5JLJA

Crystal structure of kpt8602 in complex with crm1-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
202
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Next-generation XPO1 inhibitor shows improved efficacy and in vivo tolerability in hematological malignancies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jljA00
5FTNA 2O8EA 4LCBA 1N3BA 2X19A 3IQXA 1T3LA 2EWVA 2VEDA 3LVQE 4DBLC 3PG5A 1N6OA 2DBYA 4NHOA 3EZ9A 5FUWA 5KSYA 2X77A 1Z0FA 1Z83A 1P60A 3SJZA 1YZKA 3C5HA 1B0UA 1DARA 4TLCA 4G01B 2J59A 2CNWA 2D3WA 4W5HA 3MG9A 2WICA 5FFMA 3U3KA 3HU1A 3F8TA 4KVGA 1S1CA 1QF9A 1XNJA 4DLVA 2JLVA 3QXSA 2ZJAA 2ZPTX 3GJ7A 5FBWB 1YU9A 4TLBA 4IOLA 3V00A 1ZM4A 2ZE8A 3I4LA 2ERXA 1P9NA 3V4RA 3W8NA 1FTNA 4DT1A 3K0FA 1U81A 4U5XA 2IWRA 3BH7A 1CJUC 4B32A 4BASA 4Q4AB 4TYWA 5M04A 2ODWA 3T1TA 5AUPB 2XJ4A 4PC1A 2ZS8A 4KYIB 3FHTA 4AWXA 4UXJA 1D9ZA 4DDUA 3BFXA 5BQ5A 2QG6A 4RD4A 2QZ4A 4BFYA 5KYKA 2NGRA 3X1YA 4YONB 2YOGA 2A2ZA 2VSOA 5FL7A 5G53C 5F98A 3JVVA 4LHWA 1COWD 3CX8A 4DB2A 2JLYA 1HEIA 3BB4A 5B57C 3PUYA 5JZVA 1OB2A 1KMQA 1ZUHA 1D2MA 5FBVB 3QG1A 1SKYB 3ECCA 4IW3B 1E9DA 1P72A 5DSZA 3GLFA 1WBDA 4QGHA 1R0XA 2BJVA 3HPRA 5CIQA 3WXMA 2HCJB 2RGBA 3H4MA 1JALA 3TR0A 2ZE7A 2F1JA 3L0SA 3R7WA 5KNBA 5L8VA 2QAJA 4DSOA 1JR3D 4URYR 1XPUA 1EWQA 1E79A 1YR6A 3KQUA 3MJRA 3NBZC 2QL6A 2PCJA 5EE1A 2EFEB 1OFUX 4ARZB 1Q44A 1CJVC 1PJRA 2CCKA 2MSCB 3FFBA 2OT3B 4B3DA 2AFIE 1KO5A 2E87A 1A5TA 2ERYA 1N6KA 3JZMA 3GLHA 3I62A 5DI9A 5GJWC 4N0EA 2GRJA 2PLFA 4DCTA 1KI7A 3EPJA 1XCMA 4PO1A 4LJ8A 2WV9A 4NTZA 1JQJC 3FFAA 1TF5A 2XNDA 4TMWA 4AKHA 1KDRA 4WXPA 2Q3FA 4HAYA 2C95A 1BH2A 1DEKA 1FP7A 4ESHA 4KSBA 5GVRA 4EAQA 4M8NE 2D4HA 2GAOA 3VX4A 1CJKC 4M9SA 2IXGA 4ZDKA 3UXMA 4LHZA 4URWR 5AJZA 5FPYA 3GLGA 3B1XA 1IXZA 3TQCA 1ZM3A 2GCOB 3W5JA 2NQ2C 2ZM5A 3OEED 3LLMA 2WWHA 1SZPA 3NG1A 3KXIA 2WAYA 1E0AA 1RJ9B 2OG2A 2V6IA 4O25A 3THXB 3IIKA 5ELXA 1P5ZB 2OUKA 3EW9A 1N0WA 1VHTA 2ZRCA 4G1UC 4LBVA 4ASUA 3BJIC 5TB5A 2VRWA 3EPKA 3VNUA 1CRPA 4DLZA 2A9KA 1A2BA 1OYWA 3D31A 4GZLA 4R2HA 2PCLA 2IYXA 3OESA 5CJPA 4A6XA 4K46A 3B13B 1R7RA 1HA3A 2PJZA 3SJAA 4BFSA 1OYYA 2ZYTX 1WCV1 4GMXA 1IM2A 3ND9A 1K6MA 3NEJA 3CBQA 3GLIE 3CWQA 3W34A 4V0LA 1Z28A 5TXGA 4NDZA 4Q01A 3ZYCA 2OAQ1 2F6RA 3VHXA 2VF7A 4CEJA 3LLUA 2VP9A 3OAAA 3L2OB 4O0MA 3NWJA 5E7MA 2GVZC 3HWSA 4YDHB 5CB6A 4MITA 3IHLA 4KFRA 3PXGA 1ZD9A 4JSYA 5LPNA 3KX2A 4C0BA 4OK5A 3TSWA 4Q19A 3THWB 4GP7A 1DAEA 3AB3A 4G5SA 3A58B 4M9ZA 5FTKA 1GNRA 4QNRA 1ZNZA 1A1VA 4US2R 1Q1BA 2WWYA 2OM2A 4LYJA 1Z3IX 4NYJQ 1ZCAA 5D3QA 1O87A 1G3MA 1UFQA 1JECA 2F3RA 3UMFA 3T1OA 2OBMA 4XWKA 4C0KA 2XOKA 1R4AA 4MYTA 2ZI3A 3K09C 3Q8XB 4QKQA 1L8QA 4FN5A 2OFXA 4UNNA 4I1UA 4CYMA 5AK0A 4LV6A 1GZSA 4XH9B 4MKGA 3Q5EA 3AKCA 1T9HA 3KUCA 1SVKA 4AK9A 4X8OA 4HAXA 5DNYB 5B2ZA 1YZNA 2ZE5A 1E4YA 4B2IA 1TEVA 2QE7A 4TMXA 4TZ6A 2PLRA 2PJRA 3K9NA 2AWNA 3QXHA 1J2JA 1GTVA 2GDJA 4BRWA 4URZR 4GSYA 1L4UA 4PZYA 5FTLA 1O3YA 2AXPA 4D0NA 4KODA 1E2KA 2ZS7A 3LX5A 4JJKA 2YYZA 2UZ3A 2Z4SA 3R9IA 3AVWA 3I1FA 5JJIA 4MRRA 1ZYUA 2BMDA 4DB4A 5KU1A 2QNRA 4B44A 2F43A 4JVNA 1J8YF 1G8FA 2X1VA 4CZ2A 1DVRA 2CVFA 1QZXA 4LJ9A 4ZPXA 3AP2A 5L3SB 4DXAA 4XSHA 1X3SA 3FHCB 3PUXA 3QUSA 4TLEA 3B9PA 2R2AA 2ZRGA 3ZZ0A 4KLZA 4POAA 2GXSA 4BLQA 1MABB 1H8HA 1NP6A 4V0ME 4JLAA 2XZLA 1AZSC 4RD0A 4PSVA 3G0HA 3ETLA 4FCVA 4QFMA 3A4MA 4O3MA 1NVUQ 2GEDA 1XMVA 3EXAA 3GLIB 1M6NA 3DZDA 2LWIA 3LQQA 5J40A 2W0MA 4S2EA 2ZETA 3K0EA 1R6BX 1CU1A 4B75A 2QMOA 5BN5A 3ADBA 4JLJA 3B7GA 3N2EA 2JJ1A 1NKSA 2EFGA 1G5RA 2KE5A 1MH1A 1JJVA 1RKBA 2OO7A 5IHPA 4DLYA 1R5OA 3E70C 1EFRD 3M4YA 1S3SA 2IYZA 1DO0A 3B82A 2YWFA 2ZJBA 1KO8A 1KOFA 2PBRA 2ZRKA 4LBYA 3SBDA 1KO4A 4OHZA 4IEEA 1G19A 4Q1BA 2QAGA 1E2QA 2OCAA 2IEYA 1KI3A 2ZI9A 3SE0A 4UKDA 1K5GA 2ZR7A 3CRVA 4QJ3A 2XZPA 5B58C 1UKEA 5JCZA 1F3OA 2ZI6A 3VR3A 1HURA 3FMOB 4PZZA 4Q4JA 1D2NA 4EFNA 5JSZB 4Q1EA 3LXRA 4FCWA 2C2HA 3FB4A 5LB2A 1CTQA 4TTPA 5JWOA 2IYRA 1CR2A 3EA0A 1IOZA 4HAUA 3HYRA 4PPQA 2QPOA 3UIEA 1BYUA 1ZC4A 4LUCA 2N42A 2PZGA 2JGNA 3EA5A 4F91B 2E1RA 4Q9HA 2DWPA 1G41A 4B35A 3AF3A 4ZI3A 4N0DA 2VP5A 3I5YA 3BS4A 2JDID 4FIDA 3IHWA 4IOMA 2WWWA 3W6PA 2XTNA 1NIPA 4MGZR 1FNMA 3IIJA 1RFLA 3WY9A 3MLEA 1KI9A 2RGDA 3A37A 4CT4B 4EDHA 4AKGA 3THOA 3QF4A 4P4UA 1CXZA 2HLDA 4YXWA 3T5GA 4JL8A 3AVYA 4QHTA 3AUYA 1Q0UA 3ZZUA 3FDIA 2QY9A 1KAGA 1YZUA 1GVNB 4HB4A 4LWZA 4Y0AA 521PA 3N5CA 3W6OA 2ZRMA 1QVAA 3K0CA 2WSSA 2V3CC 1UEIA 3MRSA 3FKQA 3QXXA 4UJ5A 4DKXA 5HPYB 2O8DB 5BN4A 4TQAA 1JR6A 1KAOA 1U99A 2CE2X 2CK3D 1ZJ6A 2Z0MA 3BE4A 3U3MA 1KSJA 2V7QA 1G9XA 3EC2A 3DVLA 1VCIA 1I4LD 2ZJ5A 3EZFA 5EE0A 2ZITA 1EGAA 4TSFD 1U0HC 3BD9A 3SFVA 2WWFA 2QQEA 2VYFA 2ORIA 5FOVA 4UNQA 2WAXA 4C9BA 3B6EA 1MR3F 2G1KA 4RZUA 2ZRPA 1VTKA 2ZI7A 1N6IA 3QBTA 3C4JA 1MO6A 1KSFX 1E2LA 5JI2E 3SR0A 1G4AE 4MKIA 4QL3A 2V54A 1LF5A 1EFCA 4DEYA 1Z07A 1V5WA 1W36C 1KK0A 4Q7MB 2EFDB 4LC0A 1NLYA 3IQWA 4QBGB 5L3VA 1YR9A 3KQHA 1XWIA 3PUVA 3EARA 2P0EA 3CRQA 1LNZA 3KB1A 1KTVA 2B8TA 2F1HA 3MWJA 4FMDB 4OJKA 4WA7A 2ZSDA 4GOJA 2HV8A 4MQBA 1W4BA 3LDAA 1OHHD 2YOFA 4OI4A 5CM9C 4DHEA 5B30A 