5JLXA

Antphd with 15bp dna duplex s-monothioated at cytidine-8
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
57
structure length
57
Chain Sequence
GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homeotic protein antennapedia
publication title Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulator/dna
total genus 23
structure length 57
sequence length 57
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5jlxA00
5F27A 2DMQA 2DN0A 4JP0A 2LD5A 4CYCA 1NTCA 3S1NJ 1ZKGA 2M0CA 5EGOA 1Z0XA 4XK4A 2DA4A 3MVPA 3A01A 2DA3A 3BQYA 1JKRC 3JRFA 2XGDA 1AU7A 4G12A 2XSDC 2MW8A 1AHDP 2LTPA 1FIAA 4BY7J 3CCYA 2CU7A 3NARA 1VI0A 2NVYJ 2HOAA 1T56A 1IGNA 2O9LA 1GVDA 4J19A 5EG0A 1WGXA 2FQ4A 4MLOA 1ZR2A 2HXIA 4A3MJ 4C3IJ 3PO2J 2HXOA 1QPIA 5F1JA 1ITYA 1VFCA 1VNDA 5FKMA 3S14J 1HF0A 2VKVA 2NS8A 3LSRA 5BNGA 3TW7A 3GTJJ 1HLVA 1F43A 2LVSA 5FKKA 2HOSA 2EZLA 2EZKA 2L9RA 2M34A 2XRLA 1QRYA 5J3LA 2NVTJ 3GTMJ 4QTRA 1XS9A 5FJ8J 3CQZJ 5M3FJ 3S1MJ 3RQIA 2GBYA 5GP9A 5J1RA 3JRBA 3OSGA 3BTCA 2ELKA 2ECCA 5FKOA 1HCRA 2H8RA 3TEDA 1PUFB 2XB5A 3M3YJ 1RESA 3BQZA 3HB9A 1BW5A 3I4MJ 3S1RJ 1U8BA 1JKPC 3GTOJ 2JN6A 1NK2P 4AUXA 4L5EA 1MBHA 3JRHA 4X6AJ 2LR8A 4A3FJ 5J1YA 1LFBA 3QPLA 3W6VA 1VF9A 2K9NA 1ETOA 1NK3P 3LSPA 1BJZA 4AC0A 4HNVA 2R0QC 1O4XA 1ZQ3P 3PO3J 1BW6A 3FIWA 2E19A 3HDDA 2VI6A 1W0TA 4JX6A 5IP9J 1ETWA 3FK6A 3BG3A 2HQ5A 3HOZJ 4FCYA 1JUMA 5FLMJ 1JJ6C 4A3GJ 1GDTA 2Y2ZA 2HDDA 3JREA 3S15J 5JLXA 3LSGA 3CDLA 3SDGA 2E2HJ 4C3JJ 1BA5A 1FTTA 4M3GA 4X1EA 1HDDC 3ZQCA 2NOGA 2CJJA 3BR2A 4S0HB 3S2HJ 1X58A 1R9TJ 1P7IA 2JMWA 3L1PA 2X48A 4A3BJ 1Z77A 3OSFA 2AHQA 2DJNA 2XPWA 4C3HJ 2MSYA 2OPTA 4JX4A 1B72B 3FK7A 2R92J 4DYCA 4FISA 1YRNB 2DTZA 3PM1A 2N8GA 3A02A 2R93J 3RZDJ 3TW6A 1MBJA 3OOUA 5DTDA 3G1LA 4D5CA 4A3LJ 1WCMJ 5EF6A 3CMYA 3Q3SA 2DMTA 2CRGA 2TRTA 4GFBA 1K83J 2NVXJ 5EZGA 4IHXA 4A3EJ 2EQRA 5IYDJ 4Y52J 4XRMA 3SJMA 1PUFA 3JR9A 2DA6A 2L7ZA 1ZTRA 1WH7A 4MIMA 2R5YB 2DA5A 3O8GA 3BTJA 4A69C 1LE8B 1BL0A 4A3IJ 3S1QJ 1GV5A 3LSJA 2W48A 3E7LA 3HKZN 4W1UA 3BTLA 3ZQLA 1W0UA 1OFCX 4V2GA 2JA6J 2DA1A 1JUSA 2LP0A 3DEWA 2R7ZJ 2MGQA 4JX5A 1A5JA 1IRZA 2XGEA 1QVTA 1TC3C 1OCPA 2LY9A 3OIOA 4XRSA 4FE7A 2DMPA 5IP7J 3ZOBA 4A3KJ 4MO7A 1FIPA 1SANA 5FKLA 4AYBN 1IDZA 2HOTA 1K61A 3IH3A 2EZIA 1IV6A 5M5XJ 4DZPA 5K7FA 4BKXA 4M3BA 5IPAA 5IYCJ 1I3QJ 5IP6A 2O8KA 3JRIA 3H0GJ 3GTKJ 3HOXJ 3S2DJ 2YU9J 2Y30A 1I50J 3O8HA 4RDUA 1FJLA 2L0KA 1U9NA 2D5VA 2P81A 2QCOA 1GUUA 5F0FA 1ETKA 4BY1J 1MH4A 2COBA 4DZJA 1B72A 2E2IJ 1YRNA 5JLWA 1WI3A 1E3OC 2E1OA 2YUSA 1IC8A 1MH3A 2AO9A 4C2MJ 2ME0A 3FISA 2XGCA 1ORKA 1JTXA 5M3MJ 1JJ8C 1JUPA 3HOVJ 3HGYA 5C4JJ 3GTGJ 1OJLA 2X6OA 4ABZA 3G1OA 5F04A 4UUSB 3K7AJ 4M3EA 5EZHA 5IOZA 5E3NA 2R5YA 3TP3A 1TWHJ 3Q0VA 4IEJA 1S7EA 1MBFA 5FKNA 1LE8A 5FLVA 2NS7A 2VPRA 2DA2A 1ZR4A 3QQAA 1JGGA 1MNMC 4EEFG 4A93J 2DMUA 1T33A 3Q0UA 4M3FA 1G2HA 3MN2A 3MKLA 3I4NJ 2EBIA 3ZQIA 5C3EJ 1AKHB 2ID3A 3Q0WA 5E3OA 1DU6A 1UG2A 2XPUA 4FTHA 3RKQA 2M9HA 1X2NA 4I76A 4LOCA 4B3AA 4IHYA 4V2FA 4IHWA 1Y1WJ 5F0HA 1B8IB 2JA7J 1UHSA 1ETVA 3S16J 1WPKA 4QSHA 3JRCA 2K40A 1MBGA 2R5ZB 4BBRJ 1SFOJ 2NVQJ 1XC5A 2E2JJ 2M8GX 2RAEA 2VKEA 5E3MA 4RBOA 2EZHA 5HODA 3C2BA 4Y7NJ 5IYBJ 3FKIJ 4D7NA 1IUFA 1MSFC 3ZQFA 4B1RA 3JRDA 2JWTA 4MFEA 1GT0C 3GTQJ 3M4OJ 4DW6A 3BR3A 5GPCA 5C44J 1P7JA 2EH3A 5F08A 3IV5A 1TWGJ 1JKQC 2JA5J 1DU0A 3B6AA 3HEFA 1A6IA 1ZK8A 1UMQA 2MG4A 1IJWC 2L7FP 3A03A 5K7ZA 1H89C 4BXXJ 3BR5A 3BR1A 1D5YA 1TWFJ 2K9SA 1IG7A 2JJ7A 2LFBA 1JT6A 3IH4A 3TP0A 9ANTA 3ZQHA 5C4XJ 1QVUA 2K9QA 3GTPJ 4UUSA 1FEXA 1IDYA 1APLC 2IBDA 1GV2A 3BG9A 1TWCJ 3G1MA 1Y1VJ 2OF7A 2DA7A 3IH2A 1H88C 3BT9A 1OCTC 2JK3A 3HOUJ 5M5YJ 2WB1N 3JRGA 3LNQA 1X2MA 2X9DA 3SFIA 4I6ZA 3GTLJ 2ZB9A 1AKHA 4B4CA 4FE4A 1Q1VA 3UKGA 2H1KA 2M2EA 2LLKA 3D1NI 2CUEA 3VPRA 1POGA 4D5FA 1B8IA 2CUFA 2L7MP 1ETQA 1RETA 2ID6A 3HOWJ 4CYCB 1U78A 2I10A 4DYRA 1U9OA 2R5ZA 3S17J 4M6VA 3ZQGA 5EGOB 2XPVA 2GLOA 1ENHA 3A01B 2HYJA 4XIDA 2LKXA 3GBGA 2QF7A 2FD5A 4A3DJ 1MBEA 1H8AC 3JRAA 4MFDA 1XG1A 1I6HJ 2CQXA 1MSEC 1RKTA 2KT0A 2FJ1A 3LOCA 1RPWA 4XRSG 1F36A 3NAUA 2IAIA 5F0CA 3WHCA 5EG0B 2GM4A 2HI3A 4DYQA 1CQTA 5EDNA 2KDZA 2YS9A 3B6CA 2Y31A 3RZOJ 4IHVA 4M3DA 1ETXA 2Y9ZA 2PMZN 3QPSA 2VUMJ 2XB0X 1MBKA 5IOYA 4BBSJ 2CQQA 3HBLA 1ZGWA 4W97A 4UUTA 5EEAA 2B63J 3HGGA 5J1UA 2DMNA 1JT0A 1FTZA 2G0EA 3BR0A 1TWAJ 5GPAA 1HOMA 1JTYA 2WAQN 3HOYJ 5M5WJ 2ME6A 4A3CJ 1RR7A 2FX0A 3DCFA 5EYRA 1HDPA 2LK2A 2O7OA 2ECBA 4JYKA 2TCTA 3BTIA 3K2AA 1JKOC 1WH5A 4NDLA 5E3LA 1EF4A 4XICA 2WV1A 3F0CA 4D7MA 4QIWN 2Y0SN 3H3VK 3BR6A 4A3JJ 1ETYA 1RKWA 5DS9A 1LFUP 3WHBA 2IEKA 2Y9YA 2JA8J 3HM5A 5K7HA 3BG5A
chains in the Genus database with same CATH superfamily
5F27A 2DN0A 3OYHA 4CYCA 2LD5A 4J01A 5K5QA 1IRFA 2G7HA 1U5TB 5DM6F 4YIRX 1Z0XA 4XK4A 4IOCF 3MVPA 3A01A 5IT9Z 1MJ9A 2DA3A 4V19K 3HSEA 2A5YB 4LG3A 2HGCA 2UXXA 3GFJA 2O5RA 2ZC2A 1H9GA 3VFZA 3L2WA 1IUYA 1FIAA 4BY7J 4DOZA 3R4KA 3NARA 4GXOA 2HOAA 2FMYA 3F8FA 2I8DA 4ZH4F 1ZH5A 2BEOA 2VBZA 3RTRA 4J19A 3J7ZI 4MLOA 2RKHA 4F52A 1LDDA 1MDMB 1QPIA 2Y69H 2IS6A 3KZYA 3S14J 3FZVA 2GXGA 2NS8A 4ASNA 2FA5A 5BNGA 3H35A 1HLVA 3M1EA 4OMYA 1F43A 2LVSA 2KIUA 5FKKA 3TKYA 2EZKA 2DXIA 2M34A 2XRLA 3BC8A 1USTA 3BCBA 3TOAA 3RIRA 1ERDA 4WCGA 1XS9A 3CQZJ 3CUQC 3A0BC 4NUBA 3L2RA 1VQ9I 2EFOA 2MH2A 1WJ5A 4LMYA 1V3FA 5TGTA 5FKOA 1HCRA 2HU9A 1B9MA 2H8RA 4YG2F 3ABMH 5LFAA 1RESA 3CUOA 3BQZA 4KT5C 4NNJA 3QP6A 3JAMK 2IS2A 1IO2A 2VB6A 1JKPC 1FT9A 5K1YA 5FFXA 1UB9A 3FDYA 3QRFF 4L5EA 3HJEA 5HLHA 3I64A 1IF1A 1UAAA 3QWLA 4HNVA 1P6RA 1ZQ3P 3FIWA 1A36A 2P6TA 2VI6A 2KDOA 3ZXSA 3BDDA 2DFHA 1ETWA 1HSTA 1BN5A 2CH0A 3U1KA 2J5OA 4CUGA 3BG3A 1AWCA 2EV6A 3K1PA 4L5IA 3HOZJ 2HDDA 2Y2ZA 1W7PB 4XRFA 2OCEA 3GF2A 4QWQA 3OYEA 3CUQB 2LNBA 1RR8C 4HSRA 3LSGA 5CLSA 2E2HJ 4IRGA 3MZ8A 3I4PA 3TGNA 2CJJA 2TDXA 4FETA 3CO7C 4S0HB 1O3SA 3H1CA 4HV6A 2R7OA 2MC4A 1W36D 3HUGB 1R5HA 4OAZA 4KFCA 2Q2EB 1HXDA 3L1PA 1BI0A 1Z77A 4ENKA 2I5UA 1ZG3A 3OSFA 1JI8A 5HVQC 5K5RA 4MEXF 1T95A 1Z21A 3ABKH 2HNHA 4DYCA 3P7NA 2A68F 2DTZA 1BI3A 3PM1A 4XN0A 1TW2A 3GMEA 3ZP5A 2ZXHA 2R93J 3RZDJ 2QWWA 1MBJA 3OOUA 1SD4A 3FWEA 4XBFA 3G1LA 4D5CA 4C2TA 1VQOI 2FNPA 2ZO4A 2QQ9A 2DMTA 3I0TA 2CRGA 3AFHA 1W36C 2VLAA 5A2QZ 3F8NA 1K83J 2BY1A 2Z16A 1Y0NA 3CCVI 4HSTA 2W25A 5IYDJ 1ODDA 4XRMA 2VQCA 1IXSB 1KU2A 2M8EA 1I6XA 2F5DA 1ZGJA 2L9SA 1GXQA 3O8GA 2E60A 5ICCA 4ETSA 2PLYA 1JGSA 5B1BH 1OKRA 5JHUA 1I1SA 2HPIA 3GZ5A 4XLFA 1BC8C 4XLEA 3DFGA 1GV5A 1IW7F 2VQGA 3HKZN 4U88A 3ZMSA 2L3DA 4F3QA 3BTLA 4D1QA 2KRHA 2OZ6A 5LBQA 4V2GA 1MNDA 4HLYA 1JUSA 4O6JA 2LP0A 3DEWA 2K9LA 4U87A 1IRZA 1TLHB 2A5WA 1OCPA 1QHHD 3VDXA 3OIOA 2K7LA 4XRSA 3CJNA 4OU0A 4CO8A 4QLCU 3A4CA 5L3CA 2E35A 4M71A 3ZOBA 2E34A 2AXTC 4ZTFA 3GFLA 3BJ6A 4RB2C 4MO7A 4FT8A 1V5FA 4R1HA 3H9QA 2ISZA 3J81Z 3G6EI 1K61A 4G7ZF 2CUZA 1IV6A 5TRDA 5D5VB 1XMAA 5KCMA 4KN4X 4BKXA 1I3QJ 3H3ZA 5IP6A 2O8KA 2MD5A 3JRIA 3GTKJ 3ZMTA 3W6JB 2M30A 4GGGA 4RB0A 1P4XA 2E5NA 3S2DJ 2E7WA 3UNGC 4RM2A 4Q5SF 2Z99A 1VQMI 5F64A 3HPGA 3SQNA 4O3MA 2J5PA 3C18A 1DPUA 1FY7A 2L0KA 2XAHA 2DJIA 3VOEA 2ZXIA 2QCOA 4HPQA 2YPRA 2DQLA 4B3XA 1LVAA 2COBA 4DZJA 2E2IJ 1T8IA 1SVOA 5JLWA 5BOXA 3KEOA 5E17F 3F6VA 2ZXJA 3ESWB 4EJVA 3OYCA 3C2HA 3O3KA 1B1BA 1MH3A 1IXCA 3GCMA 4P5OA 1D0XA 3S3OA 3F3XA 2XGCA 2D45A 2V7FA 4GYGA 1K4TA 1USSA 2FMLA 1YS7A 5JHFA 2XHKA 2KMUA 3CDIA 1OMIA 4LK0F 3G1OA 5F04A 1DGRM 3OR2C 3IL2A 3P9CA 2JVGA 2CO5A 1HKQA 3SXYA 5IP9J 2R5YA 3TP3A 4E7KA 3Q0VA 3D0SA 4RGXA 4BDZA 2L5QA 3IUOA 2VQHA 3A0HC 1ZR4A 2QKMB 1MMDA 1IAWA 2H94A 5E1WA 3OYBA 1T33A 1T2KA 3MKLA 2QSGX 2PMHA 2EBIA 4BJ6C 