5JLJA

Crystal structure of kpt8602 in complex with crm1-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
202
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Next-generation XPO1 inhibitor shows improved efficacy and in vivo tolerability in hematological malignancies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jljA00
2KE5A 2OCAA 4M8NE 3V4RA 2GVZC 3PUZA 1KK0A 4WXPA 1G6OA 4YDHB 3CPHA 1OXSC 2RCNA 3AKEA 4Z8YA 3ASZA 2QQEA 3Q7PA 3OIWA 2O0KA 3BFXA 1J7KA 1W4AA 2QN6A 1M2OB 2V9PA 2YC4C 3IPYA 4P4SB 1XCGB 2C9YA 3A4NA 2HJGA 5H70A 3LVQE 4B34A 1DVRA 1N0VC 1ZNXA 2AFIE 2J0UA 3C15C 4EJSA 4ZKEA 4AYXA 2O8BA 3CWZA 3CF2A 2W00A 3X1ZA 1XDBA 3U4QA 1YZLA 4KFRA 4IOKA 3B8HA 1JPJA 1OB2A 2ZAOA 2B6HA 3CONA 5FTKA 3B6EA 2A30A 3BB1A 3EIQA 2V3CC 2JJ8A 4QJ5A 5KNCA 4JL5A 2R44A 5EP2A 4EPXA 2ZTSA 3AUYA 5TY0A 2ANBA 4Q00A 2ZUBA 3DVLA 2AX4A 1GG2A 2ZRIA 4ZPXA 3G0HA 3HU2A 3B1ZA 2WV9A 2SHKA 5EXTA 4OI4A 3K09A 3THOA 4ZIRA 3NG1A 4CEHB 1T6NA 2Q9BA 1SVWA 2G77B 1II9A 3KKOA 4MYCA 4RFSB 4W7SA 1U90A 4JLBA 4RD1A 4D26A 3N2EA 5L3QA 3GLGB 4LHXA 2LWIA 4A6XA 4QM7A 4MDEA 4OQXA 4NCIA 2DFNA 1DAEA 4PQFA 3UKDA 2ZVPX 4WOPA 4YMWA 4DSOA 1VG8A 4FMDB 4JZKA 4LPKA 2Q9CA 4HAZA 5J4KA 3IKJA 5JJKA 3E70C 5C4GB 2ZRBA 2DYKA 2Z5FA 3OEED 1E2LA 3G5UA 3SZRA 1SKYB 1NBMD 1N3BA 2VSXA 3CR7A 4QC2A 4Q9KA 3O8RA 1WBBA 3VU9A 2BJVA 4PPGA 2NZJA 1TQ2A 1SXJE 4B3CA 1GRRA 3IHLA 1TF5A 1XU4A 3U7GA 4H9GA 5D3MA 4V0OA 2C98A 3IEVA 5AUNB 1JEEA 2NG1A 4OI0A 1XCMA 5KTYA 4HLUC 2E9SA 5C46F 4OJQA 3RRMA 4FWTA 1W7AA 4HB2A 3GLFA 2PEZA 4WXRA 5B57C 1HA3A 3AF4A 1FMLA 1TQ4A 1N25A 5JECA 1MKYA 2XNSA 1G19A 3LA6A 4DLUA 3EC1A 2GAAA 2HLDD 1T4GA 4ZDIA 1W4RA 2FSIA 3DKVA 1TUIA 1NMZA 1NY6A 2D7CA 3HR8A 3AP3A 3IQXA 4G5RA 1H8ED 1M6NA 2QUZA 3QKSB 2QMUA 1XTRA 2XXAB 5K8TA 3ZDQA 5L3SB 2HJVA 2HYDA 1VHTA 5DHFA 1QDEA 2QPTA 3W3AA 4HAUA 4Q7LA 3EZ6A 1QHIA 3DO6A 2WWYA 2ORWA 4ARZB 3UIEA 1JAIA 1PJRA 1T5IA 4B74A 3MWYW 2GEUA 3ECCA 1GSIA 2JAQA 3TRFA 3D7MA 4GP7A 4F91B 4A36A 1DPFA 5AJZA 4TYNA 2GHIA 2AR7A 2DWQA 1G3IA 1G8PA 4PPFA 3U6BA 4DCTA 3MWKA 3Q8XB 4O2RA 4FINA 5FOSA 2IYSA 2GESA 2PEYA 3P32A 3FMFA 2IYTA 3EPKA 4O2LA 2XTNA 3QXCA 3LBNA 4G1UC 5G40A 2WWHA 1XXHA 4C0BA 4IDNA 1ESNA 4GP6A 4DLXA 1ZW6A 2J3EA 4O3MA 4C0QC 5JWOA 2QSZA 4A2QA 1CRQA 2CJWA 1XD2B 4TSFD 5C2JB 1P73A 1AA9A 1B23P 2OFOA 1LNZA 4B48A 3U5ZB 4Q1DA 4NP6A 3GJ0A 3O8DA 3D31A 2J0UB 3TKLA 5FBRB 4EJSB 3QVVA 4DDTA 2O8BB 2FE4A 2AD1A 3U4QB 2W2XA 4LJ6A 1QG4A 1O87A 1HE8B 3Q5EA 3GD7A 5K8UA 1V43A 3THWA 2B21A 1GKYA 4LDJA 1OIVA 3R9XA 3GLHA 1MT0A 4B6FA 1SHZA 2GTPA 5IT5A 2JJ2D 4ESHA 3TSOA 2I1QA 1NVVQ 5FOTA 1JBKA 3ZS9A 1XCPA 2YWEA 2WAXA 2D06A 4IVPA 4ZIRB 2ZSAA 2KWIA 2L0XA 1Q21A 1AJEA 3IIKA 4IKEA 4C0HA 1Q20A 3CWQA 3DKPA 2F43A 3LBHA 2VP0A 4GOJA 4M1WA 2OM2A 3QXJA 2ZR7A 5L3QB 5H1YA 5BQ5A 3L8ZA 4FIDA 2YINC 4ASUA 4A2PA 1EFUA 2R62A 1AN0A 1PZNA 1ZC4A 2FV8A 2ZJ8A 4E03A 4JLOA 3A37A 2WVJA 3ZZTA 3SE0A 3ZVMA 4PC6A 4GNKA 3BBPA 1G291 4G3XA 5FFMA 3UXMA 1PLLA 2BWJA 4HI0E 2ZJ5A 4Q7JB 3SR0A 4V0LA 2HF8A 3VU9B 1V5WA 3L0OA 5KYKA 4URVR 1G16A 2IK8A 2OHFA 2UZIR 1Z47A 3SU8A 2RAPA 1ANKA 5D3MB 3TQCA 1HURA 2RGCA 2B7CA 1ZD8A 1E9CA 1G17A 1EFHA 2OXRA 1ESMA 1Z83A 1AGRA 2YNMA 3SJZA 1SQ5A 1GP2A 4BLRA 1G64A 1C1YA 5LPNA 2H16A 4Z1MA 3DM9B 2ATVA 2NO1A 2X2EA 5FOVA 3IILA 3ZQ6A 3GLFB 1HQYE 3EIHA 4OHXA 1ZCBA 1WBDA 2AXPA 4HYYA 5JBQA 1XTKA 1LFDB 1FZQA 2RHMA 2RGEA 3B5JA 4LRWA 2JA1A 1P6XA 1RYFA 1ZNYA 4DSTA 1EFTA 1Z28A 5A4JA 3AF3A 2A5GA 1R2QA 3ZH9B 5TMPA 1SVSA 2WWWA 4TLEA 4A0RA 1R6BX 2YHSA 3CX6A 2R9VA 2IEYA 1T0HB 4PTLA 5AWFC 1YZQA 3CKLA 3PEYA 1KZGB 1XJCA 4JLDA 1SXJC 3T35A 5TVKA 1IN6A 1J2JA 1OIXA 1N6IA 1Q1BA 4CEIA 4EIWA 3AGPA 1ZM3A 1VMAA 3VHXA 3QY0A 4A1FA 1G5PA 3AKCA 1SVKA 2DY1A 3K9LA 1XMVA 3WMEA 2IL1A 3KB2A 2HXSA 1MABB 3NTUA 1N0WA 4NCJA 3WMFA 2GXAA 3SI7A 4TZ6A 3TE6A 2JLQA 3NH9A 4A0HA 1DAFA 3UWOA 1VPLA 1Z2CA 4JYCA 1KAOA 2WJVA 5J4LA 3GJXC 1GOTA 1P7CA 1FMJA 1CJVC 1E4YA 3CB4A 4DC9A 1Z06A 5FL7D 1F6BA 1OXTA 3P26A 4KHZA 1XXHB 1J8YF 3PEUA 4Q47A 4UNPA 1A2BA 2PZEA 3C16C 3SQXA 4LV5B 5D3QA 5DH9A 2QZ4A 5GJVC 1W0JA 2A5DA 2CJWB 1JXMA 2K5UA 2D3WA 2YWHA 3W8RA 3T5GA 2PZGA 2AL7A 4NYMQ 4ZV4A 3BGWA 3Q3JB 1P61B 5AJYA 1JJVA 2JLWA 4RZ3A 3LFUA 4GZMA 5KO2A 4EFLA 4B6EA 4OHZA 821PA 2WWFA 1MO6A 5EP3A 3BRWD 2WKPA 1FX0B 3PXGA 1W36C 3THWB 1EX7A 1J90A 1XTQA 1P62B 2QP9X 1TUEA 2H17A 3KQUA 1E1QD 2YYZA 5AJWA 1U98A 1XZPA 3NHBA 4LY6A 1E9AA 2EW1A 1QZXA 1XFAA 3OFNA 4OHWA 1FUUA 1ZNWA 4RD2A 3BH6A 3IIMA 2BOVA 1XPUA 2XAUA 3CRQA 5CLQA 3WRXC 1P72A 5KPDA 3H2YA 2EWWA 1EFRA 2QMHA 2PBRA 3VTKA 2F43B 1W2HA 3GLGE 1FL9A 1NF3A 2DB3A 5DN6D 4QHTA 1CJUC 3FOZA 4BFVA 2CHVA 4Q9HA 1C9KA 4Q5IA 1TX4B 2Z4SA 4CYMA 1GL9B 1RKBA 1NI3A 2REBA 2ZRKA 3BH0A 3F3YA 1E6CA 4NHOA 1ZD1A 1KKMA 2QG6A 2IXFA 2YWGA 2XGJA 1ELOA 3B1VA 2J0SA 2JCSA 1HUQA 4P32A 2ZYWX 5CDFE 1ZIPA 2G0TA 2IWHA 3T1OA 3WY9A 4EFNA 1G7SA 1GZSA 1HYQA 1YQTA 4M9SA 4A4DA 1UDWA 1Q1EA 4L16A 4MKGA 1S9DA 1YZUA 2YKGA 2BBTA 2OILA 3LLUA 3RYTC 1K5DA 3QKRA 1NY5A 4PANA 3TW8B 3WHLA 3EZ9A 2KBFA 4BFSA 2FH5B 4B3FX 3UK6A 2PCLA 5GVSA 2W6JA 4OQLA 4QM6A 1IONA 4I4LA 2QRZA 4RCYA 