5C2JB 1A4RA 5SZHB 3T1QA 1S2MA 3ZIAA 1LB1B 3DM9B 3U44A 4LHXA 4F4CA 1COWA 4CW7A 3M0EA 2ZEJA 1CBUA 4D4KA 2ASEA 3GJ0A 1ZM9A 4AG5A 1U9IA 4NBSA 4UNPA 2MSDB 3FWYA 1KI8A 2EWWA 3PEYA 2J46A 5EE9A 4KSCA 2IYUA 1XMSA 4L16A 1UADA 4JL6A 4AKEA 4HZUA 2P67A 1Q1ZA 5JEEA 4EKDA 2R6FA 1JR3A 2IC5A 5JLJA 1UKVY 4ILEA 1N25A 5DYGA 1RYHA 4K81B 3TH5A 3X2SA 1E2JA 2HJGA 2N46A 1TL7C 3WYFA 3R9WA 4Q7JB 2O8BA 3GJXC 3C41J 1XTQA 4YLGA 3IDQA 4PPFA 3T06B 4QRHA 1ZBDA 3QNUA 1M7BA 4ZDIA 1FUUA 1G64A 2V1UA 1G7RA 2WKQA 1W5TA 4RFSA 1XD2B 5J4KA 4LRWA 1OJLA 4FW9A 3HU3A 4Q9IA 3CNOA 1GWNA 4H1VA 4ZDJA 1T91A 4F7WA 4GOKA 1EXMA 1VCNA 3CRW1 4G3XA 4F92B 3FGNA 2PEYA 2IYQA 2HF9A 2Q9CA 2YWEA 3DHWC 5E95A 3P4YA 4HAVA 2O8FB 3RLFA 1G3QA 2HYDA 2FN4A 5FUYA 3CX7A 1ZCBA 3OIVA 5FPTA 2NPIA 2P6RA 2BCGY 2IXEA 3AVVA 2O0HA 4Q1CA 1FOEB 1XU4A 3Q7QA 2WJYA 4HDCA 1IQPA 3HR8A 5JHHB 4JKYA 1JJ7A 5JS7A 1EX7A 2WHXA 2G77B 4NYMQ 2J7KA 2ATXA 2YINC 3BXZA 3CH4B 1P2TA 3RC8A 2BV3A 2H17A 1OXTA 5JFGA 4IKEA 4TMKA 2UZIR 3VMFA 2BKUA 4AG6A 1OXXK 3JVUA 4TZ0A 4Q4HB 2YC2C 1M34E 1RE0A 5EXPA 2OBNA 5J47A 3G82C 4YMUA 2G9NA 3ZVRA 4TLAA 2XTZA 4BGDA 4P4TA 2ZI5A 1EFHA 3A4LA 3PV0A 4QGAA 3KJHA 1T8UA 1OIVA 1XTIA 1Z22A 2DWOA 3GEEA 4LK2A 3L8YA 5JJKA 1E9EA 1KNQA 3Q5DA 3CRRA 4E07A 1DO2A 1G7SA 2P6UA 3OF5A 2V9PA 5LBIA 4C0JA 4F93B 5JHGB 2PMKA 4ARZA 3UKDA 2JIZD 1LS6A 2FEMA 1Q21A 2VP6A 1E2NA 4MGYR 2VL7A 1I4DD 5DLQC 1XPOA 2CLSA 1W2GA 3NVAA 1KK2A 1UBCA 1DAGA 1TUEA 1NJGA 3EIQA 4JBWA 5A5GA 1WBBA 3AVOA 2DCUA 3ZD7A 5FOWA 3DMNA 1VIAA 1NBME 4L4UA 4WZAE 4B3GA 3QXCA 3WP0A 4YMTA 2VSFA 4HAZA 5IRCD 3GD7A 1ETUA 2QI9C 4XTCS 2ZJOA 1KK1A 3AV0B 1KDPA 2V6JA 4D80A 4DEXA 1DG1G 3BIFA 3N70A 4PX9A 3A4NA 3GMTA 4Q21A 3SZRA 2CE7A 2ZU0C 3PJRA 1NI3A 1W4RA 2BBOA 1QHHB 2BMEA 2OESA 4CIDA 2ZVPX 4PPNA 5C1BA 1NN0A 2C78A 5DI3B 1KKLA 2R6DA 1CJMA 2E9SA 3LX8A 3SQXA 2GCOA 2OILA 3I61A 3LBNA 3CB4A 4HLUA 4HLCA 4CEIB 4RZXA 2FEOA 3QE0A 4DRZA 4A8JB 2GKSA 4JLOA 4UQOA 1FQKA 3RANA 4JLPA 1CIPA 3SHWA 3LQRA 421PA 4IVRA 3KJEA 2WJGA 2OCPA 1LW7A 1E2GA 1OLOA 1QHGA 5HCNA 5KDLA 1KJWA 3AF0A 1ESMA 4AY2A 4M9XA 4M1WA 3C8UA 1N0UA 4HB2A 5KO2A 1VYUA 3CKLA 1N5LA 3DDCA 4D81A 4I1OA 4M0LA 1N6HA 2N1BA 3AM1A 1N5JA 3CR8A 2DY1A 1WMSA 3VTKA 4TMZA 2FJUA 3MMPA 1ZAKA 2W6JD 4PPGA 1RPZA 3CUEF 2GXQA 4CGZA 4OQMA 4IDOA 2F3TA 5K8IA 2REXB 3PUZA 1TMKA 2JEOA 5CYPA 1FZQA 5EQTA 2QORA 2CDNA 2QAGC 4GDFA 2JLUA 4MRPA 1IY2A 3HPQA 1E94E 1P2UA 1NLFA 2D2FA 4OHYA 1UJ2A 4GZMA 2HEIA 1OIWA 5DISB 2CJWB 4IDQA 3TK1A 4TL8A 1HT1E 3THWA 2YC4C 2BC9A 1FFHA 4B3CA 4NMMA 2D7DA 4Z1MA 2Q0HA 3B85A 1D6JA 1XEXB 5J4VA 4MUBA 3WP1B 2Z5FA 4GP6A 1F2UB 2QTVB 3CX6A 1RIFA 2XX3A 2A3RA 1CP2A 3ADDA 2YV5A 2D06A 1AS2A 2HJVA 1CJTC 3W6NA 5CJ2A 5FTJA 2K5UA 3IBGA 2AD1A 1GFIA 5EUMA 4L9WA 5SZIA 3TE6A 2G88A 2J45A 3AKEA 1R0WA 4DC9A 1ZUIA 3IGFA 1W4AA 1EK0A 1PUJA 1EFRA 1R0YA 1P9RA 3PQCA 4BLPA 4JVLA 1VCMA 3I92A 1OIXA 3ADKA 1Y3AA 5B64A 3WMGA 1ZIOA 4D25A 4Q02A 3RRZA 4FCTA 2VIIA 5KNDA 1KSHA 1CR1A 1ZRHA 4IEIA 3K70B 1JXMA 5K8UA 1HY3A 2IBMA 5FPSA 2XXAB 2C96A 3CZPA 1E2DA 3UATA 2ZYUX 2XSZD 2WMOB 3REFA 1LFDB 2I1VB 3MCAA 4DZZA 1Z63A 4Q5IA 1AIPA 1GKUB 4UJ3A 1W46A 1YRAA 2YOHA 4HUQB 2GHIA 2RH5A 1BIFA 3NHBA 5EZ6B 4LOAA 3FE2A 2AD5A 3RS4A 3K0CC 4DJTA 4TTQA 1H65A 5KDOA 4LYFA 4HDOB 5H8WA 5L3SA 4A92A 2QBYB 4IFBA 4MUAA 4KBGA 2ODEA 1KY3A 5KUTA 4JT4A 4RZ3A 5KHOC 3THYB 2XITA 2ONKA 3MD0A 4FI3C 4LBWA 4HATA 5KSPA 3UPUA 3NTUA 1XXHE 2BKEA 1PUIA 3ZS8A 2WJIA 1XCGB 3U6KA 2J0VA 3F5FA 2KWIA 1HE1C 4GNKA 3GLIA 4M1OA 2W2XA 4KVAA 1G1MA 1W49A 5AJYA 2BBTA 2LKCA 2C9CA 2CCGA 5BYJA 2R65A 4HSEA 3AGPA 2WSMA 1W0KA 3EWSA 5EE5B 4PQYA 4TWZA 4XWAA 3AEZA 5EZ5A 4C0AC 2IS2A 5GJBA 1E1QD 2ZRAA 1BMFA 1NBMD 3FMFA 4TT3D 1KIMA 4PC6A 3AQ4A 2P2LA 3H0KA 2YHSA 4DUGA 8OHMA 1VYVA 4KAXA 4P4SB 1CS4C 4XD7A 2BCJQ 3CIOA 1OXVA 4C30A 3K70D 4RCZA 2CK3A 5AJXA 2GEUA 5AUNB 1AS3A 1XF9A 3TUIC 1IN8A 4Q9JA 3KTAB 2BBSA 1VG8A 2OSBA 2BBWA 1KHTA 3ZQ6A 4R2IA 1Z6AA 3L0OA 3OFNA 2Z4RA 2C9YA 2DYKA 1ZU5A 3VR2A 1XDBA 1UKYA 2CHVA 1IJFA 4EFMA 4XJXA 1JPNA 1Q1QA 3C15C 2ECKA 5FOTA 2QP9X 1WDTA 4IDNA 1L7VC 1U9IC 2KI5A 1VDZA 3BK7A 3R20A 1C1YA 4EPVA 4NCJA 1M1YE 3RSOA 4DCUA 4C7OA 3IEUA 3O47A 1X1SA 4TL9A 4PO8A 2IYTA 1U98A 4C2UA 1G20E 1NVXQ 5CDFE 2W2TA 4ITRC 4E5UA 3TLXA 4GPTA 1Q12A 3SJCA 1NJFA 3CWZA 2ZI4A 1X86B 2X2EA 4EPWA 3FPAA 4ZCLA 2AKAB 2DPXA 5KNCA 4IDHA 3L0IB 4U02A 3RWOA 5A4JA 4LHVA 4PTLA 3LA6A 4IJMA 1P6XA 2GBLA 2ZRBA 3Q85A 2WIAA 1CKEA 5L3QB 2FOLA 1A82A 5E7JA 5JWRA 1OHHA 2JLQA 5EXXA 1ELOA 1W4CA 2AKYA 3SBEA 1T8TA 4EPRA 1Z0IA 1LS1A 4ACBA 1XEWX 2J3EA 2Q3MA 2REBA 1E69A 1Q3HA 4FD2A 3SN6A 3GLFE 3ICQB 2F1IA 1IY1A 2ZVQX 2FA9A 4NYMR 3ZD6A 1CULC 4QOSA 4PHHA 1G6HA 2JJ2D 1JAHA 3OE7D 1VCOA 4DLUA 4KO8A 1MV5A 1X8LA 4IXMA 2FH5B 3BORA 4Q03A 3GEIA 3RS7A 1J8MF 1G8PA 4LYHA 2P3SA 2QRNA 3CONA 2D7CA 1HTWA 1KZGB 1ZW6A 2CLDX 5JEDA 1SHZA 2KJQA 1DAKA 1J99A 2J5XA 3OEHD 2R6GA 3BRWD 3GLHE 2CLCX 5F2EA 4NZYA 1T6NA 1EX6A 1RW4A 2F1RA 4Q66C 3QKSB 3TRFA 3TBKA 1UEJA 1TQDA 1WRBA 2EU8A 4M21A 3W3ZB 4I1VA 4LC1A 1P2SA 2IUSA 1UF9A 2OCYC 1FMLA 5FI1B 3MWYW 5DN6D 5HTKA 5E7IA 1AQYA 3CF6R 4PSKA 2AHOA 