2E1MC 1E0EA 4E4HA 4Q4ZF 1ZG1A 5CVRA 2R7WA 4HX7A 3RKQA 2LBFB 2ELHA 1WFXA 2V9KA 1LUJB 2FEZA 3WU2C 3CCUI 3HL2A 4IHWA 1Y1WJ 5F0HA 3TL4X 5ILVA 3IWZA 1TNTA 2W1OA 1SD7A 1OISA 3IAM2 4XONA 2VPLA 3CCLI 1Z3XA 1SFOJ 1U3EM 5DCMB 5JR3A 4DBQA 4RB1A 2VKEA 3ECOA 3MKWB 3SZPA 5IYBJ 3H36A 2EFQA 3JAMZ 3ZN1A 1MSFC 1K4SA 4WXDA 5HNHA 1F9NA 1GT0C 2UV1A 2P5VA 2OUMA 2MFZA 5ICFA 1S29A 5C44J 2RC4A 1TWGJ 3DTEA 2JA5J 5AIQA 1W5CC 4G7OF 1OYWA 2KIMA 3BWGA 3B6AA 1VQ8I 2E1MB 2OZUA 3CCRI 4G7HF 2IPQX 1A6IA 5TJJA 2XF6A 3LA3A 3PFYA 4HF1A 4YFKF 4HRIA 2LF7A 3QYEA 4BXXJ 5D5WB 2FOWA 2B7EA 4UXNA 2LY2A 3CF5F 1OQYA 2JJ7A 1JT6A 3IH4A 4XN3A 2CYYA 1RUNA 1QVUA 2EPFA 5DDGA 1R7JA 2DCEA 1D0ZA 1VZ0A 2NYXA 3ISPA 4UUSA 3S3MA 2W7NA 1UHMA 3VSLA 2FXAA 2IBDA 3OL4A 3DF8A 5JVTA 2O0YA 5CJ9A 2PBIA 1Y1VJ 1SFEA 3BCAA 2CMPA 4E7LA 1H88C 2KL4A 2JK3A 1F1ZA 4M6YA 2R7FA 3OYMA 2WAQA 3G4SI 2P5LC 1LVKA 4AWXB 2OC6A 4CZZA 2LDUA 1IXRC 5AIPA 4L18B 1RNLA 3TQNA 2F5VA 2E71A 4FX0A 1KYWA 4R79A 1EKEA 4RAYA 5DCFA 1KU9A 3TO9A 1C0WA 3NWSA 1QO0D 2ELJA 2HQRA 1B8IA 2XKOA 2K5CA 4XMYA 2R7DA 5HOOA 2L7MP 3E0JB 4HOBA 2PJPA 3PNTA 1U78A 2W85A 3HTUA 3S17J 2M45A 4XKBA 3WGGA 4RA2A 3DU5A 2XPVA 1RC9A 4II2A 5EGOB 1HA8A 2ZBKA 2LKXA 2BOLA 2L54A 1SD5A 3PIOF 1FOWA 4A3DJ 1MBEA 3T5XA 4HZFA 1BOAA 3JRAA 2KRFA 1XX5A 4ZDPA 5E8IA 1X4OA 2KT0A 1CF7A 1FPQA 1RPWA 1XGNA 1YOVB 1F36A 2IAIA 3OIPA 3KP5A 3WHCA 3WG9A 2QUFA 1MMGA 1XMXA 3E6CC 2LKSA 2CV0A 2OAZA 1K78B 3F9KA 2O8XA 3B6CA 1LJ9A 2A3SA 3C3WA 3DTIA 4HDVA 3E6MA 3T8TA 3OY9A 4IVNA 2KHMA 2VJJA 4Z6YA 4BS9A 3QPSA 1NHAA 2Z3YA 3OWTA 1Y0UA 3GEZA 2VBXA 1HW2A 1SC7A 1V5GA 5LGTA 4W97A 1YQAA 1Y39A 4EV0A 5HS9A 3HGGA 2QQBA 2QQAA 3CLOA 2DAOA 3RPUD 3GWZA 1JT0A 1LEAA 3LL7A 1ON1A 1TWAJ 3W6KB 1HOMA 4PZJA 4XOPA 2MBFA 2O6GE 1MMAA 1G3WA 4KDPA 4Y33A 3DCFA 5EYRA 1HDPA 2LK2A 4F91B 2PI0A 2P0WA 2TCTA 1X3ZB 3FM3A 3K2AA 4BE2A 1WH5A 1XSVA 2GIZA 3HG9A 1EF4A 2XASA 3VYRB 2DQRA 3F0CA 4D7MA 2A6EF 4HV5A 2Y0SN 4C30A 3GXOA 3H3VK 3NRVA 5J8CA 4A3JJ 1ETYA 1LDKB 1DP3A 3AAFA 3BG6A 2LH9A 4LJZF 3DBRB 3WHBA 4B09A 2F6CA 2F5EA 2DMQA 4JP0A 4MQVA 3K9TA 3S1NJ 4A12A 2ZMEA 1R1VA 1ZKGA 2FSWA 3TBIA 1ZHFA 3PSIA 1BBYA 3PUBA 3CMEI 2OD5A 3LSHA 4UNOA 1AU7A 3CC2I 4L5JA 2XSDC 4NQWA 5K5OA 2C6YA 4FQGA 4KT6A 1X1AA 2HVSA 3CJRB 1MNEA 1XGSA 5HLIA 5CYVA 4CCJA 4II3A 2K3PA 3RYPA 2BW3A 2MLGA 5FB2A 4A2UA 4OIRF 1OYIA 3HSRA 1GVDA 5HLTA 2Z9OA 1JE8A 2ZJQF 3LFKA 3QU6A 4BXUA 1ULYA 5H2FC 5LGUA 1WKMA 1HF0A 2WWYA 2BXZA 2KFDA 1ZELA 2KJCA 4Y15A 3PFIA 2X1DA 3GTJJ 1P9QC 5DD8A 4MHGA 1J59A 2VOOA 2K86A 1R5ID 4PJNA 4DIQA 1V55H 2EILH 1QGPA 4HA8A 4I98B 2NVTJ 3WE2A 2ZCWA 3I53A 2DFEA 3B73A 4LB5A 1SFKA 3PQJA 1K6OA 4EM0B 4ZC3A 4CA0A 5FROA 1ZARA 3RKYA 4EJWA 3OSGA 1TQPA 2EWNA 1YW8A 2ELKA 3FHNA 1QBJA 3OYJA 3H5RA 3HHHA 1R36A 2L4MA 2WBMA 2UXNA 4ZZDA 3H3UA 4JOMA 2FOKA 2K27A 3OS2A 4KISA 3BJOA 3I58A 3JRHA 2UWMA 1Z91A 1HBXG 4A3FJ 5J1YA 2XROA 1S5LC 4OWRB 1LFBA 3QPLA 3D5LA 3HKZA 2RDPA 3W6VA 1VF9A 3MZHA 2ZXWH 1BJZA 1O3TA 1IRGA 1W4MA 3R0JA 2O03A 4LIVA 2HVRA 2EA4A 4ZYHA 2OJED 2MH9A 4JX6A 2OQRA 3ELKA 1B9NA 2HQ5A 4ENJA 1JUMA 1A35A 4IHTA 1U5TC 1IN4A 1YJWI 2AQFA 3Q5FA 1LNWA 1NG6A 3SDGA 2VN2A 1LQ1A 2HTJA 4B44A 3CTAA 4G94A 1BA5A 2F4MB 4M3GA 3MKYB 3PUFA 4CHUA 1F4KA 5DUKA 2R7SA 2NOGA 3G73A 3S2HJ 3BZ6A 3QAHA 1UG0A 3TDZC 4IPAA 3V7CA 3KX2A 1R9TJ 4EM2A 1P7IA 4ITVA 4RGUA 4CXFA 2XGXA 5F6FA 3I59A 3M07A 1SMYF 1WVRA 2E1NA 2MSYA 1B72B 3FK7A 4FISA 2YX4A 1YRNB 2JZYA 1D1CA 4DNCA 4N9HA 4IHSA 2N8GA 3R6SA 1ZG5A 3ZPLA 1JHFA 1S7AA 1UJ8A 2AQEA 2DO7A 3IC7A 3K4MA 3CMAI 5EF6A 3CMYA 2VKDA 3WTVC 3G71I 2R7TA 2TRTA 2R7UA 2NVXJ 4IHXA 4JQFA 3K6GA 2DTRA 1PUFA 2KIQA 2DA6A 2L7ZA 1ZTRA 1WH7A 1OPCA 1QZEA 5DD4A 3EQLF 2HR3A 2CFOA 3AL0B 4FHTA 2GQQA 5FGMA 5LEKA 4BL0B 5JI6A 2L2OA 2XRNA 3BY6A 3KP2A 4XSXF 1BC7C 4H0EA 1OFCX 4WXCA 3RPQA 4XORA 1ZGAA 4JX5A 4PGGA 2KZGA 1A5JA 2XGEA 3F22A 1ZRDA 4BHPA 5JFRA 1P2FA 3M8EA 1YE9A 4FE7A 1X1DA 5CQGA 3RSNA 2PMZA 3UR3C 1ZYRF 3CCEI 2Y75A 3LSKA 4B8XA 4AYBN 3KLNA 2K4JA 4LLNA 2HOTA 3J80K 3IH3A 4UV9A 3OS1A 2CW7A 5M5XJ 5K7FA 4M3BA 5B1AH 1TW3A 4KIGA 2CG4A 1WSUA 4H4KC 4XKWA 2K85A 3KYDB 2PJRA 1E3HA 2KRCA 2ZNYA 4RS8A 5H20A 2LY1A 4YIFA 1I50J 2FUG2 2JRTA 2VKHA 2VASA 1A04A 1DPRA 5BMZA 3VWBA 2EA2A 2RNGA 1DUXC 5CPRB 1I5ZA 4MNUA 4ON0A 1DGWY 2D5VA 1FBQA 3IWFA 3ERED 5F0FA 3PNYA 1YHQI 5GTIC 5KNLA 1YLFA 4EJTA 3N97A 3DKXA 3WTUC 1O7FA 3GX4X 1JXSA 4A5NA 1L3LA 1J5YA 4Y4RA 1IN5A 4YELA 4CCOA 3BPVA 1FYKA 3RJPA 3OV8A 4C2MJ 5CVIA 3JW4A 3K4BA 1JTXA 3PJRA 2HTSA 1XDUA 2LF8A 5KAIC 4BQQA 2IJLA 1UHWA 4KIBA 4ABZA 2RGVA 4K2EA 3V4GA 4XLCA 4HNUA 2F48A 4LG0A 5IOZA 1WJFA 1QA6A 4IX7A 1YYVA 1XGOA 4I01A 4RAFA 3OYNA 1LE8A 3W2WA 2EFWA 2NS7A 4XNFA 3W2AA 5FLVA 2EK5A 3GLLA 4BXFA 1JGGA 1X4PA 1MNMC 4A93J 1FC3A 2VJ5A 2E36A 4OMZA 2X6XA 4YFNF 4CICA 2R7RA 2V79A 5C3EJ 5GAGJ 1BIAA 2WAEA 3SZTA 5E3OA 1R49A 2LG4A 1IRXA 1VQ5I 4BUPA 3EUAA 2CV2A 2OTJI 2GIVA 4B3AA 5D4RA 2EFNA 4HYEA 1BOBA 1ETVA 1YX5A 4EGYA 5L3GA 1WPKA 1YIOA 3OIQA 3CD6I 1WWXA 1MBGA 3JTGA 3B02A 1XC5A 2F4IA 3DEEA 3R60A 1ZRCA 4PJLA 3C2BA 3FKIJ 4XLHA 4D7NA 2BY3A 4KITB 5EEGA 4MFEA 3GTQJ 1FNNA 2QM3A 1B59A 2HKXA 4O5VA 3KEYA 5B5EC 2DW4A 3QPTA 4LD5A 5F08A 1Y8RB 5EEHA 1DU0A 3PL8A 1ZK8A 1VQNI 1UMQA 2MG4A 4Y17A 2L7FP 1BM9A 5K7ZA 1H89C 1TWFJ 3DBLB 3LQQA 4UV8A 1FMVA 4Q47A 4E7HA 4PSWA 1Z1DA 3ZCOA 5C4XJ 1J09A 1UELB 3GTPJ 2YU3A 2XSJC 1FEXA 3HPHA 2XAUA 5TISC 1AOYA 2D1HA 1N77A 4CCKA 3BG9A 3R0AA 2QQ8A 3G1MA 2OF7A 4F92B 2CW0F 3IH2A 2H6BA 4NC7A 3BOQA 2B0LA 4CZCA 1BR4A 2WB1N 4E6KG 4KA4A 4RMNA 4I6ZA 2ZB9A 1AKHA 4BYYA 4B4CA 3QOEA 2XAGA 1T0FA 3OR1C 5E79C 5HNFA 1H0MA 2IA2A 3UKGA 2PEXA 2DLLA 4UY8I 1QHGA 2LLKA 4XLPF 2JRMA 2Y0SA 4BEHB 2IGMA 4LIUA 3EUKL 1ETQA 4PK4A 1RETA 3S3NA 3PQKA 3HOWJ 3A1YA 4FX4A 5DEQA 4CYCB 1ACIA 2KPMA 1G3YA 2LMDA 2R5ZA 4R8HA 2OA4A 3ZQGA 1PVEA 1ENHA 3A01B 2HYJA 3ZRGA 3DU6A 2WA0A 2QF7A 1DQUA 2OU2A 5J4YA 2FD5A 3SDBA 2O3FA 3EUHA 3NWTA 2CQXA 3WODF 1MSEC 4U0VA 2FJ1A 2DODA 2R3SA 4PUSA 4PDKA 4IOAF 4KUMA 5F0CA 3MZYA 4YEJA 4E7ZA 2F4OB 3E5UA 3FBNB 4HX4A 3DWLE 5D8KB 3WTXC 3LFUA 5EDNA 1IV8A 4I0AA 2KDZA 5IY5H 2NVUB 2RN7A 2MC3A 2YS9A 1UZCA 2Y31A 4ESFA 3RZOJ 2ZSHB 4AVPA 4DGWB 5J4VA 2PMZN 1WJEA 4N4OB 2RV8A 4XOTA 1MBKA 2EV5A 5IOYA 2L02A 2CQQA 4BBSJ 4B48A 2CSOA 3J80Z 3V8KA 4A6DA 4NHJA 3LAJA 1ZGWA 2WAFA 1D0YA 1K6YA 1W5TA 4LITA 5EEAA 2B63J 5J1UA 2VXZA 3O2PE 1M1EB 4GDFA 1XTAA 3M9AA 4BDYA 2G0EA 3BR0A 3KIOA 5EJCA 3W2VA 2WTEA 3HOYJ 2M4GA 5LRRA 3S93A 2NXNB 4P9UA 4ENMA 4J00A 1FZPB 4XL9A 5B66C 2IVMA 3LWFA 1WZ2A 3DTKA 3OYIA 4WWCA 4L9JA 1JKOC 2R7XA 1LB2A 1FYMA 1WRJA 1LDJA 2WV1A 3IRRA 1Z05A 5KAFC 1OR7C 3ZGKA 4CDGA 3W3CA 1FP2A 2BY2A 1LFUP 4L0ZB 2COMA 3OYDA 4L9TA 4PJJA 4D0PA 4AIHA 1JHHA 2M0CA 2RREA 4ZTJA 3T8RA 1EH7A 2NAZA 3DLAA 5LEJA 3LSTA 2BBYA 1PDNC 1ZLJA 2XGDA 2AS5F 2IA0A 2Q8KA 4G12A 4OIPF 2MW8A 4CCLA 3PIPF 1OCOH 1BR1A 2EJRA 2ZFUA 3OMYA 2QBYA 2FF4A 3DPTA 4HLXA 4KMFA 1ONVA 4KMUX 4F7ZA 3CCYA 2CU7A 1VI0A 2NVYJ 4E7JA 4M72A 1V4RA 3M8FA 1T6SA 2M1BA 1O3RA 1AA7A 2X6WA 4HW0A 1T56A 1IGNA 2H27A 1VQ6I 2L9NA 2VJ4A 5EG0A 3CC7I 1WGXA 2V6CA 1ZR2A 1HKTA 1NG7A 1XCBA 4C3IJ 3PO2J 4PJ0C 2D1VA 2OBPA 3F23A 2HXOA 3S2WA 2XKPA 5F1JA 5H6QA 1VFCA 3WU0A 5FKMA 4IXAA 1KYZA 1LEBA 1MZBA 6PAXA 3MKZA 3LSRA 1SAXA 2G9WA 4I99C 4BJTA 3CMMA 2DDAA 4F93B 4S05A 2HOSA 2EZLA 3ASNH 4AVZA 2QVOA 4HG2A 2L9RA 3FKJA 1P92A 4CCNA 1I39A 3BROA 3DV8A 3GTMJ 1QU3A 1XPXA 4E7SA 3MAJA 3SEZA 5M3FJ 2DK8A 2RVCA 5LD2C 2L01A 1VQ7I 2ZJPF 2VC1A 3S1MJ 5J1RA 4OIQF 2M3AA 3H0DA 5KHDA 2ZJ2A 3QYFA 2ECCA 3KP6A 1Q1HA 3F6OA 2GOXB 3TEDA 2XB5A 3M3YJ 3H92A 2VODA 3HC7A 3MWMA 1BW5A 2V4JC 4C9YA 