5JLAA

Crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
257
Chain Sequence
ASAEFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRVARATGGKTLVLDVGEDASVTAAANEVRARYGVADVLVNCAGVLQRTLPPGELAQREWDVVSRIDLRGTYLCCAAFGAPMADRRRGSIVNIASVAGMRSGPLHAYGPAKAGVISLTETLAGEWGPKGVRVNCVSPGFTQTPALERGFTTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPVDAGYLIAGSWAAYGGLRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of putative short-chain dehdrogenase/reductase from Burkholderia xenovorans LB400 bound to NAD
rcsb
source organism Burkholderia xenovorans (strain lb400)
molecule tags Isomerase
molecule keywords Putative short-chain dehydrogenase/reductase
total genus 94
structure length 257
sequence length 259
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5jlaA00
3PIIA 4UUMA 3D4OA 4D7AA 3TZKA 3ZNPA 1LSOA 4MOWA 5ILOA 4O59O 4E4YA 1QYVA 1ML3A 3LT1A 2IEBA 1PZEA 4PLTA 1ZXLA 3VPHA 4E6PA 4W82A 2NWQA 2VZ9A 2E6UX 1R0LA 4KWIA 2BGLA 4L8VA 3ROPA 5JCJD 1OI7A 4BMSA 4LGVA 1SB8A 3WSVA 2HMVA 4Q3CA 1JVSA 1BVUA 4IDBA 4JBIA 2D4AA 1C3VA 4BO7A 4CMBA 4IQGA 1BW9B 2O3UA 4H16A 1SEPA 1QYXA 2NU9A 4PLZA 1GTMA 3RC2A 4D79A 1K0UA 3PQFA 4CJXA 3F9IA 4D45A 2VWQA 2NLOA 5IDXA 2Y1GA 5A9TA 2AE1A 3KZVA 1AN9A 3O38A 3F4LA 4GQAA 1PIWA 4B3HA 3QWAA 2Y0CA 3RQSA 1U5AA 1ISMA 7MDHA 4N5NA 5I8ZA 3FPCA 3ZNOA 2BGKA 3UCXA 2C0CA 5C7LO 1IULA 4PZDA 2YV1A 5B1YA 1LQUA 1DHRA 1B26A 1YBVA 3INTA 1ONOA 3OQBA 2D3TA 3ZGYA 3LT2A 2YHIA 1DFHA 4R9RA 3VH2A 2FHSA 1ID1A 4CM3A 4DLLA 1QSGA 4QSMA 3KYCB 1V35A 1DEHA 2A35A 1K6XA 2Y1FA 4RORA 1GQYA 3HFSA 1PL7A 3IC5A 4TRNA 2ZK7A 5CDYA 1MX3A 3WXBA 4J4HA 4E13A 3BTUA 1R15A 3OQ1A 2CDAA 5TSDA 5U9CA 1D7OA 3O9ZA 1VRWA 4WUVA 3I9JA 1TT5A 4E30A 3V5NA 3MCVA 1PJQA 3WSWA 4DXHA 3FN4A 4I9HA 1TEHA 4D43A 4DLBA 1T4BA 3ULKA 1C0PA 3CE6A 5L95A 4UVGA 3N7UA 4RZIA 1UAGA 3FI9A 4Z3KA 4ROSA 4ZHSA 1D1SA 1KBZA 2A92A 2NADA 5JDCC 4EJMA 1IUKA 4ILKA 5JDCA 1P45A 4UUPA 4CR6A 2DTXA 4IZHA 5ADHA 2W2KB 4EITA 5CDUA 1J6UA 1JW9B 2YHUA 3ABIA 1O6ZA 2ZTMA 4CMJA 2RCYA 5F5LA 5U1PA 5L45A 4DREA 4RVUA 5FI3A 1YVEI 4XX0A 2DQ4A 3H9GA 3TF5A 4FJ0A 1YOVA 2D59A 3QY9A 1RM4A 4BNIA 1DFGA 3JD3A 3CZMA 4CM4B 1ZMOA 1T4DA 1KY5A 2GN9A 5T8KA 5DULA 4MVJE 1VKOA 4R16A 3C1AA 3GVIA 1PJ2A 2GZ3A 3I9MA 3H65A 3ZWVA 1GPDG 2Q50A 4BNFA 4YAGA 4FGSA 1WW8A 1Q2XA 4IM7A 4GX5A 2HJSA 5JYEA 2J8ZA 3MWEB 3S1LA 1ZK1A 3V2UA 3DBRB 3FCOA 4QX6A 3MOGA 4NI5A 3OA0A 3O4RA 3LC1O 2F1KA 3NV9A 4E5PA 3QVTA 3UCEA 1U8XX 2ZB7A 4D0RA 1LRJA 4AJPA 2JCVA 3WNVA 3AY6A 3RI3A 5DOVA 2VOEA 3DZJA 4YAKA 1LA2A 3ANMA 5JAZA 2XPCA 3GC6A 1MG0A 1WPQA 2EKLA 2HU2A 3VKUA 4BNUA 1C1DB 4D42A 2UUPA 2LDXA 3D4NA 4MJLA 3CEAA 3BIOA 3JQ7B 4R9SA 3ZW8A 3DAPA 4BMNA 1YGYA 4NR0A 3PPIA 1I8TA 2X0NA 4RF3A 1N2SA 5AYVA 3C7AA 3BMOB 4PG7A 5IN5A 1AGNA 3PYXA 1VM6A 1IB6A 4YT5A 1Q0QA 3GEGA 1OBFO 3G0OA 1H93A 4UUNA 4HY3A 5IDYA 4YA6A 1SNYA 2DFVA 3GMSA 4XYEA 4YJHA 3EMKA 4D0SA 3WWZA 2X58A 4EJ0A 4AJEA 3H9UA 1F14A 1I36A 3F1KA 4B7CA 4WASA 5JFOA 3PHIA 2GD1O 4NK5A 5IFLA 2HAEA 2IODA 3QW2A 4OKIA 3WFIA 4CV3A 4DQVA 2EWMA 4WGGA 4NBVA 2V6GA 2QZ9A 1FDTA 3BYZA 2HK7A 4EUHA 5C37A 3AY3A 4MIEA 5B37A 4I5EA 4E2WA 4B4VA 4CMKA 2XAAA 5G4KB 1LDEA 4XQEA 3FHLA 1DFIA 5A04A 1GUFA 3QVWA 4AL4A 1WVGA 1KYQA 4LSMA 2O50A 3VDQA 1FXSA 2Y0EA 1O5IA 2HUNA 2VYVD 3OM9A 1R12A 4MKXA 3C85A 3GVCA 3NAQA 2BKAA 5HRUA 3WLFA 1ZJZA 1WMBA 3RKRA 3RU9A 1SC6A 4HFRA 3NDJA 1G0NA 3I23A 4ZQHA 3JQFC 3VH3A 4I5FA 3K5PA 4XJSA 3CXRA 3D1LA 4L73A 3UH1A 5DZSA 4XRRA 3CMMA 3OA2A 1P31A 4RJTA 3NGLA 3JQAA 3KM0A 3QP9A 1A9YA 5TRTA 3WNQA 5A06A 3ON5A 4XGKA 1ZSYA 2EW2A 1NVGA 4G5HA 4AJNA 2G0TA 1ZFNA 1EVIA 1H6AA 1BDBA 2NVBA 4PLFA 1K3TA 3CUKA 3L6EA 1U2GA 1BWSA 2VZ0A 4BO5A 1B3RA 1UP7A 1PSDA 3I9KA 4GX2A 1I01A 1W0CA 4K1LA 3PLNA 4HFNA 2X6TA 1YJ8A 1N92A 3FNFA 3GVXA 4MP3A 1T26A 4I08A 1CQIA 3FBTA 3S55A 3WGQA 2PKRA 1DBVO 4IIVA 4XQ9A 2UVDA 2BH9A 4LRTB 2B4QA 4XR9A 4CL3A 1FK8A 3X2FA 2DLDA 2NACA 4ZQGA 3D3WB 3H2ZA 1RKXA 4PG4A 1WZEA 4DBVO 1YQGA 3I9LA 3ITKA 3DBLA 4NG5A 3OF2A 3ZWCA 4L4RA 4W7HA 2G82A 3LLSA 5TGDA 4BGVA 3GY0A 4BB6A 3E9QA 3QA9A 1LNQA 3DTYA 1UJMA 4Z0HO 4AG3A 1DC5A 2VWGA 2VHZA 1SOWA 2IE0A 1PGJA 4BNYA 1GAEO 4YJFB 3BMCA 3RIHA 1X13A 2CMDA 2WDZA 4DPMA 1TB4A 4MVJM 3KOUA 3P7MA 2PH3A 1DRVA 1O0SA 1CF2O 1V3TA 3AW9A 2XOXA 4ND3A 5JNLA 2B37A 4J3FA 2GN8A 3WLEA 3Q6IA 4PIVA 2OMEA 4WCFC 3PJDA 4K6FA 1Y5MA 5B4UA 2P91A 4TKLA 4IGFA 4QXMA 3RJ9A 2O4UX 3ETEA 1LX6A 2YV3A 4PVDA 4YWJA 1NPYA 3H6KA 5COAA 2DKNA 1GL3A 1ARZA 4QQRA 4XQGA 1HRDA 3KLPX 3WGIA 2VYND 4HFMA 5JLAA 3ZV3A 1CRWG 3EZLA 3IMFA 4R1UA 3VVBA 3ZU4A 4DMMA 4PN3A 2Q99A 3DO5A 4YCAA 1PGOA 5TJ9A 4BNXA 1YBMA 1B8UA 1U3UA 3AUTA 4C7JA 5TT0A 3WTBA 3TDKA 1M2WA 1DIBA 1OC2A 4D44A 2R00C 4IMPA 4RCVA 2AMFA 3DBLB 1KOLA 4YQZA 1H2BA 2Q2VA 4DL9A 4QTZA 3ZHYA 3JYLA 1N9GB 5BQFA 1N8KA 1WDMA 1KERA 3D3WA 2WSBA 4R54A 3WJ7A 3ZHBA 1U28A 1UXHA 2ZB8A 1LLUA 1ENOA 1XQ1A 4FC7A 3TL2A 3JQAD 1WP4A 2GO1A 4IXWA 2AG5A 3TRIA 3DHNA 3B6ZA 2HMUA 3W8DA 5G0TA 5G0UA 1ZXBA 2R6JA 3K2BA 4ND4A 3HQ4O 4YTEA 1NFQA 1KS9A 3GNQA 3VZSA 3PGXA 4K9DA 5AXCA 2CVOA 1KEPA 2HRBA 2FP4A 4FOOA 2VYVA 3GUYA 4WLOA 1A72A 1E3LA 3QVXA 1LUAA 3DZKA 2O3TA 1LDYA 1XLTA 