1KI6B 3NXSA 3KKMA 3CPEA 5TY0A 4DDTA 2FZLA 1TU3A 3RNLA 4A2PA 2AR7A 1W44A 2IYSA 2AL7A 4B47A 5C4GB 2WOOA 4UXHA 1NNEA 3L8ZA 3QQ5A 1K5DA 2GAAA 2ANBA 1UKZA 2WKRA 3FOZA 1ZP6A 3GJ4A 2HXYA 1LTQA 5HE9A 4WBSA 4BFZA 3LXXA 1N5IA 2OLKA 2QRZA 1GG2A 1TX4B 3MUFA 3KQLA 3QKUA 2BHRA 5P21A 1S8FA 2RGCA 1SULA 3IBYA 4M1KA 3C5CA 4DT1B 1EFTA 3K0FB 4BZPA 5HKKD 3DO6A 1H8EA 3SYKA 1MT0A 4TMTA 3PFIA 4KU4A 2BOVA 2Q21A 4LYAA 3RS3A 1VHLA 4HUTA 3BBPA 1NVWQ 2OXCA 1ZINA 4XIGS 3VU9B 4FMBB 1JPJA 1QHSA 4U7DA 2EVWX 2ZAMA 1UAAA 3BAFA 5H68A 1IY0A 3TIFA 4OI2A 1GM5A 4Q7LA 1ZMXA 3P26A 4QJ4A 4G5RA 1UPTA 1NN5A 4HLUC 1Z8FA 1P62B 4OHXA 2J7PD 5KTYA 3QY0A 3IEVA 3VR5A 2HT1A 5F9FA 3GQBA 3AKYA 1ONBA 3CLVA 3WBJA 1FL9A 2JIZA 2IA5A 3QPVA 1X8KA 4QGGA 1SVIA 3HDTA 4O2RA 1XZPA 3E1SA 3U7HB 4N3NA 1OT3A 5JWHA 3R7WB 4RY2A 2QGNA 1MRSA 1NSFA 2ZIAA 2FV8A 4M1SA 1XEWY 1G7CA 1F2TA 2B7BA 1A2KC 2Q6TA 2R9VA 3QEOA 1XD2A 3R9XA 4D82A 4URUR 1W36B 4B33A 1X8JA 4CF7A 3A6PC 2OFOA 2GJ9A 4HLDA 4PSAA 3NDBB 3TUJC 3MFYA 2QROA 2JJ8A 2ZRHA 4FMDF 1TQ6A 2FFQA 3MJHA 1YR8A 4AI6A 4A2QA 2O8FA 2AXNA 1OKKA 4XVUA 4II7A 3ADCA 2FZ4A 3GJ3A 5CYOA 3GLHB 4EUNA 1PVOA 1L4YA 1GIAA 3A36A 2HF8A 3P4XA 4A9AA 2H16A 3LW8A 2HT6A 5AR1A 4DLSA 2XNSA 4Q1DA 2GZAA 4QHYA 4A15A 2YVUA 4A82A 4URVR 4N1AA 4EJSA 2GNOA 2PT5A 2ZU6A 4QNMA 1QHXA 4IOJA 2IWHA 1BS1A 1HV8A 3H1TA 3RAPR 2XB2A 4GRAA 3UMSA 1TU4A 1SVOA 2ODBA 1E1RD 1LVGA 2CHGA 3H84A 5J4YA 2H5EA 5FL7D 1ZNYA 3MGCA 4NPHA 3U4QA 2C99A 2QM8A 5KPDA 3Q3JB 3M6AA 4JVMA 5FOUA 2A7QA 4TYYA 1QRAA 4MH0R 1M8PA 3Q72A 5EP2A 1W0JD 3BB3A 3EZ7A 1R8SA 2W6JA 3I32A 1XTRA 2OCBA 4JVSB 5FH9A 3P32A 3B60A 3QVVA 1SVLA 1E2FA 2R62A 2IYWA 3K0SA 1BKDR 1GAJA 3VKGA 3UANA 3W9YA 2RAPA 1E79D 2H18A 1B23P 3NBXX 4MRVA 4Q1FA 1W36D 2PZFA 3UG6A 4MGIR 5C46F 1KDOA 1T3HA 5DGXA 2MMGA 4ZDWA 1SXJA 3ZZTA 2CXXA 1BYIA 2ZYVX 3DOEA 4C0LA 1XP8A 1Z08A 2JASA 2ZJ2A 3FYHA 2J1LA 2ANCA 3B8HA 4ESVA 1Z5ZA 3TMKA 1JI0A 1QHHA 5DYIA 2FFHA 2WWIA 2ZR0A 3IPXA 821PA 1SHKA 1EG7A 1E2MA 1NY6A 2PH1A 3D6TB 5DI3A 4EQ6B 1YZLA 3QXJA 1WQ1R 2EYUA 3V9PA 1Z6TA 4B73A 5BW8A 2FE4A 5UKDA 2XNDD 3K0AB 1UBEA 4CEIA 1MO5A 1HQCA 1U8ZA 4F4JA 2QSZA 2DFLA 3PVSA 3QF7A 3PEWA 5DHAA 1GKIA 4A8JA 5LD2B 2ZUBA 1TADA 2W00A 1KNXA 1N0VC 2YWHA 1OH7A 1U90A 1XMIA 4YMSA 3SYNA 3I72A 4YMVA 1AKYA 1E0KA 4OJQA 2WVJA 3QG5A 3AF2A 2CHQA 4HB3A 1JB1A 3J81k 3U7EB 3ZGXA 4MYCA 3WNCA 2BDTA 2XSZA 1OF1A 4DCNA 1YQTA 4FINA 3AF1A 4Z54A 1RVDA 1T5LA 4ASUD 2BJWA 1FP6A 1XJCA 2I1QA 4KFSA 3IILA 3HR7A 1U8YA 4B48A 1FW6A 4A2WA 1KY2A 1QBKC 121PA 4KFUA 3A1TA 4G0NA 3QVUA 4M22A 4PAQA 1N6LA 4JIMA 4ZKDA 1TUIA 4RJLA 3GFTA 4NL4H 4Z8YA 1VG0B 1E2IA 4CT5A 2ZYWX 2OEPA 2Z6VA 2VBCA 2ZJZA 4PQFA 1UDWA 2CL6X 2WMNB 3WRYC 1FNNA 2GJKA 3ZDQA 2YJTD 4BUJA 4E22A 4Q47A 1S9HA 2B6HA 5CK4A 5JMTA 4JT2A 2IF0A 2CJWA 1II8B 1WF3A 3BC1A 4Q1AA 3VQTA 3K9GA 3LO5A 2O0JA 5FBLB 4IVPA 1G5TA 4TYQA 3ND8A 1G18A 5CLQA 4US0R 1Z47A 5HR5A 1XEXA 2XEXA 3OAAD 5E4FA 4KI0A 2AFHE 2ZTSA 1XX6A 4HZIA 1F2UA 3K8YA 1IN7A 2JLRA 2DR3A 2GILA 3IUYA 4QBHA 5FTMA 4MDFA 1NMXA 3SHFA 2OAP1 3LH5A 1OV4A 2WBLC 4B3XA 2ZANA 4D4LA 2A5FA 4QJ5A 4URXR 5LDDC 5KOYA 4JLNA 1P75A 2ZXUA 3LBHA 2GZHA 4V0KA 4I4LA 3W5IA 4K8OA 2NPFA 1YRBA 3ZVLA 4DDWA 1OH8A 2QP4A 1AS0A 3A8TA 3VR6A 2A5DA 3EASA 1PLKA 3QBVA 4TT3A 2GBLC 4I99A 2X8AA 2YNMA 1SVSA 1IXSB 1F48A 2HXSA 2QM7A 4RKEA 4CDGA 1DAIA 1KI1A 3NKVA 2XXAA 1NIJA 1Z06A 2I4IA 3KUDA 4Q4AA 1E98A 3T34A 2FGJA 2QU8A 3U6BA 2JATA 3ONWA 5AWFC 4BQSA 3OEEA 4PC7A 4US1R 3WRXC 4E09A 1Q3TA 4HUQA 2G6BA 5TARA 4LX0A 2R6AA 5CIWA 3I8XA 2QMHA 1U0JA 2IK8A 1ZNXA 3LWNA 3ZJYA 3FTQA 3TSZA 2RGNA 4WW0A 1NN1A 3AH8A 3CZQA 1K8RA 3KKOA 2QBYA 1P61B 5K8TA 1NSTA 3EAQA 2HUPA 4OQXA 2W2VA 4CRWB 4Q4JB 3ZVNA 4HB0A 2VH5R 2D74A 3D7MA 2J0SA 4JLMA 3SU8A 1KJYA 1LV7A 2WM9B 4ABYA 5FPKA 4JMPA 3C7KA 2ATVA 2GCNA 1KZ7B 3UWKA 4BZQA 2IYLD 1FQJA 3GEHA 4C0HA 3CRMA 4TYPA 1YZTA 4NH0A 3K9LA 3BWDD 4RCYA 3SYLA 4KITB 1XD8A 1AZTA 4DWJA 5C18A 2OLJA 1VPLA 4TMVA 5IT5A 1J70A 1H8HD 2QENA 3T35A 4A6PA 2IEZA 3OE7A 4AD8A 4WZ6A 2LCFA 5DIFA 2IX3A 1D2EA 4GI7A 2AK2A 5L3RA 3GJ5A 1IONA 1Q20A 4B3FX 4P4SA 2PMDA 4EPTA 1DOAA 4B3BA 1GL9B 4OQFA 2JCSA 5KPJA 4IDPA 2O8CB 3QF4B 4D2IA 4DLRA 3KTAA 5G41A 3ZVMA 2AWOA 3OEHA 1SKQA 2GTPA 1P73A 1TQ2A 2VO1A 3EX7C 2J41A 3LV8A 1GL6A 3AGQA 5DE3A 1E0JA 5EP4A 3TVDA 3OIWA 4DCVA 4RSGA 1D8TA 5TVKA 5J4HA 5EP1A 2KBEA 1RJ9A 2YKGA 1TF7A 4W9MC 3THXA 1X6VA 2FPMA 2DWQA 3BH6A 4TL6A 3NBFA 1ZNWA 4R98A 1UBGA 5DN6A 1RC8A 1CEEA 2XTMA 4PANA 5AJVB 4BRUA 3TSOA 4EPXA 2H57A 2GCPA 1QDEA 4BECA 2WOJA 3TVTA 4TN1A 2G3YA 4I81A 3LNCA 1HE8B 4BWYA 1MRNA 2VTKA 2RGGA 1TTTA 2WWXA 4R7ZA 4NP6A 3KKQA 4UXIA 3O8BA 5JBQA 5SZJA 4PO9A 3EIHA 3WBKA 2J9RA 2V4ZA 4B71A 2FMXA 1E9SA 1YHNA 2YZ2A 3WMFA 4QM7A 1CR0A 2VP4A 4JYCA 1N5KA 1WA5A 5EXSA 2P5SA 4L15A 4LI0A 2ZE6A 2P65A 5HKKA 2JLXA 1G6OA 3UWOA 5J4LA 2J0UB 1Z0JA 3RHFA 4Z51A 1W47A 1GRRA 3AVUA 1IAQA 2WPDD 2G1JA 1RRGA 1GOTA 2OBLA 5FI0B 1ZIPA 1P9WA 2JA1A 1G8GA 3UG7A 1RYFA 2CMKA 1S9DA 1F60A 621PA 1YKSA 5GJCA 5K8LA 2HLDD 4J0QA 4KYUA 2J7PA 3VR1A 4WOPA 3C16C 3OIUA 4B6FA 4LJAA 2W6ID 3GJ8A 3CNLA 4Q18A 2QMEA 4DSNA 4EJSC 