5JLJA

Crystal structure of kpt8602 in complex with crm1-ran-ranbp1
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
208
structure length
202
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Next-generation XPO1 inhibitor shows improved efficacy and in vivo tolerability in hematological malignancies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords GTP-binding nuclear protein Ran
total genus 58
structure length 202
sequence length 208
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5jljA00
2Q0HA 2QE7A 3K9NA 4BRWA 2BHRA 2C95A 3KZ1E 2R62A 2O8DA 4X8HA 3GFTA 4IDOA 4LJ5A 2AX4A 5FPTA 3LFUA 3GJ7A 3CRQA 1R7RA 2BBWA 2IYXA 1T3SA 3RRNA 5KNBA 5C4GB 3C8UA 3L0IB 3B1VA 4LWZA 1XEWX 4LV5B 1R8QA 3BB4A 2JDID 2R6CA 5F9HA 2GCPA 1QHIA 4MQBA 1OSNA 1EG7A 4D26A 2YWFA 1JBKA 2CL0X 3NBZC 2F3TA 4RZUA 4HLQB 4B35A 1YR8A 1L2TA 4MITA 3WXMA 2CJWB 2JA1A 4HDOB 2ZRBA 4PHHA 3PQCA 5FUXA 4A8JC 1KTVA 3I72A 1AQYA 2CHQA 4Q48A 2JLRA 4JS0A 3W9YA 2HT6A 4I1VA 4C0AC 3QUSA 1PLLA 3VR2A 1GL9B 2YC4C 3IO5A 4PSKA 4Q66C 1U8YA 2A78A 1U99A 1HT1E 4ZPXA 4ZDJA 2QN6A 1XXHA 2GEVA 4HZUB 3EZ7A 1IQPA 2JLZA 3RNLA 1KAOA 3KJEA 1GP2A 2C2HA 3GJ4A 5EP1A 3OIYA 3F8TA 1YKSA 1N0WA 1TNDA 1NN1A 1NY6A 1IN6A 1OV4A 2IYTA 1G8HA 3RRYA 3KQHA 2X2EA 1T3HA 2FA9A 5DHAA 5AK0A 2A5YB 1G8PA 4I81A 5ANRB 4NU0A 1A2KC 3T61A 1XCGB 4XWOA 1Z63A 4AY2A 2PCJA 3MWJA 5K8TA 3T12A 3JVVA 1KSJA 1E0SA 2OAP1 4HZIA 3D6TB 1E2HA 1VDZA 4GOXA 4CEJA 3SJBA 3H0KA 1E9DA 2DFLA 4C0QC 3KB2A 3ECCA 3VX4A 1P2UA 1AZTA 4PPFA 3T1TA 2P65A 2G77B 3A36A 5HTKA 2BIFA 2QBYB 2REXB 3U6KA 1U9IA 1KI2A 4OYHA 4DCSA 4IOJA 2WWYA 3MAAC 3RANA 3TSZA 3KFXA 1ZNWA 2QAJA 2FFHA 3MCAA 1YZTA 4JBXA 4PX9A 4PQYA 3AVTA 5FL7D 2FFQA 3IEUA 4N0EA 3K0FA 4JVMA 3P1JA 1OYYA 1ZJ6A 1YJ5A 4CVNA 5DYIA 221PA 4TSFA 4DT1B 2IL1A 3ADDA 1KO7A 3EW9A 2C96A 3K0AA 2H5EA 4RZXA 4B48A 1X8KA 4LSGA 4IVRA 2JIZD 4RFSB 1AS0A 4CDGA 5JRZA 5AUQA 5JJLA 1U94A 2XTNA 1QVAA 3LX5A 2BEKA 1E69A 1T6NA 4TQUS 4LJ8A 1W4AA 2V6IA 1XRJA 2BC9A 2DFNA 4DJTA 1ZM9A 2R6GA 2H57A 3K0CC 2KI5A 4PSVA 2LKDA 1KI9A 5CIWA 5JZVA 3GLHE 1OXVA 3R20A 1W5TA 3U4QA 4N3NA 1G7TA 4TYYA 1G5PA 2IYUA 2B21A 4Q00A 1KMQA 5JI2E 3KKOA 3KJIA 4LJYA 5EXTA 4QKQA 3GLFA 4WAUA 4DIEA 4D4LA 2WJIA 1S1CA 4EIWA 4IOMA 3EX7C 2IYRA 3RWOA 1B23P 3WMEA 3K0SA 1EGAA 2ZJ5A 2YWGA 2FDCA 3FVQA 4AYTA 3GEIA 1S9DA 4QBIA 2IYQA 3CRVA 4QJ3A 5G40A 4HSEA 4BQSA 2HV8A 1ZC3A 1UM8A 3THXB 4JLKA 3EPJA 4AURA 2Q9AA 1YZKA 1J2JA 1KI4A 1E0JA 5LBIA 3ASZA 1XCPA 2F43A 2DWQA 4A0FA 3DMDA 3LQQA 4HUQA 2WM9B 1NLFA 2ZYTX 2CK3A 1KMHB 1R8SA 1CXZA 2D74A 4DLVA 1FTSA 2IYLD 3Q5EA 1RIFA 5FBWB 2IXGA 3DZDA 2GJ9A 3LW7A 2NG1A 2JJ1D 2QPTA 4I1UA 4F91B 1QF9A 2O0JA 4EJSC 3QKSA 3RS4A 4C2TA 1YZQA 1VG8A 5EE5B 3THWB 1T4GA 5CLLA 4URZR 2MSDB 1F2TB 5E4FA 3IO3A 2ZROA 4A8JB 4V0LA 3KXIA 4LPKA 5DLQC 1PV4A 3A58B 5BN4A 2W0MA 3QPVA 1DAHA 3L2OB 4U7DA 5EZ6B 2B6HA 2ZYUX 3QF4A 4B76A 1AM4D 3T1OA 2XSZA 2ZR9A 3ZIAA 4B3FX 1KDRA 2CDNA 3M0EA 3W3AA 1VTKA 721PA 2GK7A 2PMDA 5CYPA 3HP1A 2PZGA 4ZKDA 1M34E 3O47A 1QHHA 1T91A 3NDPA 2VP0A 3TQFA 1A4RA 1CR2A 1SVOA 3GQBA 4EPVA 1P72A 4QBGB 5FBVB 2IS2A 2A30A 3NXSA 1JAHA 1CR0A 1ESNA 1UPTA 1DVRA 2DR3A 4EFNA 3UIEA 4EAQA 3QXHA 2J5XA 2PLFA 2WJHA 3SHFA 1JR3E 2QPAA 4TYQA 5CJPA 3RC8A 3FB4A 1GRNA 3KFVA 3LBIA 4LJ6A 4AKEA 4E22A 3U7GA 1OKKD 1D5CA 4GNKA 2H8KA 3CKLA 4QJ4A 1QVRA 2FG5A 2V8OA 4LI0A 5EP4A 1P9WA 4ASUA 3QBVA 2FH5B 2WJVA 1G3RA 1U2RA 1T9HA 2CEAA 1JJVA 3QBTA 4IVQA 2I1VB 2RGNC 2VO1A 5AUPB 3A4NA 3B5JA 4XD7D 4C9BA 4CF7A 1Z8FA 4OHXA 2OILA 3RYTC 1N5IA 4NL4H 5KSYA 5EE9A 3TH5A 1E1QA 4K46A 3D8BA 4GP7A 1W0JA 3KJHA 3SFVA 2JLSA 2ODNA 2FV8A 4P4TA 1UBFA 4ZCIA 4M53A 1Q20A 1DS6A 2VQSA 4ON9A 4AKGA 2ZR7A 1OHHD 2CLCX 1U90A 5IT5A 5KSZA 5JS7A 5KU1A 4TQAA 4JYCA 4LBZA 4ASUD 2ZTSA 4XIGS 1OLOA 1LF0A 3QE0A 2P6UA 3A6PC 1Z5ZA 2H17A 4DSOA 1SXJC 2XZLA 3DVLA 3FMPB 4LCBA 5GVSA 1DAMA 1G18A 4LHZA 4FMDB 1DTSA 1U0LA 4P31A 1YR6A 3X1XA 3CX8A 2G83A 3QXCA 4QNRA 1XU4A 5HKKA 4TMKA 1TF5A 4LYAA 1NJGA 5CITA 1LVGA 1P6XA 2CNWD 3BD9A 2PEYA 4Q1BA 4JLNA 1Q1BA 4YXWD 3SYLA 4QJ5A 4B3CA 3CO5A 2JEOA 3QXSA 4Z51A 1YZUA 1G6HA 5HPYB 5JJIA 2XSZD 2D7CA 3PEUA 3Q3JB 5TV2A 4I99A 2QY9A 4NYJQ 3NC0C 4XH9B 4S2EA 4G3XA 3DM5A 1S1MA 3VTKA 3ZVNA 4G01B 1U9IC 4E03A 2OLKA 1OW3B 2FE4A 1TU3A 4TL8A 5TARA 2A9KA 3MD0A 4KSBA 4KFRA 4RD1A 4PC6A 1AGPA 5AJZA 4JT4A 1G4UR 3FDIA 1ZMXA 1Q0UA 1RJ9B 3LXRA 3PEYA 1ZP6A 3A4LA 1XMSA 2GEDA 1QHNA 1R0XA 4B34A 2Q3MA 1U81A 1CKEA 3CNNA 1UAAA 4CEJB 4NH0A 5AR1A 2R9VA 1E3MA 3CRW1 2P0EA 1UKYA 1TQDA 1Y3AA 4XTCS 1AZSC 1DPFA 2PZEA 3ZGXA 5CDFE 1VG0B 4ILEA 1RRGA 2XOKA 4GSYA 5HE9A 4PO1A 3IBGA 3K9GA 3WNDA 4JVSB 3DM9B 1A5TA 1KAGA 1KSHA 1ZUNB 3BWDD 4D4KA 3V00A 3AM1A 5H1YA 4CRWB 3X1ZA 4PAQA 3HJNA 1W36D 4QXAA 4NYMR 4B33A 1G3MA 3EAQA 2QMOA 5FUWA 3WP1B 1W36C 3EPKA 1ZNYA 2PBRA 1W2HA 3K9HA 2ZRNA 4CW7A 4Q19A 3I4LA 5G3ZA 2V4ZA 4IDPA 5CJ2A 5K8IA 2CCJA 5KDDA 1KI8A 3TRFA 2HCJB 1HE8B 3U5ZB 1Q1EA 3GEEA 2ZS9A 3KX2A 2NO7A 1TTTA 1IJEA 1P5ZB 1Z0JA 2FU5C 1NMXA 4Q1EA 1V43A 3TMKA 3I8SA 2BJVA 4WXPA 1WRBA 3UATA 2WWWA 3SYKA 5GJVC 4EFLA 4DLTA 2WAXA 2ZQ5A 1RRCA 3REGA 1UBCA 2CNWA 1ZYUA 