3KTAA 2BJWA 4DHEA 1KK3A 2D2FA 2O0JA 5FOXA 3A8TA 1N5JA 2J45A 2YC2C 5GVRA 3TVTA 2ZRNA 2OBMA 3AVXA 2BBWA 1A7JA 1EFRD 1ZVQA 4MRSA 3NXSA 3KQKA 2ERYA 3I61A 1SZPA 2NZ8A 3NIBA 3J81k 1EXMA 1DG1G 2OSBA 3CF0A 3H86A 5IDVA 3LVRE 4EAQA 3FGNA 1YZGA 3IEUA 3SHWA 3O8CA 4QJ3A 3PENA 5CLLA 4CEIB 4URUR 1R4AA 1KY2A 1ZM4A 3THXA 5C18A 1X1RA 2QM7A 3TH5A 2DPXA 1G8FA 1W4CA 3I1FA 4Q1EA 5KSZA 4OJKA 2DR3A 4LHZA 3TAUA 1E9FA 1QHHA 3K70B 5SZHB 5EZ6B 3PEWA 1E1RA 5KDDA 1S2MA 1IJEA 1FQJA 4P0TA 4URYR 1SULA 3MG9A 1E2NA 4TMXA 2R6GA 5E3HA 1YZKA 4OKSA 1NKSA 4P4TA 2CXXA 2YWFA 1MH1A 5F9FA 3H4MA 2P6RA 4B73A 4XWAA 1YKSA 4RVCA 4TTPA 3EIEA 4MITA 2H92A 3QJYA 2OZEA 3QEOA 2CEAA 1J99A 1NBME 2B92A 5GJWC 1Z08A 1II0A 1KSHA 4PPQA 4D6PA 3DDCA 4DUGA 1Q57A 2NO7A 1N6RA 1W0KD 2BCGY 2GETA 1XEFA 4BECA 4EPYA 2EFGA 4O25A 1JB1A 2D7DA 1VECA 1NIJA 1S1MA 1U99A 2N42A 5FR2A 4YXWA 3OAAA 3GP8A 1OV4A 1WE2A 2UKDA 2LKCA 4C0AC 1KIMA 1UKYA 2AKYA 2AK3A 4DEYA 3L8YA 4HEJA 5KUTA 4DWJA 2ZM5A 1KJZA 3RVBA 1UPTA 4OL0A 2GBLA 4PO9A 2BMFA 4PHTA 1XTJA 3AEZA 1OIWA 2OE2A 3QEJA 1KNXA 3Q9LA 4Y0AA 3BK7A 3PG5A 2MSCB 3OIVA 5ANRB 4F4IA 1IQPA 3EASA 1AZSC 2GDJA 2A3RA 1RJ9A 2G6BA 2GEDA 5KNBA 2OAP1 4Q1BA 1SKQA 4HLQB 4UJ5A 3KKMA 2F1IA 3L0SA 2FSGA 4XD7D 1NN5A 5DIFA 4TL7A 2ASEA 5B2ZA 4MUBA 3AQ4A 2EWVA 5EJEA 1N6HA 5AR1A 5G3ZA 4ITRC 2OBLA 4C9BA 3T15A 5JCZA 3KQNA 4CZ2A 2BMJA 2EQBA 1JI0A 1TL7C 4DUGD 1D6JA 4AKGA 1VDZA 5FTNA 4CT5A 2RGBA 3U3OA 4LJYA 5DI9A 2CLDX 2IYZA 4LSGA 4BLSA 3HP1A 2IW3A 4X8HA 5BYJA 4TMTA 2QAGB 2PX0A 1EG7A 1UBFA 1UBGA 3F8TA 3GLIA 4NCKA 3QKRB 4UJ3A 2ZRFA 1Z0DA 3PFIA 3CZQA 2ZR9A 4FMCF 3L0IB 1II8A 5KSPA 1E2EA 4NBSA 4DLVA 2WBLC 2NOAA 4KBFA 1XJQA 5FOWA 5BN4A 3PVSA 2F6RA 1WDTA 4JL6A 1XTSA 1RZ3A 2XOKD 4NYMR 3KTAB 3RANA 1NN0A 2QROA 3SNHA 1CS4C 2QPOA 4V0ME 4ILEA 2UVQA 2OAQ1 5BN3A 1W44A 5FPTA 1E2GA 2J41A 1YR9A 2FSFA 4L9SA 4MH0R 1L7VC 1XMSA 3BERA 3TBKA 1EX6A 2V4ZA 4QBHA 1RC8A 2QT0A 4Q03A 4QNMA 5JI2E 3BH7A 3HJNA 4TMKA 4Q4HA 4AKIA 4GSYA 2ZRGA 4A2WA 4S35A 2G1KA 2ZRDA 4JT2A 5EP1A 1G5TA 4H1UA 2OLKA 4GOKA 1IAQA 1GNQA 4LHVA 4P33A 3THXB 1NMYA 3NVAA 1E9BA 1DG3A 3QPWA 4CW7A 2J7KA 1P2TA 2PT7A 1R0XA 1VCNA 4KFUA 4JVLA 4NE2A 3K9HA 1IXSB 1OFIA 2QTVB 4R2HA 1WQ1R 2PJZA 5DE3A 1KDRA 1JR3D 1QHHB 1Z3IX 2IUSA 3NKVA 221PA 2A7QA 3DZDA 2F1JA 1CTQA 4QXAA 1G3RA 2ZI3A 3MMPA 5FUVA 2ONKA 3SHFA 2PMDA 4GPTA 2ZSBA 2VRWA 3UMFA 4BZXA 2IYQA 4D0GA 3Q72A 1XXHE 4RD0A 1IXZA 1P2VA 1YRBA 2ZXUA 2IWRA 3RDPA 4IEIA 3B9QA 3LO5A 3HPRA 1R0YA 3RC8A 2GKSA 4AY2A 4RZ2A 1U0JA 2OV2A 2MMGA 2BM0A 3HYRA 1SVIA 1T8TA 1H8HA 4L9WA 3GJ7A 3DPUA 4XOIA 4OBEA 1LVGA 2ZI7A 3I32A 5FR1A 3VHLB 1Z0JA 2IYWA 1U94A 3QXSA 4JKYA 2B7BA 3RSOA 4BLPA 4LZZA 3RS0A 1TADA 3AVWA 3LAWA 3LWNA 1XP8A 1RRCA 3B85A 3LW8A 3ADCA 2BVNA 2JLZA 2C2HA 5HTKA 1UEJA 3R7WB 2XB2A 2HF9A 3LXRA 1J70A 3ADBA 1FUKA 1OFUX 1ZM9A 4PQYA 3RS2A 2A5FA 2PL3A 5FPYA 3Q85A 1P4SA 1U9IC 3SBEA 3AP1A 1S9HA 4LX0A 3WMGA 4OK3A 3KB1A 4DLSA 3CR8A 3RAPR 2QORA 1RJ9B 1VG9B 3EWAA 4MUAA 4HSEA 2ODEA 4MGYR 3K0CA 4I1SA 4IRUB 2OFXA 4UNQA 3DM5A 5H8WA 4C0KA 4JLMA 4EJSC 2XZLA 3NBFA 4Q9JA 1G8GA 3MJRA 3QF4A 4FCTA 3QXXA 2VSOA 4IOMA 5CK4A 1CP2A 4Q4JA 3U44A 1EFCA 2VIIA 4PC2A 3CRW1 2A9KA 1O3YA 4QFMA 5LB2A 2GILA 1NSTA 1DELA 1S0UA 1MRNA 4DSNA 1W1WA 4YMSA 1TNDA 2V7QA 4Z54A 2IS1A 2MSDB 3A36A 2QA5A 1E9EA 2RGAA 4ACBA 5J4HA 2QBYA 5SZJA 2WJGA 4B2PA 3ZIAA 4UNRA 1R0ZA 2C95A 1OXXK 4I1VA 1IN4A 4K46A 3PEVA 4UQOA 5JI3E 2ZETA 1II8B 1ZYUA 5EE1A 1E98A 4D82A 4LI0A 2P6NA 1XEWX 5FL3A 2N1BA 3KJEA 2GAOA 1YJ5A 2TMKA 2XZPA 4KYIB 4PSKA 5HKKD 1WP9A 4JMPA 3ZLJA 5FUXA 4LK2A 4QBIA 2XSZA 4HATA 1E0AA 1GKIA 1YR7A 1ZMXA 3BORA 4IOJA 4KXFB 1G9XA 2FG5A 2ZJBA 5JLJA 1EESA 1AQUA 1KI1A 4NYIQ 1ZP6A 1TTTA 5J4VA 2MMCA 2CVHA 3EX7C 1X8KA 4MRPA 4NKRA 2J1LA 1R0WA 4TZ0A 1KI2A 1F5NA 2H1LA 1S3SA 4IDPA 3WNCA 3KUDA 4MQBA 3KXLA 5EXSA 4BEBA 2VP4A 4LV8B 2RGGA 4BASA 2QGZA 1ONBA 2VA8A 2XJ4A 1G20E 3ND9A 3WNDA 1X6VA 1GNRA 2H57A 1XTIA 3ASYA 2O8FB 4WW0A 4X8OA 3H0KA 3JZAA 4PPNA 1E2MA 1G18A 1LS1A 2DWPA 4E07A 4D80A 3K9NA 2QTFA 3B2EA 4PC7A 3WHKA 1N6OA 1T3LA 3CF6R 3B60A 2D2EA 4Q4AA 1VCMA 1RPZA 1RYHA 1KI9A 1SGWA 1P3JA 3I72A 5F3WB 4LGMA 2CL6X 4ACAA 4V03A 1OH5A 2OCBA 2QGNA 3RNLA 4DJTA 1OFHA 1IN5A 3SJAA 5JMTA 1Q22A 2JLRA 3VNVA 5CIQA 1VCIA 2REOA 2Z4RA 3I5YA 3M0EA 2WPDA 3GQBA 3KKPA 5E7MA 1QHSA 4XIGS 1HEIA 4B3XA 3VNUA 5B30A 3LX5A 2FJUA 4JJZA 3EPLA 1F2TA 3PCRB 1MR3F 1CJTC 2PJRA 2C77A 1G7CA 2VHJA 4H1VA 4EFMA 1E2PA 2JJ1A 3RSLA 4KO8A 2X1VA 2D4HA 4EPWA 5E4FA 3SYKA 1ZCAA 4I1OA 5CM8B 4Q9IA 2OFWA 4RD6A 1E79A 2GXQA 3SFVA 1DEKA 3X1DA 5BYKA 3QI2A 4AD8A 1D9XA 4F93B 5P21A 3K1JA 3SS8A 2GNOA 2OXCA 3FKSA 3TQFA 4L15A 4PZYA 1UAAA 1AQYA 5KSYA 2QRNA 2PLRA 2QU8A 1OE0A 4HAXA 3UATA 4CDGA 1JPNA 3DEFA 3MSXA 5UKDA 2AWOA 2JLUA 3KJHA 5EUQB 4JL8A 4P3YA 1JR6A 5CK5A 3CLVA 2VF8A 4LJ8A 2AWNA 3BXZA 3QF4B 3U7HB 4J0QA 2IS6A 1SVOA 4TTRA 3WYAA 4DCVA 1RVDA 3R9WA 2CHGA 1DO2A 1WRBA 4BFTA 2O0HA 5J4YA 4R9UC 5J47A 1KSJA 3S1AA 4KU4A 1XEXA 4AWXA 2ODBA 5IF9A 3TGPA 2CCJA 2OO7A 2QTHA 5FTMA 1AKEA 2CK3A 2UZ3A 3MCAA 2DBYA 5E95A 4A0GA 1F3OA 1GL7A 1TU3A 2QBYB 1BOFA 4LJAA 4URZR 