3RD5A 5KWEA 1QORA 3MTGA 3CPSA 1LU9A 3FTNA 1ZK3A 3GZ4A 4H15A 1NP3A 1IPFA 4OKNA 1YQXA 3QWHA 4E2ZA 2BFAA 2B36A 3BTSA 3TNLA 1ADBA 1HDGO 2C20A 3QWBA 4PLPA 1CDOA 2J6IA 3KB6A 4RZHA 3KYDB 5F1KA 2EKQA 3A9WA 5BSFA 1P77A 5JS6A 2EJWA 4ND1A 3L4BC 1WNTA 2RBEA 1IE3A 2IDZA 4L0QA 3LZ6A 5TF4A 3V1TC 2Q1WA 5C7OO 1B8PA 4BMVA 4EDFA 2CD9A 1EK5A 4GPD1 3W4IA 1I3LA 2XF8A 4WLVA 1HXHA 2H9IA 4ZQFA 1FF9A 1D3AA 4ALJA 2X4GA 1NAIA 4RPLA 1HDZA 3MWDB 2NNLD 4JXKA 3C7CB 2ZATA 1NR7A 1ENZA 4RO0A 5G4KA 1U7TA 3RUEA 4BNLA 3FR7A 4R1TA 2YFHA 5KJEA 1UZNA 4R1SA 4OIMA 3FSRA 2PZJA 3EHEA 5DN9A 1H5QA 4IJWA 2Z1MA 4NMHA 3RUDA 1E92A 3QLJA 2FR0A 3VZQA 2ZYGA 1Q7CA 2PH5A 2I65A 4DLAA 3IS3A 1DOHA 4FW8A 4GVLA 4OJNA 4IXTA 3U4HA 3AM4A 3JQBA 1DB3A 3PRJA 3JQBC 2VUSA 3EY4A 4A73A 1ZK4A 3DOOA 4AJ1A 3EW7A 3JQFA 3X2EA 5C3MA 1EBFA 5EMHA 1HETA 5K6AC 1VJ1A 3PGJA 4FFRA 5G2OA 4CL8A 5CDGA 2JAHA 3I4CA 4IDCA 4A5OA 1E3EA 4WOJA 2NVUB 2AQ8A 1A4UA 4G2NA 1M67A 5JAMA 3A06A 1LLDA 1FDVA 3TQHA 3ONFA 3H9JA 1NQOA 4YQYA 3DQPA 3GAZA 5I7VA 3F5QA 2H1SA 4K28A 1E3JA 2YQ5A 4RGBA 4QO7A 1A7KA 3IDSA 1RWBA 2G1UA 2WYUA 4PZEA 4DMLA 4YAIA 3DB2A 3E8XA 3TOZA 5K0ZA 3QVOA 1PS9A 2WE8A 4Q3DA 3PDUA 1L1FA 3GUCA 2I3GA 4P22A 3OHSX 1XKQA 1GR0A 3UFXA 4NIMA 5KVCA 3DBRA 3PWKA 3PTZA 4OXYA 3L9XA 1U3VA 4OM8A 4OAQA 2AHRA 3DBHB 4RF2A 4NK4A 1N1EA 2NQTA 4AJJA 4DC1A 4ZICA 3WGYA 4CQMB 5JYDA 4JP2A 5DNAA 2BHLA 3QV1A 3GVPA 5KJ6A 4QUKA 1E7WA 1E7YA 4Y6RA 2HCTA 5A03A 5KCZA 4GI2A 1T1SA 2HKIA 1MP0A 2C29D 2HK8A 3JTMA 2OP0A 1YOVB 2GZ2A 4XQCA 3ETGA 2X0IA 3TOXA 3JYPA 1P1IA 4WCFB 3IKTA 5JY6A 5IZCA 4ESOA 1CIVA 3DEYX 1X14A 1BG6A 2G5CA 2VZ8A 3VH1A 3F4BA 1P1KA 3LSYA 4NHEA 5THKA 3RKUA 3WYBA 3PLRA 3RVDA 4DRYA 1WZIA 3TZHA 2VWPA 3KETA 3WJAA 4Z0TA 2ZTVA 4BNWA 1DIHA 4PLVA 4IGEA 4MP6A 1M76A 1YDEA 4NFYA 4CMAA 3BTOA 3GGGA 2QRKA 2QHXA 3IQDB 5DF1A 4YT4A 3OJOA 2HJRA 2P9EA 2YUTA 3PHJA 4K6CA 5EIOA 3RUHA 1JKIA 3I9NA 1GY8A 4CR8A 2FR1A 2OBNA 3PWSA 5I9NA 5JDIC 4MVJI 1XA0A 1EQ2A 3KYCA 3WICA 1GZ3A 4HP8A 3LQFA 1Y81A 4FR5A 5KJFA 1PGPA 2YHIB 1X15A 4IS2A 1P0FA 4GMFA 4ALNA 3AM3A 4CUKA 4F6CA 1HE3A 3ADPA 1ULSA 1I24A 3JYQA 3V1YA 1P33A 4YPOA 5I9LA 3PFFA 2FMUA 4DTIA 2J5QA 5ES3A 3OIFA 4CPDA 4INAA 4J6FA 2O7SA 4TZTA 4YVFA 4E3ZA 1DIRA 1LTHR 1FDWA 2QX7A 1BRMA 1K6IA 1SAYA 2NV6A 2DT5A 3QIVA 4O0LA 5EQDA 1ZBQA 1NQ5A 1PX0A 4XJTA 3RUAA 4TWRA 1GEGA 3GNSA 5EPOA 4E5KA 2NVWA 3EAGA 1O9BA 3PHLA 1PJ4A 4MVJG 1KEUA 2ZYDA 1HSOA 4KMSA 4CM9A 1JWAB 1UXGA 2JFHA 4GLLA 4BNMA 1YE3A 5DCUA 4BQPA 2NTVA 2JKVA 4GGPA 1LDBA 2DPGA 1F12A 2VWHA 3EVNA 4QEDA 2NU8A 5ER6A 5I7EA 4ND2A 4GKVA 3ONDA 1DIAA 3TN7A 4MDHA 2RHCA 2JCXA 2P5UA 2QQ5A 3TWOA 1C0KA 4R51A 5L4LA 1CWUA 4HNGA 2OFPA 5KIAA 5FFFA 2CZCA 1UDCA 4EUFA 4C7KA 3JQDA 4GVXA 3C7DB 3R1IA 3ZWOA 4AVYA 1E77A 1MA0A 3O8QA 4A2CA 4OYRA 4R4JA 4YXFA 4H7PA 4LCEA 3G1TA 4BKPA 2R2GA 3BHIA 2RH4A 4OQYA 1HE4A 4OGWA 1PZFA 5JBIA 3E48A 4PG6A 2VTDA 1MV8A 3PQEA 3GEMA 1O95A 2OP1A 4C4OA 5BSGA 1NPTO 2YFQA 3R3SA 3VPFA 2C5EA 4NBUA 4YJGB 1P1HA 4CLEA 3PXXA 3ZWWA 5BR7A 2C5AA 2J3KA 3CH6A 5A9SB 2FPGA 5TS3A 5T57A 4Q3NA 4PCVA 4BKRA 4BO2A 3VOSA 2DFDA 3HUDA 5DOZA 1MLDA 2ZTLA 3ZU5A 3H3JA 4YDRA 3RJ5A 3WB9A 3AWDA 3V2HA 3NEPX 5AOVA 2D1YA 1K6JA 6ADHA 4NPCA 3L6OO 1BMDA 5CEEA 2X5JO 5I8WA 2C2YA 1X7HA 1F17A 4YBZA 3IIEA 2JL1A 3KO8A 2W4QA 1YWGO 4NBTA 5A3VA 2AQKA 4RF4A 4RL6A 3DMYA 1YXMA 5LDGA 4JX8A 3OP4A 1Y9EA 4Z9XA 1T2EA 4XB1A 4EBFA 1DRUA 1R0KA 3BMNA 3GRPA 3KTDA 3F3SA 4RVFA 3N74A 1XG5A 1Z74A 5H83A 1E1KA 3PWZA 5CFZA 4B3IA 3GZNA 1KIFA 3NGXA 4WCFA 4I9UA 2HMTA 3E03A 4OHUA 3DXFA 5B12A 1HDOA 2BFPA 3ZWPA 1Z7EA 5JCXA 5ENVA 3DMTC 4CQMD 4DC0A 1ZCJA 4J91A 4UEKA 5GZ6A 1I2ZA 4MIYA 1IHXA 3AOEA 3W4JA 4CLRB 5TX7A 4WPGA 4XR4A 3U9LA 4XRGA 5G4LA 3Q9NA 1XDWA 2E4AA 1DC4A 4BNTA 1VL0A 4Y6SA 2FY8A 3Q9UA 4Y67A 2O3SA 3JYOA 1GQQA 4KP7A 2AA3A 4ONEA 3GDFA 3I6IA 3VVCA 1EFKA 1P3DA 1DSSG 2HMWA 3H5AA 1Q7GA 3KHUA 5ER9A 2GRAA 4HWKA 2G76A 2X7HA 4BIIA 1ZNQO 3ENKA 1ZZEA 4W9NA 1E3WA 4KOAA 4KZPA 4KUGA 2HRZA 4UVIA 2FSSA 4DA9A 4WOKA 1Y8RA 3K8ZA 1PJBA 1HZJA 2PD3A 1ONPA 3DWFA 2YJZA 4UUOA 2AQIA 2WTBA 4RPKA 4AJIA 3DFZA 4FOSA 1LI4A 4DBZA 2DVMA 4MVJD 1Y1PA 1R4NB 3PK0A 1VPDA 5L7TA 3PJFA 3DONA 1MXHA 3ZWMA 1KVUA 1J49A 1VL6A 2NVUA 4L9RA 1NWHA 3SVTA 2VUTA 3GFGA 4CM8B 1ISFA 1JQBA 4CM9D 2Z1NA 1YL7A 2PK3A 4AJ4A 2P68A 4CMGA 3TZ6A 1JKJA 5C5IA 4Z9FA 1Z6ZA 3C3XA 3OMLA 4BVAA 2OL4A 1X7DA 2W2LA 3JQ8B 4RPGA 4PRKA 5EERA 1HEUA 2XXBA 3LVFO 1MB4A 3GEDA 2O3RA 5F1PA 4UULA 1P1FA 1W6UA 4H3VA 3U3XA 4HFJA 2JHFA 4CQLB 5G0WA 4ND5A 1GEEA 3VC7A 4CLOA 2YW9A 1M6HA 4QFDA 3CKYA 4UREA 1HE5A 3ASUA 4R69A 5TQVA 1A9ZA 4XCVA 5HTOA 5COBA 5IXYA 2W8ZA 3RROA 3E9MA 3ZHXA 4J16A 4RVGA 3A1NA 2PR2A 2DTEA 1BSVA 2Q4EA 2V6MA 4HBGA 2VHVA 2YQ4A 1OC4A 3PDJA 3AUAA 1I10A 2VRCD 1NFFA 5HS4A 1U8FO 1U9JA 1O8CA 2A4KA 1JLLA 3DC2A 1GZ4A 3KYDA 4IZIA 4I5DA 3EVTA 3M1LA 4CUZA 1TVEA 3DBVO 1SBYA 4YAEA 3M2PA 3SJ7A 2DC1A 5HWSA 3AI1A 4L76A 5CG1A 1XCBA 2YDYA 3I4FA 1P1RA 4IQ8A 4MP8A 1EQUA 1I3MA 2WD8A 2EXXA 3S8MA 2PNFA 3AU8A 4RVHA 4EGFA 2ZJ1A 2ZQYA 3RBXA 3ZNQA 1PJLA 3TZQA 5KKAA 3F47A 3S2IA 1C0IA 4D3SA 3LF1A 1HKUA 3C1TA 2HLPA 4CQMA 1B3BA 1YDWA 3FNGA 3DBHA 1KC1A 2Q1UA 1NWCA 3NJ4A 4Q39A 