4ESHA 2OEPA 2FPMA 1UDWA 2QMEA 3N2IA 4H9GA 2IA5A 1OFUX 3PCRB 3VR4A 4QL3A 4JJKA 5SZIA 3IEVA 3Q7PA 2QSZA 5AJWA 5FUYA 3FHTA 1FMLA 4QGFA 2F1JA 1UKEA 3TJZA 3LVQE 3CM0A 3NVAA 3CNOA 1Q21A 5J4LA 4LK2A 1KZ7B 1OFHA 3RWMB 3DDCA 1KZGB 2ZRJA 3A8TA 3CF0A 4X8LA 4NCJA 2PT7A 3VU9A 3NBFA 4BUJA 3CPEA 4WXRA 4AG5A 3TW8B 3U3MA 2RAPA 2ERXA 3KQKA 3ND8A 1Z07A 1CJVC 2QZ4A 1XD2A 3K09A 4NCNA 4D25A 3BAFA 2BBSA 3N2EA 3CONA 4QG7A 1P9NA 1QHXA 3ADKA 4YQFA 2PLRA 1IONA 1ONBA 3KXLA 1N6KA 1NG1A 3THYA 1TU4A 5DHFA 1GKUB 4URUR 3RLFA 3KKPA 3BH0A 3LD9A 2GEUA 4B6EA 1GZSA 4BLRA 4DT1A 4DUGD 4FMDF 2IS1A 5FBQB 5FTMA 4C7OB 3SR0A 3DHWC 1XJCA 5HE8A 1XZPA 2XNSA 2OFOA 4NHOA 4MYHA 4PXAA 2XZOA 2F55A 4C30A 1EWQA 2VSFA 1E2NA 2AR7A 1CS4C 2FSIA 1G3UA 2ZJYA 4KITB 1F60A 2RB4A 3OEHD 2XXAA 2O8EB 1P60A 4HAVA 4LYHA 1N6IA 5FOTA 2RMKA 3RAPR 5HCNA 3NDBB 3LBHA 1YE8A 4HB3A 2CHGA 3HPRA 1X8LA 4FW9A 1IY1A 1E9RA 2IYSA 5GJBA 3Q9LA 3T15A 4L5BA 4OK3A 4CYMA 1E9SA 2EFCB 2YKGA 3KXKA 2XZPA 4LC0A 4U02A 2VSOA 5F9FA 1XJQA 2QGZA 3TSWA 2HCBA 3I8XA 1O87A 4RFSA 3W5IA 1P75A 621PA 1ZW6A 4HI0E 1FNMA 3AEZA 1WB9A 2E1RA 4WZ6A 2HXYA 4M22A 4MDFA 1S3SA 2FJUA 2VP6A 1NBMA 2QU8A 1K6MA 3B6EA 1EWRA 2ANCA 3C15C 3IKJA 1IY0A 2EVWX 1X1SA 4M1TA 3KUDA 4FINA 4PANA 4OI1A 2XX3A 3N5CA 4MKFA 1IN5A 1JR3D 4PPGA 3C7KA 2YWHA 1M7BA 1MO6A 4EJSA 1TQ2A 1E9CA 4H1UA 2LCFA 1QHSA 4AK9A 2CK3D 4NYJR 4M1KA 2QAGA 3SFZA 3SJZA 1E6CA 3T34A 3E2IA 4JZKA 1G8YA 4DVGA 3CW2A 1UDXA 3SS8A 1U8AA 3GLGA 2O8FA 2I3BA 1WDTA 2QE7D 4A92A 2J0VA 4W5JA 4G5OA 3M1IA 4IDQA 4NCHA 2CCKA 3AP2A 5DO9A 2FFBA 1Z0FA 5DISB 4P4SB 4R71A 3FPAA 2NIPA 4O2LA 3G0HA 1G16A 1SZPA 1VIAA 2GCOB 4DHEA 1OFIA 4GPTA 4B2PA 3ASYA 3OESA 2B7BA 1AK2A 1R5OA 2QBYA 1ZBDA 3R8CA 1KY2A 1XPRA 3MLEA 4M9XA 2RGAA 3IHWA 3EPLA 2IUSA 2IK8A 3LAWA 3K70C 2E87A 1FUKA 2OO7A 3EPHA 1CP2A 2ZEJA 4B43A 1NVXQ 1SVWA 4Q9HA 2L0XA 2ERYA 1GUAA 4C0SA 2QP4A 3GPLA 1GNQA 1FZQA 2WHXA 3H86A 2QL6A 2OBLA 3CF6R 1JQJC 3CH5A 1EXMA 3MJHA 5FFMA 2KBEA 3L0PA 2CMKA 2ODWA 4C0KA 1N6OA 3FHOA 1Z83A 1GKYA 5C4MA 1AS3A 1R5NA 3RSOA 3ZLJA 3HU1A 2XNDA 2WPDA 2OCYC 4PR0A 1NLYA 3OF5A 4DB2A 2ZI5A 3QKUA 3MJRA 4BLQA 2GESA 1NSFA 4FIDA 2GVZC 3U3KA 4OJKA 1VYVA 5FPSA 3GLFB 1DAIA 3OAAA 4TLCA 4C0HA 4DLYA 1FP6A 1W48A 1YRAA 2BDTA 3DPUA 3VKGA 1QHHB 1RFLA 2P5SA 3O8DA 3PUXA 3TSOA 2W00A 3ZD6A 3B82A 2BWJA 2C78A 2MMCA 4BPBA 4IHQA 3GJ8A 4ZKEA 3U7FB 2OHFA 2JGNA 4HAXA 1FMJA 1IM2A 1KK0A 3IIMA 1O3YA 4LYFA 2AD1A 5JLJA 3EARA 1K5GA 1QG2A 3ZD7A 2WKPA 1W44A 5JRJA 4C2UA 4RJLA 4DIDA 2FNAA 5J4VA 3GLFE 2F9LA 2ZRPA 3BS4A 4MGKR 5E95A 4ZI2A 1OH5A 2AKYA 3WP0A 4UXJA 3UMSA 3R9WA 1DO2A 1Z6XA 4AYXA 3PR1A 4OHYA 4E07A 1EFUA 2WIAA 3ICEA 4PTLA 2WMOB 3NHBA 1ZM7A 3W8NA 5BQ5A 1G5TA 2YJTD 4L9WA 3TK1A 1W4BA 2R65A 4YXWA 2PH1A 2N42A 1JEDA 1F6BA 3LLMA 5LPNA 2VYFA 1NBMD 2NO9A 4G5RA 1SGWA 4B75A 3Q85A 4FCTA 3LY5A 3QEJA 2ZS7A 3RC3A 3CRMA 1HT2E 4TLBA 1VECA 2ZPTX 5DNYB 2REBA 2IWHA 4TTRA 1XTRA 2ECKA 1HH4A 2YZ2A 3RABA 5JHHB 2ZI3A 1BO6A 1R10A 2ZRFA 4MRSA 5TY0A 2WOOA 3EWSA 2IYWA 2R6DA 1DOAA 1HEIA 1E2LA 4PAMA 4TT3D 5IK2A 4LJ9A 4YMTA 5JJKA 4BWYA 5K8UA 4YMWA 5JEEA 3AUYA 3TUZC 1C1YA 3KL4A 4CEHA 4XTRA 2GHIA 2JASA 4Q4HA 3K9LA 1W0JD 2IWRA 3VX3A 1BYUA 2WAYA 3QI2A 2BOVA 4XSGA 4LV6A 4UXHA 3T1VA 2X19A 3QKRB 1JXOA 2IUUA 1YZGA 1UFQA 2ONKA 2REOA 2PJZA 4KYUA 4XOIA 4NPHA 3M4YA 1YQTA 3UG6A 4W5WA 3A1TA 4OI4A 1CJKC 4OQLA 2VEDA 1SULA 5FL3A 2GVDC 4TMZA 2ZJBA 2FGJA 4URVR 1LS1A 2FFAA 2QORA 1N5KA 5DE3A 5H70A 4PPQA 2AXPA 4LYJA 4A2QA 3KQNA 1F2TA 1EX6A 5DI3B 1P2VA 4XWKA 1XMVA 3AP1A 4RKEA 5BN5A 4AKHA 2VBCA 2G3YA 4Y0VA 3FGNA 1ODFA 5EQTA 1E99A 4JLPA 4WVFA 1RW4A 4KHZA 1R6BX 1Z0AA 2HJVA 5GVRA 1M2OB 4MRVA 1NMYA 3AKDA 1DO0A 3QJYA 4GT1A 3C5CA 1G8FA 1Z6TA 4FXPA 1ELOA 4EPXA 1MABA 2V3CC 1FPMA 2QAGC 4MYTA 2GILA 1QRAA 4NMMA 5TDHA 3U6BA 2PZFA 3GJ3A 1ZD1A 4YDHB 1PZNA 4FI3C 4DB4A 3CZPA 1Z6GA 1LY1A 2B7CA 3MMPA 2O0HA 2LWIA 3NH6A 1N3BA 1R2QA 1GNRA 3IQWA 5FPYA 2A5FA 2QP3A 5DN6D 1NJFA 3GLHA 4UXIA 4JL8A 5KNDA 1YHNA 5FUVA 4BFTA 3EIHA 4U5XA 5AUNB 4DLZA 4JBYA 1Z6YA 3I73A 1U0HC 2VHQA 3D3QA 2PT5A 5G41A 4A82A 4CEHB 4LOAA 4V0OA 1XD9A 1GNPA 4RVCA 2GA8A 2JJ1A 4LHVA 2QEQA 1VYUA 5UKDA 2FOLA 2GAAA 2HYIC 4DBLC 4R9UC 1TUEA 2J0SA 4IXMA 2Q9BA 2VP9A 1KOFA 1R0ZA 2Q3HA 1KKMA 5LB4A 4OHVA 3VFDA 4PPNA 5HR5A 4YMVA 2XTZA 1AKYA 4JSYA 3B7GA 5AWFC 1V5WA 1CRQA 1XNJA 1UKVY 2QSYA 3NKVA 3S1AB 3SNHA 4DSNA 1G9XA 3R8FA 1F48A 3TBKA 3FYHA 4HDQB 4TZ0A 3P26A 5JWRA 4CEIA 1UBGA 2V6JA 3ZJYA 4D0GA 3BIFA 1OFTA 1M1YE 3C4JA 3FFAA 4PFSA 4Q47A 1W36B 4HB2A 2WBLC 1CJTC 2V1XA 1E1QD 5EZ5A 2J7KA 1TQ6A 5AJYA 1XD2B 1ZRHA 3G5UA 5EUQB 2D2EA 1F3OA 4LV8B 5M04A 2JLVA 1H8EA 1YU9A 3L0SA 3LQRA 2WSMA 5JSZA 1NMZA 2CL6X 1ZCBA 1DG1G 3VR5A 2ZRDA 1N2CE 2W0SA 4BASA 4FMCB 4Q1DA 2EFGA 4KXFB 2OV2A 3SEAA 1EFCA 3IBYA 5C18A 2HDNB 4M4SA 2G9NA 4QHTA 4MYCA 3M6AA 1WE2A 1E98A 2QUZA 3QENA 4JYBA 3LNCA 2O8CA 1KHTA 4XJXA 5FTKA 1EFTA 1DELA 1XXHE 1FNNA 3OZXA 4MKGA 1T0JB 2EWVA 2JIZA 2VP2A 4ZDKA 1ESMA 5A4JA 5FR1A 2PEZA 1Z0DA 5FH9A 1P3JA 5L3QB 2GJ8A 3QNUA 2ORWA 3LO5A 2H18A 3VKHA 2OAQ1 1P2SA 1F2UA 2D2FA 4Q7JB 4A8JA 2QQ0A 3G82C 5IK2D 5D3MB 3TLXA 3ZVMA 4IEIA 4WZAE 