4GL2A 5CYPA 3SJBA 4F38A 5F9HA 2JGNA 4A82A 3OIYA 4JVSB 3ZYCA 1LS6A 5LB4A 4A0FA 4IFEA 2ONJA 2IF0A 2CE7A 4TL8A 2C9CA 2XJ9A 5GJCA 1OLOA 3FFAA 3IO3A 2ZJYA 4DDUA 4I99A 5DI3A 4CRWB 2DFLA 1G3QA 5LBIA 2JLXA 2R2AA 5AJXA 2IYRA 4IHQA 4HLCA 5HZKA 2DHRA 1X3SA 1ZD9A 3A58B 4KSBA 2JDIA 4QGFA 3GJ3A 1TQDA 3WYFA 1KI8A 1KDOA 1Z63A 3K0AA 4LCBA 4LYJA 2EVWX 2GF0A 4ZDKA 2CVFA 3B1XA 5DSZA 5HE9A 2IUTA 3FTQA 4DLZA 4Q1CA 1NKTA 1UKVY 1MO4A 2VHQA 3DOEA 1N2CE 3T1TA 1QVRA 4IJMA 2NPFA 4DLTA 4UXHA 1XRJA 4Q4AB 5F2EA 3W6NA 1QVAA 1E0JA 2VHUA 3O47A 2RGNC 2PZFA 3VX3A 5EXPA 2HT1A 2WKRA 5KDOA 2AD5A 1YR8A 4N1AA 1MO3A 3AVYA 1U8YA 1Z5ZA 5AUPB 4IXNA 4X8LA 1PLJA 3B82A 4QGAA 2YVUA 3KQLA 3R8FA 1FTNA 2NMVA 3B13B 5CJPA 1PV4A 2C96A 1N5IA 3ZZUA 2CL7X 2ERXA 2GK6A 1KSGA 1LB1B 2GK7A 1OJLA 1VIAA 3ZD7A 4ASUD 2GZHA 2ZS9A 2I1VB 4OQFA 3SC3A 1VKJA 1OHHA 1H65A 1I2DA 5EZ5A 1E94E 3K70C 1GNPA 3FHOA 4NPHA 4BLQA 2BMDA 1HT2E 1NMXA 2HXYA 2IA5A 4HDQB 4Q1AA 1DO0A 4NDZA 4NU0A 4RZXA 2ZI9A 4B2IA 2ZI6A 4MYTA 4D4JA 4DDVA 4ZI3A 2F7SA 4L8GA 2VLIA 4KODA 3ZVLA 3X1YA 4WA7A 2GZDA 2R6AA 1ZJ6A 4PHHA 3NBYC 2C03A 4Q66C 2FEMA 3CW2A 1YR6A 3QKTA 2QENA 5JCPA 1NRJB 5GJBA 1Z2AA 4GRAA 4Z1MD 4E09A 2ZU6A 5FTLA 1G3UA 2F3TA 4PSVA 1Z0AA 3D3QA 3K0SA 3V00A 1RRGA 2VEDA 3LW7A 1SXJA 2WOOA 4TT3A 4TMVA 4KYUA 1MV5A 2QE7A 2JLSA 4FMDF 4XVRA 5G41A 1TEXA 2E87A 3GJ8A 1JR3E 3RRNA 4BFXA 3WBKA 1KTVA 3M1IA 4BRWA 3GFOA 2QY9A 3OZXA 2I3BA 1T0JB 4NYJQ 2GXSA 3BIFA 5JHHB 1G41A 3WXMA 1KGDA 1RRFA 3C8UA 4WIAA 4D4KA 1A1VA 3AVUA 3K0EA 4MA4A 2ZUCA 4PSAA 5LD2B 1KOFA 3GLHB 4LJ4A 3FDIA 1UKEA 3A1VA 2FA9A 3GEEA 4LUCA 1KO4A 3AUXA 4RZUA 1NLFA 4RY2A 4KSCA 3VAAA 1KDPA 3W8NA 5JZVA 2FFQA 1G21E 1E9RA 2X19A 4AG6A 1GAJA 1KI6A 3E5HA 3TMKA 4US2R 2WOJA 2CDNA 1L8QA 3N70A 3F0TA 5FOUA 4PAOA 4ZDWA 2J59A 3ND8A 4HUQA 3LH5A 2ZE5A 3K70D 1M7HA 1UDXA 1E2IA 5FTJA 3RWMB 2VH5R 1K8RA 2FFAA 2NPIA 4DLWA 3T34A 2D62A 1Z6XA 4KI0A 4O0MA 4JYBA 4E22A 1WMSA 3AV0B 1ZU4A 5AJVB 4IXMA 3SQWA 5IRCD 1YZTA 2QAGC 1UKZA 1XNJA 1RIFA 1ZC3A 4Q21A 4C0LA 1SKYE 4YQFA 2EFCB 3K0AB 4M1YA 2ZI5A 1W0JD 1ZAKA 2W0SA 3CRRA 2EFEB 4XSGA 4KVAA 4GBMA 4TYWA 1JECA 1EWRA 3KJGA 5TDHA 1JAHA 4HAWA 3U61B 1K5GA 5CJ2A 4DB4A 1NVXQ 4GZLA 1HE1C 5JJIA 2LCFA 1T9HA 4C7OA 4BZQA 3A1SA 4Q18A 4EPTA 4BFYA 1DTSA 2F1HA 3TUIC 2RH5A 1KO5A 5EUMA 1VG1A 3OFND 2JIZA 3TUJC 2FMXA 1G4AE 2FPLA 2P67A 3KX2A 4MGIR 2C78A 4BQSA 4N0EA 4BUJA 3NDPA 5KOYA 3Q7QA 1R8SA 5E7IA 5EP4A 5K8LA 2CNWA 1E99A 5DISB 1N6NA 3W5IA 1VYUA 1YRAA 2IYYA 2ZYTX 4IEEA 1KMHA 1U2RA 2E1RA 4HLDA 2AHOA 4JLAA 4KLNA 4I1UA 4R98A 1CEEA 5TV2A 4BPBA 2FOLA 1CKEA 3H1TA 3SFZA 5GADl 6Q21A 1NVVR 2ZSDA 1HTWA 1ZM2A 1KJYA 2C04A 3SEAA 3GEHA 3TR5A 3B7GA 3SYLA 4Y0VA 2BM1A 4C0SA 1M1YE 2KI5A 3MGCA 4JLKA 1KAGA 1J8MF 1JJ7A 4B71A 2FNAA 1HH4A 2J7PA 4TN1A 3X1WA 5SZIA 4G5OA 3SBDA 1OW3B 5HE8A 3B1WA 1IJFA 2WWXA 2ZREA 1Z6GA 3KZ1E 4JLPA 3CH5A 4NTZA 5L3VA 4W9MC 3NDBB 4C2UA 1GUAA 3P1JA 2QI9C 4AK9A 1P2SA 4UKDA 1I4DD 4LJ9A 3I5XA 1GKUB 4TL6A 3AB3A 1BYIA 3KQHA 2GVDC 1P9WA 1E2HA 2YOFA 4W5WA 2FPKA 1CR2A 2W6JD 4DEXA 3DL0A 3LY5A 2FPMA 2LKDA 3VQTA 4ZCMA 3WP1B 3SJCA 4A8JC 2FU5C 4JLJA 3I62A 4UXIA 1NLYA 2JEOA 3L43A 2GBLC 1TU4A 4F7WA 2ZRJA 2BHRA 1JNYA 1PUJA 3EG5A 2QNRA 1Q3HA 4YC7A 4R7ZA 4GDFA 4FN5A 1D5CA 3EPHA 3QENA 2GWHA 2BKEA 1D2EA 2XTZA 1BMFA 4IDOA 1TQ6A 3CRMA 3TJZA 4YMVA 1OPXA 1PUIA 1XMIA 1NN3A 4D4LA 4EKDA 1TMKA 1GILA 1KI6B 3THYA 2A5JA 3I4LA 3ETLA 4JSYA 4RSGA 2Z83A 4IDQA 5DYGA 1ZRHA 1NG9A 1KI3A 3EPJA 3ZVRA 2HCJB 1E1RD 1T3HA 2QEQA 2ZE6A 3VR5A 2P6UA 3C14C 1KNQA 1R8QA 4W5HA 3ZZ0A 2BCJQ 2OESA 2CHQA 4A6PA 1XD9A 2PCJA 1F2UA 4KCGA 3RABA 2ORIA 1WXQA 1XWIA 4TLCA 3RS5A 1JQJC 4MRNA 4M9XA 3QUSA 1IXRC 4B75A 4POAA 5B58C 1SVLA 3RRYA 3W6OA 4CT4B 5JS7A 3V9PA 3FWYA 1W4BA 3LLMA 4QJ4A 1JEDA 2CCKA 2CLSA 3EARA 4FCVA 1IY2A 4FW9A 5AUQA 5J5CA 3ZQJA 4YXWD 3M4YA 3OAAD 2V6JA 4YMUA 1OFTA 4JLVA 4D81A 5H68A 1NVUQ 5IK2A 4C0JA 4LWZA 4C7OB 1DOAA 2P3SA 1Q0UA 2FEOA 4HDOB 1DS6A 3GLFE 1LW7A 3ZJYA 4PZZA 1FOEB 3TK1A 621PA 3LXXA 2WSSA 4B32A 5TXGA 4EPVA 2Q3FA 3TLXA 1FTSA 3HYTA 4JSTA 3QQ5A 2ZVQX 4PAQA 4RFVA 3H84A 2P0EA 4B2LA 3ZGXA 4RJLA 1M34E 2GJAA 3HU1A 5B64A 4A9AA 2G1JA 2RMKA 3QXHA 2F3RA 4M9QA 3SOPA 1DAMA 1OYYA 2ZSEA 4LPSA 1MO5A 3QKUA 2HV8A 4KBGA 1KMHB 3SYNA 4DCNA 2BC9A 4TQUS 1ETUA 4TQAA 1IY1A 2IYXA 1M7GA 4WZBE 3A6PC 1OXVA 4QL3A 4AIIA 1HQCA 2XNDA 3MAAC 4WZAE 2ZITA 4M2LA 2HDNB 2DFKB 4LYFA 2X8AA 1A82A 1GIAA 2W58A 1XPRA 3KFXA 3HR7A 3IBGA 3KFVA 1BH2A 5DNYB 1OT3A 4TLBA 3KUCA 4BGDA 1QHYA 4ESVA 2QAJA 2IS4A 2ZRMA 5EE5B 1E2KA 2C9OA 2V6IA 1G7RA 4NCNA 4OQNA 4PX9A 3JVVA 3DMDA 4B35A 1E69A 3OEHA 2BV3A 2QL6A 3UMSA 2GEVA 2VF7A 1XMJA 3MWLA 1RRPA 4LC0A 3A4LA 1Z22A 1OKKA 5JRJA 1OH8A 1F48A 2FGKA 4GOXA 2H7VA 1VHLA 4GI7A 4HZIA 5CDFA 3LX8A 2ZYUX 1KO8A 2VP9A 3FYHA 2ANCA 2J87A 3NC0C 4WBSA 4DIDA 1K6MA 2GXUA 4V0NA 2WJYA 5JFGA 3LD9A 4KJZA 4EPRA 3CZPA 5KNDA 1FFHA 2IYVA 1IM2A 4PFSA 2ZANA 3GLHE 3T06B 3BD9A 3PJRA 3IGFA 1P75A 4OK5A 1FQKA 1KK2A 2VQSA 4DRZA 3K53A 1CU1A 4NONA 2C5LA 3O8BA 1CF4A 4NL4H 4N3NA 4DKXA 2Z6VA 3BFKA 2QP4A 4RCZA 3BC1A 4U00A 5BXQC 3GJ6A 4IVQA 4C30A 2WICA 3THYB 