3OZXA 3WHLA 3LD9A 3MAAC 4D4MA 2C9OA 4HZUB 2HCBA 3Q7PA 4M2LA 3QIAA 4M1MA 4Q4LA 2FWRA 1OFTA 1VG1A 3TAUA 2ZSFA 1OSNA 1DPFA 1UBFA 2R8RA 4NE2A 4L9SA 2ZSAA 1KI6A 2G83A 2C03A 1RRCA 5FUXA 4F4IA 3OHMA 3T12A 1II9A 3QENA 2QSYA 4MRNA 2O8BB 4L5BA 2PX0A 4MKFA 4NCIA 1VG9B 2BMFA 5GVSA 3I8SA 4QBFA 4EFLA 4P3YA 5D3MB 1RRFA 2PZEA 2Z43A 1VECA 3CM0A 2W58A 3ASZA 3Q9LA 4JS0A 3DM5A 2O52A 2XJ9A 4RFSB 3SJBA 3A1WA 3U3RA 1E9RA 1MKYA 1L2TA 2BIFA 1N2CE 2FSIA 2EFHB 2MMCA 2VHCA 3CPJB 3QKRB 4H9GA 4LV5B 1E0SA 5GJVC 1GUAA 3B5JA 4Z8XA 1BO6A 1NF3A 4JL5A 3VAAA 4EIWA 2NO6A 2JLWA 4JLVA 5EE3A 4PR0A 4XVQA 4R9UC 1G5PA 4KHZA 1UDXA 3G5UA 2VHTA 2XB4A 1US8B 5CDFA 1SXJC 3QI2A 3SOPA 1TEXA 4QG7A 1YVDA 2VPPA 4JLDA 3RYTC 4DCSA 4U00A 3CW2A 4GMDA 1E1RA 3VU9A 1MABA 3ZIAD 4DIDA 2DFKB 2QMUA 2JDIA 2ORWA 4WXRA 4C0SA 1YR7A 1AA9A 1TNDA 1ZUNB 4MDEA 2QGZA 3D8BA 5J5CA 3EZ2A 5JJLA 1FMJA 2CEAA 2ZROA 2QN6A 2ZUCA 2AX4A 2FGKA 5SZKB 4LGMA 2GXAA 3O8CA 4XTRA 1W0JA 4ZIRB 4A8JC 1N6RA 3CH5A 4HAWA 4JKIA 2FFAA 4P32A 1Y63A 4ZCIA 1DADA 4P33A 4W5WA 4ZI2A 2GXUA 4Q48A 2ZUDA 3TNFA 3FKSD 1ANKA 2A78A 4LJ6A 1YE8A 2OV2A 3BGWA 3TQFA 1ODFA 4BLRA 3GP8A 4D4JA 3CNNA 4E03A 4G5QA 3B2EA 1TAGA 2GF0A 3BFKA 4M1TA 1XCPA 3AUXA 2IL1A 3WYAA 2NMVA 2EFCB 2OFWA 2XZOA 4PHFA 2FDCA 1QHIA 1T4GA 1WXQA 1E99A 2O5VA 4NYIQ 1PV4A 1FUKA 2ZRDA 4RZ2A 3MWLA 1AKEA 3L43A 4NU0A 4ZO4A 2VHQA 3EZ6A 4P31A 1YZGA 2ZRFA 4QC2A 1S3GA 1WP9A 4TSFA 1CR4A 2B92A 2HDNB 2P5TB 3U7GA 3AVTA 4TL7A 5JSZA 1M7HA 2KB0A 2GWHA 2WJHA 2NZ8A 1FX0B 1IN6A 1W2HA 2GK7A 5C4MA 2XAUA 3C14C 4ZV4A 1F5NA 4X8MA 2PT7A 1R5BA 1G3UA 2ZQ5A 1OB5A 4RKFA 2IS4A 1Z6GA 3R8FA 3X1XA 1PZNA 4B2PA 5EJEA 1SQ5A 3KXKA 1KMHB 4AC9A 1KI2A 3QSYA 1Z29A 4Q00A 1NY5A 221PA 2UKDA 1GNQA 4FXPA 1E3MA 1D9XA 1C4OA 3LAWA 4OI1A 2JAQA 1IJEA 1Z2AA 3EWAA 1I2MA 4A4DA 1MO4A 3LY5A 3NDPA 3NIBA 4YDSA 2A5YB 2BM0A 2V55B 1PLJA 3BFVA 3LFUA 5FPHA 6Q21A 2VHUA 4MGKR 3V4FA 4L8GA 4M53A 4OHWA 4OBEA 3PITA 1HH4A 5FBRB 3IPYA 5JS8A 4LHYA 4D6PA 1M2OB 2IYYA 4BZXA 4FWTA 2DFNA 4PAOA 3QJYA 1RRPA 4KV9A 4WZBE 2Z83A 4PZLA 4XVRA 2FNAA 2QP3A 1G17A 4V0OA 5ANRB 4A0GA 3OIYA 1ZM7A 3E5HA 4CEHB 3K70C 4M1YA 2QPTA 2QEQA 3DKVA 3F0TA 2FF7A 1OFIA 4OYHA 5G3YA 2IUUA 3DL0A 4IXNA 3I73A 2BEKA 4BFTA 4V0MA 2DHRA 4QXAA 2O8DA 1IXRC 1XXHB 2G0NA 2CL7X 5JECA 2BM1A 1NVVR 4RD1A 3KFXA 5G40A 1J7KA 3A1SA 3S1AB 4AYXA 4LY6A 4UNRA 1Z0KA 1VIYA 1DAHA 2O0KA 4G5GA 3RWMB 3CF0A 1P2VA 4B2LA 3KXLA 4MKHA 5CITA 1E6CA 3ZLJA 5BN3A 5TDHA 2FSHA 1G3RA 2W83A 5H1YA 4EQ6A 2FG5A 2WIBA 3T5DA 2VQSA 3EPHA 2RGNC 3B1YA 1W48A 1E9CA 1KI4A 3K0AA 4AYTA 3BOSA 1VKJA 2I3BA 4GOXA 2NO7A 4PXAA 2O8EB 3KQKA 4DLXA 3GCGA 4D26A 3VHLB 5IK2D 1ZD8A 5JRZA 2A5JA 2RMKA 4IVQA 4GT1A 2IS6A 1NL3A 4HEJA 3ZS9A 5DHFA 3GLGE 4ERNA 4BFVA 2Q3HA 3H2YA 4JLBA 2GEVA 1DE0A 2IXFA 3NBYC 4PQRA 4RVCA 4Q9KA 3EC1A 1GILA 2ZRLA 1GP2A 4TLDA 1XZQA 1DBSA 2J0QA 3QPUA 2MSEB 1Z2CA 3RRYA 4BEJA 4D0GA 1KO7A 1HUQA 4IOKA 2L0XA 1DG3A 2C77A 5JI3E 1II0A 2NTYC 3RS5A 4HDQB 4AURA 1RZ3A 3KFVA 2A5GA 1Q22A 3CR7A 3TUZC 4UNSA 1S4QA 4PFSA 2V8OA 3CO5A 1OH5A 2ZRJA 3PEUA 1M7GA 1R2QA 1II8A 1OFHA 1T3SA 3QEJA 1XTJA 3IIMA 4C3ZA 5CB8A 2B8WA 4O2LA 1Q57A 1E2PA 4RD3A 3U3JA 3L82B 1XRJA 2YWGA 3RDPA 4A1FA 3SEAA 5CM8B 3GLFB 1OXUA 4YC7A 3AP1A 1HQYE 2GF9A 4X8HA 3WNDA 5LB4A 5GADl 1DTSA 1QHNA 1MOZA 3KKPA 2VF8A 3NC0C 4ZCMA 1EESA 3B1WA 1T0HB 1R8QA 2ZSEA 4B76A 4TQUS 1G4UR 4AIIA 1DAMA 2H1LA 3MSXA 4BLOA 4MYUA 3SI7A 1OPXA 4W7SA 4RD6A 1G21E 1IHUA 4Z1MD 5E3HA 4DSTA 4B74A 4BPBA 3RVBA 2BMJA 5JRJA 4KFTA 1EFUA 1NN3A 1XTKA 1W1WA 3GJ6A 2FPKA 3VX3A 1WB9A 4R71A 3O8DA 1R5NA 2NIPA 2CNWD 2V1XA 4HLQB 1YJ5A 2GJ8A 1AK2A 4F38A 1I2DA 3P1JA 4BLTA 2HYIC 1HT2E 1P3JA 4H1UA 2VP0A 1AN0A 4LBZA 4OQLA 3T61A 3RC3A 1U94A 3U2QA 2CBZA 4ON9A 1ZM2A 1DELA 3PENA 1AJEA 3TAHA 1Q1EA 4JBYA 2F9LA 1KDTA 4DLWA 2J87A 2NG1A 3PCRB 4BLSA 3IO5A 5F9HA 3B1ZA 5BXQC 4Q4HA 2ZRNA 3HYTA 2P6NA 2OXRA 4KXFB 4OK3A 5TV2A 3GLGB 4JBXA 4I1SA 2EYQA 1E96A 1GL7A 2ZJ8A 5F3WB 1JAIA 4Q7KA 2WZQA 1E9AA 3PR1A 4BFXA 1U8AA 1OXSC 4B6EA 3NC1C 1V43A 3TW8B 1E32A 3IKJA 2QT0A 4C7OB 3AVXA 4LJ7A 3AF4A 4QBIA 1FPMA 2B7CA 1EWRA 5FBQB 3M1IA 1WE2A 3AKDA 3CPHA 4FWIB 1KSGA 2RB4A 1NG9A 3FHOA 3TJZA 1U2RA 1E9FA 2AK3A 3W90A 1VMAA 3WYGA 3VR4A 4KBFA 5KSOA 4GFDA 3UMRA 1AGRA 2ZSBA 1NKTA 3B1VA 2RCNA 3LW7A 4PHGA 3RS2A 1NRJB 1GNPA 2RHMA 2WPDA 2NOAA 4LSGA 1XJQA 5CLLA 3A1VA 3CF2A 4B34A 3LBIA 2IUTA 4YMWA 4CEJB 1G291 1UM8A 2REOA 2RGAA 3TKLA 2O8CA 2FSGA 2QQ0A 3GFOA 2QA5A 1W0KD 2VA8A 1LF0A 1ZD1A 4RD2A 2NO9A 1S1MA 1GKYA 2W6IA 1BMFD 2EW1A 4OQNA 2GJSA 4DUGD 4OHVA 4XD7D 3A1UA 1SVMA 3TW4A 3BH0A 2Q9AA 1KYIA 5BYKA 5HZHA 3DZ8A 3DOFA 3U61B 1E4VA 4LZZA 4DIEA 2Y8EA 1E2HA 4M9QA 1HYQA 3OFND 2GK6A 3I3SR 1KKMA 1XTSA 2A30A 3E2IA 4PAMA 4TTRA 4Q9LA 3HJNA 1NLZA 3NH9A 1ESNA 2LKDA 2BEJA 4A0RA 5HCIA 2NO0A 4JLKA 3LVRE 4NYIR 1PLLA 4EPYA 2EQBA 2QT1A 1AQUA 3PIRA 2H7VA 4QHSA 1XPRA 4AKIA 4DSUA 3BB1A 4FMCF 1I4TD 2ZS9A 4LV8B 2RGEA 3RSLA 1CF4A 5DO9A 2F7SA 1E9BA 3QOFA 5BWMA 2AN9A 2JLSA 4KJZA 4LPKA 1CLUA 2NO1A 4MYHA 2OZEA 2R6CA 1TPZA 2ODNA 3HU2A 1G16A 1BOFA 2J0UA 2ZAOA 3NEYA 3SFZA 2Q9BA 2ZJYA 1YZQA 3EG5A 3KJIA 