2DUUA 2VT3A 5T67A 4JJFA 2ET6A 1ENPA 3UCFA 3ZW9A 1E6WA 1Y9AA 1HWYA 3MJEA 3PZRA 5A5EA 3MJSA 1ULUA 2X1HA 4YAJA 5G0VA 5CPFA 2AW5A 3PVZA 4XIYA 3RASA 4A26A 3GAFA 2PTGA 1PTJA 3KSUA 4XYGA 1LBEA 5KOIA 3D0OA 3RBZA 4NZ9A 1IHYA 3H4VA 3LT0A 3AM5A 4J2HA 3EGOA 3ST7A 3EZYA 1EUDA 8ADHA 4IINA 5JC1A 3PHGA 4HV4A 4FS3A 3TZCA 1DJQA 3IL2A 2GN4A 5A4DA 1LDGA 4CV2A 2WD7B 4OSPA 4OH1A 2I3AA 3VHRA 2QW8A 1FMCA 4GSLA 1MC5A 5KVQA 2BI8A 5JPIA 3NDRA 3HHPA 5J23A 3LF2A 3JQEA 1PZHA 1P0CA 1EUZA 3OQ6A 5L53A 1I3NA 1BXZA 2HSDA 3TFQA 4WLEA 1BXKA 5JAIA 9LDTA 1YB5A 3OJLA 5JMWA 4BGUA 3BA1A 2AE2A 4WJZA 1EFLA 3JQGA 2E48A 4ZGWA 2A9FA 4BO3A 2GR9A 3DDNA 5FI5A 4A27A 1YQDA 1NXQA 3G1UA 3QE3A 1KC3A 2BFOA 2VRBA 3E5MA 3KSZO 3MJ4A 3NKLA 3PJEA 4PG5A 4YEDA 5IDQA 2BGMA 2YZ7A 1ZK2A 3UW3A 4EJ6A 1PJSA 4GX0A 4RVDA 3CZRA 1JN0A 4BNNA 1J5PA 1V3UA 2FZWA 2GNAA 3HB4X 5TJHA 1B14A 1U3WA 4YACA 4GX1A 4AJLA 2O48X 3BHMA 1Q0HA 2P9GA 3EDMA 3WBBA 3RFTA 3RUFA 1M66A 3IOYA 4B3JA 1B15A 3LU1A 2VT2A 4LSWA 2WYVA 4BO6A 4CUJA 3WG9A 3RBVA 4U6QA 1Y7TA 1HL3A 1YB4A 3D7LA 3WQSB 4W9NC 1C0LA 3OFSA 1EUCA 3A14A 3FTPA 3FWZA 3GOHA 3KV3O 1TI7A 5JW6A 3AI3A 1AE1A 3UXYA 1GYPA 4QO8A 3GR6A 4JROA 3CMCO 3IKVA 3K31A 4BNKA 3OIDA 3T4XA 2IZ1A 1WLYA 1RM5A 3V8BA 2JAPA 5F21A 4ALIA 3S2EA 1U4OA 2JJYA 1WDKA 4IUYA 1UR5A 4DIOA 4XDYA 1H0KA 2Y66A 1NX6A 1EVJA 2J5RA 3VPXA 4HNHA 3NT2A 3GA0A 3CINA 5B4TA 1B7GO 2GERA 4FFNA 3I5MA 1SZJG 2IEDA 3Q1LA 4QECA 3E5RA 1ADGA 1MUUA 4WLUA 4X54A 3M2TA 3JCZA 3PYLA 1P1JA 3S2FA 4NJOA 1N9GA 3FNEA 3ROQA 5I7SA 1AXEA 4LW8A 4WCDA 4E33A 3F1LA 1OOEA 2EP7A 4CV1A 4E2YA 1JAYA 3I1JA 1O94A 2Y93A 2GPTA 4TROA 2C59A 2DBZA 3DAFA 4P4GA 5IAAA 4UAGA 3FPLA 4DYVA 4U7WA 5EN4A 1HDCA 4J1NA 2JD1A 2I76A 1LEHA 2VNAA 1DLIA 3QJ5A 4DWVA 1NVTA 3GGPA 3BMQB 1CJCA 1X1EA 2PKQO 2W98A 5CP8A 5F5NA 3D3EA 3WWYA 1DLJA 1ZSVA 3NTQA 1LDMA 1NHWA 3GN2A 4ZD6A 5TNXA 2GN6A 3G49A 1GV1A 3I6QA 1E6UA 3SXPA 3GT0A 2OXIA 5BSEA 5IZCC 1VSUA 1EDOA 2Y68A 2O7QA 3OJ0A 1MFZA 1OZAA 2WE7A 4OXNA 3RFXA 1KVRA 1TXGA 4FGWA 5JY1A 1PQWA 3DZGA 3H9EO 4FJ2A 4EI2A 1RM3A 4J90A 1DHTA 1YL6A 3ZWXA 4WEQA 1K2WA 3BMOA 4ALLA 1T2CA 2HO5A 1SOVA 3BMCB 4ZQEA 4YJFA 1QLJA 2EERA 2OOSA 3O26A 3D5TA 3JQ7A 3MOIA 5GY7A 1UUFA 3DTTA 5A1TA 4F3YA 4XDZA 4AICA 4W4TA 4J43A 3L9WA 1EZ4A 1XWFA 4II3A 4XA8A 1G1AA 3SLKA 2OHXA 4IPTA 5JO9A 1ONNA 1LJ8A 4MVJA 3KEOA 4CODB 1HLDA 3SC4A 4JIGA 5JC8A 1U3TA 1V3VA 5L51A 4LN1A 4J4BA 2BD0A 4U6SA 4J2OA 1HDXA 4WLNA 1SPXA 2PZKA 4FIZA 3HSKA 3SLGA 1QR6A 1DJNA 1YO6A 2ZYAA 4O6VA 1R6DA 3GVHA 3GPIA 1YH3A 1GYRA 1LLCA 4A10A 3ZU2A 5TLSA 4WE3A 2UAGA 1T2DA 5L9AA 2VRCA 1YL5A 3B20A 3RCBA 1JDJA 4CM4A 1I2CA 1N7HA 1T25A 2QZZA 4IJKA 4YYZA 1R4MA 3EUWA 1GZ6A 4CMHA 4R01A 1OMOA 5EESA 2Q3EA 3HADA 2OZPA 4IMRA 5KNLA 2CVZA 3KSDO 4J4TA 3P5SA 2NSDA 5GZ1A 2TMDA 1XQ6A 2Q2WA 3UGKA 5A02A 4PLWA 1RYDA 2QRLA 1YJQA 2Q1TA 3T7CA 3Q0EA 1E5LA 2W2KA 3V1UA 1S6YA 2FPIA 4S1VA 1IZ9A 3VAZA 1PL6A 3LT4A 4BO4A 1LLQA 3IP1A 3U5TA 3U4CA 3KBOA 3M1AA 1GUYA 3HDYA 1ZSNA 1I5RA 4M54A 2PFGA 5TT1A 5JE8A 1Q0LA 2VHYA 3C24A 3N58A 4AJOA 3AUUA 5HS6A 2C7VA 4WEOA 4TMFA 4DIBA 3SX2A 4EYEA 1HDYA 1Z7BA 1MFPA 1M6WA 1S7CA 4KDEA 1ISGA 1J0XO 1ZO8A 3JQ8A 4TQGA 1EEHA 1UZLA 2ZB3A 3TPCA 4FN4A 2PD4A 2VNSA 1ISJA 2BFMA 3WMWA 5MDHA 1A4IA 4BS9A 1T2FA 2X86A 3PFWO 4F46A 3RC1A 3Q11A 5JMPA 2EIHA 4EUEA 1KY4A 3QSGA 3MZ0A 1DPGA 4EEZA 1PQUA 5DDIP 4W99A 5DCYA 3PQDA 2F00A 2BF7A 1R4NA 1HYGA 3D64A 1CQJA 2O3QA 4RQUA 5JO0A 4NJMA 3G79A 1YB1A 4ZN6A 1FDSA 1ZEJA 1MXFA 3ZN2A 4P4LA 4J49A 4MVJF 1DAPA 1Z45A 2DBVO 2ILTA 3EC7A 3MEQA 4KWHA 1E0DA 4DUPA 1D8AA 3B1KA 3K6JA 2J5KA 3PYMA 3DHEA 3RC7A 2O2SA 1DC6A 1PQPA 1PJTA 1JWBB 3CSDA 2EGGA 1YBAA 3JQCA 3AJRA 3HN2A 2IXAA 4LVUA 3U62A 1I32A 3RC9A 2BMAA 3HJAA 5AXBA 4M8SA 5KJ1A 1E7QA 1LC3A 1LSJA 3AFNA 3H7AA 2HDHA 3DAGA 1HT0A 2PA3A 2ZKLA 4B4WA 1AHHA 2VTEA 3NT4A 3ZHZA 1BVRA 4DGSA 3WYEA 4J0EA 4IDAA 1ZEMA 1PJCA 3R0IA 4GKBA 2WWRA 3H5RA 4GGOA 4Y98A 4BHTA 3U09A 2QYTA 3DOCA 3B70A 1TA4A 4CLRA 4WLFA 2FR8A 3R3JA 4OSOA 4MO2A 4BGIA 1D1TA 1VKNA 3MJTA 4TVBA 1GPJA 2OORA 1P9LA 3IAHA 4ZRNA 2W90A 4FBGA 1E1LA 3JD0A 3PHHA 3OJFA 1E3IA 1UAYA 4PZCA 1ORRA 5ICMA 3QVSA 4L4XA 3I3OA 1HE2A 1HDRA 1TLTA 4E21A 3H9QA 1E3SA 3K30A 3K73O 2VHWA 4EEXA 1U1IA 4RPJA 4N18A 3SJUA 4MINA 4BO8A 1R37A 3BMNB 3ITDA 2B4TO 5KVSA 1SCUA 4BOYA 4IS3A 2P2SA 5AXAA 1G6KA 3HE3A 5A05A 1B2LA 3P2YA 1Z73A 3W6UA 2B4RO 1I3KA 2D0IA 5IG2A 4KQWA 3BTVA 4Q3BA 4ALMA 2AEFA 1PGQA 4CM6A 1HLPA 1TT5B 1B8VA 4NBWA 1Y8QB 3ZDFA 4FFMA 1NTOA 1PWXA 3D5QA 3E82A 2OO5A 2V6BA 4Y8VA 2Y99A 1UXJA 2TMGA 2DM6A 3GHYA 5FF9A 1JAXA 2OUIA 2FWMX 1LRKA 3GNTA 4YT8A 2GZ1A 4CMIA 4YJGA 3ASVA 5L40A 4HADA 4W7IA 4CM7A 1B0AA 4BKUA 4D3FA 3SC6A 5AXDA 2IZ0A 1LDNA 3NYWA 5KJCA 1A27A 4YJDA 3M6IA 3ADOA 4DYDA 5B4VA 4O63O 4A03A 5U4QA 2YYYA 1LXCA 3HG7A 2BI7A 3ENNA 5ITWA 4N54A 1BDMA 1PR3A 5IF3A 2YV2A 2WMDA 2YY7A 2UYYA 4BNZA 1QG6A 3DFUA 3C8MA 2I5PO 1BW9A 3AU9A 3H3FA 4CM5A 1NAHA 3E9NA 3H8VA 5EJ2A 1H6DA 4CM1A 1H9BA 4J1TA 4UVEA 4KUHA 4O5OA 2O23A 4AFNA 4RDIA 3WR5A 3ANLA 2X8LA 3PI7A 4L74A 5COQA 4BV9A 4DQXA 2GUGA 1MG5A 2NM0A 2PV7A 4XIJA 4E0BA 4YRBA 1R16A 5T6BA 1GDHA 4XYMA 2ZCVA 4NFHA 4PGFA 2I67A 4CLHA 5CG2A 3H5NA 