2FSHA 4C2TA 5M04A 4PO1A 1CXZA 3QG1A 2ZAMA 2XXAA 1Z8FA 2WIAA 4TMZA 5SZKB 4QNRA 5L3SA 4TYYA 4M0LA 1G3MA 1JXOA 2NO9A 2BEJA 2WSMA 1VTKA 4ZI2A 1XBTA 3PUYA 5DYIA 2RB4A 4WZ6A 4AI6A 2IYLD 4ARZA 1F2UB 4YONB 1GRNA 1GVNB 3PR1A 2NO6A 3QPVA 4QHYA 2FGJA 1N6PA 3NEYA 3QIAA 3WNBA 4F4CA 4IFBA 2O8EA 2QPAA 1BIFA 2CBZA 4XWKA 3ONWA 4DLYA 1CIPA 2WJJA 3R20A 1H8HD 1KI7A 3T12A 3T5DA 3FMPB 4OQMA 2VP2A 4TTQA 4EUNA 5EE9A 3CBQA 3CH4B 3K09C 2VO1A 2BIFA 2OEPA 2WJHA 3GLIB 3RHFA 1WB9A 4B3DA 3QOFA 3OEEA 5L8VA 3RWOA 4IOLA 4HB4A 1NBMA 1GTVA 1XD2A 2CMKA 3UG6A 4DCUA 4M1TA 3AKYA 3TIFA 3B1YA 3A1WA 4RKFA 2MSEB 1DAGA 4IDHA 3W34A 1TF2A 1CJMA 2X77A 4QHSA 1S1CA 3AH8A 3MRSA 1P5ZB 5DHAA 4CGZA 1W5TA 4D2IA 1BO6A 1FNNA 1XD8A 5CB8A 4Q4HB 2G0NA 2RKOA 3AKDA 3CRVA 3D6TB 1A5TA 4LYHA 3K9GA 4YDSA 1W5SA 4CF7A 2C99A 1T5LA 1UEIA 3QF7A 2HLDA 1LF5A 2Q6TA 2ZSFA 4FI3C 3OE7A 4HB3A 2FDCA 3SN6A 2QQ0A 4B3GA 3BB3A 4R71A 4KITB 2W2TA 5HR5A 1H8EA 3PQCA 3U3MA 2HYIC 5HCNA 3B9PA 1S3GA 2V7QD 1N5LA 1S96A 3EA5A 3HDTA 3IHWA 4OI2A 4AYWA 4A15A 3ZIAD 1TEVA 1NIPA 5DO9A 5HPYB 3PUVA 2VYFA 2JLVA 3AVVA 3CM0A 3K8YA 3U7EB 5A0FA 1ZIOA 1C4OA 4JVMA 2KBEA 3F5FA 2Z43A 3FE2A 3FHCB 1R7RA 2NGRA 1DE0A 1Z6TA 4DIEA 2ODNA 1L4YA 2ZRHA 5KHOC 4P4UA 2XSZD 3JZMA 1SHKA 3SDZA 1OYWA 4OI1A 1AS3A 4D25A 4Z51A 2VBCA 2OCPA 2VHTA 4UXJA 3U3KA 3TW4A 1GL6A 3BJIC 1I4LD 1W47A 1WCV1 5TB5A 1VG0B 2IEZA 2Q9AA 3JVUA 1CR4A 3REFA 5KU1A 4TSFA 1OF1A 4QGGA 4HLUA 4DVGA 4V0MA 2XTMA 3UG7A 1KI4A 3OE7D 2WKQA 2ODWA 4GMDA 4Q4LA 5JS8A 3KDSE 3V4FA 3L0PA 4AG5A 3CX8A 1HT1E 1JALA 1XZQA 3GCGA 1AZTA 3TSWA 4FXPA 2EU8A 3HWSA 4MRVA 5G3YA 1U8AA 3VR1A 4GMXA 1IN7A 4LV6A 1VYTA 3QVUA 2I4IA 3AVPA 2JJ2A 2DCUA 2YOGA 3VR3A 4B47A 4DT1A 5JEDA 4DSUA 3GJ5A 2WMOB 4I81A 3FPAA 1NP6A 4YMTA 4DCSA 4ZDJA 1QHNA 3RS3A 4AKEA 3CIOA 3NC1C 2REXB 1MABA 1VCOA 2ZS8A 4Q4JB 3U44B 2H5EA 3U2QA 2O8EB 5JSZA 5LD2C 1FW6A 3D8BA 4LYAA 2PMKA 2WPDD 1N5KA 1NNEA 4M1MA 4NZYA 2A5YB 4K81B 5AK0A 5FBLB 2PX3A 1HY3A 2VTKA 5FPSA 3EZ2A 3LQQA 4B43A 4BFZA 4RD3A 3PITA 4BFUA 2QP3A 2ECKA 2JJ1D 3VKHA 1KK1A 3HPQA 4BRUA 2R6FA 4QGHA 2O52A 4WVFA 2GF9A 3KKQA 2IXGA 4UNSA 2ZE7A 1XJ0A 4QBGB 2WZQA 3NWJA 4HZUA 4JIMA 3TR0A 1RE0A 5FUYA 2ZQ5A 1E79D 2QMEA 3BB4A 3KKNA 3DMNA 1LY1A 1KJWA 1AS2A 3FKSD 3FHTA 2PT5A 1NJFA 2EFHB 1N6KA 1FX0A 4PO8A 2O8CA 1Q1ZA 1QHXA 2AN9A 4TLDA 4ZKDA 1IN8A 1N0UA 5CM9C 3EXAA 3FVQA 2KSQA 3VR2A 3VR6A 4IVRA 3P4XA 2KJQA 2GJ8A 4ON9A 1P9NA 2G3YA 5FPHA 3WYGA 3ICEA 4MYUA 4D4MA 4V02A 3A1TA 1TF7A 2V1XA 4LJ5A 4BEJA 3CPEA 3ZS8A 4D0NA 4E5UA 2IF2A 3IO5A 3U6KA 1OSNA 1R10A 1KHTA 2XZOA 2ZRAA 1I4TD 4AC9A 4ZCIA 3LNCA 2CK3D 4D0LB 4Q48A 3M6AA 4JBWA 2IT1A 5FBVB 2W83A 4DXAA 4JS0A 4QG7A 4M1SA 3AVOA 2P2LA 1M74A 1U0LA 1VIYA 2WWIA 3BE4A 1T3SA 4DLRA 4L4UA 3IQWA 2P5TB 3AF1A 3BOSA 3RC3A 2H18A 5JWRA 2CCGA 2WTUA 2ZJAA 1E9SA 1U8ZA 2WHXA 2FZ4A 2R8RA 1KSFX 5KDLA 4JBXA 3LDAA 3N2IA 1GRQA 3X2SA 5E7JA 2ZR0A 2FFBA 4JBYA 1UADA 1F2TB 2Q21A 121PA 4LHWA 4US1R 3QPUA 3TAHA 1GM5A 3QBTA 4TYPA 1W46A 5FL7A 1Z6YA 4PQRA 3VMFA 3EZ7A 1GWNA 3CNNA 1L4UA 3LBIA 4Q1FA 4QBFA 521PA 1CULC 2JDID 4BLTA 1MRSA 4AURA 2RGXA 2Q3HA 4TYQA 3RS7A 3NEJA 2W0MA 2V54A 4R2IA 1WF3A 1Z0KA 4U5XA 2RGNA 4G0NA 4WAUA 5DLQC 5FUWA 3W3ZB 5CITA 4NH0A 2ZRLA 4LBYA 4NYIR 3KXKA 4DDWA 1QG2A 2R6DA 2ZJ2A 4XTRA 1FNMA 2WIBA 2ZRPA 1FP7A 2A78A 1ZM7A 3DZ8A 3W9YA 2QT1A 1E1QA 4MGKR 2WJIA 5FBQB 4DT1B 2F55A 4PHFA 4K8OA 1OXUA 4A92A 4CIDA 1E2DA 2OUKA 2IXEA 1G7TA 4KVGA 1ODFA 1CRPA 2OBNA 2X2FA 2JATA 4NMMA 4URWR 4XVUA 5DN6A 4TMWA 5JSZB 3BFVA 4TWZA 3AP2A 1AK2A 4FMCB 3S1AB 1G8HA 1XEXB 4G5SA 4DZZA 1D9ZA 3P20A 4Q02A 2ZI4A 2O5VA 4JLNA 4PC1A 1OH7A 3GLIE 1P2UA 3U7FB 3AVQA 1IBRA 2NTYC 1X1SA 1OHHD 1L2TA 2EYQA 2ORVA 1DAIA 4S2EA 2A2ZA 1KO1A 3R9IA 2D74A 2P5SA 4XJXA 1G8YA 1TAGA 4HZUB 3T1QA 2V1UA 4UNNA 1YZNA 4C4PA 1DAHA 2Z0MA 3DHWC 1QHGA 2J5XA 1Q1QA 3RLFA 1E96A 1XEWY 2GA8A 2JASA 3TNFA 2ZYVX 3E1SA 2GCOA 5EE0A 3C5CA 5DI3B 2ZJOA 1XF9A 3EAQA 4LJ7A 2HCBA 2O8CB 4G01B 3ICQB 4CVNA 2ZUDA 1MOZA 3E2IA 2Q3MA 2RHDA 3GPLA 1HV8A 2EYUA 3A4MA 3CPJB 3GEIA 2QSYA 3AF2A 3U3JA 3TSZA 1DADA 2ZIAA 1F60A 2OCYC 4M1KA 3ZD6A 3FB4A 3UMRA 3CUEF 4TL9A 2ZPTX 3MWJA 4MKIA 1BS1A 1SXJD 4TT3D 2G88A 4URXR 1R5BA 1T8UA 2Y8EA 2QE7D 1KMQA 3IPXA 1QRAA 3BS4A 5C4MA 1CR0A 4IW3B 2GCNA 1BYUA 1TPZA 3QBVA 4MRRA 1M8PA 2FX3A 2O8DA 1YVDA 4BZPA 2W6IA 4QRHA 2ZROA 1E2FA 2CL0X 2VP5A 2FZLA 2AXNA 1Z0IA 1AS0A 4OK6A 1T91A 1BKDR 4OYHA 2GJ9A 1X8JA 3W90A 2VSFA 1CR1A 2BBOA 3QG5A 4LBVA 1I2MA 3MD0A 1W2GA 3T61A 3G82C 4P31A 2EFDB 1W48A 2QAGA 2BBSA 5JHGB 2J0QA 2QM8A 4Q7MB 2HT6A 1AIPA 4BFWA 4MDFA 2C8VA 2VL7A 3LV8A 2XEXA 5FPKA 3OESA 4BWYA 4BE7B 3TVDA 2XITA 3WBJA 1OH6A 1ZBDA 1G4UR 3FMOB 4DBLC 1E32A 1SVMA 4FD2A 1EGAA 1U81A 2OG2A 5L3RA 5FH9A 2FFHA 3IBYA 1DBSA 1UF9A 2AFHE 3NHAA 5KPJA 4DB2A 1D2MA 2FN4A 3I73A 5CYOA 5EXXA 3EC2A 3WRYC 3QSYA 1W0KA 1NJGA 1W36D 2GZAA 2J0VA 3AGQA 3I92A 4LOAA 1E4VA 1UJ2A 4TLAA 2WAYA 3IDQA 4KV9A 4LHYA 1XX6A 1RFLA 4MGZR 4XTCS 3ADDA 8OHMA 5EQTA 2VP6A 3PIRA 3TUZC 4ABYA 2IHYA 4M1OA 4PR0A 1ZUIA 3RS4A 5G53C 3CX7A 5BWMA 1PVOA 2IUUA 2W6ID 3NBXX 3FMIA 5TARA 4AYTA 2GRJA 3IIJA 1UBEA 