3C1DA 1U8BA 1CGPA 4G6QA 4KN7X 3GTOJ 2QSFX 4AUXA 3H5AA 1S9HA 4X6AJ 4M9XA 3FMRA 2IGKA 2X6YA 1U8RA 1TL8A 1ETOA 2F5CA 3CP8A 3LSPA 1NK3P 2R0QC 1OCZH 1O4XA 2HWVA 3GYHX 1BW6A 1FSEA 1B4AA 1W0TA 1U5TA 1MMNA 2KLOA 1O3QA 2BVMA 3M8JA 4ANJA 5FLMJ 3E97A 4A3GJ 4BQNA 4RB3C 1G59A 3OS0A 1D1BA 3R61A 4YRVA 1GDTA 4AYBA 1FOKA 4DJAA 3KP4A 2JPCA 5JLXA 3CDLA 5J6XA 1L0OC 4C3JJ 4I2OA 2EINH 4YIIA 1FTTA 1ON2A 1FSHA 2LYCA 3ZQCA 5FFZA 3BR2A 1R4NB 1SAUA 1G4DA 4PFOA 1MDMA 5ICGA 1X58A 4HF0A 5D5XB 4BNCA 3JTHA 1KQ9A 2JMWA 2X48A 1DP7P 3WU1B 2PMUA 1R5GA 2AHQA 2FRHA 2X1CA 2V1NA 4E70A 2DJNA 2XPWA 4C3HJ 5GAHJ 2OPTA 1RZ4A 3OL3A 4JX4A 3J7YJ 4CGZA 2HPMA 4EGZA 3OYFA 3QP5A 4WX9A 3QOPA 2VOPA 3DP7A 1SEUA 2W84A 3F21A 3L2VA 5DTDA 3QU3A 1EH6A 2D2WA 4A3LJ 2BGCA 3O6BB 2ETHA 2DYSH 1W1WE 1I27A 2DT6A 4GFBA 2VJIA 5EZGA 2X85A 1VTNC 2CQKA 2EQRA 1KU7A 5LHGA 2Z1DA 4Y52J 3JSPA 4G6DA 3SJMA 2ZSIB 3JR9A 4CCMA 4MIMA 4U7BA 2R5YB 4FASD 1GHCA 2DA5A 3GFMA 3BTJA 1MGTA 4A69C 5L3BA 1XD7A 3LSJA 3E7LA 4W1UA 1D8JA 4CSWA 3ZQLA 2W00A 3E5XA 4PSXA 2CQNA 2VL8A 2R7ZJ 2MGQA 3LQRA 1TC3C 2VXDA 3CP2A 4HBLA 1GVJA 1V5EA 3ABUA 4MTEA 5IP7J 4TV7A 4A0ZA 3F8MA 1G3SA 1QNTA 4N0BA 3GZNB 5ILSA 1SANA 5FKLA 2GXAA 4NC8A 1W7PA 1IDZA 5LHIA 4AIJA 3ZMDA 3CUQA 2VONA 5FLXK 5IPAA 5IYCJ 3G3ZA 3SEQA 2LKPA 3ROUA 3Q9SA 3JCUC 1SFXA 3V7SA 3WGHA 2Y30A 3O8HA 2YU9J 3HUGA 1FJLA 3EPZA 2Q2EA 2L4AA 5HDGA 3CCSI 3WTZA 1U9NA 3D5RC 3LSMA 5ED4A 2DDBA 2P81A 2K9MA 1GUUA 4A6EA 1ETKA 3N4MA 4BY1J 2LSOA 1MH4A 4S04A 1BR2A 1E3OC 2Q0OA 1IN7A 1I1GA 3DBHB 1KU3A 2YUSA 1E2XA 5DYMA 3TO7A 3TOBA 2O61A 3MFKA 1JUPA 1OYYA 5C4JJ 4LLLA 4BHBA 1BI1A 2IP2A 1OJLA 3K1MA 3U21A 2ICWG 4UUSB 1FBSA 2FU4A 3E3VA 4WXHA 2VE8A 2QLZA 1EV7A 4RLQA 1MBFA 5ILUA 2ESHA 3IKTA 4BE0A 3P5JA 1IN8A 2UUZA 1TT0A 3QQAA 3AL0C 1D5VA 1YFHA 2VT3A 4EEFG 3KETA 2DMUA 2CGPA 3Q0UA 1XMKA 4ZDOA 2WB1A 3KZZA 3I4NJ 2STTA 3ULQB 3LA7A 2EB7A 3V7RA 1Z6TA 3OYAA 3Q0WA 5D6FA 1DU6A 4L0YB 1UG2A 2XPUA 2NNNA 1OLTA 4BGDA 2VE9A 1H9TA 1X2NA 4I76A 4IHYA 3I3LA 3KYLA 3F8BA 1B8IB 4IKFA 1UHSA 3M7GA 2JA7J 2JPBA 3MMYB 2OV7A 3S16J 1R23A 1R6RA 1TNSA 4QSHA 1TT5B 2P8TA 4BBRJ 2NVQJ 4JBAA 3LMMA 1VQLI 5HDKA 2M8GX 1HW1A 2RAEA 2JSPA 3K4NA 3S32A 4ZYGA 5E20A 3LA2A 4ESBA 4RBOA 3EYIA 3BPXA 5HODA 2H6CA 4Y7NJ 2GA2A 1NH3A 3J7AO 2HS5A 4MQ9F 4OINF 1TBXA 3ZQFA 3BZCA 4B1RA 3KCCA 4KYWA 2JWTA 3M4OJ 1X1PA 3K2ZA 2IW5A 2W57A 4DW6A 5GADJ 3BR3A 1CF7B 1RUOA 5GPCA 1X3UA 2E1CA 1P7JA 4P96A 1J0RA 2DT7B 1KA8A 4PGHA 4PFPA 2DFIA 4XR6A 1TTYA 2YSRA 4IL6C 3RYRA 1V54H 1I3AA 4AM3A 5J47A 1N25A 1IJWC 2V1DA 3VODA 2BHYA 3A03A 3FBIB 2XDVA 1TZLA 4I09A 3BR5A 4LB6B 1D1AA 1G8XA 3BR1A 1YG2A 1IG7A 2MA3A 2ZMEC 1S3JA 9ANTA 3K4CA 2P6SA 4IQJA 4QPOA 1Z9CA 2DU9A 1IDYA 3KFWX 1Z7LA 3GLXA 5CQEA 2GXBA 4HAMA 3L09A 2DT5A 3I5UA 5LRSA 1APLC 4IJAA 1PP8F 1E3PA 4N4NB 2VQLA 5BQTA 3CJQB 5J40A 2KKOA 1W7PD 4YFXF 4M6XA 5KK1A 5HLGA 1MJAA 2KZVA 1MW7A 3BT9A 1WHUA 3HHGA 3JRGA 1KQ8A 3LNQA 1XSXA 2X9DA 1D3YA 1IZ1A 3GTLJ 2AXLA 2R4GA 3WTWC 4FE4A 3HYIA 1K79A 2JQ7A 2Z2SB 5DUIA 3K1NA 2LBFA 2DK5A 2H1KA 1R00A 2WY8Q 3GFIA 2F5FA 2CUEA 4D5FA 3MQ0A 2EIMH 4B43A 4Y13A 4OIOF 1GLNA 3L2UA 2DBBA 3FM5A 2QSHX 3L2CA 1KGSA 5HS8A 2GA1A 2I10A 5LHHA 1U9OA 2FBKA 2ZMEB 3V8LA 1HKSA 2QGUA 4IF4A 4M6VA 4PCQA 5DCMA 1MKMA 4AIKA 3HSFA 3GZ6A 3K70D 1YO5C 3IAS2 3GBGA 5D4SA 4BHCA 3DQVC 3ZQQA 5ICEA 4NQWB 3DKWA 3HRUA 4DQ2A 1O7LA 2XV4S 3KE2A 3DPLC 1H8AC 4MFDA 1XG1A 1IN6A 4XKCA 1I6HJ 2A07F 2PQ8A 1RKTA 5DM7F 2FQ3A 5B3SH 2BW3B 2V9VA 3QPHA 4XRSG 3ZQ7A 3I9V2 4P9FA 3VYTB 2GM4A 2DOFA 4DYQA 1CQTA 4IZZA 2DFFA 1YTYA 4UUVA 4RAZA 3TO6A 3DLLF 4LLGF 4ZYAA 1B6AA 4HNTA 1DDNA 3K70C 1ETXA 4XSZF 5FRMA 2HOEA 2KIFA 3C2GA 1SD6A 2W24A 5D6EA 3ASOH 1Y6IA 2HEOA 3FXMA 3RKXA 2DOEA 3KZIC 1RRJA 3HBLA 1SMTA 2ZJRF 3HZJA 1R71A 1E17A 5FLXZ 2QA4I 1S8NA 1ZAOA 2X1EA 4MEYF 4AIDA 1R58A 2DMNA 2ZNZA 2IRFG 3KLOA 5FRNA 3VB2A 3TDUC 1EJ9A 2IGNA 5E18F 1JTYA 2IS1A 2HKOA 2ME6A 2Q1ZB 3BLYA 4A3CJ 1RR7A 2FX0A 4G6TB 3ECHA 4RGSA 2ECBA 4I0BA 3WTSC 3OYKA 1OR7A 4NDLA 5E3LA 2UZKA 2IGOA 5CVJA 1R1TA 4XICA 3GW2A 2PX9A 4QIWN 1VQKI 1UFMA 1RKWA 3K0LA 2CQ7A 1XGMA 2NNYA 2IEKA 2Y9YA 3HM5A 4IO9F 3BG5A 1Y56A 1VQ4I 3CCMI 2B9SA 3COAC 1NTCA 3N05A 5FO5A 3VYSB 5EGOA 4BQAA 2EIKH 3P9IA 3BP8A 2DA4A 2HZDA 1RI7A 3BQYA 4E7IA 1JKRC 4QPQA 3JRFA 3FXOA 1P4WA 3U9GA 1TQIA 5GTHC 3CCJI 2LTPA 1AHDP 1REPC 1K7AA 2JUCA 1FBUA 1J7KA 3T0YA 1MD0A 3AG1H 2O9LA 2M87A 4UVBA 2FQ4A 1J2XA 2HXIA 4EJOA 4A3MJ 1K78A 3SYTA 3V42A 3CO6C 1ITYA 1VNDA 2VKVA 2P7VB 3HOSA 1OCRH 3I59B 2R7QA 4KJZA 3TW7A 3RKWA 2CV1A 2HDCA 2HZTA 2YR2A 3ZMVA 1EA3A 2WC2A 5CVUA 3ZMZA 5GAEJ 5BPIA 4BU2A 5E1XA 2IXSA 2MD0A 1HQCA 1QRYA 2ACJA 5J3LA 2W82A 3RI4A 3GVAA 2XUBA 4QTRA 5FJ8J 1FX7A 3ERMA 3RQIA 4A0YA 2GBYA 2BHZA 5GP9A 3JRBA 3BTCA 1ZLKA 4P1WA 1N78A 2GAUA 1PUFB 3FXQA 2STWA 1MIJA 3FXLA 3HB9A 1UCRA 1QPMA 3I4MJ 4XM3A 5LLQA 3S1RJ 2IA1A 2H09A 2W4SA 2CW8A 4U7DA 2JN6A 1NK2P 4N9IA 1MBHA 1P4AA 2DPUA 2LR8A 1FLIA 2PN6A 2HYFA 2JT1A 3FXUA 3E6DA 4BQOA 2K9NA 2E5ZA 4AC0A 1VQPI 1SFUA 2XC7A 2ESNA 3PO3J 4DBRA 2NRAC 2K3FA 2E19A 2M7BA 3HDDA 3KPHA 4RLFA 3FK6A 4M74A 1PJRA 2KP6A 4EATA 3FXJA 2HVQA 3OOPA 4M9SA 2ADUA 4FCYA 1STZA 1JJ6C 3A2KA 1HSJA 2WY7Q 3JREA 3S15J 5DV5A 3F72A 2GOMA 2GWRA 3MD2A 1XCVA 4X1EA 1J75A 2M0MA 1HDDC 2NOJB 3IHUA 5ERIA 2PJRB 2WV0A 2HDWA 3WTYC 4LK1F 1T08B 2GZWA 5L3FA 2K4BA 2V1UA 1N75A 3E5QA 3V8JA 4ZYEA 4A3BJ 2CS3A 4HX8A 1Y8QB 3I55I 2WADA 4G9YA 3VSKA 4A5MA 3RDIA 1BIBA 2R92J 3RPUA 2E7XA 4Z2YA 1YIJI 3A02A 5HDNA 3G2BA 1ZREA 5BPDA 2V9PA 4X0GA 3TW6A 2QEXI 2Z33A 1U0JA 2BXYA 2JSCA 2JUGA 5J8FA 3H9JA 1S7OA 1WCMJ 4Y3OA 1FWZA 3Q3SA 4I7HA 3DPUA 3RQ4A 2FNAA 5IT3A 3ML6A 3FX3A 2A6HF 2EIJH 4HEA2 4I02A 4KIFA 4A3EJ 4OAYA 3U2RA 3WGIA 4ZJZA 4CH7A 5FD5A 4BACA 1SVMA 4L9NA 1KONA 3K4LA 3SFZA 4PJMA 2VBWA 4LG0B 2PG4A 2CFXA 2DYRH 4ESJA 1BI2A 3K4JA 3REOA 4GRIA 2XAQA 1LE8B 1BL0A 4A3IJ 1R1UA 4ENNA 3S1QJ 4MTDA 5CKTA 3FMSA 4NBQA 2W48A 3KEQA 4AU7A 4KICA 1W0UA 1F5TA 3FXKA 2JA6J 2DA1A 1YW7A 4NC6A 4A0XA 4IRHA 1QVTA 4GCVA 5HS7A 3IP4B 2LY9A 2XVCA 3EETA 2KISA 1XDSA 2DMPA 1T98A 3AG2H 2VC0A 4BJ5C 3ABLH 4A3KJ 1O57A 1OCCH 1LFPA 1J9IA 1FIPA 2X51A 3RCOA 1WJDA 1FYLA 2HYGD 3P9KA 2JA2A 3FXRA 3CESA 2IT0A 3H5NA 2EZIA 1PYVA 1QQIA 4DZPA 4EM1A 5E1ZB 3E6BA 1G3TA 4L9VA 3AKZA 1MMSA 4EVIA 1T39A 3H0GJ 3HOXJ 2OCCH 4LFUA 1T38A 3CLQA 4EJUA 3JSOA 4U0WA 4RDUA 4M9ZA 1ZRFA 4GYIA 2FBHA 4LGWA 2L7KA 2A61A 4BH9A 1T0FC 4Q48A 3S8PA 4ZZLA 2MLKA 3DXJF 2KJBA 1B72A 2F2EA 3OYLA 4UB8C 2V26A 1YRNA 1WQ2A 1WI3A 3FMQA 2DOAA 2E1OA 4M73A 1IC8A 2A05A 1YJNI 2AO9A 3K4KA 2ME0A 3FISA 1Z67A 2V1XA 1ORKA 5M3MJ 1SVLA 2JTVA 3BZKA 3ZMUA 1WI9A 1JJ8C 3QODA 3HOVJ 3HGYA 3L2QA 4B47A 2MYSA 3GTGJ 2X6OA 5IT9K 5L3EA 1S6LA 3ZR8X 4WF2A 3K7AJ 3MEXA 3K10A 4M3EA 5EZHA 2R7VA 5E3NA 4U0YA 1TWHJ 3FHZA 4IEJA 4IRIA 1S7EA 3CC4I 1D8KA 2PFBA 5FKNA 1FOYA 2DA2A 2VPRA 3EUHC 1WJBA 2G7UA 3F8CA 4M3FA 3WE3A 1G2HA 3MN2A 1FMWA 2K02A 3ZQIA 1AKHB 2ID3A 3CDHA 2H8WA 4F55A 3OYGA 4RAGA 4OOIA 4FTHA 4NB5A 5BS6A 2M9HA 2IS4A 2XAFA 2X4HA 4LOCA 1ZN2A 3M1CA 4V2FA 3GUDA 3T1BA 2FE3A 3CJTB 2DI3A 1TQMA 5LGNA 4P55A 2BYVE 3HOTA 1YX3A 1BJAA 5H6RA 3JRCA 2K40A 2KQRA 3FF5A 2CWEA 3LSIA 4ZYDA 1A6QA 2QYOA 2R5ZB 2L9VA 2VT2A 3TMOA 2E2JJ 1XSDA 5E3MA 3AG3H 3BG7A 1FOXA 2EZHA 2JVHA 3D5SC 3GO5A 1IUFA 1Z3YA 2OTLI 3JRDA 4G8XA 2P4WA 3PSFA 5L3DA 1YJ9I 4XQFA 2EH3A 2QKLB 3IV5A 1JKQC 2A6TA 3KYCB 3HRMA 3I71A 3HEFA 4MGRA 1EH8A 1Z7UA 3CF2A 2MABA 2CUJA 3HXLA 1A31A 2NS0A 3HRTA 1D5YA 2K9SA 1QZZA 1YS6A 2LREA 2LFBA 1R4MB 3TP0A 3J7AY 2BVLA 2V6EA 2DPDA 3ZQHA 2M4KA 2K9QA 2XAJA 3IKVA 4AD9A 2BZTA 2Z5UA 2BV6A 1X1BA 2M5WA 3WTTC 2H1LA 2RQPA 