5D3MA 3ZDQA 1W47A 3BB1A 3H2YA 2AXNA 2C9CA 3B9PA 4DEYA 5L3VA 1YVDA 1ZUIA 1H8HD 5C2JB 4DZZA 2DWPA 1T8TA 2G0NA 4Z8YA 4ZV4A 2JLQA 2FEMA 2N1BA 4JKYA 3BXZA 1P9RA 4D4JA 2JLWA 1FFHA 3ADBA 3FOZA 4RY2A 3AVYA 3EA0A 4HAZA 2V7QA 1E94E 3AF3A 1CJUC 3BE4A 3GMTA 4MRNA 4XVQA 2BKUA 3JZMA 4DLXA 4EJSB 3J81k 2ZI4A 2A5DA 3FMFA 5IF9A 3VR1A 2FGKA 2V55B 4E09A 2ZAOA 4JVLA 2HT1A 2ZUDA 4IFEA 1E4VA 3OAAD 4JL6A 4TYPA 5TXGA 2C04A 2OUKA 3BFVA 1KIMA 2Z43A 4HUTA 4RFVA 1I4DD 2PMKA 1RJ9A 3Q8XB 5FBRB 4U00A 4OQFA 4TMTA 1OKKA 2FZLA 2O8BA 2GAOA 1Q1QA 2CLSA 3QF4B 3DMNA 1GKIA 3SN6A 1M7GA 5KSPA 3FMIA 1FL9A 1NLZA 2VIIA 2HJGA 3EASA 2G1KA 4BZPA 1GG2A 2PL3A 2VF8A 1XD8A 3BERA 5CLQA 4HAUA 5HCIA 1G19A 4LX0A 4RZ3A 3QIAA 4Z8XA 4F7WA 5C1BA 4CGZA 4DCNA 1FW6A 3SU8A 5FPKA 4QRHA 2CVHA 4W7SA 1KI3A 3IIJA 4V0NA 2JDIA 1KKLA 2CE7A 1M8PA 2ZJOA 3T5DA 4TLEA 1MO4A 4TL9A 4XVUA 1NNEA 3V4FA 3EZ6A 4AG6A 3L82B 2EYUA 1I2MA 2CBZA 1ZNZA 4EQ6B 3JVUA 1Z29A 3IUYA 4DLUA 4RD2A 2FF7A 4BEJA 2Z4RA 5CDFA 1YZNA 3AP3A 3LLUA 2AWNA 1U0JA 2W6IA 5BWMA 5ELXA 2ORVA 1UKZA 4MA4A 2WJJA 2H92A 4P3YA 1W7AA 3K09C 1TAGA 4LPSA 1DEKA 2GK6A 1UEIA 3GFOA 3L0OA 1JEEA 1N25A 3KUCA 5JBQA 1U8ZA 4TSFD 1Z6AA 1X1RA 2WV9A 3KB1A 4UNPA 1U98A 4M0LA 3NWJA 3CR7A 1FTNA 2Z4SA 3QPWA 4PC3A 5FBLB 3NG1A 2VLIA 5KSOA 1IHUA 3RSLA 1CR1A 4TLAA 5JWHA 2ZI7A 4F38A 1ZIPA 3OFND 3GFPA 2J0UB 3BH6A 1I4LD 1NY5A 4DCTA 1M7HA 5GADl 3CRRA 4TL6A 1EK0A 4BLTA 3LXXA 4QHYA 2QAGB 3E70C 3R9IA 1GRQA 4GOJA 4HATA 1W0KA 3CPHA 4NTZA 3P4XA 1PUIA 2RGNA 4Q4JA 2F1HA 1CF4A 3LVRE 2V1UA 3H4MA 821PA 2QA5A 3EC1A 1OB5A 5FPHA 2BBTA 2QI9C 3HR8A 4M1SA 1SXJE 4XWAA 2I4IA 3FTQA 4YMSA 2UZ3A 3K70D 4ZCMA 1NVWQ 2OT3B 2NMVA 3VHLB 1CLUA 4HLDA 2ZU6A 2VHUA 1DBSA 2O52A 1JPJA 3B1YA 5G53C 4NP6A 4W9MC 1GSIA 3TNFA 4G5GA 3U3JA 5BXQC 3UMFA 1MO3A 3MUFA 2ONJA 5CM8B 4CT4B 5JCPA 2BVNA 2JCSA 1N0UA 2K5UA 4Q4HB 4AKIA 2W83A 3PVSA 1N6PA 4L8GA 2WJGA 5GJWC 1JR6A 1D6JA 1UEJA 3EZ2A 2CE2X 1AA9A 4ZDWA 1SXJB 1TX4B 3W34A 3AV0B 4PSAA 5CB6A 3A37A 4KO8A 1GFIA 1SXJD 2W58A 4JKIA 3THWA 3PEWA 1JPNA 1PJRA 4KFTA 1D2NA 1A2BA 4FCVA 2ZE8A 3U3RA 4GMXA 1KO4A 2ANBA 3F3YA 1KK1A 1E2EA 4KBFA 4C0JA 5H68A 2Y8EA 5TMPA 2IUTA 3ZQ6A 1PUJA 2OCBA 5HZKA 4A36A 1BS1A 121PA 3UMRA 3BB3A 4DDWA 2V7QD 2ZSDA 1JR3A 1OJLA 5LD2C 3QF7A 3EIEA 3K70B 1EFRD 2J59A 2PX0A 5JECA 1AGRA 1XCMA 2BMFA 3CR8A 1Q44A 3GLHB 4FN5A 2ZRHA 4M21A 4B2LA 2IXEA 3HR7A 2RGGA 4URWR 4URXR 1XX6A 4UNNA 1PVOA 4I4LA 4NDZA 3CPJB 3B85A 1SHZA 1Q57A 2OXCA 4KJZA 4JIMA 4OK5A 4ACAA 2O8EA 2ZRLA 4PHGA 2KB0A 4O3MA 3AF4A 3QG1A 3E1SA 4DKXA 5JI3E 1RRPA 1MABB 4GBMA 1G41A 4LC1A 2QT0A 2CJWA 3O8CA 4NONA 1ZC4A 1MV5A 3AKEA 3AVOA 4H1VA 2JLYA 4UNQA 1E32A 1Q1ZA 3C16C 5EJEA 4F4IA 1Z28A 2PX3A 1XJ0A 4TYWA 2IBMA 2ZI9A 2ZSAA 1WF3A 1RZ3A 4Q18A 4BEBA 2IW3A 3F0TA 2ZS8A 4GZLA 3UG7A 4D81A 1MH1A 1VKJA 2A7QA 2F7SA 3KKMA 5JWOA 2HLDA 1LTQA 2J3EA 4M9ZA 1G5RA 4Q21A 2YVUA 3B8HA 1KNXA 2ZITA 5C46F 3U61B 4NE2A 1FOEB 2NGRA 2ZRMA 1ZUHA 4YMUA 1ZD8A 4M2LA 1S0UA 1TL7C 3OFNA 3MRSA 4LHYA 3QKRA 3C5HA 3RS2A 1OIWA 1XEXA 1M74A 2B8TA 4PZZA 4NYMQ 1N6HA 4UJ5A 4UJ3A 3UWKA 1II9A 5EE1A 1DARA 1KO1A 5EXSA 3B1XA 4ESVA 1C4OA 1E4YA 2F6RA 2ZSBA 2OXRA 4WIAA 2KBFA 4Z1MD 5JHGB 2BCJQ 3RHFA 3A4MA 5LDDC 1DADA 1BYIA 2CVFA 1G64A 3PUVA 4XSHA 3I5YA 2OFXA 4K8OA 5BYKA 4N0DA 3VQTA 4M1YA 5L3QA 1II0A 1BKDR 1OIVA 2C9YA 4X8MA 3BK7A 3HPQA 4C7OA 2GBLA 1ZM4A 2IC5A 2ZVPX 3P27A 2GZHA 4HDCA 5FOWA 1SKYB 1W1WA 2XB4A 3CH4B 4IOLA 4BFUA 4E5UA 1W4RA 2FX3A 1ZD9A 3A1WA 4LRWA 1GRRA 2DY1A 2FPLA 2X8AA 1JNYA 3P20A 3CLVA 4TTQA 4O2RA 4EKDA 4GMDA 2GRJA 1T3LA 2AFHE 1OT3A 4B47A 1ZINA 3KDSE 5K8LA 3GLIA 3CB4A 1E2DA 4RCZA 1COWD 3HU2A 2GXUA 3PEVA 1IY2A 3K8YA 4POAA 5JSZB 1B0UA 1NVVR 3NEJA 4S35A 1SVMA 3GLGE 3SYNA 4MRRA 1XPOA 4KBGA 1II8B 1KYIA 1TEVA 2ZETA 2ZM5A 3MWKA 3N70A 2FSFA 3KKQA 4D0NA 1H8HA 2CL7X 1D9ZA 2XB2A 1M6NA 1OXSC 4JLJA 4PC7A 3ZZTA 1US8B 2WKQA 2VPPA 2O8DB 3KQUA 4Q7KA 2J7PD 2WICA 1XF9A 3UKDA 3MFYA 2HEIA 5F2EA 5DGXA 1UF9A 3IILA 1AN0A 2PJRA 1E1RD 1R5BA 4MKHA 1GAJA 2GCNA 1BMFD 1XTIA 3IIKA 2FWRA 4M1OA 1WA5A 4MUAA 2AK3A 3W6OA 3BOSA 3QSYA 1JB1A 3OEHA 3X2SA 4AD8A 3OIUA 1RE0A 4PC2A 5DYGA 4A6XA 2GXSA 3EWAA 1WP9A 3HU3A 3THXA 2ZSFA 3AQ4A 4OBEA 4TYNA 4LUCA 2TMKA 4R2IA 4DC9A 4OHWA 1YZLA 2VL7A 1TPZA 1KDTA 2WSSA 3PUZA 4Q7MB 4OQMA 4Q1AA 3W5JA 3DOEA 1NI3A 4Q9JA 3V9PA 3I61A 4DSTA 2QRNA 1VCIA 4HB0A 3THOA 3LBNA 1OH7A 2E9SA 3GEHA 5CK4A 2J45A 2GTPA 3A1SA 2NQ2C 4JLMA 1E2MA 4JSTA 4BFSA 4BRUA 2ZXUA 3WRXC 1XEXB 1C9KA 4D2IA 3THYB 2QQEA 2F3RA 3ZZ0A 1KI6B 1E1RA 4DDUA 5SZKB 3EXAA 2RCNA 5FTLA 5J5CA 1IN8A 1JALA 1TADA 4IRUB 4K81B 2NTYC 4R7ZA 5BW8A 2OBMA 5L8VA 2BV3A 3QVVA 1DE0A 5B64A 5KYKA 4BFXA 4ZCLA 1TEXA 3CZQA 2UVQA 3HYTA 3NC1C 3Q7QA 3RRZA 1D2EA 1KK2A 1SVLA 5AUOB 1VCOA 1XDBA 1ZM3A 3ZYCA 3W90A 1P61B 4MRPA 4AI6A 4DLSA 2VA8A 3AF2A 3B2EA 2XAUA 4Q01A 5FI0B 5SZHB 3PJRA 1ANKA 4Z54A 5KOYA 4M9SA 5B30A 4G5SA 1JXMA 1NBME 1P73A 1T0HB 1XMIA 2CLDX 2FMXA 3GJXC 2ZREA 4Q7LA 3GLIE 5F98A 2P6NA 4B3XA 5FI1B 1TUIA 1EESA 2W6JA 5KPDA 2W2VA 1YR7A 4QFMA 2EFEB 2WMNB 3L43A 2VHJA 3HDTA 4UNRA 2F1RA 2C9OA 3H1TA 3LWNA 3QXJA 4KODA 1II8A 4HLUC 1J70A 2ZRCA 