3KXIA 2WMNB 2PH1A 1E2QA 4LBZA 2V55B 4RKEA 1ZUNB 5BW8A 3VKGA 3ZVNA 1US8A 5AUOB 3FKQA 2IX3A 3P4YA 1SXJB 2R65A 2JIZD 3C7KA 2F1RA 4F4JA 1YHNA 4OHYA 1RW4A 2ZRCA 4HUTA 1Z29A 4HDCA 4XD7A 1D2NA 2B8WA 2CNWD 2DFTA 5J40A 1Y3AA 1E2JA 1EK0A 3CNLA 3MLEA 4B33A 4ERNA 1IOZA 1FPMA 3EW9A 1PLKA 2J9RA 2OLJA 2N46A 4HB0A 1DARA 1NVWQ 5EE3A 1E0KA 2AK2A 2B8TA 2RGDA 3UANA 4U02A 3RRZA 2CLCX 3KL4A 2V8OA 421PA 3OIUA 1M7BA 2NQ2C 3AVTA 2ZEJA 2F9MA 4L5BA 4NCHA 3PUXA 2ATXA 3T1VA 3K0FA 4TQ9A 2J7PD 4HUQB 3FFBA 4ZO4A 2VHCA 3GFPA 2GCOB 4Q7KA 3ADKA 2GJSA 2IYUA 3Q5DA 3N5CA 5JWHA 3WP0A 4A8JA 1NLZA 2G83A 4QKQA 1Q44A 3CNOA 3R7WA 2CE2X 2NO0A 1UM8A 4KFTA 1GFIA 1Y63A 2HUPA 1A2KC 4M22A 2XOKA 1Q12A 5CB6A 1W36B 4Q19A 3A1UA 1NN1A 3HU3A 1ZINA 1S4QA 1YU9A 1LV7A 3I8SA 3BAFA 1X86B 2YV5A 4EQ6A 2XB4A 3PV0A 4N0DA 2JLYA 2YOHA 1AKYA 3CO5A 2BMEA 3PUWA 4CEJA 5LDDC 4OHVA 1ZU5A 2O8DB 4B76A 4II7A 3VR4A 3L2OB 5A5GA 2P65A 4Q9LA 2YZ2A 3U3RA 3I8XA 1XB2A 4P4SA 3C4JA 1IY0A 1BMFD 1N6LA 3GMTA 2GJKA 4FCWA 2GCPA 1JR3A 3W6PA 3UPUA 1E9DA 4NYJR 5IHPA 1E3MA 3IUYA 4M9ZA 1CLUA 1XPOA 2FWRA 1E0SA 1GITA 2R6CA 1DAKA 3LRPA 3BWDD 2G9NA 5C1BA 1ZNZA 4G5QA 4F92B 1KKLA 4Z8XA 1P60A 4JT4A 3OHMA 3GFTA 3I3SR 4CEHA 1LF0A 1R5OA 1UFQA 4X8MA 3X1XA 1P9RA 2IHBA 4MKFA 4M4SA 4RFSA 1ZUHA 1IHUA 2Q0HA 4US0R 3GLGA 4YLGA 2HEIA 4RD4A 3VKWA 1FP6A 3REGA 1G1MA 1KY3A 2BDTA 5CIWA 1WA5A 2NIPA 2AKAB 721PA 4FWIB 4GT1A 1Q3TA 3UWKA 1Z0FA 3W5JA 2IBMA 2ZE8A 2YJTD 5DGXA 4XVQA 1EWQA 1X8LA 1G6HA 1CJKC 3EA0A 4LC1A 4XH9B 2ZU0C 5IK2D 2VPPA 4ZCLA 4B3BA 4QOSA 3VX4A 1AM4D 2WSSD 1NG1A 1CBUA 2O8FA 3B78A 2WWGA 3DOFA 1US8B 2WM9B 2F9LA 4JJKA 4EDHA 4G5GA 1AGPA 3C41J 3L82B 2DWOA 4JKIA 3MUFA 5ELXA 4M21A 4V0KA 2W2VA 1Z07A 1B0UA 4PAMA 1COWA 3EWSA 4XSHA 4AKHA 3AF0A 1R5NA 2IS2A 3NH6A 1OB5A 3KJIA 4HAVA 2KB0A 4KLZA 4XWOA 2BEKA 1VYVA 4MKHA 3OF5A 2XNDD 3P27A 3GJ4A 4MYHA 2PLFA 4PHGA 3U60B 2QMOA 5JJLA 2ZJZA 3EZFA 3K0CC 1GDDA 1UBCA 1NSFA 5F98A 1QBKC 1JQLB 1W49A 3NBZC 5JRZA 4U7DA 3MJHA 4KFSA 4W5JA 1S8FA 1NL3A 4Q01A 3K0FB 3QKSA 3QE0A 1KO7A 4KAXA 2BKUA 1YE8A 5FI0B 5K8IA 1KZ7B 5JEEA 4LBWA 4M53A 4A8JB 2FF7A 3OEHD 1D8TA 1G5RA 4PC3A 4FMBB 4PZLA 5HKKA 1A4RA 1Z6AA 1LTQA 2ZS7A 4PXAA 1KDTA 2OT3B 1OKKD 4HAYA 4BLOA 3LQRA 5KSOA 3AM1A 2IC5A 2XX3A 5FI1B 1U0HC 4GFDA 2H8KA 3C5HA 2J46A 1KYIA 3R8CA 1QF9A 4EQ6B 5FBWB 1COWD 5BN5A 4B44A 1U9IA 3MFYA 4JVNA 5HCIA 5HZHA 4CEJB 3QNUA 4C3ZA 3VFDA
chains in the Genus database with same CATH superfamily
1DJNA 1XZNA 4M8NE 1A0OA 1XHFA 2DU8A 2GVZC 3FW1A 3PUZA 1G6OA 4AO7A 4EUSA 1LDYA 3AKEA 2BGUA 1VL6A 3GLVA 4Z8YA 5FNVF 2EP5A 2COUA 3BF8A 4BBZA 1LZKA 4DM4A 5AIBA 2QQEA 3Q7PA 5FRDA 3BFXA 5IPFA 2OCDA 4J8PA 3WK7A 1UPAA 1ORIA 3OQHA 5GM2A 2R8BA 3RS9A 4EKNB 1XCGB 2OVBA 1BEZA 2P9FA 4RFLA 4YALA 2R00A 3GEPA 5H70A 4EG7A 1R4MB 2J0UA 2BPOA 4MYSA 2B1JA 2GMWA 3KELA 4AYXA 4Z3OA 2TYSB 2O8BA 3CF2A 1FJGB 4MUGA 2C2WA 1XDBA 2BI8A 4KFRA 4FFRA 4C05A 4DQXA 1GZHB 1T2DA 4BN5A 1YF3A 3A4VA 5DHRA 2V3CC 1YVPA 2H4XA 2DWUA 1IZYA 2D1QA 2JJ8A 2ZIUB 4QJ5A 3W2IA 3JR7A 5KNCA 4JL5A 5HF6A 5EP2A 3OPVA 1ZJ4A 2VZEA 4FSHA 3R2JA 2BZSA 5TY0A 1UQRA 3I4CA 2ACVA 2QRPA 2P9TA 2ZRIA 4ZPXA 2V6GA 1NF2A 2VNAA 2IITA 3SVLA 2SHKA 1ZVMA 2G4CA 1U28A 3PXEA 4ZIRA 2O8FB 1RI4A 3K16A 3OD5A 2VJYA 4RNDB 1FK8A 1M67A 1TDJA 2O1XA 1II9A 3O7MA 2YR0A 1UXKA 4MYCA 4XQCA 2R1TA 3N2EA 3GLGB 1ID8A 4F1KA 1M83A 1PYGA 3NU1A 4LHXA 1ZH4A 1HEUA 2LWIA 2QRGA 1THMA 2HQBA 1H5QA 4ZZIA 1SQFA 2PD3A 1NLMA 1ULHA 4L6IA 3VV2A 4UPEA 3PGKA 5EHQA 1U0BB 3VVBA 3LKDA 4LYEA 1HE2A 4RKWA 2DFNA 3D3EA 1GDTA 3H5OA 2FEXA 2VRCD 3KETA 4P6VF 5AHXA 2D5IA 4U39A 4PRLA 4JZKA 4LPKA 4E94A 1NBOA 4MAMA 2OV1A 3IKJA 4QPDA 3G2OA 4R9VA 5C4GB 1TCAA 2DYKA 2OB2A 2EBWA 4IZHA 1CY7A 1NBMD 4HDRA 3K1ZA 1WBBA 4MGEA 2BJVA 4PPGA 4D42A 3AR4A 1SXJE 1WPGA 1GRRA 3IHLA 1Q7CA 4R83A 2OHIA 1PT9A 1FSSA 1GQRA 2Z3WA 4H9GA 5JMPA 2C98A 2XLCA 4P7JA 4REQB 3IEVA 1RD4A 2IZ1A 1D2GA 1QGAA 1XPJA 4N40A 4OI0A 4U5QA 1T5HX 1Y3CE 1ISGA 1NW5A 2X0DA 5DNUA 2ADMA 4NK5A 4E5NA 2E9SA 1W7AA 2HCTA 3EFEA 2PEZA 5E3JA 4MWOA 2QM0A 2AEFA 2HMVA 3GEDA 4NV3A 3A6HA 5K01A 3AF4A 3SVZA 1FMLA 4MLPA 4BCBA 5MHTA 1S6YA 4PG7A 1MKYA 2APJA 3AJ8A 1V4BA 3OPYA 3NYWA 1JHRA 1IHYA 1PW7A 1JFVA 1YE5A 2GAAA 3T7DA 4EW1A 4OU5A 1DQSA 4X9XA 4JOCA 1F4PA 1SHJA 2JKYA 4BQFA 1KJ8A 4FBLA 4AKSA 4C4ZA 1NY6A 1J39A 3IQXA 3AP3A 5FFFA 2RI6A 3M4JA 3UW3A 1V7QA 1K3FA 5JS1A 2QNBA 4YECA 1Z75A 3OQMA 4GH5A 1LX7A 3FPLA 4OYLA 1QX3A 4RU1A 1VHTA 5IAGA 4BNLA 5IASA 4WZAA 5F64A 1FF9A 1ZN2A 3ZCUA 1T1IA 4HGOA 4BKQA 3AEKA 2A1UA 3DO6A 3LO8A 1HNWB 5E4JA 2WIKA 1PJRA 4XWTA 2GD1O 1J1IA 2ODTX 3ZZMA 4DM7A 4LFCB 2WHPA 4J0HA 3NETA 5IKMA 1OASA 3G0DA 3DE6X 4DS3A 2HSWA 1G3IA 5AT1A 4YK7A 3C6BA 1VHDA 2VNIA 3Q8XB 2E82A 4KTTE 3JAWA 1UAYA 3PXBA 4FINA 2RBKA 1VPEA 4MRMB 4FCCA 4B81A 5IXSA 5BMVF 4Y6PA 4R3WA 3WSVA 3P32A 7YASA 2QSUA 4O2LA 3DT6A 3QXCA 1Z34A 2QD5A 2XI4A 2LZ0A 1XA4A 1XXHA 1XG5A 3DKRA 4C0BA 4F38A 2Z6QA 1E2BA 1RXIA 5NULA 4MWEA 3TG8A 4C0QC 3EVEA 1H6AA 1V95A 2NXJA 3H42B 5JWOA 1E6UA 2QQFA 1DLJA 3L8GA 4YP5A 4MVCA 4TSFD 3ACBA 2XMDA 1AA9A 2HPVA 4OBBA 1WXFA 2AI2A 2OFOA 5KVSA 3DTTA 