2VIXA 3CZ6A 1GV2A 1TWCJ 4C2UA 3EYYA 3DKYA 5F1RA 2DA7A 5KVRA 5D8LB 3LAPA 1OCTC 3I54A 2FBIA 2HQAA 3HOUJ 5M5YJ 4HQEA 2ZFWA 3ONQA 1X2MA 2LC2A 3SFIA 3WG7H 1RIOH 3E1SA 2ZKZA 3IRQA 1Q1VA 1HW5A 2RQQA 1QZYA 2BE5F 1YITI 1XB4A 1X3WB 3MCZA 3HTSB 2XF5A 2M2EA 3D1NI 3VPRA 1POGA 1U6GA 4XLNF 2CUFA 3HIFA 2QENA 4D9JA 2ID6A 2OQGA 3KP7A 3CCQI 2EFPA 3NEUA 2LOOA 1U2WA 5E8GA 4DYRA 3EDPA 2QZ8A 1KQ0A 4EMSA 1KZHA 3SZGA 1X1CA 2GLOA 3KP3A 4XIDA 5A2QK 3NQOA 1HC8A 3PNVA 1LKXA 4KNYA 4EQQA 2QBYB 2HQNA 2LRDA 1G6NA 2X0LA 3AG4H 1TP4A 4XKVA 3L7WA 1LPQA 3LOCA 1S72I 3NAUA 1PUEE 4HQMA 1Z6RA 5EG0B 4WK8F 1PP7U 2RNJA 1FP1D 2HI3A 3VYUB 3ABTA 3BJAA 4IQ4A 1WJAA 4IHVA 4M3DA 2XF7A 4UVAA 2P5KA 2YX7A 4GO1A 2Y9ZA 2P7CB 1WJCA 4XLAA 2VUMJ 4HF2A 2XIGA 3ZN0A 5D5UB 2XB0X 2Y48A 4RGRA 3DEUA 4UVCA 4ZDLA 2VBYA 3J81K 3I56I 4UUTA 3K69A 5CVVA 1R22A 2ISYA 1YI2I 4RM3A 1FTZA 2Y0MA 4HDUA 2A69F 4CYDA 5AONA 5GPAA 3U1DA 1X19A 2WAQN 1MJBA 4BE1A 3SHFA 5M5WJ 1XN7A 2BY0A 3VEPA 4JK1X 4UB6C 3Q9VA 1W5SA 4BAYA 3L9FA 2O7OA 4JYKA 3X2QH 3HRSA 3C7JA 3BTIA 5FD6A 2M7AA 1YW9A 3H9GA 1GXPA 3QYBA 2EV0A 3BR6A 4BEHA 3L00A 5DS9A 4UHTA 2HFHA 5JVGF 2JA8J 5K7HA
chains in the Genus database with same CATH topology
5F27A 2DMQA 2DN0A 4JP0A 2LD5A 4CYCA 1NTCA 3S1NJ 1ZKGA 2M0CA 5EGOA 1Z0XA 4XK4A 2DA4A 3MVPA 3A01A 2DA3A 3BQYA 1JKRC 3JRFA 2XGDA 1AU7A 4G12A 2XSDC 2MW8A 1AHDP 2LTPA 1FIAA 4BY7J 3CCYA 2CU7A 3NARA 1VI0A 2NVYJ 2HOAA 1T56A 1IGNA 2O9LA 1GVDA 4J19A 5EG0A 1WGXA 2FQ4A 4MLOA 1ZR2A 2HXIA 4A3MJ 4C3IJ 3PO2J 2HXOA 1QPIA 5F1JA 1ITYA 1VFCA 1VNDA 5FKMA 3S14J 1HF0A 2VKVA 2NS8A 3LSRA 5BNGA 3TW7A 3GTJJ 1HLVA 1F43A 2LVSA 5FKKA 2HOSA 2EZLA 2EZKA 2L9RA 2M34A 2XRLA 1QRYA 5J3LA 2NVTJ 3GTMJ 4QTRA 1XS9A 5FJ8J 3CQZJ 5M3FJ 3S1MJ 3RQIA 2GBYA 5GP9A 5J1RA 3JRBA 3OSGA 3BTCA 2ELKA 2ECCA 5FKOA 1HCRA 2H8RA 3TEDA 1PUFB 2XB5A 3M3YJ 1RESA 3BQZA 3HB9A 1BW5A 3I4MJ 3S1RJ 1U8BA 1JKPC 3GTOJ 2JN6A 1NK2P 4AUXA 4L5EA 1MBHA 3JRHA 4X6AJ 2LR8A 4A3FJ 5J1YA 1LFBA 3QPLA 3W6VA 1VF9A 2K9NA 1ETOA 1NK3P 3LSPA 1BJZA 4AC0A 4HNVA 2R0QC 1O4XA 1ZQ3P 3PO3J 1BW6A 3FIWA 2E19A 3HDDA 2VI6A 1W0TA 4JX6A 5IP9J 1ETWA 3FK6A 3BG3A 2HQ5A 3HOZJ 4FCYA 1JUMA 5FLMJ 1JJ6C 4A3GJ 1GDTA 2Y2ZA 2HDDA 3JREA 3S15J 5JLXA 3LSGA 3CDLA 3SDGA 2E2HJ 4C3JJ 1BA5A 1FTTA 4M3GA 4X1EA 1HDDC 3ZQCA 2NOGA 2CJJA 3BR2A 4S0HB 3S2HJ 1X58A 1R9TJ 1P7IA 2JMWA 3L1PA 2X48A 4A3BJ 1Z77A 3OSFA 2AHQA 2DJNA 2XPWA 4C3HJ 2MSYA 2OPTA 4JX4A 1B72B 3FK7A 2R92J 4DYCA 4FISA 1YRNB 2DTZA 3PM1A 2N8GA 3A02A 2R93J 3RZDJ 3TW6A 1MBJA 3OOUA 5DTDA 3G1LA 4D5CA 4A3LJ 1WCMJ 5EF6A 3CMYA 3Q3SA 2DMTA 2CRGA 2TRTA 4GFBA 1K83J 2NVXJ 5EZGA 4IHXA 4A3EJ 2EQRA 5IYDJ 4Y52J 4XRMA 3SJMA 1PUFA 3JR9A 2DA6A 2L7ZA 1ZTRA 1WH7A 4MIMA 2R5YB 2DA5A 3O8GA 3BTJA 4A69C 1LE8B 1BL0A 4A3IJ 3S1QJ 1GV5A 3LSJA 2W48A 3E7LA 3HKZN 4W1UA 3BTLA 3ZQLA 1W0UA 1OFCX 4V2GA 2JA6J 2DA1A 1JUSA 2LP0A 3DEWA 2R7ZJ 2MGQA 4JX5A 1A5JA 1IRZA 2XGEA 1QVTA 1TC3C 1OCPA 2LY9A 3OIOA 4XRSA 4FE7A 2DMPA 5IP7J 3ZOBA 4A3KJ 4MO7A 1FIPA 1SANA 5FKLA 4AYBN 1IDZA 2HOTA 1K61A 3IH3A 2EZIA 1IV6A 5M5XJ 4DZPA 5K7FA 4BKXA 4M3BA 5IPAA 5IYCJ 1I3QJ 5IP6A 2O8KA 3JRIA 3H0GJ 3GTKJ 3HOXJ 3S2DJ 2YU9J 2Y30A 1I50J 3O8HA 4RDUA 1FJLA 2L0KA 1U9NA 2D5VA 2P81A 2QCOA 1GUUA 5F0FA 1ETKA 4BY1J 1MH4A 2COBA 4DZJA 1B72A 2E2IJ 1YRNA 5JLWA 1WI3A 1E3OC 2E1OA 2YUSA 1IC8A 1MH3A 2AO9A 4C2MJ 2ME0A 3FISA 2XGCA 1ORKA 1JTXA 5M3MJ 1JJ8C 1JUPA 3HOVJ 3HGYA 5C4JJ 3GTGJ 1OJLA 2X6OA 4ABZA 3G1OA 5F04A 4UUSB 3K7AJ 4M3EA 5EZHA 5IOZA 5E3NA 2R5YA 3TP3A 1TWHJ 3Q0VA 4IEJA 1S7EA 1MBFA 5FKNA 1LE8A 5FLVA 2NS7A 2VPRA 2DA2A 1ZR4A 3QQAA 1JGGA 1MNMC 4EEFG 4A93J 2DMUA 1T33A 3Q0UA 4M3FA 1G2HA 3MN2A 3MKLA 3I4NJ 2EBIA 3ZQIA 5C3EJ 1AKHB 2ID3A 3Q0WA 5E3OA 1DU6A 1UG2A 2XPUA 4FTHA 3RKQA 2M9HA 1X2NA 4I76A 4LOCA 4B3AA 4IHYA 4V2FA 4IHWA 1Y1WJ 5F0HA 1B8IB 2JA7J 1UHSA 1ETVA 3S16J 1WPKA 4QSHA 3JRCA 2K40A 1MBGA 2R5ZB 4BBRJ 1SFOJ 2NVQJ 1XC5A 2E2JJ 2M8GX 2RAEA 2VKEA 5E3MA 4RBOA 2EZHA 5HODA 3C2BA 4Y7NJ 5IYBJ 3FKIJ 4D7NA 1IUFA 1MSFC 3ZQFA 4B1RA 3JRDA 2JWTA 4MFEA 1GT0C 3GTQJ 3M4OJ 4DW6A 3BR3A 5GPCA 5C44J 1P7JA 2EH3A 5F08A 3IV5A 1TWGJ 1JKQC 2JA5J 1DU0A 3B6AA 3HEFA 1A6IA 1ZK8A 1UMQA 2MG4A 1IJWC 2L7FP 3A03A 5K7ZA 1H89C 4BXXJ 3BR5A 3BR1A 1D5YA 1TWFJ 2K9SA 1IG7A 2JJ7A 2LFBA 1JT6A 3IH4A 3TP0A 9ANTA 3ZQHA 5C4XJ 1QVUA 2K9QA 3GTPJ 4UUSA 1FEXA 1IDYA 1APLC 2IBDA 1GV2A 3BG9A 1TWCJ 3G1MA 1Y1VJ 2OF7A 2DA7A 3IH2A 1H88C 3BT9A 1OCTC 2JK3A 3HOUJ 5M5YJ 2WB1N 3JRGA 3LNQA 1X2MA 2X9DA 3SFIA 4I6ZA 3GTLJ 2ZB9A 1AKHA 4B4CA 4FE4A 1Q1VA 3UKGA 2H1KA 2M2EA 2LLKA 3D1NI 2CUEA 3VPRA 1POGA 4D5FA 1B8IA 2CUFA 2L7MP 1ETQA 1RETA 2ID6A 3HOWJ 4CYCB 1U78A 2I10A 4DYRA 1U9OA 2R5ZA 3S17J 4M6VA 3ZQGA 5EGOB 2XPVA 2GLOA 1ENHA 3A01B 2HYJA 4XIDA 2LKXA 3GBGA 2QF7A 2FD5A 4A3DJ 1MBEA 1H8AC 3JRAA 4MFDA 1XG1A 1I6HJ 2CQXA 1MSEC 1RKTA 2KT0A 2FJ1A 3LOCA 1RPWA 4XRSG 1F36A 3NAUA 2IAIA 5F0CA 3WHCA 5EG0B 2GM4A 2HI3A 4DYQA 1CQTA 5EDNA 2KDZA 2YS9A 3B6CA 2Y31A 3RZOJ 4IHVA 4M3DA 1ETXA 2Y9ZA 2PMZN 3QPSA 2VUMJ 2XB0X 1MBKA 5IOYA 4BBSJ 2CQQA 3HBLA 1ZGWA 4W97A 4UUTA 5EEAA 2B63J 3HGGA 5J1UA 2DMNA 1JT0A 1FTZA 2G0EA 3BR0A 1TWAJ 5GPAA 1HOMA 1JTYA 2WAQN 3HOYJ 5M5WJ 2ME6A 4A3CJ 1RR7A 2FX0A 3DCFA 5EYRA 1HDPA 2LK2A 2O7OA 2ECBA 4JYKA 2TCTA 3BTIA 3K2AA 1JKOC 1WH5A 4NDLA 5E3LA 1EF4A 4XICA 2WV1A 3F0CA 4D7MA 4QIWN 2Y0SN 3H3VK 3BR6A 4A3JJ 1ETYA 1RKWA 5DS9A 1LFUP 3WHBA 2IEKA 2Y9YA 2JA8J 3HM5A 5K7HA 3BG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F27 A;  2DMQ A;  2DN0 A;  4JP0 A;  2LD5 A;  4CYC A;  1NTC A;  3S1N J;  1ZKG A;  2M0C A;  5EGO A;  1Z0X A;  4XK4 A;  2DA4 A;  3MVP A;  3A01 A;  2DA3 A;  3BQY A;  1JKR C;  3JRF A;  2XGD A;  1AU7 A;  4G12 A;  2XSD C;  2MW8 A;  1AHD P;  2LTP A;  1FIA A;  4BY7 J;  3CCY A;  2CU7 A;  3NAR A;  1VI0 A;  2NVY J;  2HOA A;  1T56 A;  1IGN A;  2O9L A;  1GVD A;  4J19 A;  5EG0 A;  1WGX A;  2FQ4 A;  4MLO A;  1ZR2 A;  2HXI A;  4A3M J;  4C3I J;  3PO2 J;  2HXO A;  1QPI A;  5F1J A;  1ITY A;  1VFC A;  1VND A;  5FKM A;  3S14 J;  1HF0 A;  2VKV A;  2NS8 A;  3LSR A;  5BNG A;  3TW7 A;  3GTJ J;  1HLV A;  1F43 A;  2LVS A;  5FKK A;  2HOS A;  2EZL A;  2EZK A;  2L9R A;  2M34 A;  2XRL A;  1QRY A;  5J3L A;  2NVT J;  3GTM J;  4QTR A;  1XS9 A;  5FJ8 J;  3CQZ J;  5M3F J;  3S1M J;  3RQI A;  2GBY A;  5GP9 A;  5J1R A;  3JRB A;  3OSG A;  3BTC A;  2ELK A;  2ECC A;  5FKO A;  1HCR A;  2H8R A;  3TED A;  1PUF B;  2XB5 A;  3M3Y J;  1RES A;  3BQZ A;  3HB9 A;  1BW5 A;  3I4M J;  3S1R J;  1U8B A;  1JKP C;  3GTO J;  2JN6 A;  1NK2 P;  4AUX A;  4L5E A;  1MBH A;  3JRH A;  4X6A J;  2LR8 A;  4A3F J;  5J1Y A;  1LFB A;  3QPL A;  3W6V A;  1VF9 A;  2K9N A;  1ETO A;  1NK3 P;  3LSP A;  1BJZ A;  4AC0 A;  4HNV A;  2R0Q C;  1O4X A;  1ZQ3 P;  3PO3 J;  1BW6 A;  3FIW A;  2E19 A;  3HDD A;  2VI6 A;  1W0T A;  4JX6 A;  5IP9 J;  1ETW A;  3FK6 A;  3BG3 A;  2HQ5 A;  3HOZ J;  4FCY A;  1JUM A;  5FLM J;  1JJ6 C;  4A3G J;  1GDT A;  2Y2Z A;  2HDD A;  3JRE A;  3S15 J;  5JLX A;  3LSG A;  3CDL A;  3SDG A;  2E2H J;  4C3J J;  1BA5 A;  1FTT A;  4M3G A;  4X1E A;  1HDD C;  3ZQC A;  2NOG A;  2CJJ A;  3BR2 A;  4S0H B;  3S2H J;  1X58 A;  1R9T J;  1P7I A;  2JMW A;  3L1P A;  2X48 A;  4A3B J;  1Z77 A;  3OSF A;  2AHQ A;  2DJN A;  2XPW A;  4C3H J;  2MSY A;  2OPT A;  4JX4 A;  1B72 B;  3FK7 A;  2R92 J;  4DYC A;  4FIS A;  1YRN B;  2DTZ A;  3PM1 A;  2N8G A;  3A02 A;  2R93 J;  3RZD J;  3TW6 A;  1MBJ A;  3OOU A;  5DTD A;  3G1L A;  4D5C A;  4A3L J;  1WCM J;  5EF6 A;  3CMY A;  3Q3S A;  2DMT A;  2CRG A;  2TRT A;  4GFB A;  1K83 J;  2NVX J;  5EZG A;  4IHX A;  4A3E J;  2EQR A;  5IYD J;  