2CL0X 4IHQA 5HE8A 3U5ZB 3ICEA 1XMJA 3KDSE 4KLNA 1XEFA 1U0LA 2RHDA 1JNYA 1R0ZA 4M4SA 2F43B 2GESA 3VKHA 3X1ZA 1QG2A 4G5OA 2H8KA 2DB3A 3PEVA 2VP2A 5IF9A 3KKNA 1J90A 3EPLA 2W0SA 4NCKA 1W5SA 3DPUA 2R44A 3ZH9B 4WIAA 3VNVA 3DKPA 1OW3B 1GITA 2QTHA 2PX3A 4IRUB 1TF2A 3B78A 4JJZA 2G0TA 1JBKA 1ZVQA 4OKSA 3FKSA 3WMEA 1SXJE 1E1QA 1NBMA 3T1VA 4LPSA 3GFPA 1XB2A 3DEFA 3K53A 4LJYA 5H70A 4D0LB 2IHBA 4LJ5A 5FUVA 1C9KA 4PHTA 3RABA 3L0PA 3HP1A 4NONA 2ZR9A 3VFDA 2FX3A 1S0UA 2XOKD 3EIEA 1R10A 2QUZA 2SHKA 1GRQA 2GETA 4P0TA 2CCJA 4LJ4A 1Z6XA 5D3MA 1W7AA 1CRQA 4GL2A 1F2TB 2BVNA 2QPAA 4XWOA 3FMIA 5FOXA 2IHYA 1N6PA 1NMZA 2GJAA 3QKRA 1AGPA 1XBTA 4OK6A 2FFBA 5FR1A 3DMDA 4LDJA 4QM6A 1DS6A 2ONJA 3W3AA 2QE7D 2QAGB 3P20A 5TMPA 1SVWA 1KO1A 1US8A 2WJJA 4MA4A 3LRPA 1QHYA 1DAFA 3QKTA 4JZKA 4DDVA 3TGPA 1P4SA 3AP3A 4ZKEA 2IT1A 3BERA 2PEZA 3AVQA 5HZKA 3FMPB 2WJVA 4NYJR 3KJGA 1NVVQ 3THYA 2ZREA 1X1RA 1G3IA 1TQ4A 4X8LA 1Z6YA 1M74A 2B21A 5A0FA 4BFWA 3AVPA 1IN4A 2ZRIA 4WAUA 4EJSB 1AM4D 2QTFA 4JSTA 2DFTA 1JQLB 4NCNA 2WWGA 1H8ED 2FU5C 3K09A 4OL0A 3REGA 2OHFA 3K1JA 3SQWA 5EUQB 4FMCB 4ZIRA 5LD2C 4OI0A 1Z0DA 1ZC3A 1Z0AA 3H86A 2H92A 3IO3A 3KZ1E 5EP3A 4YQFA 3SNHA 2JJ2A 1JR3E 2KSQA 5AJWA 4QGFA 3U4QB 4TYNA 3NH6A 4BE7B 1A7JA 3F3YA 1XJ0A 2D2EA 2NZJA 3WNBA 2IF2A 1JEDA 2FPLA 2F9MA 2GVDC 3U3OA 5DH9A 4PC3A 3K9HA 4BEBA 2JLZA 2JJ1D 4RFVA 1G7TA 1KGDA 3KB2A 1F6BA 4V0NA 4B43A 2VLIA 3RRMA 4PC2A 3SC3A 1NG1A 3X1WA 1S96A 1ZU4A 1QVRA 3SS8A 1T5IA 3MWKA 1FX0A 4DVGA 1KJZA 3VKWA 3JZAA 4WVFA 2IS1A 1SXJB 1OE0A 1GRNA 721PA 3ASYA 3I5XA 3FVQA 3R8CA 1G8HA 2X2FA 1OKKD 3B9QA 4KCGA 4MRSA 5FOSA 2IYVA 1KMHA 1XD9A 2RGXA 4V02A 3T15A 3U7FB 4JYBA 2KBFA 1E2EA 3P27A 4XSGA 5IDVA 5IK2A 3WHKA 5FL3A 3GPLA 4V03A 4C4PA 1FTSA 4NCHA 5KSZA 5AUQA 4S35A 4A0FA 2RKOA 1MO3A 2C5LA 4W5JA 1XFAA 4A36A 4HYYA 2C04A 1G8YA 2ORVA 5L3QA 1SGWA 5JCPA 3KQNA 3U60B 2IW3A 2D62A 4A0HA 2C8VA 1SKYE 2WKPA 4BFUA 2UVQA 4CVNA 4C0QC 4AYWA 4DLTA 4ACAA 1T0JB 1JEEA 4TQ9A 5AUOB 2F55A 1NMYA 1JXOA 3RS0A 4CEHA 4HI0E 5CK5A 2OE2A 2TMKA 3KL4A 4Y0VA 2WTUA 4C2TA 3UK6A 4IFEA 1OH6A 1GSIA 3N2IA 5EXTA 3U44B 1LY1A 1VYTA 1XXHA 1N6NA 1P7CA 2GZDA 1D5CA 5G3ZA 5FR2A 4YXWD 1KK3A 3S1AA 3QPWA 2XGJA 2BWJA 1IBRA 3QKSA 3X1DA 4XOIA 4NKRA 1GDDA 3SDZA 1IN5A 2C98A 2PL3A 2WSSD 4GBMA 2VSXA 3ZQJA 3O8RA 3PUWA 3TR5A 2GA8A 1SXJD 5KDDA 2CVHA 3W8RA 3NHAA 1QG4A 2FSFA 2VHJA 2V7QD 3RRNA 3D3QA
chains in the Genus database with same CATH superfamily
1NR5A 5FTNA 4IUDS 3LZDA 4LCBA 1N3BA 3LUAA 5FLKA 3USCS 3LVQE 4K6KA 5HA5A 5JMPA 5JXHA 3NHLA 3IKVA 4GQIA 3CLUC 3PG5A 2X42A 2FMTA 1Z83A 4AUKA 1JDUA 1I80A 4FONA 4S1PA 3WK7A 2UYHA 5LDHA 2WJPA 2YW9A 1QXSA 2YHIB 1W76A 4W5HA 5ALKA 2WICA 4KE7A 1C0LA 3U3KA 1S1CA 4D9KA 2QVXX 4AG3A 1DSSG 1IOVA 2ZPTX 1JPVA 3GJ7A 3NHUA 2JVIA 3ZQUA 4DA0A 3GZNA 1BRMA 3KHSA 3A26A 4YTEA 2DFDA 5L7YA 5A6SA 1ZM4A 3AJAA 3JX9A 2NQTA 1K68A 3KZKA 3QKIA 3ZEIA 3ZHVA 4RTRA 2AB0A 4HTFA 4NCXA 1ZD2P 5KIAA 3Q12A 3CVXA 5BV8A 1D8AA 4DT1A 4M37A 4JI1B 3TMYA 4BASA 4DLAA 4DR7B 4Q4AB 2OA0A 3ROTA 1UXIA 4RZSA 3NCHA 4L0QA 4WFQA 5AUPB 3OIDA 2ZS8A 3A3PA 4KYIB 3UUEA 1TYDE 1D9ZA 1W8DA 3MXOA 3WGTA 4BNJA 5BQ5A 2QG6A 3L77A 2QD3A 3KQTA 4WN9A 5KYKA 3X1YA 5A7HA 3EZGA 2X9GA 3F1LA 2PUAA 2YOGA 3WR5A 4LHWA 4L8WB 5AKYA 1UC4B 1W75A 1ZH8A 2V58A 2Q5FA 3CX8A 4NBUA 5AOVA 3TIXB 3FIJA 5C4IA 4J29A 1RC0A 2W2KA 1OB2A 1PJZA 1ZUHA 2OYRA 2X6TA 4UEOA 1A9OA 3B7PA 1P72A 2OFPA 3L6BA 3WGQA 3Q2IA 3WRVA 3GLFA 4MDFA 4TS9A 3FFWA 4YRKA 2BJVA 2OHJA 4UCWA 4WZBA 5CIQA 2HCJB 3MGBA 3H4MA 3L0SA 3CBGA 3W78A 1JR3D 4URYR 4YRFA 5FNZA 2YHUA 1EWQA 4ER7A 4I1PA 2B0CA 3OJWA 1JUDA 2KMLA 4AS3A 5JAMA 3PUIA 3MJRA 4FZVA 4OGKA 1Z4NA 3CU5A 3CVOA 1ONPA 4HH4A 5EE1A 1ZMRA 4FVTA 2CDRA 1L3CA 3UN1A 2E89A 3FFBA 4GI2A 4GRDA 1DV1A 2P11A 4RH3A 3WQBA 4ZMSA 4B3DA 4PGMA 1SNYA 3GFBA 5KTMA 1M0EA 4RHFA 2ERYA 1MUUA 3JQDA 2ZBFA 2FRXA 3P9RA 5K3AA 3MB8A 3KSUA 3GLHA 4W6ZA 3I62A 5IXSA 5GJWC 5BMVA 4JOBA 3TZKA 4WXMA 2LGJA 3P71T 3DEJA 1KI7A 2IX9A 3W4KA 4ARIA 1AX9A 2O3RA 3AB8A 3DVAB 3LFHA 4LJ8A 4U2DA 2WV9A 4RTLA 5TIIA 4L2IA 3RT7A 1TF5A 2ZIVB 4BS9A 4KQHA 2Q3FA 4HAYA 1O95D 3K0KA 1FP2A 1DEKA 1ZGAA 1FP7A 2C95A 3UOAB 4KSBA 4BKQA 2J67A 3FTNA 4EAQA 3MTGA 2QYTA 1EVJA 4PR3A 1P7PA 3QFSA 2WRZA 3IBCA 2D4HA 1PYOA 1RLUA 1MU0A 2GAOA 3K2QA 3X44A 1CJKC 3T7TA 1UWLA 2DBQA 3BKWA 2CXHA 3JYOA 2BEUA 4LOJA 1IXZA 3W5JA 3GJZA 3LO8A 1JKXA 1JIUA 1SC1A 1KJIA 1BDJA 2NQ2C 4X6UA 2Y2UA 3KQYA 2CL5A 5LLSA 4OJMX 1VBNA 1J49A 5T4BA 3SLGA 3NG1A 5EGSA 5C7YA 4ZAVA 1RJ9B 3MLBA 3EIWA 3KVRA 4YV1A 3MCZA 3THXB 3IIKA 3UB2A 1JPUA 4ZHQA 1LLFA 4Q3NA 3H9EO 2NZWA 4TPKA 2Q5LA 3UUWA 1O94A 2VRWA 3D3NA 4RIIA 1JLLA 4ZA2A 1CRPA 1U6IA 4M55A 4GHWA 4AJ4A 4P3XA 2CKMA 2SBTA 3T9AA 5D7BA 2B30A 1R0LA 2IYXA 1IRIA 1R7RA 5JV5A 4PSCA 4KREA 1LPBB 5TGZA 1HA3A 3H4IA 4ZJZA 2PJZA 1O5TA 2BFEB 3JYLA 4BFSA 4N48A 4X85A 1WCV1 4GMXA 1K6MA 1BE8A 1WCIB 1IIRA 4N3GA 3UPTA 1W4ZA 3NEJA 3UK1A 5CGZA 2B1QA 3GLIE 4I9UA 4V0LA 4LGVA 5BY2A 2WG0A 3G9QA 2JVJA 4EA9A 2FQWA 2I4TA 3F49S 2XKAA 2CNNA 1QPBA 1X2EA 4AMYA 2VF7A 2PBZA 1PI3A 4FGLA 1KA9H 1UWCA 1UMDA 1YB7A 2JBAB 2N0SA 