1QKIA 4FFPA 4FC6A 1HTBA 3ZV6A 4IDDA 3UF0A 5JCJA 5BSHA 4DVJA 4M86A 4CV0A 3B1JA 3S2GA 2CF6A 1UDBA 3GG9A 1VJ0A 3BXXA 1EBUA 1AHIA 4NJMB 3Q3CA 4TVOA 4OL9A 2EF1A 3KEQA 5H81A 1CEQA 1NM5A 2AG8A 2W2LD 3ROMA 2X9NA 1NNUA 4NFSA 3MJVA 5F3RA 4IJUA 2X9GA 4CMEC 3U0BA 4CMEA 1L7EA 1B16A 2V6FA 4E32A 2DAPA 4BKQA 1ZUD1 3OEYA 4TKMA 5G0SA 4TSKA 1E6EA 4R1NA 5HA5A 4BNVA 5A9RA 5KVVA 5JSFA 3DL2A 2P5YA 3L0DA 1GD1O 2JFGA 4RV9A 5F1OA 5IN4A 4RF5A 3QWIA 1ISHA 4R3WA 1F8GA 4N5LA 3ZV4A 4P4NA 5K9ZA 4B7XA 3INRA 1W8DA 2IRWA 2QRJA 4IY1A 1I2BA 2VYNA 3OBBA 3UKOA 1N5DA 2X9VA 2UV8A 3KRTA 5IDWA 2ZCUA 1KEVA 2DTDA 2O4CA 2GDZA 2Y0DA 1KETA 2PGDA 1PR9A 4JP3A 5DBGA 3WX0A 4WKGA 4CLDA 3WYCA 2PZLA 1R66A 2PZMA 5DP2A 2O3JA 1EVYA 4LK3A 1L7DA 3OECA 4JBHA 4XWYA 2XXJA 2NUAA 6LDHA 4UEJA 2JCYA 4DPLA 2JD0A 1F0YA 4E12A 1BXGA 1XU9A 5EL0A 4IIUA 3PP8A 4PLYA 2VHXA 4XKJA 3JD4A 3F46A 3OICA 5BT9A 1T1RA 5JDIA 3E18A 1U2DA 4J7XA 4PLHA 1K89A 1PS8A 2VCYA 1X1TA 2WJPA 3FWNA 1A71A 5T5QA 1O89A 3UOGA 4K26A 3WIEA 1UP4A 3TJRA 4FPXA 3JYNA 2FPPA 3IUSA 1KVQA 1N1GA 1SB9A 4GMGA 3WDSA 7ADHA 4S3MA 3NTOA 4B8WA 1R4MB 3W1VA 2Y1OA 3A4VA 2EEZA 1XR3A 4RLHA 4BKOA 2EG9A 3GDOA 2IXBA 2G17A 4J1SA 4GWKA 3MTJA 4J9UE 3VZRA 3WGOA 3ICPA 3RU7A 1ZJYA 5L7WA 1E7MA 1NVMB 3SBOA 4NU5A 4OXKA 1JKFA 2PKQP 3GDGA 1K5HA 4W6ZA 4L4SA 5FYDA 5FWNA 1WWKA 3OETA 3COSA 5BNTA 1LC0A 3ICCA 4KTVE 2I9PA 2PLAA 1VC2A 2YDXA 4QT0A 1HYHA 1XYGA 5DP1A 4F45A 1F8FA 2IYOA 4TRJA 5ENDA 1DXYA 1H9AA 3I9OA 2BELA 1YKFA 4UVHA 3L4SO 4LISA 4B4OA 1FJHA 4ZRMA 2FN7A 3FRJA 2QIOA 3GFBA 2H6EA 4L75A 5CEJA 5JXWA 2Q46A 2AEMA 4J1QA 1EK6A 4Y6PA 4OO3A 2FZEA 2ZB4A 1J4AA 3VTFA 1ADFA 3RFVA 4J7UA 2B69A 2RAFA 2D5CA 3IUPA 1GCOA 4FD3A 3F5SA 3D4PA 3GG2A 3OIGA 3ETDA 3V2GA 1TT7A 2CY0A 5FEUA 1NBOA 1YRLA 4GWGA 3WGHA 3AOGA 4EW6A 2WEKA 4KUEA 1A7AA 1H6CA 1PS0A 2B35A 3A28A 1DO8A 2PWZA 4KQXA 4U0JA 1PU2A 4CLXA 2VUUA 3GH3A 3W4KA 1XEAA 2IZZA 4G81A 5T64A 4LRSB 1C1XA 4Y9DA 3Q2IA 5I7FA 3DHYA 3LDHA 5LCXA 3CTMA 3JQ9C 4A7PA 5BNIA 3SEFA 1VI2A 1ZVMA 4GSKA 3TSCA 3BMQA 1HYEA 5T8KC 1KVTA 1GCUA 1PWZA 1Z82A 3ZV5A 2A94A 3EYWA 2PY6A 5KTKA 2X23A 4P8RA 2Q1SA 2X5KO 3LC2O 4M89A 4FSHA 5EQFA 1P74A 2I99A 3FD8A 1UP6A 3GHHA 5IXSA 1PEDA 3GN1A 3C1OA 3OSUA 1UXIA 3ZWYA 1QYCA 2X0RA 1ZMTA 1KVSA 2X22A 1SMKA 4I1IA 3INGA 4B7UA 2FRDA 1PJ3A 4CMCA 1U4SA 4JGBA 1LQTA 2CDCA 2J3HA 4I5GA 2D2IA 3DR3A 1WAMA 1LSSA 1XIVA 3B1FA 3QHAA 2CFCA 2NU6A 4Z3DA 1Y5RA 3UVEA 2GCGA 4Q3EA 3WS7A 3PIDA 4JBGA 4WK6A 5DT9A 4DQUA 2X5OA 4RPHA 4R68A 1LSUA 2JHGA 4IBOA 3W8FA 2JD2A 1A5ZA 4M55A 4MVJP 4E2XA 1EE9A 4IDGA 4IJVA 2FOIA 4DPKA 2HQ1A 3K96A 3L77A 3HDQA 2PD6A 4N5MA 4P38A 1QRRA 3AOEC 2H63A 1C14A 3FBGA 3TFOA 3P2OA 1NQAO 4NU6A 1X0XA 3LYLA 4I9NA 4XZ3A 1LRLA 1Y6JA 4FFOA 2H5LA 1BTOA 2EW8A 2IYPA 4I8XA 4NDNE 1RYEA 3ORFA 4CR7A 4JJGA 4BO1A 2CDBA 4XEHA 4M49A 3WGZA 1NASA 3DOJA 4OMUA 3ZWNA 5HM8A 3LC7O 5GMOA 4ZVVA 3KXDA 2VN8A 4ID9A 2EP5A 1UH5A 1P44A 3KLMX 1BHSA 1AXGA 1VLLA 1DC3A 2ZJ0A 4JCOA 4LMRA 3TL3A 1Z75A 3LK7A 2B5WA 5IJZA 1ZW1A 4F6LA 1GFSA 2B0JA 3QRWA 3OH8A 4RLSA 4ZU3A 4FFLA 4JNKA 4Z0PA 2BLLA 4UEOA 1BGVA 2GYYA 1CYDA 1ZH8A 3U4IA 4YR9A 3GPDG 4UVDA 3KUXA 1IOLA 4LVCA 1X7GA 4OOFA 4GBJA 3WBFA 2CNBA 3VH4A 2Q45A 2RH8A 3AI2A 4PG8A 1H2HA 2AXQA 2D5AA 4ZA2A 3JQGB 4E5MA 1NFRA 2GF2A 2SCUA 3GF4A 2BRUA 3IP3A 3RSHA 2LDBA 2V7PA 3UICA 4U8GA 5CDSA 1U5CA 3DZFA 3JD1A 3EK2A 3AY7A 3NRCA 4YB8A 3RUIA 4HUJA 2WM3A 1QYDA 4D46A 3VPSA 1V0JA 3PEFA 1GYQA 1Q7BA 1YONA 1ADCA 5DBIA 3ZZNA 2OBYA 1JA9A 2WD7A 1DRWA 3GLQA 4HKTA 4PRLA 4TRMA 1X0VA 2HMSA 3PJGA 4R5HA 1HSZA 1UXKA 2E37A 1N7GA 3PZBA 3DMTA 2WYWA 4NBRA 3VPGA 1SEVA 3GGOA 5THQA 2CVQA 1VJTA 5TC4A 1I33A 3U49A 5MGBA 3WIDA 3JSAA 4HXYA 4U0KA 3ZI0A 3HB5X 5CHEA 1ZK0A 3WTCA 4II2A 4RVSA 3ONEA 4QFCA 4ZQBA 1WXDA 4AJKA 1OAAA 1XSEA 5I9MA 3U4DA 3BHJA 3UAGA 3I52A 5DCWA 4MVJH 2GLXA 1GUZA 3H2SA 3RWBA 2DBRA 1IYZA 2X0JA 2HK9A 3UHAA 3IJRA 4BB5A 4HX5A 5LDHA 4XGNA 1E1NA 1RPNA 3JQAB 3ZH2A 1F06A 5A5FA 3K92A 4R41A 4JK3A 1JU9A 1RJWA 2V65A 4MPDA 4R5MA 3G17A 5BNFA 1ZIDA 4R3NA 5EINA 2P9CA 5GZ3A 2Q4BA 1ZKMA 3JV7A 3K2EA 1QP8A 4GLOA 4MKRA 5CPBA 2I66A 2RIRA 2DUWA 1I30A 2C82A 1XU7A 1VL8A 2C54A 4BNGA 5ILGA 4PVCA 4JLWA 1XGKA 4N7RA 4ITUA 3ZCXA 2GGSA 1EE2A 3P19A 5L3ZA 3QQPA 4RQTA 3NTRA 4TRRA 8LDHA 3MJCA 2OGUA 3DZBA 2EGHA 5AQ1A 3RAJA 5CDTA 1UDAA 3T7EA 3JQ9A 9LDBA 2O2YA 2ZQZA 1IPEA 3JD2A 2EV9A 1R0SA 4IDEA 4OQZA 2DBQA 4BL5A 4BNHA 1GQ2A 3NDIA 1QV6A 3NX4A 3WQQA 1C1XB 2Z95A 3DZIA 3HZZA 3G3EA 4RDHA 4YJHB 4Q3AA 3GK3A 4E5NA 4CLOB 4IDFA 4GAEA 4CQLA 1QLHA 1V6AA 4E31A 4NNJA 3AUSA 1PGNA 1E1MA 1DDOA 3IJPA 3WOHA 4OOEA 4BV8A 1QMGA 4U5QA 3BAZA 5C7IO 2VOJA 4ALKA 1XELA 2Y67A 2I6TA 4AJ2A 4J7CA 3E1KA 4J9VA 2P4QA 3W8EA 2CF5A 3HWRA 3K9QO 1C1DA 3F6YA 1FDUA 3ZWAA 4D41A 5KKCA 4FDAA 2UDPA 5L4NA 3LLVA 1WMAA 4CM8A 2Y1CA 4WNIA 1ENYA 2J3JA 2Y05A 1ISIA 2Y1EA 1QV7A 3ZNNA 1VSVA 4JJIA 4FJ1A 2PGLA 3UN1A 4YRAA 1QXSA 1NR1A 5L4SA 2Y1DA 4B4UA 4EZBA 2GSDA 4LMPA 4KTTE 1EVZA 3WQRA 4B79A 5K6AA 3KYBA 4YRDA 1DAOA 3KVOA 4XYLA 1OFGA 3STHA 4E5YA 3BZUA 3HNPA 3L6DA 3W6ZA 4ZJUA 2E49A 1PL8A 4IQ0A 4XYBA 3HFGA 1V9LA 3WGTA 1PZGA 1Y8RB 4G65A 3L4BA 1NPDA 1D4FA 1UZMA 2J3IA 4DIFA 1IL0A 1E3WB 