4Y52 J;  4XRM A;  3SJM A;  1PUF A;  3JR9 A;  2DA6 A;  2L7Z A;  1ZTR A;  1WH7 A;  4MIM A;  2R5Y B;  2DA5 A;  3O8G A;  3BTJ A;  4A69 C;  1LE8 B;  1BL0 A;  4A3I J;  3S1Q J;  1GV5 A;  3LSJ A;  2W48 A;  3E7L A;  3HKZ N;  4W1U A;  3BTL A;  3ZQL A;  1W0U A;  1OFC X;  4V2G A;  2JA6 J;  2DA1 A;  1JUS A;  2LP0 A;  3DEW A;  2R7Z J;  2MGQ A;  4JX5 A;  1A5J A;  1IRZ A;  2XGE A;  1QVT A;  1TC3 C;  1OCP A;  2LY9 A;  3OIO A;  4XRS A;  4FE7 A;  2DMP A;  5IP7 J;  3ZOB A;  4A3K J;  4MO7 A;  1FIP A;  1SAN A;  5FKL A;  4AYB N;  1IDZ A;  2HOT A;  1K61 A;  3IH3 A;  2EZI A;  1IV6 A;  5M5X J;  4DZP A;  5K7F A;  4BKX A;  4M3B A;  5IPA A;  5IYC J;  1I3Q J;  5IP6 A;  2O8K A;  3JRI A;  3H0G J;  3GTK J;  3HOX J;  3S2D J;  2YU9 J;  2Y30 A;  1I50 J;  3O8H A;  4RDU A;  1FJL A;  2L0K A;  1U9N A;  2D5V A;  2P81 A;  2QCO A;  1GUU A;  5F0F A;  1ETK A;  4BY1 J;  1MH4 A;  2COB A;  4DZJ A;  1B72 A;  2E2I J;  1YRN A;  5JLW A;  1WI3 A;  1E3O C;  2E1O A;  2YUS A;  1IC8 A;  1MH3 A;  2AO9 A;  4C2M J;  2ME0 A;  3FIS A;  2XGC A;  1ORK A;  1JTX A;  5M3M J;  1JJ8 C;  1JUP A;  3HOV J;  3HGY A;  5C4J J;  3GTG J;  1OJL A;  2X6O A;  4ABZ A;  3G1O A;  5F04 A;  4UUS B;  3K7A J;  4M3E A;  5EZH A;  5IOZ A;  5E3N A;  2R5Y A;  3TP3 A;  1TWH J;  3Q0V A;  4IEJ A;  1S7E A;  1MBF A;  5FKN A;  1LE8 A;  5FLV A;  2NS7 A;  2VPR A;  2DA2 A;  1ZR4 A;  3QQA A;  1JGG A;  1MNM C;  4EEF G;  4A93 J;  2DMU A;  1T33 A;  3Q0U A;  4M3F A;  1G2H A;  3MN2 A;  3MKL A;  3I4N J;  2EBI A;  3ZQI A;  5C3E J;  1AKH B;  2ID3 A;  3Q0W A;  5E3O A;  1DU6 A;  1UG2 A;  2XPU A;  4FTH A;  3RKQ A;  2M9H A;  1X2N A;  4I76 A;  4LOC A;  4B3A A;  4IHY A;  4V2F A;  4IHW A;  1Y1W J;  5F0H A;  1B8I B;  2JA7 J;  1UHS A;  1ETV A;  3S16 J;  1WPK A;  4QSH A;  3JRC A;  2K40 A;  1MBG A;  2R5Z B;  4BBR J;  1SFO J;  2NVQ J;  1XC5 A;  2E2J J;  2M8G X;  2RAE A;  2VKE A;  5E3M A;  4RBO A;  2EZH A;  5HOD A;  3C2B A;  4Y7N J;  5IYB J;  3FKI J;  4D7N A;  1IUF A;  1MSF C;  3ZQF A;  4B1R A;  3JRD A;  2JWT A;  4MFE A;  1GT0 C;  3GTQ J;  3M4O J;  4DW6 A;  3BR3 A;  5GPC A;  5C44 J;  1P7J A;  2EH3 A;  5F08 A;  3IV5 A;  1TWG J;  1JKQ C;  2JA5 J;  1DU0 A;  3B6A A;  3HEF A;  1A6I A;  1ZK8 A;  1UMQ A;  2MG4 A;  1IJW C;  2L7F P;  3A03 A;  5K7Z A;  1H89 C;  4BXX J;  3BR5 A;  3BR1 A;  1D5Y A;  1TWF J;  2K9S A;  1IG7 A;  2JJ7 A;  2LFB A;  1JT6 A;  3IH4 A;  3TP0 A;  9ANT A;  3ZQH A;  5C4X J;  1QVU A;  2K9Q A;  3GTP J;  4UUS A;  1FEX A;  1IDY A;  1APL C;  2IBD A;  1GV2 A;  3BG9 A;  1TWC J;  3G1M A;  1Y1V J;  2OF7 A;  2DA7 A;  3IH2 A;  1H88 C;  3BT9 A;  1OCT C;  2JK3 A;  3HOU J;  5M5Y J;  2WB1 N;  3JRG A;  3LNQ A;  1X2M A;  2X9D A;  3SFI A;  4I6Z A;  3GTL J;  2ZB9 A;  1AKH A;  4B4C A;  4FE4 A;  1Q1V A;  3UKG A;  2H1K A;  2M2E A;  2LLK A;  3D1N I;  2CUE A;  3VPR A;  1POG A;  4D5F A;  1B8I A;  2CUF A;  2L7M P;  1ETQ A;  1RET A;  2ID6 A;  3HOW J;  4CYC B;  1U78 A;  2I10 A;  4DYR A;  1U9O A;  2R5Z A;  3S17 J;  4M6V A;  3ZQG A;  5EGO B;  2XPV A;  2GLO A;  1ENH A;  3A01 B;  2HYJ A;  4XID A;  2LKX A;  3GBG A;  2QF7 A;  2FD5 A;  4A3D J;  1MBE A;  1H8A C;  3JRA A;  4MFD A;  1XG1 A;  1I6H J;  2CQX A;  1MSE C;  1RKT A;  2KT0 A;  2FJ1 A;  3LOC A;  1RPW A;  4XRS G;  1F36 A;  3NAU A;  2IAI A;  5F0C A;  3WHC A;  5EG0 B;  2GM4 A;  2HI3 A;  4DYQ A;  1CQT A;  5EDN A;  2KDZ A;  2YS9 A;  3B6C A;  2Y31 A;  3RZO J;  4IHV A;  4M3D A;  1ETX A;  2Y9Z A;  2PMZ N;  3QPS A;  2VUM J;  2XB0 X;  1MBK A;  5IOY A;  4BBS J;  2CQQ A;  3HBL A;  1ZGW A;  4W97 A;  4UUT A;  5EEA A;  2B63 J;  3HGG A;  5J1U A;  2DMN A;  1JT0 A;  1FTZ A;  2G0E A;  3BR0 A;  1TWA J;  5GPA A;  1HOM A;  1JTY A;  2WAQ N;  3HOY J;  5M5W J;  2ME6 A;  4A3C J;  1RR7 A;  2FX0 A;  3DCF A;  5EYR A;  1HDP A;  2LK2 A;  2O7O A;  2ECB A;  4JYK A;  2TCT A;  3BTI A;  3K2A A;  1JKO C;  1WH5 A;  4NDL A;  5E3L A;  1EF4 A;  4XIC A;  2WV1 A;  3F0C A;  4D7M A;  4QIW N;  2Y0S N;  3H3V K;  3BR6 A;  4A3J J;  1ETY A;  1RKW A;  5DS9 A;  1LFU P;  3WHB A;  2IEK A;  2Y9Y A;  2JA8 J;  3HM5 A;  5K7H A;  3BG5 A; 
#chains in the Genus database with same CATH topology
 5F27 A;  2DN0 A;  3OYH A;  4CYC A;  2LD5 A;  4J01 A;  5K5Q A;  1IRF A;  2G7H A;  1U5T B;  5DM6 F;  4YIR X;  1Z0X A;  4XK4 A;  4IOC F;  3MVP A;  3A01 A;  5IT9 Z;  1MJ9 A;  2DA3 A;  4V19 K;  3HSE A;  2A5Y B;  4LG3 A;  2HGC A;  2UXX A;  3GFJ A;  2O5R A;  2ZC2 A;  1H9G A;  3VFZ A;  3L2W A;  1IUY A;  1FIA A;  4BY7 J;  4DOZ A;  3R4K A;  3NAR A;  4GXO A;  2HOA A;  2FMY A;  3F8F A;  2I8D A;  4ZH4 F;  1ZH5 A;  2BEO A;  2VBZ A;  3RTR A;  4J19 A;  3J7Z I;  4MLO A;  2RKH A;  4F52 A;  1LDD A;  1MDM B;  1QPI A;  2Y69 H;  2IS6 A;  3KZY A;  3S14 J;  3FZV A;  2GXG A;  2NS8 A;  4ASN A;  2FA5 A;  5BNG A;  3H35 A;  1HLV A;  3M1E A;  4OMY A;  1F43 A;  2LVS A;  2KIU A;  5FKK A;  3TKY A;  2EZK A;  2DXI A;  2M34 A;  2XRL A;  3BC8 A;  1UST A;  3BCB A;  3TOA A;  3RIR A;  1ERD A;  4WCG A;  1XS9 A;  3CQZ J;  3CUQ C;  3A0B C;  4NUB A;  3L2R A;  1VQ9 I;  2EFO A;  2MH2 A;  1WJ5 A;  4LMY A;  1V3F A;  5TGT A;  5FKO A;  1HCR A;  2HU9 A;  1B9M A;  2H8R A;  4YG2 F;  3ABM H;  5LFA A;  1RES A;  3CUO A;  3BQZ A;  4KT5 C;  4NNJ A;  3QP6 A;  3JAM K;  2IS2 A;  1IO2 A;  2VB6 A;  1JKP C;  1FT9 A;  5K1Y A;  5FFX A;  1UB9 A;  3FDY A;  3QRF F;  4L5E A;  3HJE A;  5HLH A;  3I64 A;  1IF1 A;  1UAA A;  3QWL A;  4HNV A;  1P6R A;  1ZQ3 P;  3FIW A;  1A36 A;  2P6T A;  2VI6 A;  2KDO A;  3ZXS A;  3BDD A;  2DFH A;  1ETW A;  1HST A;  1BN5 A;  2CH0 A;  3U1K A;  2J5O A;  4CUG A;  3BG3 A;  1AWC A;  2EV6 A;  3K1P A;  4L5I A;  3HOZ J;  2HDD A;  2Y2Z A;  1W7P B;  4XRF A;  2OCE A;  3GF2 A;  4QWQ A;  3OYE A;  3CUQ B;  2LNB A;  1RR8 C;  4HSR A;  3LSG A;  5CLS A;  2E2H J;  4IRG A;  3MZ8 A;  3I4P A;  3TGN A;  2CJJ A;  2TDX A;  4FET A;  3CO7 C;  4S0H B;  1O3S A;  3H1C A;  4HV6 A;  2R7O A;  2MC4 A;  1W36 D;  3HUG B;  1R5H A;  4OAZ A;  4KFC A;  2Q2E B;  1HXD A;  3L1P A;  1BI0 A;  1Z77 A;  4ENK A;  2I5U A;  1ZG3 A;  3OSF A;  1JI8 A;  5HVQ C;  5K5R A;  4MEX F;  1T95 A;  1Z21 A;  3ABK H;  2HNH A;  4DYC A;  3P7N A;  2A68 F;  2DTZ A;  1BI3 A;  3PM1 A;  4XN0 A;  1TW2 A;  3GME A;  3ZP5 A;  2ZXH A;  2R93 J;  3RZD J;  2QWW A;  1MBJ A;  3OOU A;  1SD4 A;  3FWE A;  4XBF A;  3G1L A;  4D5C A;  4C2T A;  1VQO I;  2FNP A;  2ZO4 A;  2QQ9 A;  2DMT A;  3I0T A;  2CRG A;  3AFH A;  1W36 C;  2VLA A;  5A2Q Z;  3F8N A;  1K83 J;  2BY1 A;  2Z16 A;  1Y0N A;  3CCV I;  4HST A;  2W25 A;  5IYD J;  1ODD A;  4XRM A;  2VQC A;  1IXS B;  1KU2 A;  2M8E A;  1I6X A;  2F5D A;  1ZGJ A;  2L9S A;  1GXQ A;  3O8G A;  2E60 A;  5ICC A;  4ETS A;  2PLY A;  1JGS A;  5B1B H;  1OKR A;  5JHU A;  1I1S A;  2HPI A;  3GZ5 A;  4XLF A;  1BC8 C;  4XLE A;  3DFG A;  1GV5 A;  1IW7 F;  2VQG A;  3HKZ N;  4U88 A;  3ZMS A;  2L3D A;  4F3Q A;  3BTL A;  4D1Q A;  2KRH A;  2OZ6 A;  5LBQ A;  4V2G A;  1MND A;  4HLY A;  1JUS A;  4O6J A;  2LP0 A;  3DEW A;  2K9L A;  4U87 A;  1IRZ A;  1TLH B;  2A5W A;  1OCP A;  1QHH D;  3VDX A;  3OIO A;  2K7L A;  4XRS A;  3CJN A;  4OU0 A;  4CO8 A;  4QLC U;  3A4C A;  5L3C A;  2E35 A;  4M71 A;  3ZOB A;  2E34 A;  2AXT C;  4ZTF A;  3GFL A;  3BJ6 A;  4RB2 C;  4MO7 A;  4FT8 A;  1V5F A;  4R1H A;  3H9Q A;  2ISZ A;  3J81 Z;  3G6E I;  1K61 A;  4G7Z F;  2CUZ A;  1IV6 A;  5TRD A;  5D5V B;  1XMA A;  5KCM A;  4KN4 X;  4BKX A;  1I3Q J;  3H3Z A;  5IP6 A;  2O8K A;  2MD5 A;  3JRI A;  3GTK J;  3ZMT A;  3W6J B;  2M30 A;  4GGG A;  4RB0 A;  1P4X A;  2E5N A;  3S2D J;  2E7W A;  3UNG C;  4RM2 