4II2A 3S4YA 4ALLA 4ND1A 4YAIA 2QOEA 4UATA 1C4XA 1P1IA 2XVMA 3BD6A 3HWSA 3IB3A 4MPPA 1GCIA 1MN6A 1NWCA 1XHLA 3IHLA 3RFCA 4KFRA 3PXGA 1HG1A 5LPNA 3EVAA 3ZK9A 2K7FA 3WLRA 1V6SA 3H5TA 5CTJA 2HREA 1B4DA 4GP7A 4Q12A 3HVHA 4Y9UA 2PO7A 3I04M 3BA6A 1YRYE 5DOVA 3HSSA 1JKIA 2RAUA 5JT1A 1ZNZA 4P6VF 3H4TA 4CDRA 4DUYB 1XLUA 3HA3A 3ML1A 3WGGA 1Z3IX 4CMIA 2XQIA 4MAAA 1UFQA 2C4WA 1JECA 1UK6A 5J2TF 2F3RA 3IAHA 1S02A 2AFIB 2BF4A 1GJRA 1KQOA 2R66A 3GRFA 5JCOA 1R4AA 1S2LA 3ZVKA 3QTTA 4OJYA 3R0JA 3K09C 3Q8XB 4LECA 3VJMA 4B9EA 4CCAA 4EKIA 4QKQA 4UNNA 4I1UA 2FVXA 3IQIX 1HE5A 3FAKA 5HQ3A 2P40A 4FKZA 5IVDA 5KOJB 5JTUA 3J81A 3PT5A 3RIYA 2QB5A 1GZSA 1OGJA 2WF5A 4MKGA 3IE1A 2Q27A 1JWAB 1UZNA 2TS1A 1U3UA 1PFYA 3TXXA 1KQ3A 1YXMA 4KPEC 3BMNB 4KQJA 4GPAA 2QG9A 3TJRA 4TM8A 4RULA 1YZNA 4PRYA 4B2IA 1TEVA 3H9GA 4LISA 5HQJA 2PLRA 3EY4A 4CM8A 5F78A 3K9NA 1GTVA 3RVOA 1EDZA 4URZR 5GP1A 3HYNA 3RROA 3MCUA 4UEJA 3FYTA 4RTNA 2RHRA 4JP5A 2KHZA 1XRRA 2ZUVA 2AXPA 3ETNA 3OO0A 4LCJA 2C3YA 2I33A 3LKVA 3PRJA 1IHPA 2AMFA 3JWHA 4MYSA 1BA2A 1Z0ZA 2EKLA 3VH1A 3LX5A 2UZ3A 3I1FA 2BMDA 1L9XA 2Y9MB 4B44A 2F43A 2FPWA 3A9UA 4JVNA 1AUOA 4O4IA 4WNAB 5K3FB 4CG0A 1GPDG 3UT6A 3BWEA 5LQAA 3QITA 3QJGA 2XE8A 1DVRA 3WL7A 4BVHA 2BTEA 1PFQA 3A7DA 1RE1A 3HSKA 4ZPXA 4C7KA 1TCBA 1ATIA 1ZL0A 2AQKA 4XSHA 3V8VA 1X3SA 3Q3VA 3L4EA 1X7WA 2V65A 3RS8A 4TLEA 4H3VA 4L5YA 4NESA 4C14A 1ZDMA 3D6MA 4J07A 4KKXB 3T9BA 3ZZ0A 4E5MA 3VJRA 4FOTA 5K01A 4HOYA 1TVKB 1W0CA 2W42A 3ANSA 3RSGA 4NZ9A 4MKRA 4UHHA 3RFFA 1AZSC 4DTCA 4PSVA 1K8QA 4FDMA 2DPHA 4D9JA 1SB8A 3C97A 4IV0A 5I3CA 4KQWA 4UZSA 4EECA 4ANFA 5FNVA 2XDAA 5IABA 1X39A 2LWIA 3PQ2A 2W0MA 1C14A 3HKDA 4RANA 3R8XA 3R3YA 4B75A 1CU1A 2QMOA 1KRHA 2J5RA 1DKNA 4JLJA 4JYZA 1O1YA 2D7JA 3ABZA 3DBHB 2JJ1A 3N2EA 3QVSA 2WDZA 4LXQA 1G5RA 2HJ9A 2WJZB 3FUCA 4JWKA 4U8HA 5K05A 4DQXA 3AR7A 3R6LA 2I54A 4TTAA 4G84A 4E14A 4R8MA 4DJDC 1YS7A 1U9CA 1S3SA 3RVDA 4TMFA 2GPBA 5E4FA 1WU7A 1DO0A 4OXKA 1E62A 3F96A 2PBRA 4M1EA 3K20A 1LDEA 4G85A 3AUTA 2OHHA 1WD5A 1V39A 5DHTA 2DUUA 4IEEA 5DMHA 3T4XA 4MV3A 2HR1A 3B3QA 2PGLA 3ZX5A 2QAGA 1L7BA 4I19A 1E2QA 2OCAA 4K3VA 2AN4A 1YZHA 3JY6A 5BSRA 3G85A 5A4FS 3CRVA 1Z4KA 3ROFA 5ICSA 1NXTA 5JCZA 1F3OA 2CJFA 4UE6A 2HA0A 4X00A 4D7AA 3FMOB 4F11A 4MQEB 4ENTA 3EDQA 3CKKA 5DX1A 2XUHA 3LT1A 2PMEA 3FNFA 1TZCA 2B34A 5KTPA 5AI0A 5LB2A 1FX1A 1BQ3A 1EK2A 4O1HA 3GI1A 2Q7OE 5JWOA 1YACA 2FSSA 1QRUA 3R0XA 1XLVA 1Y4DE 1LQ2A 1SCUB 3CUKA 5AI4A 1RHJA 3ROPA 2NVBA 4UTNA 4L95C 3EA0A 1YQXA 1OFGA 4YRPA 3HYRA 2O6HA 4D57A 1A8QA 2Q6LA 1E20A 3UIEA 3EG9A 4LUCA 1JL3A 1OGYA 1K7FB 2R2GA 3GNSA 3DC7A 4B80A 3BJRA 5G0VA 4PNPA 1WZUA 1G41A 1QKIA 2UUPA 1POXA 3EULA 4J7CA 1C2YA 5A4MS 4RTOA 1XQVA 2FP4A 5AW5A 2CUNA 3G8CA 4JQCA 1Z7YA 4FIDA 5PNTA 5REQA 1QFMA 2VKTA 1MG0A 2QDKA 1UQTA 1AKWA 1NIPA 2E49A 3AJ8A 1FNMA 5DGHA 1QX3A 3GJYA 4R1LA 3R44A 3KZCA 3EYWA 5YASA 4JSRA 4JJIA 4WXYB 2I9KA 3MBIA 4GF5A 1N2JA 2PNFA 4H7EA 4EDHA 2QQGA 3SS9X 3GVIA 3RTDA 4XGQA 4EA8A 2WKSA 1ACLA 1HSOA 3B6MA 4QVKA 1XU9A 3W79A 1K2VN 2NT4A 3CW9A 1MOSA 3FY4A 4J94A 3AUYA 1U5BB 5K99A 1KAGA 4BV8A 3DE4X 2JEZA 1XAJA 4OHOA 3F98A 2ZYAA 3PNVA 4Y2VA 4OUKX 2RH8A 4MLPA 3MRSA 2HL6A 3P9SA 3QXXA 5HPYB 3NIDB 3DB2A 1B8PA 6LDHA 1JR6A 5C51B 1KAOA 3IYLW 1ZJ6A 4DA7A 3O9VA 3PA8A 1GQYA 1GTMA 2MINB 3NOQA 4EJMA 4UBIA 3U3MA 5ITSA 2PRJA 2V7QA 1X77A 1V1RA 4BMSA 1VCIA 4ZWNA 3NVKI 5JFTA 5DHPA 3A3YA 1Z9BA 2IPLA 2DG2A 3A6KA 4OXYA 5E6SA 2ZITA 3WGZA 1EGAA 3H83A 1FDWA 1U0HC 1V3VA 3RPEA 3G2OA 2X9NA 1TGVA 4XCQA 3ZBPA 2QQEA 4A2CA 1ISJA 2Q4OA 4X3CA 5A4KA 4UNQA 4NFYA 1HETA 4HQFA 3ORYA 4NR0A 4UU0A 1I1HA 1MR3F 2YUTA 4FEEA 5H9VA 3LCJA 4Y2UA 2ZI7A 4BNTA 1ST3A 2YY7A 3BWCA 3I42A 2AYYA 3U9LA 4D8YA 4J43A 4MKIA 5H7XA 4KB5A 4N65A 2R8ZA 3PFCA 3VC1A 2ZB8A 2JL1A 4A73A 1FUEA 2GPSA 2FY8A 5KNCD 1W36C 4ZCSA 1KK0A 3JV7A 4QBGB 5L3VA 5BNFA 1T15A 5B6JA 3PUVA 2YZKA 4EI2A 1NJ8A 2P0EA 3PZBA 1WW2A 1CHNA 1K75A 1LNZA 2DAPA 2J3LA 2YV3A 3CRQA 2VBGA 1KJQA 2PDAA 3JQCA 4MR7B 4R1TA 2FUG6 5DSTA 3WLSA 1OX4A 4PCLA 3SF8B 3Q3EA 1W4BA 3LDAA 1OHHD 2YOFA 4JP1A 5CR9A 1P9OA 1EEXB 1BHSA 3L8DA 2IU4A 5SZHB 1PSWA 3T3OA 3EZNA 4RNCA 2BELA 4O6VA 3OQHA 4MHOA 1DKOA 4E4RA 1USIA 3LUDA 4LHXA 3IUMA 1XA4A 4J0JA 4OMDA 1RFGE 4S1VA 4O4LF 1ZM9A 5D87A 5AXAA 2HBYA 4RK7A 2C58A 4GLJA 1L1QA 1BXGB 1F9AA 3FWYA 3CT6A 4QWWA 4MSUA 1R4NA 4A8TA 1I7QB 2EWWA 3PWZA 3PEYA 3E05A 1C3LA 1SD2A 2C2BA 1Z0SA 3SJ7A 1XMSA 4L16A 1UADA 1XZBA 1Y7PA 1E4OA 3OLQA 4JL6A 2PANA 4NBNA 4RW0A 2G71A 2D5IA 2RH9B 5JEEA 3K6SB 3C6QA 1T43A 2IC5A 3IT3A 4UM9D 4ILEA 2G67A 3L40A 3RC7A 2D5AA 4K81B 1NASA 4ZRMA 3W8FA 5AM1A 5CH5A 1E2JA 3ROZA 2GSWA 1UUFA 5A62A 4WK0B 3A6HA 3R6TA 4MPRA 5JNSA 4CKYA 2O8BB 1TL7C 3GQBB 4DYHA 4Q7JB 3R9WA 2FWIA 2O8BA 3LQKA 3GJXC 1BZYA 3P9NA 2YVLA 5EEHA 3NU1A 4YLGA 3QOWA 4LYYA 4QRHA 4YAEA 4HWRA 3QNUA 4I9GA 5FA6A 1M7BA 1ZSVA 3GRAA 3N74A 1FUUA 1G64A 3GH3A 5A3RA 1EE1A 3JSAA 2WKQA 1W5TA 3L05A 5FWXA 5GONA 3OZFA 4EVQA 4Z2AA 1M1UA 1NF9A 1OLSA 1GZHB 4G0PA 4FW9A 2XA1A 3HU3A 3CNOA 4OSOA 3W7BA 1RI5A 2QR3A 4I5IA 2BGJA 4BBZA 1B93A 1VCNA 3CRW1 3PKZA 4G3XA 3AZPA 