3UPDA 3KT6A 4DLBA 2BHLA 3FYUA 3QVVA 4RKRA 1C0KA 4MWDA 1G2IA 5B7NA 5IJ9B 2AUMA 2IU6A 1UC5B 5I9MA 1GZ3A 2WG1A 3Q5EA 4GXTA 4DWWA 5IAOA 1GKYA 4PZCA 3WQHA 1MT0A 1ZD4A 4ZVNA 4B6FA 2H8GA 1Y4AE 3KKLA 3HSSA 2GTPA 4DJEC 3AUFA 2JJ2D 2YMPA 3PNVA 2PUGA 3TSOA 1UBKS 2ZB4A 4OB7A 1UMBB 2I1QA 1FVXA 1DRWA 1BU5A 3I2HA 5ECWA 5KNLA 1YDFA 1Y1TA 4KKVA 3ZS9A 4EJ6A 1CLEA 1RWVA 1V8BA 5LIPA 3AZPA 4X97A 1C7RA 4MEBA 5SYAA 2VHEA 1K27A 1N5MA 2L0XA 3EGXB 3O1HB 4L0CA 4YO7A 4IKEA 4C0HA 1JNXX 2F43A 2ZIZA 1OREA 2H2DA 2GEFA 1BD4A 3AM5A 5KWJA 4PBTA 4F2WA 5L3QB 5BQ5A 3CJRA 3L8ZA 1A9YA 1EP3B 4I4TB 4FIDA 2PZMA 1UJ4A 2YINC 3OJWA 4AJIA 4H4CA 2ZSIA 1AN0A 1PZNA 1K7XB 3WWYA 1JBQA 1IHXA 4JLOA 3TYXA 1TJYA 2C61A 1ZS9A 1W5FA 4PTYA 3ZVMA 2Q29A 1KOGA 4RXTA 4MJLA 2YBDA 5KKCA 3B52X 1H0SA 1V11A 1VBNA 2Y66A 1T2CA 3UXMA 1PLLA 1XDZA 3AR6A 4EGQA 4HI0E 3CFYA 2M1ZA 2YJNA 3UGTA 4DJJA 4V0LA 3SP1A 4EKGA 2PUCA 3VU9B 5LA6F 2FQXA 2XBLA 5KYKA 4KNVA 2HA5A 4EYQA 3R6GA 2SKCA 1ANKA 1J0DA 4XOUA 5D3MB 1HURA 5EJAA 4KR0A 3ZBPA 3JTEA 4AUNA 3C7AA 3EDRA 1Z83A 3RRJA 4C4SA 4XWWA 1SQ5A 1GP2A 2FTKE 1G64A 3MJSA 2C7QA 2PUEA 5BWNA 5I7SA 4Z1MA 2YJ4A 3PHHA 2JGIA 3ZQ6A 3ROPA 5MF6A 2Z9DA 1HQYE 3GA7A 2KLHA 3C6MA 3IOBA 1TD1A 4OM8A 4G97A 1T8RA 2AXPA 4HYYA 3UJ3X 3AL0C 4BJ3A 1S01A 1F2DA 1XZDA 1K3TA 5AW8A 3TFOA 4O33A 1LVUA 1P6XA 2V3WA 3MMXA 3OQVA 1X7ZB 4XA8A 3JD1A 5LZ5A 3RK4A 4DSTA 4FDUA 3HLKA 3EMBA 5CD9A 4NOMA 5KWVA 3FBTA 2C2YA 2YCBA 5FWXA 3ZD8A 2WWWA 1KEPA 4FX5A 2DHEA 3WIOA 4BATA 4BMXA 4FE3A 1R6BX 3KL2A 4JC8A 4ND1A 4TTSA 2X4GA 4BP8A 4U1RA 3B20A 4TUYF 1LNSA 3TGLA 2FXIA 1KZGB 3C74A 1TKAA 2PGIA 3I58A 4U63A 3TL2A 1IN6A 1J2JA 1YRQA 4U2GA 4WZBB 4YUXA 1ZD2P 4RSHA 5B2FA 5CEJA 3G79A 3PNPA 1GRCA 3MNFA 4HY3A 1ZMBA 3NOQA 3K9LA 3WMEA 1QRUA 3KB2A 1MABB 2A9RA 1N0WA 3HVJA 5HMMA 3KB8A 1P81A 2E1PA 3VRHA 4FYKA 2HIAA 3FBWA 3PEEA 5DYWA 2DR2A 3ZWQA 3KSRA 3PC4A 3M6LA 1VPLA 1Z2CA 1RU3A 4JYCA 2E4WA 4HDAA 1LKZA 3FZNA 1JTFA 4A3SA 3DEJA 3WJ2A 4IDBA 5K6TA 3L6EA 5AM1A 1GOTA 1CJVC 2C31A 2B9EA 1IHPA 1ONSA 2YJ6A 4UHCA 1Z5GA 1F6BA 3IUEA 1OXTA 4BV9A 1RXWA 1JYFA 4M8SA 5CAEB 4EECA 1J8YF 3ZNNA 3JYHA 3BQNB 2QYTA 3IP6A 4DMUB 1L7BA 3WLSA 8MHTA 5JD4A 1OLUB 3W8RA 5A3RA 3NBQA 4FLMA 2BGIA 1DKMA 3T5GA 5DM60 3ZK9A 5CG2A 2JCVA 3VPGA 5BVHA 2DTEA 4RK5A 4I9HA 4ZV4A 3Q3JB 2EIHA 1JJVA 4LE1A 4RZ3A 1M0WA 1HLGA 3ZH2A 1LDEA 3CJQA 4G0QA 5EP3A 1MO6A 1DKOA 4MQLA 4B6EA 4BUZA 1K92A 4PONA 2WKPA 3DVSX 4D9GA 1E7MA 1FX0B 2LR0A 3JASB 3K0HA 4WCDA 1YTUA 3X43A 1LRLA 1ABFA 1P62B 3R9XB 1TUEA 1JHPA 3GLUA 4KRYA 1P1FA 1H2HA 2YIJA 2YYZA 3WGNA 2XCIA 4EX6A 1U98A 1XZPA 2NZVG 1JIKA 1E9AA 2EW1A 4G5HA 4LOKA 4WLFA 4XDYA 1Q1NA 3D6UA 3O73A 4QUHA 3BYZA 5TE9A 3V8BA 4ZD6A 2YZ7A 3N05A 2XAUA 3R5KA 4M8IA 4I4CA 1GTL1 2XDQA 4QASA 1RAEA 2WUGA 3EGDB 1SOAA 2A0XA 3DWEX 4YP0A 1EFRA 5K0GA 2VHVA 3I04A 2FP4B 3M83A 3ZV4A 2W22A 3RT9A 3GLGE 4JI7B 2VJDA 3PJDA 2H11A 3FOZA 4COKA 2W48A 4NWIA 4EDFA 1IM5A 4ZOCA 4IHJB 3BHMA 4B46A 1NBWB 2MU1A 4YAOA 1R6DA 3IT3A 3KYCA 1ZHHA 3LF2A 1NC1A 3LYAA 3LCRA 1BQ4A 4K5QA 4PLZA 3RD5A 3V4OA 4CYMA 3K71B 2IPMA 2Q5LA 3SF8B 1SPXA 4F4DA 1P4RA 1KKMA 2XGJA 1Z0UA 5M3BA 4AWBA 4I9UA 1E2UA 1FMTA 1GSOA 2BFOA 3B1VA 3EHEA 1O58A 5A71A 3E9RA 4ADSG 3IS3A 1M6VA 5TT1A 1E3TA 3SIWA 3N6VA 4QUKA 4I2VA 4FM9A 1W9HA 3QU9A 5I7RA 1PX0A 1R8JA 1ZIPA 2IWHA 3LRXA 4HH4A 3T1OA 2PT6A 4EFNA 1HYQA 1UBTS 2I4OA 3IJPA 4W9NC 5TS3A 3M6VA 4L16A 4MKGA 1JQ3A 4P7GA 5F4ZA 1JDTA 1L4LA 3KQTA 2YKGA 3RYTC 3JD0A 3ABSB 3NP7A 4P08A 3CLRC 1PGPA 3F6PA 3TW8B 4IIUA 1YJBA 2X0NA 4BFSA 1JDZA 2VAMA 2O3TA 3RTEA 5DTJA 5EUBA 1OLSB 3L7DA 2V97A 1ZW1A 1X7XA 2QRZA 1NPDA 4XDGA 3TL3A 2W6NA 4F2GA 4K9OA 4L4RA 2O0JA 3H8WA 1N5JA 3RF6A 5B58T 1QU2A 3TVTA 3VC2A 3GEGA 3K1AB 1A7JA 3WQQA 4B2YA 2DY0A 3N5KA 3NXSA 5CJJA 2ERYA 4IL5A 3AF5A 3UFBA 3O4FA 2RGYA 3PR2B 5FBZA 5DZSA 4XM0A 1NBHA 2ZIVB 4QDUA 1U0RA 4KPEC 4LY0A 1PR0A 4JODA 5B3JC 4RK6A 2ZQYA 4LOHA 3U4AA 3VGJA 5JNWA 2Z08A 4PG8A 3KKEA 1CZOA 2P78A 1IG3A 2PSEA 3NHMA 2HD4A 4CEIB 1R4AA 1X1RA 4BVHA 3WBBA 1V3UA 2W6ZA 4OG2A 2C97A 3Q12A 2A1TS 3LFTA 1G8FA 3I1FA 3OX4A 2XIQA 1HMYA 2CEKA 4R1MA 4X3PA 3ZXSA 2NP6A 5K9ZA 1ORTA 3L8HA 3OBIA 1K7EB 3IIIA 1OY1A 1ZK2A 1QHHA 4UAGA 3TAUA 2H2AA 3R3WA 1V8ZA 5L7TA 2C00A 3FLEA 1EDOA 2F3UA 1YIOA 3MVEA 1S2MA 5FORA 1LK0A 4URYR 3WRYA 2RBGA 4D9JA 1W87A 3X1MA 4LRQA 2QN8A 4EZBA 4EJFA 1EUCB 4TMXA 2XYPA 3NMUF 2WVAA 3BMNB 4OKSA 1NKVA 1WEKA 2JKVA 1U3FA 2XZDA 4FUQA 4OQPA 1VFNA 4P4TA 3GB9A 5U4XA 3H4MA 2P6RA 5F9FA 3PUHA 4D96A 2JCYA 3QJYA 4YRGA 3OUUA 2VTBA 1NBME 5GJWC 1II0A 1KSHA 1JEYA 5DT9A 4M86A 4CCYA 3V80A 1YQQA 2AOUA 2BCGY 1XEFA 3KCNA 2HRZA 4RZHA 3X1KA 1PVVA 2I7DA 1VECA 3E7PA 1NIJA 4EWLA 2JIRA 1ACMA 1R5JA 4QE3A 3OAAA 1Y5MA 3RG8A 3HLTA 2WEKA 3AY0A 4N8SA 1SXPA 2YMQA 5C4IA 1YJQA 3EEBA 3GFRA 4OQYA 5G1NA 1YCHA 2AKYA 1RQLA 1T8YA 4KQGA 4IG4A 1PWXA 4DWJA 2F4VB 2ILVA 2VNJA 1TMGE 3RVBA 1UPTA 1ZL0A 4OVKA 2GBLA 2JZNA 4LYGA 3UT5A 3AEZA 3K72B 4AG3A 3AI2A 1H4SA 1FYEA 2OE2A 4RO0A 1R6XA 1KNXA 2Z5VA 2HBYA 1NW9B 1NQTA 4HNVA 5B6IA 2C9BA 6PFKA 3LDGA 4E13A 1GCOA 3CUYA 4GLBA 4N3BA 4F4IA 3OT1B 1GGEA 2FPIA 2A3RA 1U3WA 