A;  4Q5S F;  2Z99 A;  1VQM I;  5F64 A;  3HPG A;  3SQN A;  4O3M A;  2J5P A;  3C18 A;  1DPU A;  1FY7 A;  2L0K A;  2XAH A;  2DJI A;  3VOE A;  2ZXI A;  2QCO A;  4HPQ A;  2YPR A;  2DQL A;  4B3X A;  1LVA A;  2COB A;  4DZJ A;  2E2I J;  1T8I A;  1SVO A;  5JLW A;  5BOX A;  3KEO A;  5E17 F;  3F6V A;  2ZXJ A;  3ESW B;  4EJV A;  3OYC A;  3C2H A;  3O3K A;  1B1B A;  1MH3 A;  1IXC A;  3GCM A;  4P5O A;  1D0X A;  3S3O A;  3F3X A;  2XGC A;  2D45 A;  2V7F A;  4GYG A;  1K4T A;  1USS A;  2FML A;  1YS7 A;  5JHF A;  2XHK A;  2KMU A;  3CDI A;  1OMI A;  4LK0 F;  3G1O A;  5F04 A;  1DGR M;  3OR2 C;  3IL2 A;  3P9C A;  2JVG A;  2CO5 A;  1HKQ A;  3SXY A;  5IP9 J;  2R5Y A;  3TP3 A;  4E7K A;  3Q0V A;  3D0S A;  4RGX A;  4BDZ A;  2L5Q A;  3IUO A;  2VQH A;  3A0H C;  1ZR4 A;  2QKM B;  1MMD A;  1IAW A;  2H94 A;  5E1W A;  3OYB A;  1T33 A;  1T2K A;  3MKL A;  2QSG X;  2PMH A;  2EBI A;  4BJ6 C;  2E1M C;  1E0E A;  4E4H A;  4Q4Z F;  1ZG1 A;  5CVR A;  2R7W A;  4HX7 A;  3RKQ A;  2LBF B;  2ELH A;  1WFX A;  2V9K A;  1LUJ B;  2FEZ A;  3WU2 C;  3CCU I;  3HL2 A;  4IHW A;  1Y1W J;  5F0H A;  3TL4 X;  5ILV A;  3IWZ A;  1TNT A;  2W1O A;  1SD7 A;  1OIS A;  3IAM 2;  4XON A;  2VPL A;  3CCL I;  1Z3X A;  1SFO J;  1U3E M;  5DCM B;  5JR3 A;  4DBQ A;  4RB1 A;  2VKE A;  3ECO A;  3MKW B;  3SZP A;  5IYB J;  3H36 A;  2EFQ A;  3JAM Z;  3ZN1 A;  1MSF C;  1K4S A;  4WXD A;  5HNH A;  1F9N A;  1GT0 C;  2UV1 A;  2P5V A;  2OUM A;  2MFZ A;  5ICF A;  1S29 A;  5C44 J;  2RC4 A;  1TWG J;  3DTE A;  2JA5 J;  5AIQ A;  1W5C C;  4G7O F;  1OYW A;  2KIM A;  3BWG A;  3B6A A;  1VQ8 I;  2E1M B;  2OZU A;  3CCR I;  4G7H F;  2IPQ X;  1A6I A;  5TJJ A;  2XF6 A;  3LA3 A;  3PFY A;  4HF1 A;  4YFK F;  4HRI A;  2LF7 A;  3QYE A;  4BXX J;  5D5W B;  2FOW A;  2B7E A;  4UXN A;  2LY2 A;  3CF5 F;  1OQY A;  2JJ7 A;  1JT6 A;  3IH4 A;  4XN3 A;  2CYY A;  1RUN A;  1QVU A;  2EPF A;  5DDG A;  1R7J A;  2DCE A;  1D0Z A;  1VZ0 A;  2NYX A;  3ISP A;  4UUS A;  3S3M A;  2W7N A;  1UHM A;  3VSL A;  2FXA A;  2IBD A;  3OL4 A;  3DF8 A;  5JVT A;  2O0Y A;  5CJ9 A;  2PBI A;  1Y1V J;  1SFE A;  3BCA A;  2CMP A;  4E7L A;  1H88 C;  2KL4 A;  2JK3 A;  1F1Z A;  4M6Y A;  2R7F A;  3OYM A;  2WAQ A;  3G4S I;  2P5L C;  1LVK A;  4AWX B;  2OC6 A;  4CZZ A;  2LDU A;  1IXR C;  5AIP A;  4L18 B;  1RNL A;  3TQN A;  2F5V A;  2E71 A;  4FX0 A;  1KYW A;  4R79 A;  1EKE A;  4RAY A;  5DCF A;  1KU9 A;  3TO9 A;  1C0W A;  3NWS A;  1QO0 D;  2ELJ A;  2HQR A;  1B8I A;  2XKO A;  2K5C A;  4XMY A;  2R7D A;  5HOO A;  2L7M P;  3E0J B;  4HOB A;  2PJP A;  3PNT A;  1U78 A;  2W85 A;  3HTU A;  3S17 J;  2M45 A;  4XKB A;  3WGG A;  4RA2 A;  3DU5 A;  2XPV A;  1RC9 A;  4II2 A;  5EGO B;  1HA8 A;  2ZBK A;  2LKX A;  2BOL A;  2L54 A;  1SD5 A;  3PIO F;  1FOW A;  4A3D J;  1MBE A;  3T5X A;  4HZF A;  1BOA A;  3JRA A;  2KRF A;  1XX5 A;  4ZDP A;  5E8I A;  1X4O A;  2KT0 A;  1CF7 A;  1FPQ A;  1RPW A;  1XGN A;  1YOV B;  1F36 A;  2IAI A;  3OIP A;  3KP5 A;  3WHC A;  3WG9 A;  2QUF A;  1MMG A;  1XMX A;  3E6C C;  2LKS A;  2CV0 A;  2OAZ A;  1K78 B;  3F9K A;  2O8X A;  3B6C A;  1LJ9 A;  2A3S A;  3C3W A;  3DTI A;  4HDV A;  3E6M A;  3T8T A;  3OY9 A;  4IVN A;  2KHM A;  2VJJ A;  4Z6Y A;  4BS9 A;  3QPS A;  1NHA A;  2Z3Y A;  3OWT A;  1Y0U A;  3GEZ A;  2VBX A;  1HW2 A;  1SC7 A;  1V5G A;  5LGT A;  4W97 A;  1YQA A;  1Y39 A;  4EV0 A;  5HS9 A;  3HGG A;  2QQB A;  2QQA A;  3CLO A;  2DAO A;  3RPU D;  3GWZ A;  1JT0 A;  1LEA A;  3LL7 A;  1ON1 A;  1TWA J;  3W6K B;  1HOM A;  4PZJ A;  4XOP A;  2MBF A;  2O6G E;  1MMA A;  1G3W A;  4KDP A;  4Y33 A;  3DCF A;  5EYR A;  1HDP A;  2LK2 A;  4F91 B;  2PI0 A;  2P0W A;  2TCT A;  1X3Z B;  3FM3 A;  3K2A A;  4BE2 A;  1WH5 A;  1XSV A;  2GIZ A;  3HG9 A;  1EF4 A;  2XAS A;  3VYR B;  2DQR A;  3F0C A;  4D7M A;  2A6E F;  4HV5 A;  2Y0S N;  4C30 A;  3GXO A;  3H3V K;  3NRV A;  5J8C A;  4A3J J;  1ETY A;  1LDK B;  1DP3 A;  3AAF A;  3BG6 A;  2LH9 A;  4LJZ F;  3DBR B;  3WHB A;  4B09 A;  2F6C A;  2F5E A;  2DMQ A;  4JP0 A;  4MQV A;  3K9T A;  3S1N J;  4A12 A;  2ZME A;  1R1V A;  1ZKG A;  2FSW A;  3TBI A;  1ZHF A;  3PSI A;  1BBY A;  3PUB A;  3CME I;  2OD5 A;  3LSH A;  4UNO A;  1AU7 A;  3CC2 I;  4L5J A;  2XSD C;  4NQW A;  5K5O A;  2C6Y A;  4FQG A;  4KT6 A;  1X1A A;  2HVS A;  3CJR B;  1MNE A;  1XGS A;  5HLI A;  5CYV A;  4CCJ A;  4II3 A;  2K3P A;  3RYP A;  2BW3 A;  2MLG A;  5FB2 A;  4A2U A;  4OIR F;  1OYI A;  3HSR A;  1GVD A;  5HLT A;  2Z9O A;  1JE8 A;  2ZJQ F;  3LFK A;  3QU6 A;  4BXU A;  1ULY A;  5H2F C;  5LGU A;  1WKM A;  1HF0 A;  2WWY A;  2BXZ A;  2KFD A;  1ZEL A;  2KJC A;  4Y15 A;  3PFI A;  2X1D A;  3GTJ J;  1P9Q C;  5DD8 A;  4MHG A;  1J59 A;  2VOO A;  2K86 A;  1R5I D;  4PJN A;  4DIQ A;  1V55 H;  2EIL H;  1QGP A;  4HA8 A;  4I98 B;  2NVT J;  3WE2 A;  2ZCW A;  3I53 A;  2DFE A;  3B73 A;  4LB5 A;  1SFK A;  3PQJ A;  1K6O A;  4EM0 B;  4ZC3 A;  4CA0 A;  5FRO A;  1ZAR A;  3RKY A;  4EJW A;  3OSG A;  1TQP A;  2EWN A;  1YW8 A;  2ELK A;  3FHN A;  1QBJ A;  3OYJ A;  3H5R A;  3HHH A;  1R36 A;  2L4M A;  2WBM A;  2UXN A;  4ZZD A;  3H3U A;  4JOM A;  2FOK A;  2K27 A;  3OS2 A;  4KIS A;  3BJO A;  3I58 A;  3JRH A;  2UWM A;  1Z91 A;  1HBX G;  4A3F J;  5J1Y A;  2XRO A;  1S5L C;  4OWR B;  1LFB A;  3QPL A;  3D5L A;  3HKZ A;  2RDP A;  3W6V A;  1VF9 A;  3MZH A;  2ZXW H;  1BJZ A;  1O3T A;  1IRG A;  1W4M A;  3R0J A;  2O03 A;  4LIV A;  2HVR A;  2EA4 A;  4ZYH A;  2OJE D;  2MH9 A;  4JX6 A;  2OQR A;  3ELK A;  1B9N A;  2HQ5 A;  4ENJ A;  1JUM A;  1A35 A;  4IHT A;  1U5T C;  1IN4 A;  1YJW I;  2AQF A;  3Q5F A;  1LNW A;  1NG6 A;  3SDG A;  2VN2 A;  1LQ1 A;  2HTJ A;  4B44 A;  3CTA A;  4G94 A;  1BA5 A;  2F4M B;  4M3G A;  3MKY B;  3PUF A;  4CHU A;  1F4K A;  5DUK A;  2R7S A;  2NOG A;  3G73 A;  3S2H J;  3BZ6 A;  3QAH A;  1UG0 A;  3TDZ C;  4IPA A;  3V7C A;  3KX2 A;  1R9T J;  4EM2 A;  1P7I A;  4ITV A;  4RGU A;  4CXF A;  2XGX A;  5F6F A;  3I59 A;  3M07 A;  1SMY F;  1WVR A;  2E1N A;  2MSY A;  1B72 B;  3FK7 A;  4FIS A;  2YX4 A;  1YRN B;  2JZY A;  1D1C A;  4DNC A;  4N9H A;  4IHS A;  2N8G A;  3R6S A;  1ZG5 A;  3ZPL A;  1JHF A;  1S7A A;  1UJ8 A;  2AQE A;  2DO7 A;  3IC7 A;  3K4M A;  3CMA I;  5EF6 A;  3CMY A;  2VKD A;  3WTV C;  3G71 I;  2R7T A;  2TRT A;  2R7U A;  2NVX J;  4IHX A;  4JQF A;  3K6G A;  2DTR A;  1PUF A;  2KIQ A;  2DA6 A;  2L7Z A;  1ZTR A;  1WH7 A;  1OPC A;  1QZE A;  5DD4 A;  3EQL F;  2HR3 A;  2CFO A;  3AL0 B;  4FHT A;  2GQQ A;  5FGM A;  5LEK A;  4BL0 B;  5JI6 A;  2L2O A;  2XRN A;  3BY6 A;  3KP2 A;  4XSX F;  1BC7 C;  4H0E A;  1OFC X;  4WXC A;  3RPQ A;  4XOR A;  1ZGA A;  4JX5 A;  4PGG A;  2KZG A;  1A5J A;  2XGE A;  3F22 A;  1ZRD A;  4BHP A;  5JFR A;  1P2F A;  3M8E A;  1YE9 A;  4FE7 A;  1X1D A;  5CQG A;  3RSN A;  2PMZ A;  3UR3 C;  1ZYR F;  3CCE I;  2Y75 A;  3LSK A;  4B8X A;  4AYB N;  3KLN A;  2K4J A;  4LLN A;  2HOT A;  3J80 K;  3IH3 A;  4UV9 A;  3OS1 A;  2CW7 A;  5M5X J;  5K7F A;  4M3B A;  5B1A H;  1TW3 A;  4KIG A;  2CG4 A;  1WSU A;  4H4K C;  4XKW A;  2K85 A;  3KYD B;  2PJR A;  1E3H A;  2KRC A;  2ZNY A;  4RS8 A;  5H20 A;  2LY1 A;  4YIF A;  1I50 J;  2FUG 2;  2JRT A;  2VKH A;  2VAS A;  1A04 A;  1DPR A;  5BMZ A;  3VWB A;  2EA2 A;  2RNG A;  1DUX C;  5CPR B;  1I5Z A;  4MNU A;  4ON0 A;  1DGW Y;  2D5V A;  1FBQ A;  3IWF A;  3ERE D;  5F0F A;  3PNY A;  1YHQ I;  5GTI C;  5KNL A;  1YLF A;  4EJT A;  3N97 A;  3DKX A;  3WTU C;  1O7F A;  3GX4 X;  1JXS A;  4A5N A;  1L3L A;  1J5Y A;  4Y4R A;  1IN5 A;  4YEL A;  4CCO A;  3BPV A;  1FYK A;  3RJP A;  3OV8 