3AF0A 3D31A 1D2MA 2A5JA 4D4MA 3MSXA 2GETA 4DLRA 1E9EA 2OCPA 4RD3A 1Z47A 2AFIE 2YYZA 4M1WA 2X77A 4R2HA 2MSCB 2NOAA 1Q3TA 4TTPA 4BFVA 4DEXA 3GJ5A 5A0FA 1P62B 2UKDA 4Q4JB 5DN6A 3P32A 1AQUA 2H1LA 4L15A 4UNSA 4ZI3A 1MOZA 1KNQA 1NF3A 3TVDA 2YOFA 3R7WA 4OQXA 1COWA 1UJ2A 1H8ED 2KJQA 2R6FA 2XJ9A 5EXXA 3A1VA 2QMHA 4M9QA 1Z2AA 5L3SB 4NYIR 4C0BA 2Z6VA 1CEEA 5IDVA 3U44B 4I1SA 2ODEA 3TR5A 2RGCA 4QOSA 3E5HA 2F43B 4V0ME 2Z5FA 3BFXA 4HAWA 5DI3A 4AC9A 2RHDA 2D62A 3C14C 5J40A 2BJWA 1CU1A 2J7PA 4IDHA 3V4RA 5CYOA 1OIXA 1XEFA 2IF2A 1HTWA 2J0QA 3WYGA 4TZ6A 2YINC 3AGQA 1NRJB 5KTYA 1WBBA 3FFBA 2YHSA 1XTKA 2VSXA 4KVAA 3SZRA 4RSGA 5B57C 3QG5A 1N5LA 1G7SA 2R6AA 1Z0IA 3REFA 2AHOA 4NCKA 4BZQA 3ICQB 4OKSA 3B1WA 1AJEA 2C8VA 3ZZUA 2NZ8A 5DSZA 3I3SR 1FX0A 2IYVA 4V0KA 4D6PA 1S96A 2CCGA 1KO8A 2BM1A 3AVXA 3HWSA 2VP4A 3QQ5A 1NN0A 2XEXA 4DLWA 3K53A 4FMCF 1MT0A 2VH5R 4US1R 4PAOA 1XB2A 3BJIC 3EG5A 1G20E 4ITRC 1QG4A 1E9BA 2RKOA 1T5IA 3AUXA 3SBEA 3O8RA 4A1FA 4DXAA 2YV5A 2A5GA 4G0NA 4Q4AA 3QVUA 3NHAA 4PO8A 3O8BA 3SC3A 4F4CA 1NG9A 4HAYA 3W6NA 2ZVQX 1L4UA 2EFDB 2F1IA 4BLSA 5BN3A 2IS6A 1NVVQ 1NKSA 1Q3HA 1GTVA 5J4YA 5FOUA 3PENA 4A2WA 2ATXA 4TLDA 3SJAA 4ZO4A 4M8NE 2YOHA 5SZJA 2C5LA 4PHFA 1HA3A 4LJ4A 1AS2A 4Q03A 3EZFA 1P7CA 4TMXA 3LRPA 1J8MF 2Q21A 2NPFA 1J90A 4EPWA 1BIFA 1HY3A 2ZJ2A 1OHHA 2GNOA 2QT1A 2JLUA 1CULC 1XBTA 2P2LA 1IXZA 1GIAA 3TW4A 4IXNA 3TAHA 3PFIA 2ZRKA 4B3GA 2J87A 3AGPA 1VG9B 5CIQA 4YDSA 4A9AA 4BFZA 4MUBA 2VTKA 1E79A 3C41J 1ZIOA 1HE1C 1T5LA 4XD7A 1KO5A 1E9FA 1YR9A 4DRZA 5JEDA 5GJCA 5DH9A 1FX0B 2W2TA 2D3WA 4EPTA 1H65A 4V0MA 4B3BA 4NZYA 2JJ8A 2ZSEA 2GF0A 1XTJA 4HLCA 3WHLA 2J0UA 5EP2A 1RYFA 1ZAKA 2GJSA 4GI7A 3PUWA 3IPXA 1ZVQA 1IBRA 4Q9LA 5CK5A 1W46A 1X8JA 1BOFA 3WYAA 4Q1FA 2IXFA 4W5HA 3UXMA 3U2QA 2IYYA 3CWZA 4V03A 1G7RA 5E7IA 1IAQA 3KTAA 1HYQA 1GVNB 1VCNA 1KI6A 1F2UB 4GRAA 5L3RA 3W8RA 3UPUA 2ATVA 2NO1A 1W49A 4QGHA 3DZ8A 2OBNA 4TT3A 3ZQJA 3OE7A 4LDJA 4HYYA 4MGZR 4A4DA 1DG3A 4BLOA 3VNVA 3LX8A 2ZUCA 2ODBA 1N5JA 3T35A 5EUMA 2ZANA 1SXJA 3WBJA 1NKTA 4QBHA 4CZ2A 4A0GA 3P4YA 6Q21A 2ZJZA 4LJ7A 1ZNXA 1W2GA 3F5FA 3FKQA 1E2GA 2QROA 1LF5A 3VAAA 1W0KD 4DUGA 3AVWA 1KY3A 3TQCA 4P4UA 2N46A 1IJFA 2ZU0C 1OPXA 4OK6A 3CWQA 1CBUA 3K0EA 2J9RA 1PLJA 5IRCD 5KDLA 3X1DA 4OJQA 4D80A 3QEOA 2ZRGA 4B3DA 2ZYVX 4AYWA 1G7CA 4A15A 1J8YF 1LS6A 3GLIB 3GD7A 3NEYA 2ZJAA 4KYIB 3TE6A 4B74A 2HYDA 2KSQA 3TR0A 4II7A 3AB3A 1GDDA 3DKVA 4J0QA 4NBSA 3B13B 4LBYA 5AJXA 2KE5A 1KI1A 2I1QA 3K0AB 3W6PA 4N1AA 2GJKA 3I5XA 3VHXA 2A3RA 5FOXA 1L8QA 3JZAA 3ONWA 2WPDD 1K5DA 1CRPA 1G3IA 1RKBA 1G4AE 2P67A 2YOGA 2V9PA 4AWXA 5KHOC 5DIFA 3PXGA 5E7JA 2DYKA 3DOFA 1Q22A 1GL7A 3FHCB 2EWWA 1N6LA 4EFMA 1G21E 1Y63A 4A2PA 3FE2A 1E2JA 3RS0A 3VNUA 2C03A 5FTJA 2GZDA 2OG2A 3CUEF 4IDNA 2P5TB 2RGXA 2G88A 4P4SA 3MWLA 2OFWA 4RKFA 2WWHA 5CM9C 3PUYA 3QY0A 3B1ZA 4HLUA 2X2FA 1XPUA 4DDVA 1D9XA 2QTHA 3LA6A 4GOKA 1TF7A 2XNDD 1UADA 4WOPA 1NL3A 1CIPA 3B60A 3ZS8A 2GJAA 4QHSA 3GJ0A 1TF2A 2EU8A 3WY9A 4EQ6A 2VP5A 2GZAA 3DL0A 3A1UA 4KFUA 4PZYA 1WXQA 3RS5A 3RVBA 2O5VA 3DKPA 4BLPA 4JLDA 1W5SA 2QMUA 2ZIAA 2HUPA 4IKEA 5A5GA 2CHVA 2DPXA 3VR6A 1ZM2A 2G1JA 2R2AA 2GCOA 2VRWA 5KUTA 5B2ZA 1XXHB 4B6FA 1WBDA 2GXQA 4PZLA 4AIIA 2FEOA 3U60B 3FWYA 4OI0A 1MKYA 2BMDA 1GWNA 2XTMA 3KJGA 4G1UC 1GM5A 2BMJA 2JATA 2OE2A 2QTVB 3OHMA 2FN4A 1LNZA 3U4QB 1S2MA 1OF1A 5FL7A 5HZHA 1VHTA 4KAXA 3W3ZB 3GP8A 1QBKC 1WCV1 2ZAMA 4QGAA 1S8FA 2BEJA 1RYHA 2F9MA 2ZI6A 1VHLA 1BH2A 1E2QA 2ZUBA 3NTUA 4YC7A 1IOZA 5KPJA 3LW8A 3T1QA 1TQ4A 2KWIA 4RD4A 2QTFA 3RDPA 3KQLA 1FUUA 2BMEA 2ZE6A 4KLZA 3X1WA 2IT1A 1I2DA 1EFRA 1FQJA 4PC1A 4TN1A 3NBXX 2IEYA 1VPLA 4KVGA 3WHKA 1L4YA 4GFDA 1E2FA 2B8WA 2Q6TA 3PIRA 5JFGA 2NPIA 3UANA 2ORIA 1RRFA 5AJVB 2IEZA 5H8WA 2FPKA 1I4TD 3PV0A 4HUQB 5BYJA 2W2XA 2OLJA 4M1MA 1J7KA 1E9AA 1S9HA 3CIOA 4G5QA 4IOKA 4ZIRA 5KO2A 5HKKD 5JCZA 4KI0A 1WMSA 4RD6A 3IHLA 3LH5A 1E96A 4IEEA 3WMFA 3WNCA 4EPYA 5KNCA 4UQOA 3Q5DA 1Z2CA 1OXUA 4PO9A 4HZUA 3SI7A 3VMFA 1AKEA 1E2IA 4RCYA 1SVSA 2WZQA 2LKCA 4PQRA 4WW0A 4L4UA 2Z0MA 3OE7D 3B78A 4LZZA 2RHMA 3BH7A 1EX7A 1XMJA 4B73A 1JI0A 1MO5A 5F3WB 4RD0A 3LV8A 2EYQA 4LHXA 4KCGA 3RRMA 3NBYC 4JMPA 4Q9KA 4C4PA 2UZIR 3GLGB 2O8FB 4D82A 1QHGA 2G0TA 3WRYC 4X8OA 1SVKA 3I1FA 1ZU4A 1L7VC 5EXPA 2AKAB 1VG1A 3GCGA 4QBFA 3CBQA 4IVPA 3AKYA 1DAKA 3BRWD 1A7JA 4TMWA 1DAGA 4QM6A 2GBLC 4D0LB 4L9SA 1EFHA 1IN4A 4DDTA 1XP8A 2QG6A 1JQLB 2WTUA 3T5GA 3VU9B 4F93B 3UWOA 4DWJA 1E79D 1IXSB 1NIPA 1ZCAA 2IS4A 1N0VC 2SHKA 3ZVLA 4O25A 3WBKA 2V54A 4R98A 1LV7A 4BGDA 1E0AA 2A2ZA 1Z22A 4FWTA 1P2TA 1XZQA 1AIPA 2XITA 1XFAA 1KJWA 2Q3FA 2IYZA 1HQYE 2NO6A 2JAQA 2VHTA 1SQ5A 4US0R 4JVNA 2WKRA 1KMHA 1Z3IX 3BFKA 4XVRA 4GP6A 4B2IA 8OHMA 5E7MA 3EIQA 2HXSA 2YWEA 4TWZA 5FTNA 1GL6A 3ZIAD 4KSCA 2AD5A 3Q72A 4A6PA 1KK3A 2AK2A 2DBYA 4YLGA 2RH5A 2XJ4A 3ZS9A 2ZRAA 2QM7A 3BORA 4UKDA 2JJ2D 1IN7A 2GWHA 2XXAB 4MKIA 2QRZA 2OM2A 3L8YA 1OH8A 2EQBA 4BFWA 1G291 1Q12A 3H84A 3PITA 1T8UA 2QP9X 3TUIC 3WNBA 1F5NA 3CF2A 1GILA 1E2KA 4B71A 5FOSA 4P32A 1MRNA 1Z0KA 3ZVRA 3OIVA 1YRBA 2IHBA 3SQXA 1CJMA 2XOKD 4B44A 1E0KA 1K8RA 3TUJC 5EE0A 4CIDA 1KDOA 