1EDZA 1AUPA 2B5VA 4M1QA 4A0SA 3NUGA 4BUCA 4WNCA 4FB5A 5TIIA 3NT5A 5H82A 2QG4A 3AK4A 3HDHA 1WDLA 4PLCA 5L7YA 2DPHA 1JTVA 2PGJA 3WFJA 3DZHA 2CUKA 5DBFA 3ROKA 1T2AA 2AQHA 1GU7A 1EMDA 3R6DA 2NTJA 4BO0A 3NJ8A 1KEWA 1MC4A 1W4ZA 2EHDA 4KDFA 1YS4A 4JQCA 3WMXA 3OEWA 4FQ8A 3VKVA 5CAEA 2Q49A 2P4HX 1BXGB 3VDRA 3ZU3A 1GV0A 2B83A 4PLGA 4AJHA 3UUWA 1E7RA 2NU7A 4CMIB 4WECA 4MIOA 4NQZA 5A3JA 4Z9YA 2E82A 2RHRA 4URFA 4BGEA 5AVOA 4FCCA 3GZNB 2DU8A 3CIFA 1Q1NA 2ZIZA 2QYSA 2C7GA 1IZ0A 3FR8A 1SO8A 4Z6KA 2Q2QA 2EKPA 3JQ6A 4J0FA 2FSVA 1V8BA 1Y8QA 2CSUA 1NQTA 1VE9A 1E7SA 2JFFA 5ICSA 3FNHA 3L07A 1GADO 4M87A 4BNJA 3GQVA 4O1MA 2EJVA 1QYWA 1G0OA 3HN7A 4NH4A 4TZKA 4GL4A 3VTZA 3RUCA 1HZZA 2VQ3A 2R00A 4B8ZA 3E6AA 5LC1A 1IY8A 2POQX 1T24A 3GRKA 1I0ZA 4YT2A 2AEJA 1H6BA 2C07A 3O03A 4BO9A 3VZPA 2NQ8A 3QWFA 4XB2A 2D8AA 2GASA 1CERA 4XD2A 1E5QA 4BQRA 3I83A 3FF4A 2UUOA 4GH5A 5HBRA 3Q2KA 3WGGA 5A9SA 5IZ4A 2C2XA 3ANNA 1CETA 1NYTA 5ITVA 1DIGA 3AFMA 1M75A 1RM0A 1NHGA 5JAQA 4MKZA 4JN6B 1W73A 1U7HA 2Z5LA 3ZWBA 2ZTUA 3HDJA 1H94A 3OJEA 1JVBA 4Q9NA 4LCJA 4XGIA 3T4EA 3GMDA 3O8QB 4D3DA 5CEFA 2NTNA 1MGOA 1HF3A 4PFJA 1XHLA
chains in the Genus database with same CATH superfamily
3FVVA 1ECJA 3D4OA 4Y0VA 4QL3A 3GCGA 1ZRNA 1GQSA 2A9OA 1LSOA 3A1EA 4JDPA 4I9GA 4MOWA 4O59O 3TZKA 4EF5A 5ILOA 1SKBA 1I9GA 5JADA 1Q17A 3RVMA 1ML3A 5A6VA 5IVHA 1H2WA 2IW1A 4IHQA 4BFXA 2VZ9A 4F56A 1R0LA 4KWIA 3TM5A 2BGLA 3WL8A 4IIEA 3FUUA 1NJ8A 3HU3A 4HRAA 4ERXA 2C92A 1KXZA 3KZMA 2PN1A 1NJ5A 3WSVA 4G0PA 4I55F 2WWTA 4Q1CA 4LAFA 4X00A 2CV1A 1QGDA 1C81A 4IDBA 3K3PA 2OQRA 4MSUA 1K9VF 1QHGA 4RWEA 4W1SA 1N5OX 4LKOA 4MQUA 1WNFA 1HNWB 3CZQA 3QF4B 4GP6A 1G4AE 2O3UA 2NXJA 3R4VA 1MIOA 4ZDIA 3C6ZA 1QYXA 3E7XA 2NU9A 4PSVA 3S99A 3ZHRA 1UWCA 1SK8A 3SS7X 1EIZA 2ID9A 2ZVPX 1T35A 4R83A 1T0JB 5A4JA 2VHTA 3F4LA 4GQAA 4MUEA 2QQFA 2FHPA 2R6ZA 3UMJA 5LM3A 2W70A 1RIFA 5M04A 3N2GA 1BDHA 2BGIA 7MDHA 5JFGA 1KS2A 2VP2A 2XKBA 4H1TA 4N5NA 4EMSA 5LXTB 3ROGA 4GMXA 4JC0A 2C0CA 3VVMA 4NYJR 2BJHA 2BTQB 1J2EA 1RWMA 1W96A 2XODA 2FW0A 3AT1A 3L7DA 4JY7A 3NBZC 1WXXA 2H5JA 1YBVA 2KBFA 3INTA 2I8AA 4J2TA 1WPRA 5AI6A 1ONOA 1YF3A 1KL7A 2CK3D 4M8IA 1PKXA 3SZOA 3T1TA 4BDSA 2ZT7A 3HMQA 2XUIA 3BQ9A 4R9RA 1I51A 1RYYA 3VH2A 1LF0A 1CR2A 1HY3A 1FTWA 2GM3A 1V35A 2A35A 2Y1FA 4TRNA 1GQYA 4H0NA 4KO3S 4QGGA 5CCBA 4Q05A 3OAAA 4AF6A 1JT2A 3BTUA 3ZEAA 3O73A 1CEYA 1CRZA 1BS9A 2FQ1A 2P27A 1E2PA 3V80A 3UW1A 2AOVA 4E30A 4R0MA 2R0QC 2DY1A 3MCVA 3EG9B 3PKZA 5NULA 3SGLA 5HQ3A 1Z06A 3K53A 4BTEA 1CZOA 1PT7A 4D43A 4DLBA 1T4BA 2VI5A 4R0VA 2HLHA 3IUYA 4UVGA 1YV9A 2H06A 2V7QA 3K94A 3OQIB 1T13A 4QOEA 2VJBA 3TR6A 4Z3KA 3IP6A 1F9AA 5FUYA 1PG0A 4S05A 3S3TA 5JDCC 1IUKA 1YQWA 1SBQA 4G86A 2Y27A 1X92A 4GPEA 4E15A 4EHDA 3R5HA 4MEAA 1T5DX 1Y8ZA 2Z58A 1MJFA 2CEAA 5BO5A 4IP0A 3A6HA 2YHUA 3ABIA 5AVRA 1IH8A 2B8TA 5K8JB 4HPJB 4KH0A 4DV7B 2IY7A 3PL1A 1UADA 2IEAA 4PBTA 3F2IA 1OTXA 4YDSA 2YV5A 2Z3WA 4ZJYA 2B61A 3QEOA 3JYHA 5F5LA 2X76A 1WSWA 1N2HA 1SCJA 1YU9A 3SZGA 1S89A 2WI8A 1GTVA 3HWWA 1RW4A 3NIDB 3L46A 4XX0A 5KNDA 4FJ0A 1K9SA 1YOVA 2D59A 2OTCA 1GXSB 2QDKA 1JMVA 1LJUA 1RM4A 1H05A 3OCWA 3T3EA 3V6LA 1UJ4A 1DFGA 1DKOA 4ZCSA 4BNDA 4ZDKA 3RHFA 2AJBA 4QATA 3DGFC 1U65A 1WU8A 2Q3LA 3FB4A 4HG2A 1FFXB 1ATIA 4OUKX 5DULA 1Q74A 1WG8A 2FDXA 2HQRA 3GUUA 5CD1A 1DKPA 4FX5A 2AKEA 1HG0A 2D1QA 3UMMA 2CZQA 1JIXA 4RA6B 3DVAB 1ETUA 2DZDA 1O7JA 4JJ7A 4KAJA 3KQPA 1XO1A 2QR2A 5CX4A 2EX1A 2J7PD 2P67A 2WF6A 3V2UA 1ANKA 4YV1A 3FCOA 1KORA 1QE3A 2EVWX 2IZ5A 3C5EA 3HJGA 4QX6A 3MOGA 4EG8A 3PUWA 1P9OA 2F1KA 3C6QA 4E5PA 2ZLBA 1JPVA 5L3QA 4V3CA 4L7QA 3QVTA 4ETIA 3A3YA 5C81A 3QOXA 2ZB7A 4D0RA 5SZJA 4LY9A 5AKHA 3DV2A 3WYGA 3WNVA 1W36D 1J42A 3AY6A 3AV3A 3LM8A 4M3NA 5DOVA 3G0DA 4DJEC 4YAKA 5J9FA 4JDUA 2I6GA 1LA2A 3CW2A 1Z35A 4PX3A 3VR5D 1W5EA 1MG0A 1UMBB 3PFBA 4TGLA 5IP5A 4WQMA 5AOBA 3R9KA 1YMUA 2XGSA 4BNUA 2VG8A 3D4NA 1YCGA 4E5DA 3EOBI 4EARA 3ZW8A 1UWKA 1YGYA 5DNUA 4M9ZA 3QLTA 1YQQA 1HYQA 2R5FA 2ZUDA 2RHHA 3F9RA 3TSYA 5EIWA 3C7AA 2PWAA 3K9LA 5DRTA 3PYXA 1U2ZA 3TIXB 4LDQA 1VM6A 2PZGA 1IB6A 3K8YA 1E9SA 2QQGA 3ZBTA 3ADCA 5L8VA 1RJDA 1JFFB 5ALWA 4LF6B 3ZEIA 2J3LA 1JILA 3H1BA 5KREA 2Q3BA 1JALA 2H08A 1N5RA 2ZFUA 2GKGA 1LGYA 3UMCA 4RZ3A 2J9FA 4KXFB 4HNQA 4YONB 3M83A 4MICA 4M99A 4ARIA 1VMIA 4GOOD 2VF4X 2ZWPA 1Y3BE 5GJVC 3F1KA 3IMCA 4DSNA 1XFDA 2D1RA 2XW6A 3HN6A 4E4TA 5IFLA 3PNYA 3WK4A 3ESRA 2EWMA 5GQSA 1TMOA 1GGKA 4YRNA 3GDHA 4FHDA 2HM7A 1LBSA 3UAOA 1PK8A 4BN0A 5FOXA 5FTMA 1BDJA 5FPHA 5FPQA 3URMA 1PFUA 3R4CA 1U0HC 1ORTA 2Q2OA 2QJTA 3ELDA 1R6TA 3AIKA 1IQPA 3AJEA 5A04A 1MT3A 3L8YA 3QVWA 3ICVA 4PC1A 2WVAA 1KYQA 5BN1A 5JTUA 1WHSB 5KYKA 3VU3A 1M2OB 3F6PA 13PKA 2HUNA 2I7CA 3C85A 4LSZA 2R86A 2C4HA 1IIBA 1L7RA 3NAQA 4R9UC 3WLFA 3UPDA 1C41A 3RKRA 3ZHOA 1V26A 2RSLA 3RU9A 1P5JA 4HFRA 3NDJA 1QHIA 1G0NA 2R48A 4L3VA 4ZQHA 4MWBA 1YZKA 3CXRA 3D1LA 3FOBA 1NJ2A 2BGUA 1DC8A 4DT1A 1U11A 3QXSA 2DWUA 4XRRA 2XNKA 5DZSA 5LKRA 3LCVB 1NOJA 1FU8A 3JQAA 1A9YA 2Q5IA 1OHHA 2VJOA 4HDKB 1T1JA 5DBHX 3RRYA 1UZUA 2PUEA 5HSGA 3MN1A 2FMTA 4NS4A 3UANA 1EVIA 1YS7A 5GIPE 2WSMA 4PLFA 4F72A 3N7AA 4ZTUB 1E4EB 2ZSAA 2WOOA 