4PVDA 5C8XA 3T5MA 1SKMA 2PEYA 1FXWF 4D8VA 2IYQA 2Q9CA 2Z2KA 3BYZA 3JAWB 4LVNA 3E9DA 3P4YA 4HAVA 5E95A 4DMRA 2Q6IA 3IP1A 3FVTA 2ZJ1A 5FUYA 4QUBA 1FS6A 2QD5A 3OIVA 2A59A 2DM6A 2YUIA 3AEKB 1ZD4A 5FPTA 4A0QA 4COOA 3AVVA 1JI3A 3I9MA 1IUNA 5L4LA 2HCTA 3Q7QA 5IJ0A 3HR8A 3MC1A 3NNSA 2Q1WA 1H85A 3KZXA 3ENZA 4YAKA 3QU4A 1QOZA 2WHXA 4FYPA 4D96A 1AMOA 3NCTA 1FA9A 1XDDA 2XQKA 2YINC 3BXZA 3CH4B 3DEKA 4YVFA 2BV3A 4J3JA 5B3JA 1OXTA 2W11A 1R6AA 3EAFA 3OBBA 4YJKA 5DYWA 4KQGA 3H19A 3MUNA 3S44A 4BGEA 3LGXA 3EMKA 1RE0A 4NAHA 2FLKA 4MW7A 2FEAA 1UOOA 2HJRA 3G82C 3UWDA 4AZWA 1GYRA 4B4VA 2VYCA 5EKUA 5C3MA 3ZVRA 3G17A 2EFYA 2WHYA 1JILA 2IW1A 4KIUA 4P08A 5IUKC 1JLMA 1VI2A 3MS2A 2I1LA 5JJKA 2OO3A 1JIKA 1TCAA 1JH8A 3R5SA 2JBWA 1MAHA 3QVOA 2EBWA 3RJZA 2HW8A 1L5OA 4L0MA 3IP8A 3WFZA 4F93B 5J23A 4C0JA 1O96A 1PZMA 3IS3A 3B3JA 3UKDA 1NYQA 1RYMA 4GYYA 4ZRNA 3WJ1A 5ED4A 2WF9A 3DZJA 2VP6A 5D01A 5IZCA 2HK9A 5EINA 2XUIA 1Y37A 5DLQC 3UA3A 4EHFA 2PVSA 3ROQA 5DT2A 1OTXA 3NVAA 4C2BA 3U1BA 2WF8A 4MVJG 4XD2A 3IKTA 4TV9A 2CUKA 1TUEA 4RL4A 2GF2A 1TM4E 4ZVUA 1YUMA 3FPCA 4WCDA 1FVHA 3WP0A 3BXHA 3DZKA 1WDKA 2YDYA 3GD7A 1ETUA 2FAXA 1MQSA 3AV0B 2EEZA 1CNEA 1N2BA 3UXEA 4D80A 4DEXA 2GBIA 2KLBA 3BIFA 3AC0A 1PZXA 1G5FA 4ER0A 2ID8A 2CE7A 5CIYA 3OQOA 3M4XA 2JAPA 2BBOA 2WA1A 3NYIA 4Q3KA 2WHPA 3EUWA 4CIDA 3HJUA 1J7JA 4QT4A 5C1BA 1L5NA 3DNMA 2C78A 3CTPA 5DI3B 3O4FA 1KKLA 5LZ2A 3NV9A 2GCOA 2GM5A 3I61A 2O8EB 3ECSA 4HLUA 3L5KA 1E1NA 4X7BA 3HCPA 5J2UB 3ONNA 1QR6A 4RMIA 3BJZA 3GZTB 2GKSA 2GNPA 1Z7BA 2W4IA 4JLOA 5ELMA 3WHIA 3VXKA 5CCXA 5D5HA 2VJQA 2Y71A 2IVZA 4R54A 1AH2A 4EZEA 3K8QA 3ICWA 5ARDA 4HV4A 1ZKMA 4IDEA 1NVEA 1PR9A 1MC8A 1TCUA 3R5JA 5IC5A 2XVXA 4WFKA 4RGYA 1LW7A 5F1OA 5IN5A 1QHGA 3P9KA 1YA6A 3AF0A 1GFWA 2AI2A 3IIIA 1H1LA 5DULA 3NWOA 1KZ6A 1KAHA 2P2NA 3KOZA 3LSTA 4JB8A 4U8GA 5KO2A 2WD8A 3CKLA 1N5LA 3DDCA 4CV2A 4M0LA 3I30X 4K0RA 1OZHA 2N1BA 4MW5A 5FIUA 5L6LB 5HUHA 1RSZA 5DK6A 3ID6C 2G4LA 4CWAA 1UPCA 3I9LA 3SC4A 2C94A 4YAJA 1RPZA 2FXVA 3CUEF 1T5SA 2H9IA 2ASVA 2XCQA 3P2MA 4LDAA 3DLBA 2FFJA 4IIJA 3R0IA 1CUXA 2P0AA 3D43A 3PUZA 3PWKA 1M34B 1QQ7A 2ODAA 4FBGA 4ZOLA 3VAZA 1J2YA 4E12A 4D46A 1AURA 2BI4A 3ZY2A 3NUZA 4ZAFA 2JKVA 1NVGA 2BEWB 3EBLA 4AUMA 2G17A 2HRRA 4RV5A 3VR0A 1VPWA 4IDQA 1PL6A 4LX8A 4TL8A 2ZPAA 2BC9A 4XGNA 3RM3A 2ZBRA 3AETB 3DP9A 1NW9B 4ER3A 4X62B 3HXOA 2XUPA 1G4HA 1NKVA 3B85A 3DFKA 4PZEA 2VPTA 1EQ2A 3VC7A 4KPUB 2Z5FA 4A03A 1T36B 2QTVB 3CX6A 4RGBA 3FYCA 1AUVA 2XX3A 1GPKA 1IC6A 1PQWA 2FKNA 4EB6B 5LZ7A 2ABWA 3PDUA 2IIPA 3DE2X 3E7XA 4M87A 4YAFA 1XP5A 3KBBA 2Q7DA 3UOWA 1EFAA 3IBGA 1Q7GA 1GFIA 1WZCA 3NVDA 1KXZA 4CLRA 3AKEA 3DT6A 3ZNNA 5AVYA 1U3GA 4NJMB 1DX9A 1W4AA 1ZGGA 1T6YA 2GBGA 3KFLA 1PS8A 1P9RA 1UWKA 1VCMA 5EFZA 2XTAA 3I92A 4UHEA 4BKOA 1CVRA 1O89A 5ESRA 3C85A 4RPKA 4LE1A 2HUNA 3HJGA 1G6KA 1FB5A 2UVPB 1KSHA 4IEIA 3K70B 1JXMA 3A1CA 1AD2A 1CRWG 1A8IA 1YQ9A 2C0PA 4X65B 3ZJVA 5C81A 2IBMA 3CJQA 3NTLA 4LKRA 2Y67A 1M6VB 3AR6A 4X64B 2XXAB 1ZEJA 3L46A 3NPMA 4X1IA 1R6UA 1VL8A 1OWOA 1W29A 1AU9A 3PTAA 5FLXA 3NB0A 3X43A 5JZOA 1V8DA 2WYVA 4BX9A 1Q0LA 3U80A 1K7EB 4NG5A 4HGZA 1CCWA 4KPYA 1PN3A 4XDZA 3OPXA 1N2ZA 2DKFA 3E22B 1GKUB 2OD2A 4UJ3A 4WT7A 3PSAA 1VXOA 1W46A 4EY8A 1YRAA 4Z7QB 3OY2A 2GHIA 4B3RB 1ZR4A 2NP6A 1BIFA 3NHBA 4UREA 4LOAA 3R7BA 4CQMB 1K27A 5BORA 4P7FA 2OGUA 4ZGWA 3QLVC 3K0CC 4NG4A 4B8WA 2Z2JA 1WLSA 4MYDA 2PG3A 3R77A 2SKDA 3J7AC 4TRRA 4TV8A 4FLEA 4XR9A 1YQUA 1ND5A 2QBYB 3PR2B 3RGGA 4M1QA 3T3IA 3THYB 1CIVA 2ONKA 2XITA 4OFWA 3PICA 3ZCVA 4RTKA 2RHWA 3OZCA 3SF0A 3GWGA 1FRNA 1TYBE 3NTUA 4HT3B 3DMRA 3ZS8A 1TQHA 1XCGB 3F3KA 1P18A 3D8HA 1FP4B 3N0TA 2KWIA 1HE1C 3DZGA 1UBTS 3GLIA 3PNYA 3KWJA 5CXXA 4QOFA 3I9NA 4AN0A 4ZQHA 1HT3A 1EK5A 1W34A 1XT6A 2WSYB 3T3HA 5FX2A 3K1AA 1NR1A 5GAJA 4ZZ0A 3GK3A 5J1TB 4KOAA 2R65A 2ID7A 1W0KA 3EWSA 3QW4B 3CF4G 4R2XA 4GWLA 4C7XA 5DTJA 2OFFA 2WQ6A 1YSCA 4XWAA 2BM8A 2ZJ7A 3IL2A 2WWVD 2N1MA 1NBMD 3VR6D 1I51A 1S6YA 1X80A 1BC5A 3BZUA 3MW8A 4TT3D 2P2LA 1DMRA 4IMJB 4ES6A 4KAXA 4P4SB 1IYZA 3R7NA 4BPRA 5EZYA 4IIGA 2YNMD 1MX5A 5E0KB 5H5JA 1OXVA 4RVDA 2A9RA 1AGXA 2BMWA 1M9NA 5AUNB 1NW5A 3TUIC 1GN8A 2VRCD 4QOEA 1SWVA 3R09A 5AH0A 2OSBA 4LF8B 1DHTA 4Y2HA 2R60A 1VLMA 1Z6AA 2E4YA 1QPGA 4QDXA 4WJLA 2DQSA 3RSSA 3WBFA 2DYKA 2HA6A 3VR2A 5EWJB 1UKYA 2CHVA 1IJFA 4EFMA 5BQOA 3WLIA 3K71B 2IGBA 4DAOA 1T9GR 1L7VC 1U11A 1U9IC 1EFVA 4Q0MA 5A3VA 2HRCA 1QRDA 3BSSA 2FZEA 5KC9A 1UANA 2GHRA 4DCUA 1QFJA 1EP2B 5AKJA 3W06A 2LDXA 4N6NA 1GKLA 2RE8A 4M98A 4TL9A 1U0EA 3E3LA 4A16A 2HD4A 1U98A 2W2NA 4RMHA 3RIEA 2HWUA 1NHWA 2NXNA 4Z0NA 2FUNB 3H6HA 4MWZA 4E5UA 1K9VF 4QBTA 2E4UA 1W2WB 1WKVA 3AJDA 3CLHA 2VHYA 1FYWA 3M8KA 4CL0A 2X2EA 3L4SO 7AT1A 2AKAB 2L17A 2XGOA 3HJCA 3OJEA 4L75A 3L0IB 2I4LA 4PTLA 3LA6A 3BQ9A 4IO0A 1S2GA 1CKEA 4J16C 4D3FA 5L3QB 2CGEA 1DTEA 1CQZA 1A82A 1X1DA 5H59A 4CNBA 4OA8A 5L40A 4M0DA 4XFDA 3TIGA 1NC1A 3IRUA 3VO8A 3TL6A 1OBHA 2YY6A 3A9CA 4MW4A 1Z0IA 1ARZA 2ZIWB 4QTYA 4ZCPA 5ADVA 4BJHB 1CE8A 4AP6A 3WRWA 5AKGA 2G8NA 3PHHA 4FOOA 1YF3A 2FA9A 1Z45A 2QTNA 4GGOA 1CULC 1KZHA 2GD2A 