A;  4C2M J;  5CVI A;  3JW4 A;  3K4B A;  1JTX A;  3PJR A;  2HTS A;  1XDU A;  2LF8 A;  5KAI C;  4BQQ A;  2IJL A;  1UHW A;  4KIB A;  4ABZ A;  2RGV A;  4K2E A;  3V4G A;  4XLC A;  4HNU A;  2F48 A;  4LG0 A;  5IOZ A;  1WJF A;  1QA6 A;  4IX7 A;  1YYV A;  1XGO A;  4I01 A;  4RAF A;  3OYN A;  1LE8 A;  3W2W A;  2EFW A;  2NS7 A;  4XNF A;  3W2A A;  5FLV A;  2EK5 A;  3GLL A;  4BXF A;  1JGG A;  1X4P A;  1MNM C;  4A93 J;  1FC3 A;  2VJ5 A;  2E36 A;  4OMZ A;  2X6X A;  4YFN F;  4CIC A;  2R7R A;  2V79 A;  5C3E J;  5GAG J;  1BIA A;  2WAE A;  3SZT A;  5E3O A;  1R49 A;  2LG4 A;  1IRX A;  1VQ5 I;  4BUP A;  3EUA A;  2CV2 A;  2OTJ I;  2GIV A;  4B3A A;  5D4R A;  2EFN A;  4HYE A;  1BOB A;  1ETV A;  1YX5 A;  4EGY A;  5L3G A;  1WPK A;  1YIO A;  3OIQ A;  3CD6 I;  1WWX A;  1MBG A;  3JTG A;  3B02 A;  1XC5 A;  2F4I A;  3DEE A;  3R60 A;  1ZRC A;  4PJL A;  3C2B A;  3FKI J;  4XLH A;  4D7N A;  2BY3 A;  4KIT B;  5EEG A;  4MFE A;  3GTQ J;  1FNN A;  2QM3 A;  1B59 A;  2HKX A;  4O5V A;  3KEY A;  5B5E C;  2DW4 A;  3QPT A;  4LD5 A;  5F08 A;  1Y8R B;  5EEH A;  1DU0 A;  3PL8 A;  1ZK8 A;  1VQN I;  1UMQ A;  2MG4 A;  4Y17 A;  2L7F P;  1BM9 A;  5K7Z A;  1H89 C;  1TWF J;  3DBL B;  3LQQ A;  4UV8 A;  1FMV A;  4Q47 A;  4E7H A;  4PSW A;  1Z1D A;  3ZCO A;  5C4X J;  1J09 A;  1UEL B;  3GTP J;  2YU3 A;  2XSJ C;  1FEX A;  3HPH A;  2XAU A;  5TIS C;  1AOY A;  2D1H A;  1N77 A;  4CCK A;  3BG9 A;  3R0A A;  2QQ8 A;  3G1M A;  2OF7 A;  4F92 B;  2CW0 F;  3IH2 A;  2H6B A;  4NC7 A;  3BOQ A;  2B0L A;  4CZC A;  1BR4 A;  2WB1 N;  4E6K G;  4KA4 A;  4RMN A;  4I6Z A;  2ZB9 A;  1AKH A;  4BYY A;  4B4C A;  3QOE A;  2XAG A;  1T0F A;  3OR1 C;  5E79 C;  5HNF A;  1H0M A;  2IA2 A;  3UKG A;  2PEX A;  2DLL A;  4UY8 I;  1QHG A;  2LLK A;  4XLP F;  2JRM A;  2Y0S A;  4BEH B;  2IGM A;  4LIU A;  3EUK L;  1ETQ A;  4PK4 A;  1RET A;  3S3N A;  3PQK A;  3HOW J;  3A1Y A;  4FX4 A;  5DEQ A;  4CYC B;  1ACI A;  2KPM A;  1G3Y A;  2LMD A;  2R5Z A;  4R8H A;  2OA4 A;  3ZQG A;  1PVE A;  1ENH A;  3A01 B;  2HYJ A;  3ZRG A;  3DU6 A;  2WA0 A;  2QF7 A;  1DQU A;  2OU2 A;  5J4Y A;  2FD5 A;  3SDB A;  2O3F A;  3EUH A;  3NWT A;  2CQX A;  3WOD F;  1MSE C;  4U0V A;  2FJ1 A;  2DOD A;  2R3S A;  4PUS A;  4PDK A;  4IOA F;  4KUM A;  5F0C A;  3MZY A;  4YEJ A;  4E7Z A;  2F4O B;  3E5U A;  3FBN B;  4HX4 A;  3DWL E;  5D8K B;  3WTX C;  3LFU A;  5EDN A;  1IV8 A;  4I0A A;  2KDZ A;  5IY5 H;  2NVU B;  2RN7 A;  2MC3 A;  2YS9 A;  1UZC A;  2Y31 A;  4ESF A;  3RZO J;  2ZSH B;  4AVP A;  4DGW B;  5J4V A;  2PMZ N;  1WJE A;  4N4O B;  2RV8 A;  4XOT A;  1MBK A;  2EV5 A;  5IOY A;  2L02 A;  2CQQ A;  4BBS J;  4B48 A;  2CSO A;  3J80 Z;  3V8K A;  4A6D A;  4NHJ A;  3LAJ A;  1ZGW A;  2WAF A;  1D0Y A;  1K6Y A;  1W5T A;  4LIT A;  5EEA A;  2B63 J;  5J1U A;  2VXZ A;  3O2P E;  1M1E B;  4GDF A;  1XTA A;  3M9A A;  4BDY A;  2G0E A;  3BR0 A;  3KIO A;  5EJC A;  3W2V A;  2WTE A;  3HOY J;  2M4G A;  5LRR A;  3S93 A;  2NXN B;  4P9U A;  4ENM A;  4J00 A;  1FZP B;  4XL9 A;  5B66 C;  2IVM A;  3LWF A;  1WZ2 A;  3DTK A;  3OYI A;  4WWC A;  4L9J A;  1JKO C;  2R7X A;  1LB2 A;  1FYM A;  1WRJ A;  1LDJ A;  2WV1 A;  3IRR A;  1Z05 A;  5KAF C;  1OR7 C;  3ZGK A;  4CDG A;  3W3C A;  1FP2 A;  2BY2 A;  1LFU P;  4L0Z B;  2COM A;  3OYD A;  4L9T A;  4PJJ A;  4D0P A;  4AIH A;  1JHH A;  2M0C A;  2RRE A;  4ZTJ A;  3T8R A;  1EH7 A;  2NAZ A;  3DLA A;  5LEJ A;  3LST A;  2BBY A;  1PDN C;  1ZLJ A;  2XGD A;  2AS5 F;  2IA0 A;  2Q8K A;  4G12 A;  4OIP F;  2MW8 A;  4CCL A;  3PIP F;  1OCO H;  1BR1 A;  2EJR A;  2ZFU A;  3OMY A;  2QBY A;  2FF4 A;  3DPT A;  4HLX A;  4KMF A;  1ONV A;  4KMU X;  4F7Z A;  3CCY A;  2CU7 A;  1VI0 A;  2NVY J;  4E7J A;  4M72 A;  1V4R A;  3M8F A;  1T6S A;  2M1B A;  1O3R A;  1AA7 A;  2X6W A;  4HW0 A;  1T56 A;  1IGN A;  2H27 A;  1VQ6 I;  2L9N A;  2VJ4 A;  5EG0 A;  3CC7 I;  1WGX A;  2V6C A;  1ZR2 A;  1HKT A;  1NG7 A;  1XCB A;  4C3I J;  3PO2 J;  4PJ0 C;  2D1V A;  2OBP A;  3F23 A;  2HXO A;  3S2W A;  2XKP A;  5F1J A;  5H6Q A;  1VFC A;  3WU0 A;  5FKM A;  4IXA A;  1KYZ A;  1LEB A;  1MZB A;  6PAX A;  3MKZ A;  3LSR A;  1SAX A;  2G9W A;  4I99 C;  4BJT A;  3CMM A;  2DDA A;  4F93 B;  4S05 A;  2HOS A;  2EZL A;  3ASN H;  4AVZ A;  2QVO A;  4HG2 A;  2L9R A;  3FKJ A;  1P92 A;  4CCN A;  1I39 A;  3BRO A;  3DV8 A;  3GTM J;  1QU3 A;  1XPX A;  4E7S A;  3MAJ A;  3SEZ A;  5M3F J;  2DK8 A;  2RVC A;  5LD2 C;  2L01 A;  1VQ7 I;  2ZJP F;  2VC1 A;  3S1M J;  5J1R A;  4OIQ F;  2M3A A;  3H0D A;  5KHD A;  2ZJ2 A;  3QYF A;  2ECC A;  3KP6 A;  1Q1H A;  3F6O A;  2GOX B;  3TED A;  2XB5 A;  3M3Y J;  3H92 A;  2VOD A;  3HC7 A;  3MWM A;  1BW5 A;  2V4J C;  4C9Y A;  3C1D A;  1U8B A;  1CGP A;  4G6Q A;  4KN7 X;  3GTO J;  2QSF X;  4AUX A;  3H5A A;  1S9H A;  4X6A J;  4M9X A;  3FMR A;  2IGK A;  2X6Y A;  1U8R A;  1TL8 A;  1ETO A;  2F5C A;  3CP8 A;  3LSP A;  1NK3 P;  2R0Q C;  1OCZ H;  1O4X A;  2HWV A;  3GYH X;  1BW6 A;  1FSE A;  1B4A A;  1W0T A;  1U5T A;  1MMN A;  2KLO A;  1O3Q A;  2BVM A;  3M8J A;  4ANJ A;  5FLM J;  3E97 A;  4A3G J;  4BQN A;  4RB3 C;  1G59 A;  3OS0 A;  1D1B A;  3R61 A;  4YRV A;  1GDT A;  4AYB A;  1FOK A;  4DJA A;  3KP4 A;  2JPC A;  5JLX A;  3CDL A;  5J6X A;  1L0O C;  4C3J J;  4I2O A;  2EIN H;  4YII A;  1FTT A;  1ON2 A;  1FSH A;  2LYC A;  3ZQC A;  5FFZ A;  3BR2 A;  1R4N B;  1SAU A;  1G4D A;  4PFO A;  1MDM A;  5ICG A;  1X58 A;  4HF0 A;  5D5X B;  4BNC A;  3JTH A;  1KQ9 A;  2JMW A;  2X48 A;  1DP7 P;  3WU1 B;  2PMU A;  1R5G A;  2AHQ A;  2FRH A;  2X1C A;  2V1N A;  4E70 A;  2DJN A;  2XPW A;  4C3H J;  5GAH J;  2OPT A;  1RZ4 A;  3OL3 A;  4JX4 A;  3J7Y J;  4CGZ A;  2HPM A;  4EGZ A;  3OYF A;  3QP5 A;  4WX9 A;  3QOP A;  2VOP A;  3DP7 A;  1SEU A;  2W84 A;  3F21 A;  3L2V A;  5DTD A;  3QU3 A;  1EH6 A;  2D2W A;  4A3L J;  2BGC A;  3O6B B;  2ETH A;  2DYS H;  1W1W E;  1I27 A;  2DT6 A;  4GFB A;  2VJI A;  5EZG A;  2X85 A;  1VTN C;  2CQK A;  2EQR A;  1KU7 A;  5LHG A;  2Z1D A;  4Y52 J;  3JSP A;  4G6D A;  3SJM A;  2ZSI B;  3JR9 A;  4CCM A;  4MIM A;  4U7B A;  2R5Y B;  4FAS D;  1GHC A;  2DA5 A;  3GFM A;  3BTJ A;  1MGT A;  4A69 C;  5L3B A;  1XD7 A;  3LSJ A;  3E7L A;  4W1U A;  1D8J A;  4CSW A;  3ZQL A;  2W00 A;  3E5X A;  4PSX A;  2CQN A;  2VL8 A;  2R7Z J;  2MGQ A;  3LQR A;  1TC3 C;  2VXD A;  3CP2 A;  4HBL A;  1GVJ A;  1V5E A;  3ABU A;  4MTE A;  5IP7 J;  4TV7 A;  4A0Z A;  3F8M A;  1G3S A;  1QNT A;  4N0B A;  3GZN B;  5ILS A;  1SAN A;  5FKL A;  2GXA A;  4NC8 A;  1W7P A;  1IDZ A;  5LHI A;  4AIJ A;  3ZMD A;  3CUQ A;  2VON A;  5FLX K;  5IPA A;  5IYC J;  3G3Z A;  3SEQ A;  2LKP A;  3ROU A;  3Q9S A;  3JCU C;  1SFX A;  3V7S A;  3WGH A;  2Y30 A;  3O8H A;  2YU9 J;  3HUG A;  1FJL A;  3EPZ A;  2Q2E A;  2L4A A;  5HDG A;  3CCS I;  3WTZ A;  1U9N A;  3D5R C;  3LSM A;  5ED4 A;  2DDB A;  2P81 A;  2K9M A;  1GUU A;  4A6E A;  1ETK A;  3N4M A;  4BY1 J;  2LSO A;  1MH4 A;  4S04 A;  1BR2 A;  1E3O C;  2Q0O A;  1IN7 A;  1I1G A;  3DBH B;  1KU3 A;  2YUS A;  1E2X A;  5DYM A;  3TO7 A;  3TOB A;  2O61 A;  3MFK A;  1JUP A;  1OYY A;  5C4J J;  4LLL A;  4BHB A;  1BI1 A;  2IP2 A;  1OJL A;  3K1M A;  3U21 A;  2ICW G;  4UUS B;  1FBS A;  2FU4 A;  3E3V A;  4WXH A;  2VE8 A;  2QLZ A;  1EV7 A;  4RLQ A;  1MBF A;  5ILU A;  2ESH A;  3IKT A;  4BE0 A;  3P5J A;  1IN8 A;  2UUZ A;  1TT0 A;  3QQA A;  3AL0 C;  1D5V A;  1YFH A;  2VT3 A;  4EEF G;  3KET A;  2DMU A;  2CGP A;  3Q0U A;  1XMK A;  4ZDO A;  2WB1 A;  3KZZ A;  3I4N J;  2STT A;  3ULQ B;  3LA7 A;  2EB7 A;  3V7R A;  1Z6T A;  3OYA A;  