4LDNA 4BO5A 4MAFA 2ZSBA 4YMIA 4TS9A 5K3SA 1PSDA 2OEPA 4BLRA 4CBVA 3T15A 1I01A 1W0CA 2QRMA 3F74A 2X6TA 1N92A 3Q41A 1JBKA 3O91A 3FMGA 3UQYS 1W30A 3NHPA 1W2GA 1TTHA 3G5TA 4X85A 4TYPA 3SP1A 3SXUB 2JFPA 1M2FA 2X2EA 2QT1A 1M2JA 2B9VA 3A6LA 2UVDA 3EHDA 2G08A 4G4SO 1G8SA 4LRTB 4XR9A 1PX2A 5EAIA 3TNYA 1L4NA 1OFTA 2ZYTX 4O25A 3MMPA 3TLCA 3ZE0B 4D8TA 2H1LA 5BOVA 3GGSA 4KR2A 1Q3KA 3PC8A 2BGRA 1LBIA 1J07A 4RMIA 4OH7A 4DUPA 1RKXA 4X1OA 3I9LA 3E8SA 1UBCA 4R2XA 1ESCA 1TQ6A 2XMCA 3IVMA 4LWPA 1L4BA 1YZVA 4MKGA 1EX7A 4Y1RB 1SA0A 3KZNA 3LLSA 4L0CA 4BGVA 1SC1A 3N0RA 2ECKA 1LNQA 3SCZA 3KDAA 1E59A 2XUFA 4LXXA 3DZCA 1RLJA 4A1OA 1WMFA 5KB3A 1G9SA 4WX2B 3UO8B 1GAEO 4YJFB 3BMCA 4UE3S 1X13A 2WWXA 3RIHA 3VR6H 2CMDA 4RPCA 2NP6A 2WDZA 3ETLA 1UKVY 4JP8A 1SULA 1TB4A 1XDGA 3P1JA 1QO0D 3TKLA 4O2AA 3UV6A 3B51X 3H05A 3VYSB 4AIRA 3AW9A 1OWMA 1V3TA 3JR3A 1F3LA 2PO7A 1RSZA 1WKBA 1GPAA 3GBVA 3WLEA 1T2NA 5ALDA 1TK2A 4PIVA 3UT0A 1O95D 2HQOA 1DAMA 4I1UA 3SU8A 3VSCA 2I9KA 3PNKA 4IGFA 4RFVA 3SNHA 1YVDA 2O4UX 4BY9E 1JJIA 1NPYA 3EY9A 3QK7A 3UV3A 3JAKA 2DKNA 1BQ3A 1GL3A 2UZAA 1Q11A 4QQRA 3KLPX 1I9CA 2GF9A 1ZM2A 3PCTA 5JLAA 1TJPB 4GRDA 3PXEA 4XLLA 5C4IA 5B1HA 5JYBA 3IMFA 2OM2A 1FRNA 3HB7A 1K7EB 4HDAA 3VVBA 4V3BA 2YZNA 3ZU4A 4PN3A 3OTOB 3ZD6A 1M6YA 4FGKA 1SKYB 1T8UA 5SICE 5AW8A 2WTNA 1U3UA 2LD4A 3WTBA 4DFDA 1G1MA 1DIBA 1R0BA 2M2IA 4GUAA 2N1BA 1XZIA 3EC1A 4OGKA 1JHDA 1GNVA 3M6WA 3OQJA 4HYYA 4IMPA 4M9CA 4RCVA 3DBLB 5IM5A 5TGTA 1XEXA 1KOLA 1H2BA 1S3SA 2QKYA 3A31A 4A8TA 1E8NA 4DL9A 1Y34E 1ZC4A 1QAQA 2AF3C 1PLLA 1N8KA 3D3WA 4P5DA 4DMHA 3KKOA 4TMVA 2CBGA 4RETA 3WJ7A 3ZHBA 5AW6A 1LLUA 4FC7A 3QMMA 4F7DA 4WACA 3JQAD 3CF6R 4IXWA 3RHSA 3TRIA 2XCLA 1JRLA 4J29A 5KQSA 4ND4A 3HQ4O 4YTEA 2XX3A 1KS9A 1V8DA 3GNQA 3I72A 3VZSA 2NZWA 2W6JD 3LQKA 4E7PA 3LXXA 4KE8A 5AXCA 1A8IA 1E2BA 1L4UA 2OFOA 1MH9A 3J80A 2HSWA 3LC0A 3LGXA 3CKMA 1HI9A 1ABFA 5AVJA 3GUYA 4HH4A 1TA9A 2ZUTA 3DOEA 2P9HA 5CVVA 3RIGA 4CCWA 2BFEA 1E3LA 4UU8A 2ZXUA 2DULA 4KMMA 1XLTA 3EXEA 3WLRA 3IE2A 3HXTA 4HWGA 3MTGA 4R2IA 2V96A 4YMWA 1KI1A 1E9RA 3FTNA 1ZK3A 2PS3A 3LQRA 4C21A 3A1TA 2YXBA 3L7AA 1SC3A 4OL0A 4OKNA 2X4DA 1KI4A 2JBAB 4HDQB 4COKA 4DCJA 1HDGO 4N3AA 1BXRB 3FSGA 2BCJQ 2CJWB 3EFOB 2B4YA 2WIBA 1PR4A 1OU0A 2OSBA 8GPBA 2IF2A 2BF4A 3MXOA 3RK4A 3MT8A 1D6SA 4Q82A 1JEEA 1TTPB 4QUJA 3Q72A 1WOMA 3TECE 1FTQA 3IEVA 2ZVJA 1Y7HA 4DM7A 2O2HA 5LUAA 3ZDDA 1TQ2A 1OYVA 4L0QA 4NCKA 3DL7A 4AMVA 1LWNA 3AONB 3MD9A 4NNOA 4BMVA 4EDFA 5C7OO 2CD9A 2IYLD 3EH1A 1I2MA 3LQ2A 1E9DA 1V6CA 4GPD1 1PUXA 3MINA 2DPMA 1LPOA 2OK8A 3FJ1A 1RP7A 1UBRS 3DC7A 3D6HA 1HXHA 2H9IA 3WLQA 6Q21A 1FF9A 1SVWA 1NAIA 2VP5A 3MB5A 3MWDB 4RPLA 4H4EA 1KJNA 2ZATA 1ENZA 1EFVB 4RO0A 1I7DA 2EYUA 1AF7A 3SZ3A 3LUGA 2GZHA 4HDMA 1ZD9A 3DTVD 4L5AA 2G5PA 3B3AA 1GLNA 1BAPA 1T8PA 1XZAA 3ASZA 1SUPA 3AVTA 4HAOA 3BEDA 1AMUA 3GLIB 3HABA 4UBJA 3RUDA 1E92A 3RVNA 5A2QA 3QYJA 1RCUA 3EDCA 2GBPA 1VXOA 1FTSA 2ISQA 1KO4A 3IS3A 5CA1F 5FR2A 4GG1A 1COWD 2O1XA 2WZBA 1W52X 4OX9Y 3HKBB 3OEED 2QGZA 1VIDA 2VPZA 4HATA 4TTTS 5E9AA 2PIDA 4DA0A 1FP4B 3VISA 4A73A 4E2FA 2X5XA 4F86A 5CFNA 1WV1A 2NUPB 5C3MA 2HXYA 1HETA 1XMSA 1R8JA 5CDGA 4ECAA 4ISCA 5AESA 2ZUFA 1KP3A 1JI3A 3N5CA 5D85A 1I6LA 4A5OA 4MTLA 2PLNA 3KPUA 4WOJA 4X6XA 5DLPA 2NVUB 2X15A 3IURA 2GA8A 1NXOA 1TFUA 1XL1A 3A9SA 2XMQA 5EXSA 3H9JA 2WT4A 2ZOSA 5K8IA 3GAZA 2HCFA 4PHHA 4Q4DA 4N65A 4C08A 3N2KA 2ODAA 4D9BA 1LQ2A 5I7VA 2YQ5A 3JZFA 1MOSA 2XT6A 2JCGA 2Y76A 3CRRA 1A7KA 1EVEA 4XQ0A 4GEGA 4PO3X 4EFKA 1E1QD 2IS2A 1V47A 3FX2A 4YAIA 3GLHE 4P36A 4E09A 4YAWA 1FX0B 5K0ZA 3A70A 4C0AC 1GA6A 2C61A 3KVNA 3CO5A 1XTZA 2PKWA 3BC1A 3P9QA 4OHVA 1JH9A 3H87A 2IU0A 3QVOA 4ZYYA 2IYRA 2Z2YA 1L1FA 1QC5B 1CUXA 2E9SA 1BCSB 3KDSE 4R3UC 4YK7A 2WSLA 1ZVQA 5DISB 2O8EA 4P22A 4C2UA 1N0UA 1Y1TA 3F6SA 5DEOA 5BN4A 2FV8A 3L41A 4F4JA 1XMQB 5BOSB 2VA9A 1FFDA 3IVXA 1E5TA 1GR0A 5IAGA 2GZDA 4NIMA 4EFLA 2XF2A 5K09A 3FHTA 2AN9A 3BMXA 3ZYZA 4OXYA 1B0UA 2QGNA 4RTSA 4TVKA 3RC8A 2FPPB 4WZAB 3L9XA 4B2LA 4OM8A 1OGIA 3M1IA 4I50A 3U7FB 1DMSA 1FRQA 4DCGA 3I2GA 3KKQA 4DC1A 4DILA 4WL0A 3WGYA 4CQMB 4N39A 5DNAA 4R0NA 1XV5A 3LVQE 4V1CB 5KJ6A 4GHWA 3DDWA 1E7WA 5I7RA 1E7YA 3VPBA 4R05A 2AS0A 1FBTA 2MINB 2WG0A 2IS1A 4Q7KA 2YZKA 3RH0A 5TEWA 2V8BA 5JVDA 3HVIA 3H11B 2HK8A 5CLGA 3BF8A 4UOEA 2OP0A 2HA3A 521PA 3PQ2A 4NWIA 4TT8A 5FNVA 4MRPA 3WLKX 3ANTA 2X0IA 1JHZA 3TOXA 2D0OB 4OAPA 1Z47A 1INLA 3C6YA 4OUDA 1X1DA 4DWJA 3DQZA 5IAKA 3DXZA 4NJEA 3R8CA 1E60A 5IZCA 5IYZB 1I13A 4YGXB 4CFYA 4YAFA 1TVKA 1CIVA 2QTZA 1RZVA 5DGTA 1GL9B 2E5LB 3TD6A 1N5LA 2G5CA 3RNOA 9GPBA 3AVUA 1U8AA 3LP6A 2FN9A 5CVEA 3GYGA 3SHTA 1U2QA 3K0FA 4XGRA 4CEHB 3WYBA 1TYDE 5CIYA 3HKDB 3FRHA 4P35A 1UBMS 1Z16A 3B9RA 2W6OA 1D4ZA 4AXXA 3A4YA 1G6Q1 4GP7A 3DL0A 2A9QA 3A7EA 1OROA 1Z38A 2IUEA 4UBMA 1OTYA 4Z0TA 2ZTVA 2QXUA 5FBLB 1W5AA 2J46A 3RT7A 3DE5X 2WJ3A 3VR4A 6YASA 2X6QA 1YDEA 3ABZA 1J8DA 5ICCA 3NG1A 3AP3A 4DM3A 2A8YA 2QRKA 2XVZA 2EWVA 4AZWA 3N0TA 1A2QA 2P9EA 2ZZKA 2CJXA 3LL4A 3PHJA 4HZUB 4IYJA 5J5CA 4J3NA 4MCJA 3PJRA 2P6NA 3RUHA 3I9NA 1GY8A 1KPHA 2QXYA 1NN3A 1B0ZA 2YHBA 3CU5A 1KZ9A 1XRPA 4XPIA 5T4BA 3MTQA 3LRTA 