3EC2A 4CT5A 4EDHA 5D3QA 1NP6A 2Q9CA 3I92A 2D4HA 4Y0AA 2C98A 2ZR0A 4FMBB 2JJ2A 2QENA 3EZ9A 3U7HB 1MRSA 3HYRA 3R9XA 1HUQA 2WVJA 1X86B 2QGNA 3CX6A 1A82A 1RPZA 3SQWA 1OB2A 1UBEA 1G6OA 2B92A 3FMOB 4FWIB 2NZJA 1X6VA 1GOTA 2VF7A 4IJMA 4EUNA 4WBSA 1OXXK 3OIWA 4V02A 4C3ZA 3T06B 2GXAA 4URYR 3FKSA 3R7WB 3RS3A 1KGDA 3QXXA 2VHCA 1G8GA 2OESA 4OI2A 2Z83A 4JLOA 3WYFA 4GZMA 4O0MA 4LY6A 1KJZA 4ARZB 1KSGA 2O0KA 2XGJA 2CXXA 4QGGA 3AH8A 3I62A 2RGDA 2ASEA 3KKNA 4ZDIA 2W6JD 2YC2C 4ACBA 4DCVA 3QKTA 2HLDD 3QKSB 1G17A 4GL2A 3BGWA 1P4SA 3ETLA 3WMGA 3EA5A 1PLKA 5FR2A 2DFTA 2QPOA 2IHYA 2BBOA 4QC2A 4WA7A 1N6NA 4LBWA 2IX3A 521PA 2RGBA 5LB2A 4HB4A 3SJCA 4LBVA 4BZXA 1J99A 2D7DA 1SVIA 2O8BB 1WQ1R 4JT2A 5J4HA 3QOFA 2OCAA 2FSGA 4KLNA 2YNMA 1QHYA 1CTQA 3IGFA 3SHWA 4FCWA 3SE0A 3K0FB 1NN5A 4Q4AB 1KDPA 2R44A 3BBPA 4NCIA 2GDJA 1TMKA 5EP3A 2P6RA 1E2PA 2ZYWX 2WIBA 3IPYA 1S3GA 5J4KA 2BM0A 4BE7B 3L8ZA 4QM7A 1OE0A 4NKRA 5EE3A 2OSBA 4TQ9A 1LFDB 4B32A 5DI9A 1R4AA 2AWOA 4IW3B 3DEFA 2G6BA 4JLBA 1LB1B 3AVQA 1OXTA 3AF1A 1VIYA 3VR3A 2HF9A 3I32A 4JLVA 5L3SA 1KSFX 4OHZA 4TMVA 2WSSD 5J47A 3U44A 2JLXA 1D8TA 2DFKB 2H7VA 4MYUA 5B58C 4A0RA 4ARZA 2AL7A 2GKSA 4Q1CA 4F4JA 4DCUA 4NYIQ 4QNMA 2QNRA 3RS7A 4FD2A 4F92B 2D06A 4LHWA 2WWFA 2H16A 2IF0A 4P33A 1MR3F 2GF9A 4L16A 3IDQA 4C0LA 4DSUA 3D7MA 1SKQA 2OZEA 2R8RA 2ZE7A 1VYTA 5FOVA 2ZRIA 3FKSD 3U7EB 2FZ4A 3SOPA 1Z08A 1RVDA 3TGPA 4HEJA 2P3SA 3K1JA 2C77A 1NSTA 3IQXA 4OL0A 2DWOA 5G3YA 4LJAA 5KDOA 3AKCA 2MSEB 1NIJA 3BC1A 2WOJA 4PHTA 1IXRC 1VMAA 3SBDA 3TKLA 2O8CB 1FQKA 1Z06A 3NIBA 4ABYA 4Z1MA 4JBWA 1JECA 3TAUA 1US8A 2MMGA 3NH9A 2BCGY 1RC8A 3UK6A 3LDAA 2BKEA 1BMFA 1DAEA 4P0TA 1GITA 3QPUA 4Q02A 4Q9IA 2DB3A 1ZU5A 2J46A 2NO0A 3X1YA 1W4CA 3TIFA 2DCUA 1KJYA 4YONB 2WWXA 1X3SA 4OQNA 4US2R 5E3HA 5TVKA 4KV9A 3TVTA 3VKWA 1JJ7A 1HQCA 2HF8A 3DO6A 2EW1A 5JS8A 1OH6A 1R0YA 4MH0R 2DHRA 3CX7A 1QZXA 1XEWY 1N6RA 1G1MA 5IHPA 3AVVA 1VCMA 2EFHB 3U3OA 2AN9A 2WJYA 3MGCA 3K0CA 4EPRA 1FP7A 4WZBE 2WWIA 4CEIB 4IFBA 421PA 4I1OA 5LD2B 4PQFA 1CR4A 3MG9A 1G3QA 4LGMA 4MDEA 1A1VA 4TL7A 3S1AA 1KI7A 1XTQA 5TB5A 5P21A 4RZ2A 5CB8A 1XTSA 3SDZA 2ZE5A 4MGIR 4ERNA 2PCLA 3PG5A 1HV8A 1R0WA 1HURA 2RGEA 1SKYE 4BECA 3KTAB 1OYWA 2FSHA 3OEED 3ZH9B 1ETUA 2J1LA 5JMTA 1NVUQ 3OEEA 3B9QA 3GJ6A 1NN3A 4ZIRB 4KU4A 3CNLA 1LW7A 3ND9A 3AVUA 4BFYA 1QDEA 4JL5A 2QM8A 4KFSA 4JJZA 3ADCA 4Q4LA 2X1VA 1XWIA 1S4QA 2WWGA 2ZJ8A 2C99A 3MWYW 4MGYR 1DAFA 4GDFA 1SHKA 4Q5IA 4JLAA 3AVPA 4A0HA 2W6ID 1JAIA 2J41A
chains in the Genus database with same CATH superfamily
3K9NA 4BRWA 3VNQA 3GFTA 1EK2A 2X58A 3JQAB 4DLLA 3MSCA 2G9RA 2JI6A 2SKEA 4IDOA 3TB4A 2Y93A 5ALFA 1X38A 2HJWA 1JBEA 2XMRA 3HRKA 1FFXA 4KR9A 5AYVA 4GL4A 4F4DA 2WAOA 1I6KA 4CMIA 3G13A 3WGUA 1SHTX 3L0IB 2AE1A 5HIKA 5JSQA 1YB2A 4KLCA 4R1MA 5NULA 1XRMA 3A05A 3FMGA 4RM2A 2GCPA 4MQBA 1OSNA 4D26A 1W29A 2YWFA 4MAMA 4BLVA 5HDBB 4OJMX 1IIRA 2VUUA 4HLQB 4B35A 4UFOA 5FPPA 3BSFA 4OL9A 3G5TA 4LE0A 3I04A 3WXMA 4PWYA 5AQEA 4AJ1A 2ZRBA 5FUXA 4YT5A 4DCMA 3FYUB 1T2EA 3I72A 4GUAA 2CHQA 1U0OC 3EIXA 4LXXA 4C0AC 3KR0A 2FUEA 3LY9A 3QUSA 1PLLA 1U3UA 4CCSA 2PA3A 2YC4C 3IO5A 1JIUA 3QI7A 1VGVA 3CZ5A 1AVTA 3AERB 4GI1A 4PSKA 3R76A 2IHNA 5GOZA 3T1YB 5AW3A 2WTAA 2IY7A 2QN6A 2GEVA 4HZUB 3EZ7A 1TTPB 2PXXA 1C1DA 4GYKA 2PYZA 1BD4A 3BFJA 1KAOA 1RE1A 3BRCA 3KJEA 3RNLA 2PYDA 3PUIA 1GP2A 1HE2A 1TQHA 2EKPA 2H0QA 5EP1A 3I0ZA 5HMLA 4BGIA 5CVVA 2DZDA 1YNOA 1W6UA 4RNDB 5EWLB 1GUFA 2DQKA 3KQHA 4IG4A 1G8HA 1KMNA 3RRYA 1U4NA 2GEKA 5DHAA 5AK0A 1S02A 1JW9B 4WZAA 2FPWA 4KE6A 4NU0A 4LWQA 1I36A 4QJIA 2QM3A 2MR6A 2VH2A 2C7VA 3HDHA 4MLZA 4Y1RB 2B69A 2DJIA 2LW7A 2JRCA 1AZWA 1E2HA 4GOXA 4URFA 3F97A 4LAFA 2QVGA 3TTTA 3KB2A 2Q2OA 1BXGA 1PO7A 2B35A 3OOJA 2BKLA 2P65A 4I9FA 2BIFA 1FP1D 2XKBA 4I50B 2REXB 4QU8A 4ATNA 1EA5A 2B1IA 4M86A 2HC9A 3LLVA 4TV9F 4BV3A 3KFXA 1AY0A 3MCAA 2PR2A 4OP3A 4KE8A 2O4UX 3Q7IA 2Z9DA 3JSAA 4PX9A 5AVTA 5FUBA 3AVTA 2MSKA 2OAGA 2QD2A 4YMGA 5BWCA 1IXKA 1P2BA 1JEYB 1X1QA 1FJ2A 3K0FA 1Z8NA 3FYDA 4JVMA 5HQ3B 1UBKS 2EXXA 3EIWA 4N82A 4PYOA 2O0LA 3AUSA 3P0JA 2H2AA 4XUGB 4WN9A 5HIAA 5FLXA 1CB7A 3HUEA 4GMHA 2OVBA 3A2NA 5T6MA 2IL1A 3BJZA 4E33A 5KTOA 1KO7A 1DEOA 4WKCA 5DXFA 2H5EA 1IQRA 3HBFA 4J0DA 3KEGA 4RZXA 5TJHA 1X8KA 4AQDA 1SVUA 2I67A 2UAGA 1K8XB 2X8JB 4IVRA 4CIAA 4CHGA 1BVUA 4YX9A 3OFVA 3KZMA 3R7LA 1WM1A 3NOOA 3QFCA 4P82A 4HRVA 5AM5A 5EJGA 3W5DA 1RBMA 5DFAA 1M2GA 1HDZA 2BEKA 1E69A 2E4XA 3DT6A 4N8EA 4QPZA 4X1IB 3JQPA 1XRJA 2MCFA 3EDCA 3UJBA 4F6RA 1TVMA 3VSEA 4DJTA 2JIDA 1ZM9A 4I19A 3LE8A 3OTOB 2QUBA 2FW8A 4JDUA 3DWFA 1R27A 1ZK3A 3LVBA 4FEYA 2RI0A 2XWQA 1A72A 2Y67A 5GONB 1JG3A 2B30A 2VZLA 4IIYA 1OXVA 1G6Q1 3F4BA 3AW9A 1QIHA 1RJEA 5J2UB 1KRXA 4N3NA 2J5KA 4R8VA 1AF7A 4GBGA 1Y6ZA 2B21A 4Q00A 1KMQA 1MAVA 2QPLA 2A4KA 4B85A 3PHCA 5EFZA 3OJXA 5GPBA 2A9OA 2P6PA 2G63A 2AOUA 1S1CA 3JYHA 4J49A 2QL5A 2IGTA 1A8SA 1I7SB 2JB9A 2IYRA 4LF5B 2DY0A 3EEQA 4EI2A 5HSGA 4I1PA 2B0CA 4D9MA 3K0SA 2O5EA 2ZJ5A 1Q2UA 3Q2OA 3MT0A 4GVPA 4ZOCA 4J1TA 3GJQA 2IYQA 1M54A 4JH0A 5ALZA 5G40A 2QG4A 2E7ZA 3U19A 2IP4A 2HV8A 1P3DA 4X97A 1AV6A 3EPJA 4AURA 1WNFA 