2G6BA 2GDJA 3C8DA 1R9MA 1XN1A 2AG1A 2GEDA 5F12A 3KPJA 2EBHX 2QTTA 4Q1BA 4F11A 3ZDAA 4HLQB 3KKMA 2ET6A 1ODSA 3IUBA 1EPUA 1V3TA 3DXFA 1R4ZA 4Y6SA 1RRKA 4TL7A 1Y5RA 3P9RA 3D0OA 1P31A 3JQAB 3K31A 4FQ5A 5B2ZA 5LA6A 4CBVA 5LWHA 4CF7A 1G4HA 3AOGA 3LVFO 1GRVA 5ESWA 4DV2B 1KJQA 3IURA 4U2FA 3H5RA 2E4ZA 2OBLA 3RRBA 3W2HA 4M0DA 3T15A 4C9BA 3KQNA 3EW7A 2BMJA 4XDZA 4R0VA 4H60A 3KR9A 3WFJA 5DW0A 1DKLA 1JI0A 1QIFA 3U0BA 4DUGD 3SVTA 4L3OA 2XCSB 1KQ3A 4GLOA 4HDNB 4KBYA 3AL2A 5I8PA 5FTNA 3FWKA 4DJ5X 1JRLA 2WW8A 2KW5A 4HQLA 5CT9A 4BLSA 3O91A 3K4PA 1KAEA 2RE8A 2C57A 2QN7A 3GIWA 4D46A 3FX2A 4X8HA 2A0UA 1OTYA 4TMTA 1TYZA 3G2PA 2II6A 4EY7A 1UBFA 3SQOA 5F76A 5D00A 3ELYA 3F8TA 2FE1A 4G24A 4DQUA 3WLAA 4BFLA 1O8CA 3ESRA 3I30X 4UATA 4E14A 3PFIA 5IJ0A 1IOLA 5KKAA 1II8A 1E77A 1E2EA 1SM4A 3CIFA 2P9HA 3DD1A 4M37A 4P93A 4ZOAA 5EKXA 4KQIA 1YDGA 1HYBA 4ENUA 4RELA 5FOWA 5BN4A 5HUHA 3H1EA 3STTA 2O57A 3K35A 2V0CA 4NZ9A 1WDTA 3ZCQA 4JL6A 1K1EA 3NQ41 3RANA 3SNHA 3QQPA 2VKTA 3ZQKA 1OB2A 3WB1A 1S8AA 4C7BA 3FB1A 4IJQA 5A02A 2FSFA 3AEQA 4D1YA 2H51A 1MD9A 3KPVA 2E4UA 4WBNB 4P83A 2LCIA 4D6XA 1N7JA 1TZKA 1MZVA 2YMMA 4NBWA 5BRJA 3O3NB 2BTQB 3U80A 2O2EA 3H2SA 5NLLA 3BTSA 3HCFA 2FMFA 2RHLA 3K1YA 3GRCA 4WESA 4AKIA 4F2DA 4GSYA 2ZRGA 1CUJA 2AYZA 2HA0A 2Y76A 4S35A 4JT2A 5ALZA 1E6EA 5EP1A 3ZYZA 1ZHOA 4TVSA 4PS0A 5T4EA 4CM6A 1IAQA 4BO9A 2YQZA 2J7KA 1L4FA 1P2TA 2C7PA 3H9BA 1QBGA 1XR3A 1R0XA 2XF2A 2NYUA 4BBPA 1DQYA 1K68A 1KZ9A 1UBUS 2ID9A 3K9HA 4JVLA 4NE2A 2QTVB 1T6XA 2OCXA 2FZVA 4N39A 4UD2A 2PH3A 3I9JA 1S2GA 2BP7B 1JR3D 2IUSA 1O6GA 3HKDB 2F1JA 3C7CB 4U7FA 4OSOA 1N2CB 4ARAA 2PZJA 2ZI3A 5JNUA 1YQEA 3MMPA 1QRSA 1R9NA 1FRFS 1X1AA 3ZN2A 4GPTA 5DLPA 3QFSA 3DOHA 3IHKA 2ADFA 4PNPA 1PD0A 4LOLA 4RVUA 2R87A 4WFKA 1XZGA 3ZGNA 1AXRA 1LK7A 1I32A 2AB0A 4L5CA 1IXZA 3OQIA 5LXTF 1YRBA 4YPVA 3AESA 1OLXB 4AFNA 5A4KA 3CO0S 3D5EA 4YJFA 3PWZA 1DPGA 3VYRB 2AZTA 3PNLA 4N5MA 2XXJA 3RC8A 3UV7A 1IBCA 3EEIA 3LIPA 1ISHA 2OV2A 4Y2VA 1RHMA 2XRYA 3BGIA 1AXEA 1P39A 4AZVA 2XBMA 4Y2SA 2VK8A 3GJ7A 3DPUA 5CRIA 4YCSA 1LVGA 3VHLB 4F3TA 1Z0JA 1EVZA 4B3HA 5JAIA 2WKWA 3E5RA 3RSOA 1PJTA 1C9NA 1MDBA 1TADA 1XP8A 3B85A 1JDBC 2QYSA 5IDQA 4QTZA 5CH3A 4W5TA 4NR0A 2BVNA 4G0PA 4Y9TA 1F9EA 3JPWA 5HFJA 4UUPA 2XB2A 1FUKA 3UGKA 1RLOA 2QW8A 4G0YA 3CY6A 3BIWA 4J9UE 4IY1A 2PL3A 3RVRA 2FLVA 4JI1B 5FPYA 3Q85A 1P4SA 3W5AA 5C8ZA 1LJUA 5JCJA 4B3RB 3AP1A 4BQRA 1E7WA 2DTXA 4ARCA 5JYCA 2IP2A 2FEWB 1RJ9B 1VG9B 4RWEA 5I4BA 3QE9Y 2ZBGA 1XZAA 3EWAA 4EG1A 1A8IA 4A10A 5EWLB 3VSDA 1I8TA 3WYNA 4XPIA 5IP5A 3HWWA 4MUFA 3ULKA 3UUGA 2C3PA 1XO1A 3RF7A 5AKGA 3QH4A 5JUWA 2OFXA 4HNAA 3T9CA 3SC4A 3NBFA 4JR0A 2X5KO 3QF4A 4RPJA 4FCTA 3INGA 2YJGA 1DXQA 4QYTA 4WD3A 2HREA 3S2FA 1CP2A 4FKZA 2WFMA 3VOAA 4LDQA 4EY3A 1S7GA 2VIIA 3RG2A 4MS4A 2AF3C 3CRW1 4IIGA 4KRFA 5C8YA 1EE9A 2B83A 3G5AA 1MRNA 4QX6A 5JNLA 2SNIE 1MB4A 1QOZA 1W1WA 4DSNA 1TYEB 2MSDB 2HWWA 2IS1A 3A36A 4I9FA 3WB0A 1E9EA 5J4HA 6AT1A 1ZO8A 3GJQA 4NJMA 2WJGA 3EQ9A 4B2PA 1YKFA 4UNRA 5ALLA 5KHLB 1OXXK 2DEUA 4K46A 1B42A 1WL8A 3TNDA 2AYXA 4IO1A 3NUGA 2X8WA 3T3OA 2ZETA 1G2OA 1ZYUA 4HXYA 4G63A 1KH2A 1V1MA 3KWLA 2N1BA 2A9FA 2GFHA 2YYYA 1YJ5A 2Q1YA 1Z4PX 2F67A 2Z04A 1Z2PX 4PSKA 4QYMA 3PFGA 1V7ZA 2ARKA 4FFMA 4R01A 4TTIA 4MLDA 2PLWA 1YR7A 3BWMA 3BGSA 3RASA 2CHEA 1LRKA 3BORA 1TZJA 1GPDG 3QITA 4IOJA 4K6GA 4KIGA 4O4IF 4WKPA 2D13A 3WDLA 4HBGA 1G9XA 1PT5A 2FG5A 1RQGA 1KI1A 5ILGA 1KY5A 1ISJA 2X9GA 5INTA 1EVKA 4H77A 4I9GA 5BRNA 2OHHA 3ZBUA 5HQTA 3FIUA 3EQ8A 4NKRA 4QXQA 4R2WA 1KI2A 3CCCA 2BHNA 3AFGA 4YI3A 4GG1A 1LLFA 3KXLA 5CH8A 5EXSA 5LQCA 1B16A 2O1EA 3IP8A 3DDZX 3OTGA 4L74A 3ZE2B 5ADUS 4I55B 4N6NA 2ALJA 3F3SA 1GNRA 2H57A 1XTIA 4Q7EA 3G2QA 3E7XA 3UK0A 3H9UA 1U0SY 1XDSA 2IFTA 3HCRA 3RJ9A 3TNYA 4RH3A 4KN9S 1LS1A 1LBEA 3B2EA 4LZAA 4AKTA 2FG7C 1AGXA 4QZVA 2VI5A 3U9SA 2PSFA 4O59O 5JDIC 3CKMA 3N8HA 2D2EA 3BWVA 4Q4AA 2E6UX 1RPZA 2H08A 1KI9A 2E5WA 1SGWA 3G6WA 4Y2PA 4PFQA 1T10A 4RF5A 3RRXA 2IEBA 4YMLA 4OPMA 3RNLA 3GARA 5KNCD 5BOSA 3SJAA 3I37X 3ZV7A 3GHHA 1PJAA 4P3XA 5EFZA 3VNVA 5CIQA 3JQGB 1E61A 3L7OA 2FVYA 2Z4RA 3I5YA 4B5KA 3QSGA 3KTFA 3GQBA 2OHVA 4NH4A 5E7MA 1QHSA 1XLTA 3H7IA 4DR7B 2YS7A 2FZWA 4RUKA 5BWOA 4O4JB 3FNGA 4H1TA 5B30A 2FHSA 1N7HA 2FJUA 1B26A 4GQBA 4YFVA 4B6SA 3DE5X 3U1BA 2H4JA 1NP7A 5LCXA 2C77A 5BT8A 1QQ7A 4H1VA 5F51A 4DMMA 4EFMA 5BR4A 3M4ZA 4KO8A 4L75A 4FYXA 2X1VA 3PVCA 4EPWA 2WAAA 3SYKA 3D7RA 2PK3A 1LNQA 2OYSA 1IZ0A 2AFHB 3WGKA 5FV7A 3LSTA 2BSQA 1W4LA 1JG2A 5CM8B 5B3LA 4ZI5A 1X14A 4WHMA 1E79A 2C84A 1QLHA 1U7TA 2WIGA 5FULA 1O1YA 3W9SA 5EQDA 2AVDA 3W79A 2ZOSA 2GNOA 1IWPB 3HMKA 1NQVA 2C4KA 1RPNA 3I76A 3ANMA 1LXCA 4E5MA 2GBCA 4OMUA 4DRXA 1WZEA 4TKVA 3K5PA 3UATA 5CFQA 1JPNA 3AWDA 3MSXA 4ZCPA 2YWRA 3H2ZA 5UKDA 3P7MA 3EBLA 5EUQB 3E15A 1PBNA 1HDRA 1FYWA 5CK5A 3TLBA 4C7XA 4RENA 3BXZA 1B6SA 1IG0A 4J0QA 4WQMA 3RM3A 4NBRA 2OD2A 1SVOA 1JEAA 4FW8A 3WYAA 1PJBA 5DYTA 4QA9A 1RAAA 3PHIA 4WINA 1CRZA 1P17A 2HY7A 4QXRA 5LLSA 4EZEA 2DG2A 3CUTA 3LZ6A 1AHNA 2O0HA 4OUDB 2V0NA 5KYTA 4QAJA 3IE1A 4DR4B 2HWKA 4YBZA 5CB4B 5J47A 2FPUA 