLLA 4FPXA 5IAGA 4DABA 3EWNA 4EFLA 2PRYA 2RHRA 4B43A 4LHWA 1WVIA 2PT9A 3KZOA 1OT5A 1T9KA 1NW4A 2XDYA 3CH6A 2CXHA 2I6UA 2DY0A 2BJWA 3QLVA 5I7WA 1HE8B 3BIFA 4IVPA 3MRXA 1LRJA 5L3ZA 4BB6A 2UXBB 5HK8A 2PYZA 2PUEA 2GX6A 3MS4A 2H07A 3LRTA 1IN6A 1WZ2A 1ZRHA 4RVSA 5HGXA 2BGIA 4RFSA 2P4QA 4US2R 1AUOA 4HQNA 3GZTB 1V5IA 5EKSA 3S6JA 2O8DA 1U11A 4BO0A 5C8DA 2Q2OA 2FETA 3SF8A 3A36A 4LNHA 3OZRA 1COZA 1GA4A 2O3RA 1CJUC 3TIIA 1GCIA 3TW6A 3OLZA 2XDQA 3PGA1 5TX7A 4M1ZA 1E20A 2R2GA 5C3UA 2ABWA 2HQOA 3O8NA 3GGPA 1E3JA 2VNHA 1YRAA 2B6HA 5EXPA 2IXGA 3QPVA 4BBPA 3OI7A 3L7NA 4MKHA 4XPIA 4HGNA 1XR3A 3CVOA 3SYRA 4LEIA 3U2QA 1BE8A 2ZW9A 5JHHB 1IM2A 3OQNA 2O8BA 3P0EA 3IOBA 3L0IB 3AZOA 3LDUA 4G8JA 3PFBA 1V5GA 3B2NA 4Q3CA 1YXMA 2VEOA 2P90A 2Z98A 2PMKA 1J2YA 1A76A 1DV2A 3P9CA 1KMHA 1TKRA 5DDIP 5JAOA 4L3WA 2DWOA 5E0OA 2OBNA 3VAAA 2GH1A 5CGQB 3IHLA 4B3IA 4C4OA 4ZCMA 1Y34E 5HQ3A 4B3JA 4EA9A 1SUEA 4B6FA 1X1TA 3DDNA 2EFDB 1BEZA 5HCIA 4LYAA 1ISPA 2R6ZA 4F4DA 1W4CA