1SH7A 1YZKA 4AJOA 3ZBQA 4DR7B 1J2JA 1U7XA 2XVAA 1MHTA 4YFYA 1KAEA 1E0JA 2IZ6A 1DBWA 3BIWA 4OQZA 3K6SB 2F43A 1HDRA 4J4BA 4P5DA 4QPPA 4D79A 5T3UA 1QQAA 4EGAA 3H3XA 4QUDA 1Q0TA 2ZYTX 3NBQA 2NTNA 3EXFB 1KMHB 4DE5A 2D74A 4GVXA 2V6FA 2VJCA 1I4OA 3JU3A 4JJGA 1I7LA 1JT9A 4L1KA 6GPBA 5HOEA 5AM1A 5FBWB 4P84A 2IHUA 4EHKA 1K6JA 3BZWA 1KWKA 2OKGA 5KYUB 2WNSA 1H2AS 4ZD6A 1L5WA 2GQ0A 3JYNA 1ODJA 2QPTA 4JCOA 3VSCA 5K5EA 4NULA 1Z5NA 3K8QA 4LY9A 4OHFA 1TIBA 5LUAA 1NM5A 5ES3A 4DS3A 3O4IA 1AGYA 1WCYA 2A84A 4XDYA 3HJCA 4I4TA 2ZSIA 1U0GA 2B8JA 1IUNA 3HEMA 1U3TA 1RXVA 1QZTA 5CLLA 4URZR 1JIXA 2O7VA 3HN7A 1ETHA 1F2TB 2AOTA 3IPAA 5IJ0B 2ZROA 3FYUC 2G7MC 4NZZA 1DZ3A 2WHEA 2W0MA 3QPVA 5EOVA 2Y1XA 3A6LA 1HOTA 3L2OB 4LOIA 3IBSA 1FXWA 4OSEA 4YRPA 4HTFB 3FVTA 2XXBA 4M9CA 1X9HA 1KL7A 1LCIA 4JENA 3ZIAA 4MQMA 4IDEA 2JHCA 2WQ7A 1VTKA 2GK7A 3NXKA 1QAOA 1XZMA 4ZKDA 2GM4A 1M34E 1W19A 4AO8A 1KS2A 1T91A 3NDPA 4AO6A 3ICWA 1CR2A 2Y2UA 1DSSG 3E3OA 4WK4B 3KOYA 2VBFA 4DT1B 4RTJA 2IS2A 2GBPA 3IAM1 3NXSA 4ZHQF 4IMIB 5KX5B 3CCBA 1V35A 5HWSA 1OAKA 2J5XA 2P30A 2WJHA 4S1WA 3EFBA 4G5HA 5CDSA 3ZUGA 4MRMB 1YQQA 1GRNA 1QNLA 4DVJA 2XW6A 3HE3A 2ZYSA 3U7GA 1D5CA 1RWKA 3ZBUA 2YUTA 1USIA 2VWHA 4XGRA 2QRVA 2V6GA 3ZY2A 3UGJA 1G63A 2FG5A 2G70A 4DM7A 2FH5B 4CIXA 1XVIA 2EP5A 1T9HA 3E8XA 3L0ZA 3W2HA 1WEHA 3ZU6A 1JNXX 2EHJA 1EFKA 1L7DA 1R0CA 3QFRA 4ID9A 3A4NA 1ZJJA 2KMLA 1WMDA 1GKLA 5EWJB 4GBED 1Z8FA 4M0CA 4OHXA 1K8QA 3EYAA 2OILA 3PFBA 3FTNA 3SQLA 2ZTMA 1AQ6A 1V26A 5CVJA 4ZO7A 1TJYA 3C8DA 5EE9A 1ZWKA 3KPUA 3VSAA 5F35A 4K46A 1CY7A 4CQLA 3SFVA 2YIJA 1MLDA 1M34A 2Q5LA 3GVIA 2FV8A 4P4TA 1JE0A 4Q05A 2B4AA 4WGGA 5B3AA 3TNLA 5CA1A 4GF5A 2H5JA 1B7GO 2H51A 4AKGA 2VQSA 4AKTA 2ZR7A 5IT5A 1SKBA 4K6OA 5CXXA 1PJZA 3WYNA 1ADBA 4TQAA 5CCDA 4E13A 4TUYB 3UHJA 1Y9DA 5H7XA 3T54A 3WGKA 2JBAB 4XIGS 1NZJA 1SG6A 2Z9CA 2P6UA 2VYQA 4HVCA 1Z5ZA 4G0QA 2XZLA 2HNBA 3DVLA 3I2HA 2PU7A 1SQGA 2W4MA 1N34B 4P5PA 1YK1A 2JH8A 5BV7A 2QMQA 4IQGA 1LTKA 1YR6A 3D5TA 4H08A 4P31A 4QDUA 3X1XA 5BVHB 2I1WA 1N2HA 1V45E 1TF5A 2Z2ZA 2ON6A 3F5DA 1EGVB 1P6XA 4IDAA 1NW7A 1I4EB 1Q1BA 2I7VA 4YXWD 5JS6A 1CW2B 3SYLA 3CO5A 3QXSA 4Z51A 4HDSB 5LOVA 3ETNA 3LO8A 4ALKA 5JJIA 4CV1A 3Q3JB 5TV2A 2YZMA 2MSNA 2ENWA 5AM2A 3DM5A 4G01B 1I13A 1B14A 2VH1A 4HWRA 3RD5A 2JNWA 4E03A 2FE4A 1RXEA 3IEIA 4RABA 4TL8A 1W4ZA 2FY8A 1HL7A 4MA5A 2V7BA 1P3Y1 4UZFA 4YJGA 4BP8A 3SEQA 1E89A 2AMVA 2HDWA 3O5AA 4KFRA 2VK8A 4LYYA 3GT7A 4J43A 1RHQA 4HWPA 4LECA 3EGDA 3ANNA 3F6YA 3KD2A 3BWXA 2PFSA 5FJJA 2QXTA 5TQJA 2BGGA 3RS9A 3LXRA 3C6YA 1M1YB 1Z68A 3A4LA 2AXEA 1OQAA 1ZVKA 4ZARA 3MTAA 4CEJB 1CKEA 2YY5A 2PIDA 3CNNA 3FH0A 1NX9A 4GMGA 4PV7A 1MC5A 2WTNA 4HBZA 4QUKA 1R9MA 5AR1A 4ZV7A 1E3MA 1Y8RA 1WUTA 3EIFA 3ML1A 4KWHA 3CRW1 1THZA 1TQDA 3B20A 1SNYA 4P4NA 4MS1B 4WACA 3PWKA 3C24A 1JG4A 3MA0A 3VPFA 3ZGXA 4ILEA 4TYNA 4AB1A 3IDZA 2FWBA 5HE9A 4MS4A 1NJ6A 2VDJA 1F9AA 4RTPA 4JJ6A 1YUNA 1GAEO 5CB4B 4K9MA 3DMYA 3ZVKA 4H1HA 2RH8A 1P44A 4JP8A 3WQRA 4EHBA 1RQGA 1KAGA 1KSHA 3F9RA 3BWDD 2CMHA 2EZTA 3AM1A 3X1ZA 5DCYA 1LPNA 2WFZA 1UWCA 1VFPA 5K9ZA 4QXAA 4G8CA 3V6LA 4B33A 2P1ZA 4LJLA 2UYGA 4TWBA 5FUWA 4QFDA 3TTVA 3V4ZA 1OI3A 3HB9A 1W36C 1M0EA 1I01A 3QLVC 2P2NA 3NHZA 2JD0A 2PBRA 1DJLA 2PQ0A 3TX6A 3K9HA 2WUFA 3PPXA 3QUQA 1TOAA 2O3UA 2H65A 3IRUA 2PGJA 3MMXA 5KDDA 1KI8A 3L1JA 3RB8A 2PX5A 3LUKA 4NFSA 4UAGA 4CI0B 1KYWA 3MOGA 1NT4A 1Q1EA 3NTOA 1QRRA 1TMOA 2UVPB 4D8WA 1JYFA 2NO7A 5FA5A 1TTTA 3FFTA 1P5ZB 1Z0JA 4KQHA 1JYEA 2UZ1A 4I8XA 3GHHA 2NLOA 4MW1A 3VZSA 2QDKA 2MOKA 1DBVO 2X4DA 4DLTA 3N7TA 4N03A 2HQOA 3SZOA 2WJPA 3REGA 1LJUA 4D43A 1EHCA 2HMWA 2FPMA 4ESHA 1L5HB 4IUDS 1YE5A 4LZOA 4EQZA 1CYEA 3PCRB 4GLFA 3IEVA 4JJKA 4RVOA 4FLEA 1MOSA 2QSZA 3H2SA 1FMLA 3RUAA 1YL7A 3QHQA 2XGSA 4HMOA 4QGFA 5DBEX 4D9CA 2JZOA 1NMEA 3PEFA 5CAEB 3M6MD 1CUFA 1Y4DE 2OHXA 3AHGA 3CNOA 4ND4A 1Q21A 3RYIA 1XRNA 1B41A 2YQZA 4UHDA 3SM9A 5J4LA 2ACVA 1KOGA 5HFAA 5DM0A 3LSYA 4EEZA 4ZZ1A 2BI7A 1AKWA 3TLGB 1PE0A 5LUBA 1V5IA 2UXBB 3VYVA 1KZGB 3A8TA 5TF0A 1XCBA 3VRHA 1KJNA 2R97A 4BUJA 5HZGA 3S2FA 5JSUA 3Q6MA 3UJCA 4WXRA 3WWOA 5F5LA 4RV5A 5ALHA 3TW8B 2XI4A 2XLCA 2ERXA 4AG5A 4FJ2A 3ND8A 3SKVA 4D8TA 4D25A 4NCNA 1KPIA 3BAFA 1SK9A 1XRSB 5EIOA 2WYIA 3IBFA 4JR0A 3WSWA 3HDVA 1J39A 1L4MA 1P9NA 3BCHA 4FYWA 4YQFA 4ZVOA 4FGWA 1T8PA 5DHFA 1GKUB 2X1LA 4QXRA 3WWDA 3K71B 3KKPA 1WXFA 4BLRA 4C4RA 4F3TA 1GZSA 3TDMA 5JAMA 1RU3A 1WEKA 2RKWA 3DLAA 5FBQB 1Z2DA 3KYDB 4S0XA 1O6FA 1MHPA 3KQQA 1PKEA 4QXPA 3RU2A 3ORQA 1CRZA 2AFVA 2OFOA 1TK3A 1DKPA 2J07A 2X2OA 4OEHA 2VSFA 2MDTA 1EWQA 1CS4C 3JATA 1G3UA 2AF3C 5JMPA 5CYGA 2O8EB 4AJIA 1YQUA 1P60A 3WWCA 3UUFA 3NEAA 2OZLB 2A1UA 3NEPX 1C80A 1HL3A 1L4LA 2ODPA 3LBHA 2B9EA 2WUVA 4HB3A 4C1BA 1RVV1 1BS2A 2BW0A 2CHGA 3HPRA 3SEFA 4B5KA 2IYSA 4QULA 4RTSA 1EVKA 4L5BA 4BO1A 1QTNA 1E9SA 2EFCB 4L73A 4XCXA 3WFZA 3QOWA 8ADHA 3T3NA 4W6ZA 1ZH0A 4U02A 5B3JA 4HVTA 2QGZA 3TSWA 1ORWA 2BE7A 3BXHA 1LX7A 2N75A 3AHDA 1ZW6A 2PGIA 4WBXC 1PS8A 1J1UA 1WB9A 4S1PA 4M22A 2AVDA 4MMYB 1ORIA 4XXHA 1XDSA 3A3OA 3Q9UA 1AC5A 3MHPA 5EC8A 5GV7A 3IP9A 4D44A 1EP3B 1HEYA 2VP6A 3KLMX 