2G76A 4KU4A 1XRRA 4XKJA 1XEXA 2ODBA 1RQXA 2CCJA 1RJDA 4C14A 1G2QA 1WSAA 1R0KA 4KB5A 3LZCA 1RWMA 1QIGA 4EA7A 2P11A 1TU3A 2QBYB 1T9DA 2X2PA 1WTCA 2AYYA 1L7AA 2OC9A 2KS6A 3KWJA 4PHCA 4L9AA 2VUUA 1CRWG 4HQKA 4LRXA 4XX1A 5K0LA 3FMVA 3ICOA 5D3KA 3ZDYB 3SJBA 5F9HA 3RCBA 1XVVA 1M1UA 5KYWA 4JVSB 5IC5A 2GK3A 1BX3A 1JHYA 2Y2UA 3DMYA 3ZZNA 2UZ1B 2Z2ZA 3N7UA 2EZUA 1WPRA 2NVWA 5KJEA 2QTBA 4IFEA 1MHPA 5HF5A 1Q83A 1Q16A 1ADCA 5GJCA 3A4IA 3D4IA 3FFAA 3QW2A 5GM1A 4F8YA 3BHJA 1CETA 3UJBA 3G9ZA 1XDWA 1QH1B 1X1CA 2N3ZA 3GGDA 4OJMX 1ZPDA 1KMNA 2R2AA 5HZKA 5KNBH 2AEEA 2DHRA 3V32A 1H6DA 2ICAA 5HK8A 1RSZA 4C88A 3N2NA 3B9RA 1N57A 4FTWA 4F97A 3HJTA 4XLLA 3AXTA 1KI8A 1VMEA 4OJNA 4OLHA 5CFLA 1QYRA 1Z63A 5KAPA 5HJ7A 4LYJA 4S0ZA 3LWBA 2GF0A 4B09A 4ZDKA 1VJCA 2CVFA 4V0QA 1RS0A 3BGVA 5HE9A 1TEHA 3VUFA 4C4TA 3NHYA 4LRSB 3V7YA 2ZAGA 2ZIXB 4Q1CA 3ECSA 3T1HB 1ARZA 3QNWA 1F12A 3G9TA 1H2WA 3GJRA 4FHZA 1X0XA 2PTHA 2PRSA 4MZXA 5LXTA 5JBIA 1N2CE 2HA2A 5G4LA 4CKWB 1N9KA 4IJMA 5K45A 2O0MA 1FEZA 2QD1A 2B1GA 1IZ7A 4UUMA 2YVAA 5F2EA 3O8OA 3ZDBA 2NX2A 1QTRA 1E0JA 4ZV7A 4NMLA 2CSUA 4PGMA 5D01A 2IVZA 1GQ2A 1XZKA 3GP5A 3K6JA 2IODA 1NVAA 2AD5A 1PJ2A 1TE2A 2WKRA 3TNLA 5KDOA 1QONA 4IJUA 5AUPB 3A1DA 4HDKA 3HO1A 1AN9A 1RHKA 1WMAA 1GAXA 3D1VA 3OTWA 2YVUA 2C5GA 4CLOA 3PDHA 3LPAA 2AF4C 2BGNA 1R00A 4IWYA 2BF4A 3T5CA 3OPYB 4F5DA 1ZJWA 4W82A 2YBEA 1SU4A 2C96A 2F3QA 5CJPA 4DPMA 1PV4A 1YQGA 2Z1MA 5B4TA 1QWSA 3Q9NA 1KSGA 4E21A 1AGNA 4YMGA 1IDOA 2GK7A 1OJLA 1L7OA 1VIAA 3WICA 1WZUA 3E81A 5AOVA 1K6EA 4JAVC 2GZHA 2ZS9A 2I1VB 4OQFA 1G5QA 2CLMB 4IUCS 1OHHA 3MT9A 1I2DA 4PXYA 3K70C 1R9JA 3M6UA 4YX9A 2OORA 2W2NA 1ZMOA 1HT2E 3NVDA 1NMXA 3R6LA 4YCMA 2IA5A 1MTOA 1N9GB 4OFBA 4X20B 1BDBA 1CK4A 1YZVA 2A1UB 4L8FA 4TMYA 4WUTA 5MGBA 5K2MA 2QD4A 4QOGA 3PPYA 2ZI9A 4B2IA 3L8FA 2P8JA 4GXRA 3TOCA 3UPTA 5E2AA 4HGYA 2WHPB 3FLMA 2EDCA 4D4JA 1X74A 4DDVA 4HJXA 1QYXA 3BL8A 2F7SA 4G5XA 5F7JA 4X65B 1LC0A 1MQ8B 3U4HA 1U7ZA 3OLCX 1PTJA 2K4MA 1QFYA 4WA7A 3FNHA 1Z9BA 3UMCA 5I6DA 5IAKA 4ITUA 4Q66C 5JCPA 1NRJB 4BO0A 2G07A 4Z1MD 1P4JA 5DFAA 3VOTA 4E09A 2ZU6A 1Z4JA 3BL6A 2CD7A 3P71T 2XMCA 5BSKA 4R8VA 1GQSA 4KL8S 4XIJA 3Q8LA 3OIDA 3VI4B 4FUTA 1E60A 1RRGA 2VEDA 1NRWA 4TT3A 1L1EA 1XVLA 1ATIA 1FQOA 5G41A 1P33A 3G3EA 1ABBA 1RM4A 1JR3E 1EXWA 3V7UA 5HWSA 4OIFA 1ZGHA 4WBXC 5CYFA 3FYUB 3PKZA 2BRUC 1T5SA 1P0FA 2BZGA 2G7ZA 2VJOA 4JQOA 2VEOA 1G41A 1YC2A 3D8RA 3WXMA 2EEZA 2ZUCA 2ZUWA 1KOFA 2IU4A 1ISIA 4GW3A 1EE2A 2WJAA 3A1VA 1WCIA 2FA9A 3GEEA 1NUHA 3A9UA 1NQ5A 1NLFA 3WWEA 1W581 2H4YA 2YIMA 2IDKA 4KSCA 1RR6A 1PE0A 3W8NA 5H81A 3K9FC 5ARCA 3E3MA 1E9RA 1GAJA 1KI6A 2C54A 1I36A 3A11A 3E5HA 2WOJA 2WU1A 3UJ9A 4US2R 3D4NA 3N70A 3LFHA 3L0BA 2NWQA 3R0IA 2J59A 3F71A 3JALB 3NFYA 4DDHA 2ZE5A 1VL2A 4ZTZB 2I91A 1LDMA 3OKPA 1JU3A 1U3GA 4RGQA 1RPTA 4HOYA 3RWMB 3T5PA 2PMBA 2ECFA 4H4DA 2FFAA 3QI7A 4EW6A 4DLWA 2HRDA 2X86A 3F6CA 4HKTA 3T34A 1Z6XA 4O0MA 4E22A 5I48A 1J9GA 5BT9A 5JZ9A 4L95C 3OCWA 5LOVF 1TJ4A 4Y2QA 5EQJB 4BP9A 2WUWE 5IMSA 5IRCD 2IH2A 1U8CB 3O75A 1N8SA 2C3UA 2RHOA 3NOOA 2AW3A 1A4IA 1V11B 1ZZGA 3MCVA 5ALFA 4YLYA 1A9XA 4H59A 3AUKA 2OP0A 4M1YA 5E6UA 5JS2A 2ZI5A 4LZPA 2O8VA 1I2CA 1L5YA 2W0SA 4KVAA 1OGYA 3WMRA 3W0LB 1JECA 1RDFA 3I6MA 4BE4A 4XDHA 1TYAE 1MJHA 1JLHA 5TDHA 1S2IA 4J3FA 2AG8A 5KYGA 1NVXQ 1NU6A 3SJUA 2PL5A 4MWZA 4YR7A 4TRNA 1NHGA 4BZQA 1QFMA 3V4LA 3I9V6 1Z35A 5CPBA 5LNK6 3AEUB 3TIVA 1DTSA 2F1HA 3EC7A 1Z4LA 1EVEA 5BURA 1HLPA 3C70A 1M1NA 2FOIA 2JD0A 2RH5A 5EUMA 3ZWXA 3JQEA 2Z8YM 5FA6A 1G4AE 2FPLA 3E9ZA 4TVBA 4YIHA 2GPAA 2WF6A 1XRMA 3KQOA 3KX2A 4OYYA 4CKCA 3Q7QA 1QDLB 3HUFA 1SJ9A 4DV4B 1JTEA 3H5LA 4HN9A 5G0VA 1EIWA 1E99A 3X2EA 1Y6ZA 4GYWA 1PJLA 3LPCA 5KI6A 4JDUA 2PKEA 2E4YA 2JBWA 4HCJA 1YRAA 4IEEA 3LX4A 4NAHA 4OLJA 1KMHA 2E1RA 4UEOA 2VSYA 2AHOA 1AHHA 1PYDA 2B35A 2OGZA 4I1UA 4KLNA 4II3A 2PFGA 4R98A 2EWMA 1MC1A 3HXOA 3H1TA 1CKEA 5GADl 4L5AA 4LVUA 4Q12A 4EA8A 4C2AA 3ESQA 5B12A 3TR5A 4GX2A 3SYLA 1I9CA 3PSAA 1ISSA 5C7YA 5H7XA 1CCWA 2P4UA 2EX4A 3MGCA 4I50B 3O5AA 2XDYA 2VFAA 3HYSA 1JJ7A 1N1GA 1E3DA 1KETA 1REQB 2FNAA 2XIJA 4K6KA 2CVZA 4D7AA 2PXXA 4DDKA 5HKAA 5IH7A 4LEIA 4CLRA 2Z6AA 1XUOA 1RAGA 5JW6A 4X3OA 4D0RA 3I2IA 1OW3B 5FNVB 4D9NA 1VPTA 4XWGA 1ZDMA 1IJFA 1ORVA 1RTTA 1J23A 5DCUA 1KQFA 1Z6GA 3EXFA 2B6NA 4KK3A 4NTZA 3QOXA 4W9MC 5EJ2A 4BO3A 1JLSA 3FDZA 3P1JA 4WKOA 4RMHA 2CB9A 4UKDA 4LJ9A 1SWWA 4BQIA 1KFEB 3G8YA 4Q3BA 3I5XA 3IYLW 5T41A 3PE4A 2Y9PB 1K6XA 2H0RA 3NHPA 3KQHA 2GVDC 1KL7A 1P9WA 5FBKA 1CR2A 3FNEA 3G0CA 2WLSA 6CHYA 1FS4A 3CLTD 5K3OA 5C35A 3GL9A 3VQTA 3PRHA 4TT8A 3T3HA 3UJPA 2JS7A 1DTEA 1EA5A 2JGDB 2OVFA 3FGOA 5FWAA 4AP6A 4UXIA 2JEOA 3PHLA 1L5OA 2PYDA 1GG8A 5B36A 1JNYA 5F7OA 1PUJA 2JEZA 1Z7BA 2I4NA 3EVGA 2AUNA 4P3NA 3KQQA 3KYDB 1Z7EA 4L76A 4GDFA 2ATIA 4FOPA 4FN5A 4DV6B 1Q0PA 2P6OA 3NWPA 4KRXA 1SXHA 5ER6A 1HE3A 5T4HA 4QGSA 5BWLA 3EPHA 2FR8A 1PR3A 4WDRA 3WS7A 3ZU2A 1SIOA 2XTZA 1T8PA 3NYRA 5EY5B 2R8OA 3TJZA 2HWYA 1DI0A 1IJBA 3OFJA 2H9YA 4RY0A 2PKRA 4WJLA 3NIGB 2VG8A 1ULZA 2RHJA 4TS4A 1UPFA 3MUOA 5EMKA 2W42A 1T0PA 4ZVMA 1HG1A 3FMGA