3RUAA 1ORTA 2H1RA 1G6HA 2G9UA 2PRKA 2R00A 3OE7D 4DLUA 5IG2A 3P0JA 3FVRA 2O5CA 3F73A 3VI4B 4GKJB 4I55F 3BORA 4Q03A 1IVYA 1TO6A 1TE2A 4KH1A 4LZNA 3E9YA 5K20A 1G8PA 2CHFA 4NMWA 3C6YA 4ETIA 2D0DA 3MB5A 3OCJA 3T52A 1NUUA 3AY7A 2VDUE 4JEHA 1KZGB 2P9TA 3G9XA 2HPZA 3ZV7A 1SHZA 1E66A 2KJQA 4BYGA 4UBJA 1IHXA 3OEHD 3BRWD 4NV3A 4C4OA 2VUUA 4I50A 2F1RA 5F2EA 1RW4A 4QDZA 3ZE1B 5HM8A 2GZSA 2ADOA 2HDHA 1UEJA 1TQDA 4GRIA 3D2CA 4LCEA 1UMCB 1MDFA 2I99A 3DXZA 4V38A 4CMAA 3BKXA 4UCFA 3VR5H 4LC1A 4Y6PA 2Y27A 3MUEA 2PU5A 4CQLA 5A4AA 1P2SA 1F51E 2IUSA 1FMLA 2Q3DA 5FI1B 1GXSA 3L4JA 4ZVQA 5DN6D 3N28A 5DB4A 3BWMA 5HTKA 5E7IA 3CF6R 3U7QA 4PSKA 3RQIA 2X9VA 3N2LA 1G38A 4JOQA 3KYDA 1RAFA 3PPYA 1S8AA 3L6DA 2QLBA 3BDVA 4PZ9A 4OQDA 2IBTA 3WQHA 1L9KA 4A2PA 5IT9A 3IMFA 3ELDA 2XXBA 2IEBA 1OZAA 4PLZA 5JC1A 2WTAA 1G60A 3D81A 3H75A 4CJXA 1IVNA 4CTOA 1QQBA 2IELA 1YTUA 1CYDA 1WVMA 4O5OA 4ZHQF 2AOTA 3S3TA 1IEWA 2DLDA 3I6QA 3R3VA 1XTPA 2IV2X 1YBMA 3G5LA 2ANBA 2HO5A 4G4GA 4JR0A 4L4SA 5D5PA 5LQRA 2IH5A 3GWZA 5E6RB 1ZP6A 3UJ9A 3P0HA 1UZAA 3WGOA 4BFZA 4YAUA 3REQB 2XD4A 1KMNA 1Y5NA 1N5IA 4W1SA 3RGWS 5JBIA 5IKXA 3AUUA 1FFCA 3WO0A 1DRWA 1F0PA 4BZPA 1QC5B 2AZTA 2CLEB 2I6TA 2BUCA 1UM9B 4QU0A 2NU6A 2WJAA 5JATA 3PNMA 5DLEA 3ZD8A 4RABA 2C88A 1MT0A 4EI7A 1JE1A 2VJMB 4C08A 1YJCA 3RS3A 3ZCQA 1N0HA 3T7RA 1VHLA 3KKKA 1XRNA 2AR0A 4UULA 4I7EA 2QUIA 3EUFA 1I1OA 1THZA 1QHSA 1RIIA 4B7ZA 1XZEA 3IALA 3VM6A 2YRFA 2ZAMA 4JXXA 3CRNA 3VDXA 3BAFA 1UAAA 5JMOA 1KVUA 1YQWA 4DCCA 2DECA 2YIJA 4OI2A 1T2EA 1WSBA 5EMLA 3TOXA 3N1UA 2DFPA 4QQFA 2R1TB 3T7DA 1ZMXA 4EY7A 4QJ4A 1NN5A 1Z8FA 4Y6QA 3WSTA 3IDFA 4B3IA 1QIGA 1SCDA 3DMPA 1S5PA 3IEVA 4WLNA 1V71A 3AKYA 3N8KA 2EL9A 2IE0A 3Q9SA 1ENZA 4TLCA 3IR5A 3WBJA 1G9TA 3JQGB 4PQGA 5T6BA 4QGGA 5JNWA 1IK6A 3HDTA 3CNQS 3E1SA 1VJTA 5JSQA 1GZUA 3U7HB 2JGDA 1OT3A 3EDCA 3MTBA 4OB7A 5JWHA 4KUEA 4RY2A 3H5LA 1QB7A 3GFQA 1RWXA 2FV8A 3K2IA 2B7BA 4M1SA 4MAMA 2R9VA 3QA9A 1XD2A 3M1LA 4RF3A 2A9OA 5JS1A 3OCUA 3X2FA 4E3ZA 4HFRA 2SCUA 3TYXA 1X8JA 3R6WA 3JQAD 2O7RA 4KDCA 4CF7A 5DM1A 5AW8A 1QIFA 4PSAA 4HLDA 3NDBB 2IEIA 2Y1DA 3PYXA 1ECBA 3TUJC 4IDCA 3W2HA 4G0QA 2GLTA 3C6BA 1V11B 3HG7A 4JODA 4LW8A 4AI6A 1RVV1 2O8FA 4CI9A 4EY3A 3NFYA 2O2HA 3LCCA 2EQ5A 3VPHA 3NM6B 4RTMA 4RPGA 4CMGA 3AUKA 1KERA 5KU7A 5FRDA 3HA2A 1K3TA 1DXOA 4A9AA 4AAYA 3FWNA 3LW8A 3Q3GE 5AR1A 3L6UA 4GGMX 3RHZA 4M86A 5CFZA 4QHYA 2WP8J 4A15A 1RYNA 5LP6B 3I9V6 1W5EA 4N1AA 4C21A 3O4RA 1TGYA 4MRAA 4Q6BA 4QNMA 3S27A 3R5XA 3IELA 3RAPR 1CJSA 2HC9A 3A0RB 5J3JA 3BG5A 3KU1A 1T4CB 1TU4A 1YZ3A 1X0VA 4P7BA 4ZTUB 2ZZMA 5HIJA 1SVOA 2Y92A 1U65A 1NX6A 2FN7A 3CX3A 3PFGA 4WD3A 5TPWA 2PZBA 2XKJE 3FNBA 3ZWKA 4B8YA 3TF5A 3BDAA 3HHEA 3SD7A 2VI5A 2AN5A 1YHYA 1M8GA 1ETHA 1UOPA 2Y1XA 2RBEA 3CH7A 2D8AA 2SKEA 1VKRA 2PFKA 4GPBA 3CCFA 4I8XA 4MH0R 4OH1A 3Q72A 4OG2A 4R31A 1G1AA 5BT9A 4LYDA 4G4SO 3I32A 3PNPA 2W6JA 3AXSA 4UDOA 1CQXA 1QO0D 3L8HA 4KRGA 4RETA 1RWBA 1NPDA 5KJ6A 2MJLA 1A8SA 4TTIA 2ENUA 4JN6B 2R62A 2Z3WA 3K0SA 5LKAA 4D8UA 9LDBA 3ANNA 5G0WA 1EBUA 1QMPA 5GWXA 3NBXX 3SIXA 3TLEA 2HCRA 4Q1FA 2MDTA 1JHZA 4IQGA 1W87A 2IOYA 4J0CA 2JJYA 1T3HA 5DXAA 3TQOA 2OWDA 2MMGA 2A0KA 1H6DA 3VTFA 1IPHA 2O07A 3BSFA 4URHA 2H6EA 3ER9A 3Q0IA 4LZPA 3AHCA 1WMDA 3DE0X 4HRVA 4ZP1A 1Z08A 4L27A 5BOVA 2ANCA 4ESVA 3M6IA 2PLAA 3X1KA 1QHHA 1Z2PX 4N03A 1E3SA 1CW2B 2J3IA 2HHJA 1TYAE 3DFMA 3IPXA 4NBTA 1SHKA 4QQ8A 4B7UA 2PH1A 1E2MA 2I87A 3TEJA 5JC8A 1IY8A 1KU6A 1SBQA 2WUFA 1G8KA 4Y18A 3HSYA 4WTOA 1M5UA 1Z6TA 1MA3A 2EKBA 1B00A 1PV2A 3OFSA 5M3BA 5UKDA 2R47A 1Y9JA 3C3YA 4DR5B 1X38A 1U8ZA 1CFZA 1JG1A 1URPA 2DFLA 3HJBA 3PVSA 5ADUS 1GKIA 2W6OA 4A8JA 4D9NA 5LD2B 3MYYA 4BNKA 2VXBA 4IILA 5D51S 1KQNA 5L4SA 1DJLA 3DZHA 3KPYA 1R9NA 1HDIA 2BKVA 3NETA 4UNIA 2HWKA 5IWAB 5KOHA 1JP7A 2FOIA 4R7GA 3GVXA 1R9MA 4L3VA 3BRQA 3MA0A 4PLCA 5ALPA 3QG5A 1SIOA 1RR6A 1RJFA 1JVBA 4LXYA 4DQDA 4IIBA 1DQPA 4J3FA 3J81k 3UFBA 3B51X 5F3RA 5BRJA 1TK3A 2XSZA 1OF1A 2YVAA 3RIXA 1A1SA 3OWHA 1UL1X 3QVGA 2HA2A 4E2WA 2O3QA 1T0BA 3AF1A 5HTOA 4Z54A 4WK4B 1YNOA 1TT5A 1FP6A 5M2QA 4RK5A 4YPFA 1BTOA 4GQAA 2GYWA 1U2QA 3T5BA 3ZHXA 2FWNA 1Z2NX 2PKEA 121PA 5EQJB 3WTCA 3L9WA 1Q77A 2D5CA 2FW9A 5DTQA 3RYIA 2J31A 3QVUA 4M22A 1QCYA 1YR1A 2P9JA 4LJLA 4P92A 4ZKDA 2A0WA 3GFTA 3JQ9C 1VG0B 4JI6B 2ZYWX 4PQFA 2ZJZA 1IPEA 3JALA 4Y2RA 1F3LA 4V1CA 1WUIS 1T3ZA 2LP4Y 2GJKA 4XQ0A 1NP3A 2EFJA 2ZWAA 1S9HA 5IM5A 2B6HA 4FB4A 1JFSA 1AQ6A 3E8XA 4BHTA 4JT2A 2H1IA 2IF0A 2V98A 1WF3A 3BC1A 4JUIA 3OKAA 2XY4A 3L4BC 4LY9A 2O0JA 4IVPA 1J9EA 5LOVF 1TD1A 3BD8A 1G18A 4PFJA 3V2IA 4BO7A 2F2TA 1V3UA 1KYXA 1BXZA 1XEXA 1V26A 1ZGCA 2EW2A 2WUWE 3DMTC 2IP1A 5FAXA 1F2UA 3C98A 5DEIA 1OAAA 1Z7WA 2VUHB 1GGKA 5FTMA 3W5IA 2NWQA 4Y9DA 1FW8A 2PKQO 2OAP1 2Q4BA 3RARA 4G5YA 3EFHA 1G8SA 1OV4A 2WBLC 1VE7A 2TMDA 2ZANA 3BZBA 3LH5A 2Y1FA 4C6TB 1CF4A 1C9EA 1FU7A 5KOYA 2Y1LA 4RHYA 4OH7A 1TAHA 4JLNA 3GVCA 2ZXUA 4KUHA 2OAGA 2NUAA 2PQMA 1OH8A 4GYJA 5C1OA 3EGEA 1NW4A 2QP4A 5A6VA 1D1PA 2W8BA 3RVNA 3ZWYA 4BMDA 3QBVA 4Z5XA 2QN8A 2YZNA 1C41A 2BL4A 1BN6A 2X8AA 4CMEC 1NMSA 1R4MA 2UAGA 3DEZA