4OAOA 1NBMA 4LIPD 5LYJA 4BQIA 5KNCH 4C7JA 1EWRA 2ANCA 2KHZA 3C15C 3F6SA 3JQ7B 3DCNA 4ZAYA 3SZMA 4Z99A 1K4YA 1SEPA 2P75A 3D4IA 4FNGA 4PVCA 4WBNB 1RXWA 1RC1A 4PANA 1L8OA 4ETIA 1OBCA 3E0QA 4PPGA 5EXDA 2I34A 4XYLA 3EUWA 4JI2B 3FPSA 4EJSA 2WWTA 3EJWA 3GRPA 1P1FA 2ZGVA 2FE1A 2OYRA 5HIIA 1XZ8A 1ZDMA 2LCFA 2C31A 2PMCA 2QRUA 2ZJ7A 2PWBA 3D6UA 3DG9A 3JWGA 1J49A 1SD2A 3H13A 3AM3A 2CK3D 4L2IA 1Y48E 4PR3A 3SFZA 3H2KA 5IC4A 3KKKA 4OKNA 1FMCA 5DLDA 4YP5A 3VJMA 4BNXA 2EF1A 4MDYA 2O3QA 5FX2A 1UPBA 1D1SA 2ZDQA 5FT9A 3GLGA 1AQIA 3O7MA 4W5JA 2Z8YM 4R5MA 4TX1A 3JAKB 4U2FA 1EHIA 2VXYA 3KU1A 3DEAA 5DO9A 2QN2A 3JV7A 3Q5GA 3MW8A 4MPPA 3ZQ4A 1Z0FA 1Q91A 2R7AA 3IURA 4P4SB 4UMVA 4YCNA 1NUSA 4REOA 3LL7A 3FUXA 1UWLA 3ZGNA 4AVYA 3QUBA 4DHEA 2HBRA 4EG3A 3OESA 1UPCA 4BNHA 3MJTA 1A9XA 3IUEA 4XGNA 1PNVA 2ZIXB 4LG1A 4XM0A 1QVZA 1XCOA 3MLEA 1E61A 3E8MA 2R4UA 1WMAA 2RGAA 4OH7A 4G0OA 3ZK9A 4HSGA 1FLDA 4O59O 4TLLB 1YB6A 1OROA 3IHWA 4B5LA 3G0CA 5CBPA 1UXIA 4LKRA 2XUOA 1AK1A 1VSBA 1FUKA 1YRLA 3VGJA 3ROZA 2W2PA 3BN3A 2CYAA 3HGMA 3IDAA 3VDNB 4J76A 3EPHA 3LC7O 2ERYA 1GUAA 5GAJA 2Q46A 1B8PA 2QP4A 1RCUA 2TMDA 2WHXA 3QMVA 3KM0A 4P7KA 4ZOQI 1FVFA 3HWWA 1RI5A 2MTBA 3CKMA 3JQGA 2QTCA 2X13A 1WW2A 4BNVA 2RGYA 1E64A 3H5OA 1Z39A 5DWVA 4UTPA 5FFMA 2WU4A 3L0PA 1P31A 1URPA 4W99A 1N6OA 3T41A 4DR3B 1Z83A 1YMQA 1OWMA 2AFHA 3M81A 1R5NA 1SBNE 1Z18A 3LTNC 13PKA 5AW2A 3ZLJA 3FXAA 2X0IA 3DE5X 1CY0A 4BVLA 4UUAA 1U5AA 2OCYC 4D3DA 1NLYA 4DAEA 1U80A 3A4VA 3KLBA 4DM3A 3QKUA 5DIZA 4DB2A 2HCFA 4JEUA 1N9GB 3HL0A 4BO8A 3QY9A 4EHIA 3U81A 1UT5A 1HZZA 4OJKA 5FPSA 3GLFB 5LXTF 1DAIA 1PQWA 1TM2A 2BGUA 3DHEA 3OAAA 1JRLA 4MB0A 1W48A 3V80A 5D6NA 4DLYA 2G8LA 3DPUA 1RFLA 4RENA 3WGVA 3PUXA 3TSOA 2I3AA 4I4TF 1PJAA 3DLIA 2MMCA 2V5AA 1CRLA 3GJ8A 4ZKEA 3QVMA 4E5PA 5HW0A 3U7FB 2OHFA 5IZ4A 5E38A 4P34A 5F73A 1X92A 4YT8A 4O2BA 1XE3A 1ZJZA 1WDWB 3GNSA 2V3WA 5B1HA 4EEKA 3BILA 4TGLA 4YQYA 1DQNA 1K5GA 2P6MA 1SUEA 3EFOA 3HV2A 1RJFA 4EA8A 4DMKA 1DDIA 2J3MA 1W44A 3DZJA 4II2A 2J5RA 2OC9A 1QR2A 4FB5A 5C1PA 4ZI2A 1OH5A 2ZBRA 2RHLA 2O1WA 1RKQA 4LX8A 1JIKA 1P7PA 3TXAA 3ZHCA 2NT4A 1E3WB 4HGZA 3L0YA 1MQ9A 1RYBA 3EFEA 2C83A 5BQ5A 3L93A 1G5TA 3MMZA 2DJ5A 2OP1A 3PGMA 2OK7A 2COUA 1FNDA 3RVPA 1I2CA 3TK1A 2DU8A 1O9BA 4D9JA 5IARA 3G9XA 3HZOA 4NENB 1YBMA 1XDDA 2PH1A 1F6BA 1NASA 2IXTA 2FMIA 3ZLUA 5KTSA 3AFHA 3KYIB 1IE3A 2AFIB 2BGIA 4OREX 5DCWA 3DDSA 3ORFA 5AICA 4TKVA 5BMVF 5LQCA 3LY5A 2ZS7A 5EG5A 5IAEA 1KC3A 1UKCA 5AVWA 3U4GA 1HT2E 1V5EA 4ECEA 2CT8A 3NTXA 4EHAA 1I4WA 2ZBDA 4UDXX 2IWHA 1UJ5A 4ZQFA 2XE8A 3VZRA 5CA0B 1V95A 3RABA 2GK3A 4JT9A 3D02A 3PDIB 2Z30A 2C5EA 2XVZA 3KHSA 4IZIA 5TY0A 2Y66A 4RJTA 1Z15A 3CJRA 3VNSA 4YMTA 2R6DA 4L3VA 4PAMA 5IK2A 2AYXA 3OVMA 1CZNA 3ZK8A 3K5IA 1M83A 4B7UA 2XD9A 4IIFA 2OC4A 3TUZC 1C1YA 3O2QB 3UJDA 1JKMA 2PMEA 5LZ7A 2Q7DA 2A0XA 3VX3A 1BYUA 1VXOA 1SQSA 3QI2A 4QO8A 1B16A 1O7JA 1HQKA 1Y6QA 1SBHA 4XSGA 5T3YA 5TVGA 4OX9B 3QKRB 1SPBS 3GFRA 4FPXA 4U0KA 3M4YA 2WU3A 4OI4A 4ALJA 3S2IA 1NQ5A 1FP2A 1U1FA 2FP4A 2RC6A 2EKLA 1NBIA 3E7DA 5EAIA 1N5KA 1WXEA 2B37A 3GEMA 4O4HA 2DPLA 4TV8F 2AXPA 5H70A 3T0GA 3WLOA 3KQNA 2M6SA 4G1FA 5JNVA 2GN9A 4NJMA 5BP7A 3W1WA 3QZUA 4QJBA 1E0DA 4X7PA 3VKUA 2G3YA 2PZMA 3WYEA 1ODFA 3LQFA 4YT2A 3J7AC 2IOHA 1VDMA 4F1WA 1MJ5A 1TUBA 3GDFA 1CDZA 3P0EA 2HJVA 1WPQA 3HCDA 5GVRA 1N57A 2NT3A 3QJ5A 1F8UA 3HO8A 5AW4A 1SU6A 5JG7A 3KEOA 1MB9A 3KWMA 4UHKA 3AKDA 2IZ0A 3CIFA 3MCZA 1K7SN 1PAUA 2AQKA 2R8XA 3RV3A 3A32A 1WZUA 2W11A 3DAHA 4GT1A 4XPIB 4ARUA 5C8YB 2V3CC 1T3TA 2QLLA 1JKIA 4NS1A 2Y76A 3ZWYA 4F3RA 4O2AB 1QRAA 1WMBA 3I23A 3TOCA 1J2YA 4QO7A 1HWYA 4BMVA 4ZC8A 1ZD1A 4LF8B 1PZNA 3GHYA 4JV5B 2FPPB 5CDTA 1Z6GA 3R74A 2B7CA 3SC2A 2Y4OA 4OJNA 4DNFA 3DXXA 1LC0A 3IE0A 4NZOA 2CSUA 1A8UA 1B2LA 4YLEA 9LDTA 1PR9A 1GNRA 1R2QA 2GPAA 2A5FA 3KZKA 3E4DA 4JL8A 5KNDA 4TXMA 5CB0A 2VC2B 1EBBA 3GGSA 1AXEA 4U5XA 1A95A 3KVVA 4YAFA 4L9RA 2HLHA 2Y1DA 3K72B 5FKJA 4WXYB 2OXTA 4A82A 2VHQA 3HB4X 3AETB 3DFMA 4ZAWA 4LOAA 1AUPA 3Q2KA 5BNIA 1GNPA 1H2RS 2ODQA 3TLYA 3N2KA 4H18A 3DBVO 3CHYA 2OMKA 2QEQA 1SKAA 1VYUA 1HLPA 3D4LA 3OLZA 3HVUA 2GAAA 5UKDA 2GFHA 3AF6A 3P9IA 4DBLC 1HMPA 2OV6A 5IG2A 4OOFA 2IPAB 1MEJA 4R9UC 1KEZA 2QOEA 3EUAA 4JFAA 3ZZMA 2CFRA 4ENPA 3IEKA 3R7BA 1LLFA 2QRVB 5CD9A 2JGIA 2VPIA 5HHTA 2BJHA 3H8VA 5SY6A 2IBSA 2NADA 4MWBA 4OHVA 4PPNA 5ALOA 4K6KA 2OQVA 4V0QA 3SCZA 5C32A 2PS9A 4TSRA 3T7CA 4NRDA 1PG5A 1UBLS 1EINA 4S1TA 1CRQA 3T7RA 3SHOA 2QSYA 1CYDA 4RKWA 3CSDA 4R3WA 1TA4A 4RHXA 2HJRA 2HD4A 2A86A 2WZCA 4R1PA 1AJEA 4ZP1A 3P26A 4OHPA 3V97A 1VCHA 5JWRA 2GAFA 4MEBA 3GRAA 1UBGA 2V6JA 3GIWA 3OKAA 3CF4A 1PX2A 4JI0B 4BKPA 5LZ2A 3OCCA 1OFTA 3RKRA 4DBVO 3TLKA 4G9GA 1CDEA 4UBMA 4MV5A 5KWSA 1CJTC 5BUCA 4G4GA 5BWNA 1H2FA 1CUWA 5E1MA 2J7KA 3EY9A 2YMPA 3AR8A 1J33A 1J2EA 3GA0A 5IMSA 1B0AA 2ZB8A 4LV8B 2JLVA 1H8EA 4F85A 1KQOA 1QUFA 1X13A 3LQRA 2WSMA 2WNHA 4I4TB 1PBTA 4DLAA 2CL6X 1ZCBA 1DG1G 3VR5A 1N2CE 1BC5A 1TA0A 2PVPA 4NBVA 4YH1A 4BASA 3W1EA 2Q8PA 2VTDA 3AR4A 4HEA6 2HTEA 3FYCA 2YJNA 3QITA 4KXFB 5CA0F 2OV2A 1EFCA 3NKLA 2AKEA 2HDNB 2QW1A 4HADA 4MP8A 2CFCA 4QHTA 