5LMZA 3OFND 5B36A 3WICA 1GZ3A 4HP8A 4LYEA 4ZJZA 1Y81A 4AIIA 2ZRGA 5DGDA 2CT8A 1P0FA 4RM2A 4PSAA 2AI3A 4MEBA 3SKXA 1WXIA 2E3JA 3GLVA 4WK0B 3HACA 3ADPA 5AIBA 1GZUA 3T0IA 3L43A 4MDFA 1E89A 2A86A 4OU4A 5ES3A 3U9SA 3HJFA 1RBMA 3QSYA 4FINA 3FYHA 4INAA 4J6FA 3LD9A 3U7RA 1JYFA 5TMEA 5LOVA 4E3ZA 1LTHR 3JVVA 5F2NA 2QX7A 3GPBA 3IPXA 1KA9H 5IF9A 3EIQA 2X41A 4KVZA 4UPVA 3MB8A 1KRXA 1KHHA 4A8JA 4HMOA 1VLVA 2B4KA 1ZBQA 2C4UA 3GPCA 4JFAA 1O5TA 1PX0A 1UCFA 1U1CA 5CVUA 1JZQA 3GOQA 3VMMA 2PX4A 1V7QA 5AW1A 2B8WA 4QNNA 3WDLA 1GEGA 2WHRA 3VDXA 2EWWA 4JI2B 1OIVA 3EAGA 4L85A 4NPHA 2BMEA 4LMAA 4MVJG 4UNSA 1E2QA 1GPWB 1YB7A 3NYQA 4FNMA 4ENVA 1HSOA 4RQAA 3TRKA 4KMSA 4EFNA 3O31A 4RWZA 2JFHA 1T1IA 2WIKA 2RD2A 4GLLA 5LQMA 2LR0A 4BUZA 4GMDA 4X65B 4QHYA 4GGPA 4POAA 2ON6A 4OLJA 1XJWA 2WSYB 2I4OA 4QEDA 3QEAZ 1YFKA 2JGDB 1P3JA 2JIZA 2NIPA 4X6UA 3ONDA 4Z4CA 3R6WA 3K1JA 4BQNA 2JCXA 3AVYA 3TWOA 2XQKA 1Q57A 1RXWA 3BFXA 2G1KA 2WTUA 4EPVA 1UEIA 3OPYI 4K3VA 1CLEA 5FFFA 4JASB 1LVUA 1WZCA 2W2OA 3AF5A 3IOCA 3BM5A 4KK3A 4GVXA 3R1IA 4OFWA 4XVRA 1SUIA 1E77A 3BB3A 5DKFA 3KQQA 4C4SA 5F7OA 4BXOB 3UXMA 3K8OE 3LIIA 3PC8C 3DE0X 3WK7A 2ORVA 4QOGA 1G5TA 5DNEA 3ZDRA 5JBIA 2VTDA 1M8FA 5KTOA 1QGOA 1GUDA 2HYDA 3FWHA 3KOZA 2WM2A 1Z33A 3UJCA 5BSGA 2QTWB 2XSZA 3R3SA 4LDRA 5AKJA 1W581 1OASA 1P1HA 2GUWA 3TPFA 1EWQA 1GRNA 3U3JA 5FUQA 3R9XB 3L05A 1N36B 1HPLA 5TS3A 5ESWA 4CKCB 1SQSA 5KYNA 1N3YA 4JAVC 4BKRA 3QNUA 4TMTA 2A5DA 4KXXA 4HZGA 4MHTA 2DFDA 3HUDA 2PZEA 2ZTLA 3N7TA 4MS4A 3AWDA 4ILEA 3AUFA 3I45A 4U4AA 3V8QA 2WAMA 1P0PA 2QN1A 1QP4A 1A8UA 4LRWA 3PGMA 4RC9A 1KY3A 1Q0PA 1O0CA 3L6OO 3GLGA 1H23A 1A5AB 2X5JO 4KGVA 3GLFB 3CRZA 2IV7A 3QI2A 5IJ9B 2QN8A 1FTGA 3O8DA 1NG9A 3MWGA 4M53A 5HNKA 3QVGA 1J8QA 4NBTA 4DR2B 2AQKA 2QT0A 1CHDA 1FYXA 1QIJA 2CJPA 2OYSA 3HYNA 3L02A 5J59A 2WU1A 5I4KA 2ZU0C 1YXMA 5LDGA 3O8CA 1I3CA 4B3MB 3OP4A 4Z9XA 1YVUA 2JRLA 3LDUA 1DRUA 2EJUA 3FBWA 1XDBA 1R0KA 3R0VA 1MENA 1TCBA 1UJCA 3BMNA 1SQ0A 3O47A 5A5DA 1XZNA 4RVFA 3HYSA 2BZ0A 2H4WA 4P4SB 3ZIUA 1CQPA 4ETWA 4Y2PA 1NJ1A 3AKEA 2I4TA 2LWIA 5ECDA 1E1KA 3ZU6A 1DT3A 1UC8A 4ZVMA 3GZNA 4UASA 1JEYB 4WCFA 4I9UA 4GNKA 3BKWA 3RU2A 3ZIAA 1UK6A 2HMTA 3E03A 1RHRA 4FBMA 3EEBA 4OHUA 4PHGA 4XW2A 4A1FA 1VKZA 3DB1A 1WUIS 4ON9A 2FDRA 3DXFA 3GLHA 3I6ZA 4RL4A 3W5VA 4ZT4A 3K6SA 3NVKI 1H42A 3NHJA 5JCXA 5EE5B 3M3HA 4EA7A 1ZCJA 5LQAA 5GZ6A 1EFPB 1Z5VA 2QM8A 4CLRB 1G17A 2WICA 4WPGA 3KKZA 3U9LA 3HLYA 3RK1A 2HHJA 1XDWA 2E4AA 4I3GA 5CT4A 2P9FA 1IY2A 1U2PA 4XM2A 1VRCA 1GTG1 4FP9A 1YMQA 3BJZA 4EY7A 4DLZA 2BEUA 3BSWA 4JU9A 3JYOA 5BN5A 1W9MA 1XNGA 2OSVA 3RK0A 4ANFA 3TG8A 1PSZA 5CBPB 3VVCA 4LYAA 1P3DA 1HMYA 1LPMA 2ROQA 5ER9A 1ZCAA 3RKSA 4D6PA 1FXWA 1DCTA 4HWKA 2QL6A 3KQHA 1ZS9A 4EPWA 4ZOEA 1ZNQO 2IV3A 4G09A 2CCKA 4W9NA 4KZPA 4KOAA 5BYAA 1E63A 1QO0A 1VPWA 4C29A 3AZPA 2FSSA 1H0SA 1VXRA 1W0JD 4BEBA 1D2NA 3DLTA 1IBRA 1ML4A 2NQ2C 2PD3A 5F35A 1ONPA 3JY6A 1KJJA 4NE7A 3CJQA 2P7HA 2IS4A 1QVWA 3RFUA 3B2EA 2XVXA 5K3FB 4KO2S 4RPKA 1LJLA 4FOSA 3UHFA 2DVMA 3LO5A 3AERB 5J2TA 2PEYA 4HWRA 3P8ZA 5JBQA 2PDAA 3U13A 3PK0A 3IR5A 3HPRA 3OTGA 4TVSA 5C35A 4ENWA 3OJCA 3ZWMA 1OREA 1E2DA 2X2OA 5EHGA 2PSFA 2Q8NA 3BK7A 1VL6A 4WGFA 5JWHA 4WKPA 3NC0C 4QDOA 2P78A 3SVTA 4NU0A 4LE1A 3ZBUA 1ISFA 4IXMA 2BFCA 2QTGA 2GNPA 1YL7A 1HTWA 4XIFA 4AJ4A 5IWAB 1E1DA 1SVUA 3PPXA 4FFWA 1J2RA 1YJXA 4OD0A 2NSHA 3VRHA 2PBRA 4C7OA 2HX1A 2P8JA 4MQEB 1RZRA 2MSLA 2OL4A 4M7OA 1U81A 1X7DA 3AR6A 4PINA 1RKQA 1NQWA 4CE6A 4YLYA 4I2NA 1XAHA 2OMKA 5CK4A 1IN7A 1JXOA 3R6TA 1ESNA 2OA0A 5DSZA 1PO7A 1RLMA 1W34A 2O3RA 3GEDA 1W6UA 4LTDA 2EZTA 2QAGA 2FLVA 5D87A 4N5IX 1D2CA 2VJPA 5FP0A 1G7RA 2YW9A 3AESA 4HR7A 1KI2A 3VFDA 3K09A 4UREA 4F4UA 3HRKA 4OQLA 3EQ8A 5TQVA 5TV2A 4BB9A 3A9TA 3EGXB 4KEAA 2KM1A 4XCVA 3EPJA 5IXYA 2B25A 2JATA 2JI6A 3SEAA 4BBAA 4YYEA 5LNK1 1FE8A 3N2NA 2QTTA 4JQOA 3DMHA 4N49A 4Y1FA 1FMTA 2E4XA 1JHMA 3QU7A 3BWYA 4OVKA 5FL7A 1UMKA 5HJ2A 3V3KA 4DCNA 5AICA 3A1NA 2R1UA 3V3TA 2DTEA 4E70A 5KNDD 3PEYA 1H1LA 1RPJA 2Q4EA 1WA5A 2X7JA 3CUTA 1IPHA 4LE0A 5EGNA 1OC4A 3FCCA 4CCAA 2V7EA 4CDRA 1ZXXA 2WHQA 3AUAA 3PHCA 2H00A 4JEIA 1ZCZA 3IAM6 5KYUA 3I2IA 4HGNA 4JLJA 4ARSA 5JWRA 4RVOA 4OI2A 3N3BC 4D3YA 2A4KA 1JLLA 2ECOA 2EJTA 2OVFA 3PDIB 3QUBA 4NEHB 4Z8XA 3KYDA 5EWJA 3L3BA 2R8BA 3K1AB 1KZ4A 2F1OA 2WG2A 1TVEA 3U9TA 3DBVO 2XUZA 3KQNA 1SBYA 4P2BA 2QMQA 4ZARA 1E20A 1ZWLA 1LD3A 3TUZC 2G71A 3KQOA 1ULZA 1XCBA 1CE8A 3ADKA 4PO9A 1G60A 3I4FA 4IQ8A 5E1MA 1ZU5A 1EQUA 4Z4QA 2VDJA 3IO5A 1QO7A 2PNFA 3ACCA 2VDPB 2WFMA 5BSFA 1KP2A 1QE0A 1SH7A 3TZQA 5ALQA 3F47A 3R9IA 1B73A 4FE3A 1AGYA 3TMYA 1WXEA 1RRKA 2HLPA 3BOSA 4BATA 1G5IA 1B3BA 2ONZA 2ZT8A 3FNGA 4W8GA 5IVDA 4R8MA 2GBLA 1KC1A 4LY3A 1JLRA 1R5BA 1CIPA 1ZN8A 3SQNA 1CJBA 4Q39A 4KFTA 2DUUA 3UJHA 1ZJ5A 2W71A 2ET6A 4NHOA 4G9EA 4MRAA 4F1KA 3M34A 1MEJA 4PFQA 7REQA 4WW0A 3EVBA 1KRWA 4AI6A 2JIRA 3A0UA 2X1HA 2X8JB 2XT9A 2AW5A 3T38A 4NRDA 5IUNC 1JSZA 3KSUA 1GKKA 3VO2A 3ZCTA 5IC4A 4XYGA 3WHIA 4WIAA 5B6PA 1XZMA 3Q1KA 3CF4A 1YUBA 5K0BA 3NATA 4D9EA 1P9WA 5IWCA 4CW7A 4MW0A 3LT0A 4HVTA 1ECCA 2O0KA 4G01B 3N9IA 5KTNA 3FUWA 4HQNA 2QZPA 3BF7A 3P9CA 3R09A 1DAHA 1IN8A 1PNQA 1EUDA 4UDOA 4IINA 2HBYA 8ADHA 2IYSA 2OM6A 3PRHA 1DJQA 1W35A 2HRCA 5ESXA 5FPPA 1M74A 2CL6X 3T9DA 1DXQA 1KNXA 2WU0A 3ZLUA 2J67A 5KSZA 1UKCA 2HJVA 1LDGA 1N5KA 2ZJ7A 4RZ2A 2DLCX 2I03A 3O3MB 1JQJC 4OSPA 3QKSA 1Z3IX 1AZWA 3X3HA 2I3AA 2Z1DA 5D01A 1MRNA 3SIPA 3VHRA 4EHIA 1SU6A 4HB3A 3PGA1 3ZDXB 1HFWA 5FUWA 2H3HA 3G0HA 2ZPUA 3HHPA 4U2EA 3C2QA 3LF2A 4OX9B 4V0ME 3JQEA 3UYKA 1P0CA 2O20A 1EUZA 1ZGBA 3OQ6A 2Q5EA 4G56A 5D8DA 4ARVA 3DEAA 4WLEA 1BXKA 3PA8A 3HJUA 1CUCA 1GA4A 5KSPA 4BWYA 2W2TA 4X93A 1YBFA 2YOGA 1N6PA 2C2MA 2F6RA 1FSPA 3O2SB 2ZIAA 3DDNA 4ZALA 5AR1A 3WGVA 3UWMA 1Z3CA 2WRZA 1Q20A 4TL6A 4D9GA 2GXQA 2KSQA 1Z2NX 1QCDA 4D57A 4HNTA 3RO7A 3FIJA 4YEDA 2JI7A 3RSCA 4AXBA 3UW3A 4Z4HA 2E4VA 4XWGA 1JN0A 5LYYA 4DV3B 4DMRA 3QUCA 5E1BA 1CW2B 2FZWA 4DCUA 1PF7E 1XF1A 2O8NA 2FR8C 3FTFA 1EXWA 4QYSA 1P2TA 1SRRA 4MWZA 4DCMA 3JSXA 5KX5B 1RXUA 4NMMA 4MWEA 1L5ZA 1Q19A 4HNVA 3BHMA 3O4GA 1DBQA 2R79A 1UC5B 4FYPA 2YIJA 3EDMA 4ZZ3A 4ZPXA 3BUSA 1YZNA 1NZDA 1P0IA 4JVLA 2AN5A 4F9GA 4QDZA 4LSWA 1DKMA 2MU1A 2WYVA 5AW3A 3HMKA 2H1HA 1E4YA 1CIJA 4H9GA 5F51A 1IY1A 1XRMA 3TLKA 2TECE 3EH2A 4FNAA 4L8WB 4FQ5A 5J4KA 3D7LA 3WQSB 1MB2A 4L02A 4CG1A 4HPXB 3LP5A 3W8RA 1UFRA 3IESA 2XUDA 3V8PA 1NU6A 3M3PA 2GXUA 4F60A 4M0CA 2QJRA 3O7WA 3SQWA 4L2IA 5I48A 2KPOA 3FTPA 3DULA 3WKAA 3GOHA 2RHMA 2FPKA 3NWEA 1Z26A 1Y5NA 4TXMA 1UWLA 1G9TA 3V6MA 4J8PA 3MGCA 1RFLA 2QJOA 2AX3A 3AEUB 3GR6A 5IH7A 2WFLB 3K31A 3WRVA 4BNKA 3VA7A 2PYZA 3MD0A 4UTPA 1QWSA 4HLCA 4QEZA 2IZ1A 3DMPA 1RM5A 3GXBA 3V8BA 3U1VA 1JPNA 4ZVRA 3S2EA 1SVNA 3NEAA 1WDKA 2YMLA 5E6SB 1Z5NA 3ASYA 4DIOA 1G291 4XDYA 2Y66A 2D13A 3T5PA 4Q9IA 3NT2A 3OWHA 3EPHA 4LVOA 2ZEJA 2GERA 2O0MA 5KWVA 2IF0A 4L7VA 2H1CA 3UJAA 1Z2CA 1C1YA 3RS9A 3E5RA 3VV3A 1WHTB 3D7NA 2A2ZA 2AOTA 3EF1A 3G2LA 4WLUA 3QFSA 5HIIA 2AGVA 2NO9A 4HD8A 3Q3EA 1QIKA 3FYUC 3QXHA 4N8SA 4R9NA 4OFXA 3HEBA 2OOKA 3NBQA 1NZFA 4C4YA 1SU7A 1V37A 3DAYA 3FNEA 3ONWA 4TN1A 2OXTA 5FUXA 4LW8A 2IOHA 3ZZUA 1OOEA 4MAMA 2H17A 2JLQA 1R9GA 1JAYA 1JEQB 1UINA 1ZONA 1SXJD 2P79A 3A0RB 3C8HA 3P4UA 3I9V1 1O94A 3JVDA 1UFQA 1RR6A 2ZSDA 3E9RA 2GPTA 2VPTA 3G6KA 1DKRA 3CVYA 3I9FA 1BWPA 4PQRA 4U7WA 3CNOA 4DYVA 2O05A 3GO4A 2Q0XA 4FUTA 4F21A 4WZ6A 1HDCA 3A8TA 4J1NA 3LPLA 2O5EA 1NUUA 3HPQA 2VNAA 4ZV7A 4WZBB 1KOGA 2Q41A 3IT3A 3TOSA 3IP8A 1SOUA 2YXDA 1VIVA 2H4HA 2W6ID 5EJAA 2H0QA 2PKQO 4HRVA 5BYJA 5J2TF 3SQMA 3QPAA 1ZSVA 3WLMA 2GESA 1QFSA 3R7FA 4UCFA 3F9CA 3OI7A 1P39A 2X1VA 5CU7A 1OXSC 2Q6LA 2GN6A 2ZSKA 4UARA 3KTOA 3DJFA 1E6UA 3SXPA 2AHOA 1CY6A 2XE8A 3TK1A 1C3XA 4UAVA 4NCBA 4OXNA 3OF3A 2WE7A 1OZAA 2QY9A 3EX7C 3K20A 1KVRA 1VJDA 1QCYA 1VGVA 1TYAE 2JI4A 1AQIA 3AQIA 2EFEB 2WF7A 3I42A 3JS5A 3OY2A 4GBMA 4O4HA 4PC6A 5ALLA 1YL6A 5E4FA 2NYUA 1OTHA 3ZWXA 4A3SA 5IUJC 5CA1A 2HIHA 1IJEA 3DF9A 3BMOA 2FQYA 3ICOA 1T2CA 3C3WA 1UFOA 3NXSA 1SOVA 4MULA 3PC3A 2OOSA 3O26A 3EJ6A 1BQEA 1SWWA 2FZCA 3JQ7A 4X8OA 3W5JA 4I50F 4TLCA 2Q9BA 2IOFA 1GG9A 3DTTA 3HVKA 3G5UA 4XDZA 4B6JA 1CUBA 5AVWA 1F2UB 4C4ZA 1R0RE 3BT7A 5ELMA 2WMNB 4EY8A 3W5CA 1MHPA 2I2XB 2PH7A 3HR8A 4OGGA 5AM3A 5B3JC 3FUXA 5FO0A 2ZJ4A 2O2IA 3KEOA 4CODB 4HN9A 3HR7A 3Q5GA 4QPNA 3WL5A 5A3RA 5C1BA 4ZIRA 2UUAB 5FTJA 1SCKA 4LDPA 1NMQA 1NLUA 1Q0UA 4PGHA 3DT9A 2PAAA 3DNPA 3WRXA 3ZE1B 2C9BA 5FIUA 5I4CA 2X9LA 3NVDA 1HDXA 2BBSA 4ZZ1A 3BBLA 4X20B 1SPXA 4CT0A 3I32A 1HDIA 1IUOA 3V55A 1ZGZA 3NZEA 3Q15C 1QR6A 3R5XA 1DJNA 4LHXA 1CZKA 2Z09A 4HEA6 2LNDA 3H42B 2W43A 4RD2A 5TLSA 2QI9F 1ZHOA 3VPAA 1WB5A 4IIDA 4D4MA 2OQ2A 3ZJ5A 3BG5A 2VRCA 5L9AA 4CM4A 1AKNA 2Y92A 3RCBA 3M6UA 3P45A 3S44A 5FTKA 3CISA 5CLFA 3MFQA 4Z1OA 421PA 1QQ6A 4RGVA 3L0OA 4LXHA 1KH1A 5C8YA 1KI6B 4P2GA 1GRQA 3FUVA 3NHLA 1SCNE 1OLUA 4H31A 3A9RA 2DFKB 5JANA 3L49A 4QBHA 3SPXA 3KSDO 3KP1A 4I4LA 2TMDA 3F67A 3NTVA 3DXXA 1UF9A 3Q4GA 1YKSA 2JBWA 4ARZB 1YJQA 3ORHA 4FGUA 4RM3A 2CLHB 2RMKA 3COPA 1S2OA 3V1UA 1C9JA 2F3SA 3U39A 3V7NA 3WA7A 3MCUA 1VKHA 2XHZA 2NUAB 3LT4A 3FJYA 3UY4A 5A0VA 4CHTA 1Q1ZA 1XPUA 3IP1A 3U5TA 1MO5A 4TL9A 3CNHA 2BV3A 3UWDA 2D1FA 1ZPDA 3HVHA 2AT1A 4TV8A 3KKLA 1A98A 5GONA 1EPUA 3AKZA 4NYIR 2PFGA 2PPLA 3UMYA 1DUVG 5HE9A 6REQA 4AB1A 2RGRA 3ZD7A 4YFVA 1E2LA 3H4TA 1YVPA 3QNMA 5K05A 4C2TA 3GWZA 1THZA 4JUBA 5J3JA 2C7VA 1OWNA 1UQUA 2WWVD 1NVAA 3HI6A 4MR7B 1C7QA 3MA0A 4MJXA 4IIHA 1T9HA 2IPNA 4LHSA 4UE2A 4MWDA 2XNHA 1H4TA 4C6HA 3OJWA 1ISGA 1TC2A 1XN4A 5DYWA 1CFZA 4EPXA 2VJKA 3LWZA 2NXCA 1KDOA 5B64A 1NVDA 3LE8A 3LG2A 4TQUS 5TEVA 2P6RA 3ERCA 1E62A 1VJGA 4WCVA 5SV2A 4C0WA 1Q95A 1Q44A 1TRHA 5B7PA 5HPYB 2PD4A 1J70A 4F2DA 1PQYA 5AJXA 2ID7A 3X0DA 3EXG2 1FUEA 5HGXA 1WU7A 2FRDC 1A4IA 2GCNA 4GP9A 1FNBA 2J32A 2ZUCA 4ZV9A 2X86A 3VHXB 3KHSA 3LDGA 4WK4B 2FZ4A 4EX7A 4W5WA 3RC1A 8OHMA 2Q29A 2PS9A 2XQIA 3OZWA 2XTNA 4J0QA 4AQDA 4EUEA 3RYHA 1EVKA 2P6PA 3S7TA 3QSGA 5EKUA 4KR7A 2MSDB 3T9CA 1PQUA 1KAGA 2IPMA 2P77A 2YR0A 4TYQA 4EEZA 3KKMA 3QX3A 2O8CB 3C6KA 1W8IA 3LO8A 1YB1A 1FDSA 2CHVA 1R6XA 2ZS9A 4MVWA 4JI1B 2I1LA 1OAOC 2QS9A 3P9NA 3FETA 4UU7A 4CDGA 1TF7A 1D8AA 2H4YA 2V55B 4M1WA 1SG6A 3K6JA 4EJSA 1R9JA 4NZOA 3OEHD 1T8WA 5H8WA 1DC6A 4ZEXA 1KO1A 1U9YA 4XAQA 2JKYA 3LBAA 4D3XA 1F4LA 3MLBA