4W7HA 2PUBA 4CODB 1E98A 3N7AA 1V96A 1FTWA 1N92A 2QUZA 1KBQA 2IZ7A 1BVRA 3QENA 3WSVA 3AR6A 1MH9A 1RQLA 3BF8A 4XJXA 2IW1A 1DELA 2AOWA 1FNNA 3VUFA 4B45A 2JIZA 3DLTA 2RKBA 4ZDKA 3DDNA 4CN8A 3OKCA 4KOAA 3CLHA 4MQ5A 4G2NA 3UV7A 2GJ8A 1K4KA 1PTKA 3QNUA 4QUHA 2ORWA 3L6RA 1XLUA 4FFBB 4D45A 5JY1A 2OAQ1 1P2SA 1F2UA 4A8JA 2WR8A 2QQ0A 4OMCA 4GR9A 3ZXXA 1XZFA 2XUKA 2C4VA 4QXQA 3FPBA 1L3BA 1B15A 1JHVA 1UFOA 4L02A 1W47A 1YZHA 3QYAA 1HORA 1SXGA 3H2YA 5I45A 5BV0A 2CUKA 3TMAA 1XDGA 1JFSA 5IT9A 2VPTA 3PB3A 5C2JB 3N8NA 2V4UA 1JFVA 4HTAA 2AOVA 1T2CA 4DV5B 4CGYA 3OH8A 2G0NA 4RH1A 4Z8YA 4N0QA 3KOUA 2WD7A 3SHTA 2N1BA 4PQEA 3ILYA 2ZYIA 3R5JA 4JBNA 1XMPA 4PG4A 5ESXA 3O0TA 3I42A 3U7QB 3KPYA 2E4ZA 2J3KA 5FF9A 3WIEA 5HBGA 4D4JA 3HSYA 1X87A 2XYQA 1SMKA 4RY2A 3KQVA 2VZ0A 3L0CA 1VPWA 5DGHA 2P9YA 3HRIA 3K1ZA 3OQ1A 1V6CA 2EP7A 3AVYA 1EB8A 4XE5A 4OOEA 1E94E 3DONA 4PCAA 4MRNA 3J81k 3GUVA 2BKUA 3JQRA 3E9EA 2ZI4A 5CLIA 3VR1A 1KMCA 3NYIA 1RQNA 2OTCA 1N9ZA 2ZUDA 2I29A 3LK6A 4IFEA 5BWBA 3U80A 1L5SA 3F6RA 2H2WA 3PHBE 2MT9A 4DV1B 2VPZA 4RFVA 5JNTA 5KYUA 5HS6A 4U6SA 4P7BA 1I4DD 1GPDG 3NM4A 4QICA 4L85A 4OQFA 4IQ8A 5LKRA 2Y99A 3V8VA 4N39A 3M4XA 3RVQA 2FN8A 3Q40A 3R8FA 1HX7A 5ETJA 3ZLBA 2Q2WA 2GAIA 2YW2A 1QIFA 1VSTA 2HJGA 5KYWB 2V97A 1YOVB 3QW4B 3CNEA 4JJ8A 1FYXA 2Q2VA 2QR2A 4K9SA 4WQMA 2R1ZA 2PL3A 1M8JA 2VF8A 1EQAA 1YB4A 3FF4A 5HCIA 4OHRA 2HDHA 4RZ3A 5FUQA 4CGZA 5ALWA 2G1AA 2DULA 2FW9A 3SU8A 5JNUA 2CVHA 1ZLXA 5JNSA 1IVSA 3HGTA 2LZ0A 4W7SA 5IAJA 3RFTA 1T5BA 4C78A 4TWAA 1PT7A 3DFUA 3KHKA 3VTZA 4K3VA 3EZGA 4E6PA 3SZ3A 1M8PA 1HK7A 1R6UA 2NVBA 1C2YA 2X0RA 2GX6A 2W71A 2ZJOA 3EVFA 5ALUA 5B36A 4TLEA 4AF6A 4A26A 3V4FA 1OZHA 5K6AC 1I2MA 1UP6A 1N0HA 1Z29A 3JVUA 1I3KA 4BMPB 1A8QA 4EB0A 3NU1A 4DLUA 1AKRA 4BEJA 1OAAA 2OFFA 3GMDA 3AP3A 3LLUA 5T8KA 1Z0UA 3R6DA 1NYRA 1Q95A 3BCUA 4LRYA 5KYXB 4RYLA 5BN1A 4H7DA 4YCJA 1RRMA 1FE8A 3G8BA 2GHQA 3MTGA 4LPSA 5G0TA 1A2QA 3GH1A 1DEKA 2GK6A 3GFOA 3ULKA 2DEUA 9MHTA 1DQRA 2BELA 4LQDA 3TVYA 3OY7A 4ARSA 4CIYA 1GGFA 1U8ZA 1Z6AA 2QTAA 3UJHA 4KREA 4O4IF 4MQ6A 2LDBA 2RH9B 3OLXA 3R77A 3J80A 3ZV4A 2XRZA 4M98A 4CKEA 3NG1A 2VLIA 5CP8A 1GZ3A 3MBIA 4QDXA 1ZITA 3AFOA 3CLUD 3HHEA 4UREA 2ZI7A 3U7JA 1J8DA 3MGBA 4F38A 4P2GA 3D6FA 4EHNA 1SOMA 3BQNB 2J0UB 3PFKA 2I2AA 5F9MA 5FBVB 5IVPA 1BU5A 2YIMA 4S24A 4TL6A 3R3JA 1EK0A 1Q7EA 1MUUA 2Z2IA 1DWUA 2VCEA 4EAAA 1PU2A 2GYYA 5JDIA 2R8BA 3P5SA 2B78A 1UM9B 1W0KA 2IPXA 1C2TA 4J75A 1ST3A 3IR7A 1PUIA 2RGNA 4KQFA 5EZYB 1CF4A 3DR5A 1R6VA 2RK4A 5F64A 2I0FA 3MTIA 1ENOA 821PA 2AXQA 4OA5A 3EC1A 3B36A 4MYDA 4RMHA 1H2ZA 3Q3HA 4H6XA 2HXGA 1A9TA 1SXJE 3D2BA 3IPCA 3C39A 4R8SA 4AMVA 3K70D 3E9QA 1PL6A 2QRQA 1NVWQ 1E8NA 4I3FA 2OT3B 1D3AA 2IFTA 1XVTA 1Z82A 4RIGA 3VHQA 5EUCA 1CLUA 4HLDA 2QR5A 3QE4A 3NHSA 3CEMA 1JPJA 2Z04A 5BSRA 3FR8A 1DHTA 3B1YA 1AD2A 2ISSD 3K2EA 3QU4A 4NP6A 1FQWA 5H02A 3U3JA 4B0PA 3NTRA 2DUNA 5G2OA 2J6CA 2E4WA 3WDKA 4CT4B 4KHPB 1DOHA 2JI7A 2K5UA 1N0UA 3VNAA 1UAGA 4AKIA 3LL4A 4PZ0A 4AUNA 3FUTA 4L8GA 3OF2A 1JAXA 4DIMA 1RRVA 2DT5A 1Z3CA 1AA9A 3H42B 4RPHA 1PZHA 3BGSA 3JCZA 3CG0A 3GV0A 4QQKA 4ZDWA 1RWPA 5JCXA 2EL7A 3OUUA 4YJ3F 2FKAA 2PKWA 4C3UA 3TBFA 2XD4A 1OU4A 1ZGCA 5L45A 3UAWA 1SXJD 1JU9A 3H5LA 2ZTVA 3O3NB 4DNPA 1JPNA 2NAPA 2XRFA 5H82A 4ZYUA 3AKZA 1Y1RA 4MW6A 1A2BA 2FUG6 4FCVA 4FBMA 4YWHA 2OZLA 4AAYA 4QT4A 3BL6A 1O5IA 4C0JA 2A9VA 5H68A 4FYIA 5TMPA 2IUTA 3ZQ6A 3I9OA 3A7EA 1YDWA 2IELA 2XECA 5C37A 2F4VB 1KHHA 3HUTA 2PFKA 1Y34E 2RGWA 5KAPA 3FIJA 4AJEA 121PA 4HNQA 5I9SA 3ZY6A 3IJ5A 1ZHFA 3BB3A 3P4UA 3Q88A 4H31A 1Z2EA 3AB7A 2CDAA 3HKCA 2QX6A 3CH6A 3K70B 8ATCA 3EQ7A 1PD0A 1C7EA 4XGQA 2J59A 2PX0A 3FWKA 3ISJA 4LF9B 2WP8J 5ALGA 4JI1B 1FVOA 1XCMA 4B2LA 2FSSA 2ZRHA 5IDWA 1PJ8A 4L27A 3ZI7A 3DAFA 3HR7A 5KIAA 2DTEA 4URWR 3CLTC 2ZG6A 3GFBA 3K5PA 5ADHA 1P19A 5LL6P 1PSZA 4I4LA 4NDZA 4B46A 1LPOA 4RPCA 1GGKA 5EESA 2Q3EA 3IJEB 1AHHA 4NU8X 4IDBA 3SXJA 2O8EA 5EMJA 2HDOA 3TMYA 4ZCTA 1V6AA 1Y81A 1OZ0A 3L5OA 4Z9AA 2KB0A 2R7MA 4PLZA 4S3MA 1KE1A 3E1SA 4HFRA 3M8KA 5JI3E 3ZCPA 2IOQA 1DMSA 1MABB 2QVZX 3O4VA 4MUYA 4GBMA 1G41A 4LC1A 2QT0A 5MGBA 2CJWA 3O8CA 4HLNA 4N6NA 1J09A 4LA4A 3AVOA 1IBKB 3UUEA 3FTCA 2JLYA 1E32A 1ZN8A 4OATA 5EJEA 1U65A 2CLHB 5FAXA 4F4IA 1FFBA 2DQSA 3WQSB 1U7ZA 1U0SY 4RXMA 5HBRA 4TYWA 4DGQA 1Y4AE 2IBMA 4B3MB 1CF2O 3H5AA 4Q18A 3RODA 2IW3A 4KXUA 4ZEMA 3CFYA 3VVBA 1X74A 1ZG3A 2A59A 2HMSA 3NT5A 3B3AA 3UG7A 4KE9A 4D81A 4CIVA 2C2BA 4UTNA 3PNVA 2HB6A 4IZHA 2R5WA 2Y1LA 3KKMA 1BWSA 4RDHA 4EO9A 4KK4A 1YQDA 2AG5A 2GNAA 2J3EA 1EDEA 1QRDA 4HFMA 2YVUA 1KNXA 5A9SB 4X90A 1J0EA 4J7UA 3BE8A 1ZUHA 2HIHA 1UMKA 2IOFA 3KJXA 2IPOA 2Y0DA 1NNSA 1TL7C 3PDUA 3QKRA 5D84A 4IUBS 4KO3S 3OPYB 1X7WA 2M9MA 4PS0A 3A10A 5H5JA 2PRJA 3U0BA 4AJ2A 1L5ZA 3WLTA 4XWTA 3ELYA 1HNWB 4BDSA 2C8LA 1N6HA 2JGDA 3H2IA 3PC7A 4UJ5A 3I01A 4S05A 1K3FA 5BSMA 1II9A 4HFNA 5EE1A 1KO1A 3OQOA 1JFLA 1U0RA 4WNYA 5I51A 3ZW9A 1OASA 3IOYA 1X0VA 2FOIA 2F6RA 2XMZA 3TD6A 2BRUC 4OVKA 2PL1A 3T6KA 1ZSNA 1GV0A 4DPMA 3R6LA 1GZ6A 3GQVA 4G0MA 3NTLA 1SCAA 2NZYA 4QUEA 5E0OA 5LP6A 1D04A 3ZU3A 2XCIA 4RH3A 2CVFA 3LBAA 5KU7A 3I5YA