3Q0W A;  5D6F A;  1DU6 A;  4L0Y B;  1UG2 A;  2XPU A;  2NNN A;  1OLT A;  4BGD A;  2VE9 A;  1H9T A;  1X2N A;  4I76 A;  4IHY A;  3I3L A;  3KYL A;  3F8B A;  1B8I B;  4IKF A;  1UHS A;  3M7G A;  2JA7 J;  2JPB A;  3MMY B;  2OV7 A;  3S16 J;  1R23 A;  1R6R A;  1TNS A;  4QSH A;  1TT5 B;  2P8T A;  4BBR J;  2NVQ J;  4JBA A;  3LMM A;  1VQL I;  5HDK A;  2M8G X;  1HW1 A;  2RAE A;  2JSP A;  3K4N A;  3S32 A;  4ZYG A;  5E20 A;  3LA2 A;  4ESB A;  4RBO A;  3EYI A;  3BPX A;  5HOD A;  2H6C A;  4Y7N J;  2GA2 A;  1NH3 A;  3J7A O;  2HS5 A;  4MQ9 F;  4OIN F;  1TBX A;  3ZQF A;  3BZC A;  4B1R A;  3KCC A;  4KYW A;  2JWT A;  3M4O J;  1X1P A;  3K2Z A;  2IW5 A;  2W57 A;  4DW6 A;  5GAD J;  3BR3 A;  1CF7 B;  1RUO A;  5GPC A;  1X3U A;  2E1C A;  1P7J A;  4P96 A;  1J0R A;  2DT7 B;  1KA8 A;  4PGH A;  4PFP A;  2DFI A;  4XR6 A;  1TTY A;  2YSR A;  4IL6 C;  3RYR A;  1V54 H;  1I3A A;  4AM3 A;  5J47 A;  1N25 A;  1IJW C;  2V1D A;  3VOD A;  2BHY A;  3A03 A;  3FBI B;  2XDV A;  1TZL A;  4I09 A;  3BR5 A;  4LB6 B;  1D1A A;  1G8X A;  3BR1 A;  1YG2 A;  1IG7 A;  2MA3 A;  2ZME C;  1S3J A;  9ANT A;  3K4C A;  2P6S A;  4IQJ A;  4QPO A;  1Z9C A;  2DU9 A;  1IDY A;  3KFW X;  1Z7L A;  3GLX A;  5CQE A;  2GXB A;  4HAM A;  3L09 A;  2DT5 A;  3I5U A;  5LRS A;  1APL C;  4IJA A;  1PP8 F;  1E3P A;  4N4N B;  2VQL A;  5BQT A;  3CJQ B;  5J40 A;  2KKO A;  1W7P D;  4YFX F;  4M6X A;  5KK1 A;  5HLG A;  1MJA A;  2KZV A;  1MW7 A;  3BT9 A;  1WHU A;  3HHG A;  3JRG A;  1KQ8 A;  3LNQ A;  1XSX A;  2X9D A;  1D3Y A;  1IZ1 A;  3GTL J;  2AXL A;  2R4G A;  3WTW C;  4FE4 A;  3HYI A;  1K79 A;  2JQ7 A;  2Z2S B;  5DUI A;  3K1N A;  2LBF A;  2DK5 A;  2H1K A;  1R00 A;  2WY8 Q;  3GFI A;  2F5F A;  2CUE A;  4D5F A;  3MQ0 A;  2EIM H;  4B43 A;  4Y13 A;  4OIO F;  1GLN A;  3L2U A;  2DBB A;  3FM5 A;  2QSH X;  3L2C A;  1KGS A;  5HS8 A;  2GA1 A;  2I10 A;  5LHH A;  1U9O A;  2FBK A;  2ZME B;  3V8L A;  1HKS A;  2QGU A;  4IF4 A;  4M6V A;  4PCQ A;  5DCM A;  1MKM A;  4AIK A;  3HSF A;  3GZ6 A;  3K70 D;  1YO5 C;  3IAS 2;  3GBG A;  5D4S A;  4BHC A;  3DQV C;  3ZQQ A;  5ICE A;  4NQW B;  3DKW A;  3HRU A;  4DQ2 A;  1O7L A;  2XV4 S;  3KE2 A;  3DPL C;  1H8A C;  4MFD A;  1XG1 A;  1IN6 A;  4XKC A;  1I6H J;  2A07 F;  2PQ8 A;  1RKT A;  5DM7 F;  2FQ3 A;  5B3S H;  2BW3 B;  2V9V A;  3QPH A;  4XRS G;  3ZQ7 A;  3I9V 2;  4P9F A;  3VYT B;  2GM4 A;  2DOF A;  4DYQ A;  1CQT A;  4IZZ A;  2DFF A;  1YTY A;  4UUV A;  4RAZ A;  3TO6 A;  3DLL F;  4LLG F;  4ZYA A;  1B6A A;  4HNT A;  1DDN A;  3K70 C;  1ETX A;  4XSZ F;  5FRM A;  2HOE A;  2KIF A;  3C2G A;  1SD6 A;  2W24 A;  5D6E A;  3ASO H;  1Y6I A;  2HEO A;  3FXM A;  3RKX A;  2DOE A;  3KZI C;  1RRJ A;  3HBL A;  1SMT A;  2ZJR F;  3HZJ A;  1R71 A;  1E17 A;  5FLX Z;  2QA4 I;  1S8N A;  1ZAO A;  2X1E A;  4MEY F;  4AID A;  1R58 A;  2DMN A;  2ZNZ A;  2IRF G;  3KLO A;  5FRN A;  3VB2 A;  3TDU C;  1EJ9 A;  2IGN A;  5E18 F;  1JTY A;  2IS1 A;  2HKO A;  2ME6 A;  2Q1Z B;  3BLY A;  4A3C J;  1RR7 A;  2FX0 A;  4G6T B;  3ECH A;  4RGS A;  2ECB A;  4I0B A;  3WTS C;  3OYK A;  1OR7 A;  4NDL A;  5E3L A;  2UZK A;  2IGO A;  5CVJ A;  1R1T A;  4XIC A;  3GW2 A;  2PX9 A;  4QIW N;  1VQK I;  1UFM A;  1RKW A;  3K0L A;  2CQ7 A;  1XGM A;  2NNY A;  2IEK A;  2Y9Y A;  3HM5 A;  4IO9 F;  3BG5 A;  1Y56 A;  1VQ4 I;  3CCM I;  2B9S A;  3COA C;  1NTC A;  3N05 A;  5FO5 A;  3VYS B;  5EGO A;  4BQA A;  2EIK H;  3P9I A;  3BP8 A;  2DA4 A;  2HZD A;  1RI7 A;  3BQY A;  4E7I A;  1JKR C;  4QPQ A;  3JRF A;  3FXO A;  1P4W A;  3U9G A;  1TQI A;  5GTH C;  3CCJ I;  2LTP A;  1AHD P;  1REP C;  1K7A A;  2JUC A;  1FBU A;  1J7K A;  3T0Y A;  1MD0 A;  3AG1 H;  2O9L A;  2M87 A;  4UVB A;  2FQ4 A;  1J2X A;  2HXI A;  4EJO A;  4A3M J;  1K78 A;  3SYT A;  3V42 A;  3CO6 C;  1ITY A;  1VND A;  2VKV A;  2P7V B;  3HOS A;  1OCR H;  3I59 B;  2R7Q A;  4KJZ A;  3TW7 A;  3RKW A;  2CV1 A;  2HDC A;  2HZT A;  2YR2 A;  3ZMV A;  1EA3 A;  2WC2 A;  5CVU A;  3ZMZ A;  5GAE J;  5BPI A;  4BU2 A;  5E1X A;  2IXS A;  2MD0 A;  1HQC A;  1QRY A;  2ACJ A;  5J3L A;  2W82 A;  3RI4 A;  3GVA A;  2XUB A;  4QTR A;  5FJ8 J;  1FX7 A;  3ERM A;  3RQI A;  4A0Y A;  2GBY A;  2BHZ A;  5GP9 A;  3JRB A;  3BTC A;  1ZLK A;  4P1W A;  1N78 A;  2GAU A;  1PUF B;  3FXQ A;  2STW A;  1MIJ A;  3FXL A;  3HB9 A;  1UCR A;  1QPM A;  3I4M J;  4XM3 A;  5LLQ A;  3S1R J;  2IA1 A;  2H09 A;  2W4S A;  2CW8 A;  4U7D A;  2JN6 A;  1NK2 P;  4N9I A;  1MBH A;  1P4A A;  2DPU A;  2LR8 A;  1FLI A;  2PN6 A;  2HYF A;  2JT1 A;  3FXU A;  3E6D A;  4BQO A;  2K9N A;  2E5Z A;  4AC0 A;  1VQP I;  1SFU A;  2XC7 A;  2ESN A;  3PO3 J;  4DBR A;  2NRA C;  2K3F A;  2E19 A;  2M7B A;  3HDD A;  3KPH A;  4RLF A;  3FK6 A;  4M74 A;  1PJR A;  2KP6 A;  4EAT A;  3FXJ A;  2HVQ A;  3OOP A;  4M9S A;  2ADU A;  4FCY A;  1STZ A;  1JJ6 C;  3A2K A;  1HSJ A;  2WY7 Q;  3JRE A;  3S15 J;  5DV5 A;  3F72 A;  2GOM A;  2GWR A;  3MD2 A;  1XCV A;  4X1E A;  1J75 A;  2M0M A;  1HDD C;  2NOJ B;  3IHU A;  5ERI A;  2PJR B;  2WV0 A;  2HDW A;  3WTY C;  4LK1 F;  1T08 B;  2GZW A;  5L3F A;  2K4B A;  2V1U A;  1N75 A;  3E5Q A;  3V8J A;  4ZYE A;  4A3B J;  2CS3 A;  4HX8 A;  1Y8Q B;  3I55 I;  2WAD A;  4G9Y A;  3VSK A;  4A5M A;  3RDI A;  1BIB A;  2R92 J;  3RPU A;  2E7X A;  4Z2Y A;  1YIJ I;  3A02 A;  5HDN A;  3G2B A;  1ZRE A;  5BPD A;  2V9P A;  4X0G A;  3TW6 A;  2QEX I;  2Z33 A;  1U0J A;  2BXY A;  2JSC A;  2JUG A;  5J8F A;  3H9J A;  1S7O A;  1WCM J;  4Y3O A;  1FWZ A;  3Q3S A;  4I7H A;  3DPU A;  3RQ4 A;  2FNA A;  5IT3 A;  3ML6 A;  3FX3 A;  2A6H F;  2EIJ H;  4HEA 2;  4I02 A;  4KIF A;  4A3E J;  4OAY A;  3U2R A;  3WGI A;  4ZJZ A;  4CH7 A;  5FD5 A;  4BAC A;  1SVM A;  4L9N A;  1KON A;  3K4L A;  3SFZ A;  4PJM A;  2VBW A;  4LG0 B;  2PG4 A;  2CFX A;  2DYR H;  4ESJ A;  1BI2 A;  3K4J A;  3REO A;  4GRI A;  2XAQ A;  1LE8 B;  1BL0 A;  4A3I J;  1R1U A;  4ENN A;  3S1Q J;  4MTD A;  5CKT A;  3FMS A;  4NBQ A;  2W48 A;  3KEQ A;  4AU7 A;  4KIC A;  1W0U A;  1F5T A;  3FXK A;  2JA6 J;  2DA1 A;  1YW7 A;  4NC6 A;  4A0X A;  4IRH A;  1QVT A;  4GCV A;  5HS7 A;  3IP4 B;  2LY9 A;  2XVC A;  3EET A;  2KIS A;  1XDS A;  2DMP A;  1T98 A;  3AG2 H;  2VC0 A;  4BJ5 C;  3ABL H;  4A3K J;  1O57 A;  1OCC H;  1LFP A;  1J9I A;  1FIP A;  2X51 A;  3RCO A;  1WJD A;  1FYL A;  2HYG D;  3P9K A;  2JA2 A;  3FXR A;  3CES A;  2IT0 A;  3H5N A;  2EZI A;  1PYV A;  1QQI A;  4DZP A;  4EM1 A;  5E1Z B;  3E6B A;  1G3T A;  4L9V A;  3AKZ A;  1MMS A;  4EVI A;  1T39 A;  3H0G J;  3HOX J;  2OCC H;  4LFU A;  1T38 A;  3CLQ A;  4EJU A;  3JSO A;  4U0W A;  4RDU A;  4M9Z A;  1ZRF A;  4GYI A;  2FBH A;  4LGW A;  2L7K A;  2A61 A;  4BH9 A;  1T0F C;  4Q48 A;  3S8P A;  4ZZL A;  2MLK A;  3DXJ F;  2KJB A;  1B72 A;  2F2E A;  3OYL A;  4UB8 C;  2V26 A;  1YRN A;  1WQ2 A;  1WI3 A;  3FMQ A;  2DOA A;  2E1O A;  4M73 A;  1IC8 A;  2A05 A;  1YJN I;  2AO9 A;  3K4K A;  2ME0 A;  3FIS A;  1Z67 A;  2V1X A;  1ORK A;  5M3M J;  1SVL A;  2JTV A;  3BZK A;  3ZMU A;  1WI9 A;  1JJ8 C;  3QOD A;  3HOV J;  3HGY A;  3L2Q A;  4B47 A;  2MYS A;  3GTG J;  2X6O A;  5IT9 K;  5L3E A;  1S6L A;  3ZR8 X;  4WF2 A;  3K7A J;  3MEX A;  3K10 A;  4M3E A;  5EZH A;  2R7V A;  5E3N A;  4U0Y A;  1TWH J;  3FHZ A;  4IEJ A;  4IRI A;  1S7E A;  3CC4 I;  1D8K A;  2PFB A;  5FKN A;  1FOY A;  2DA2 A;  2VPR A;  3EUH C;  1WJB A;  2G7U A;  3F8C A;  4M3F A;  3WE3 A;  1G2H A;  3MN2 A;  1FMW A;  2K02 A;  3ZQI A;  1AKH B;  2ID3 A;  3CDH A;  2H8W A;  4F55 A;  3OYG A;  4RAG A;  4OOI A;  4FTH A;  4NB5 A;  5BS6 A;  2M9H A;  2IS4 A;  2XAF A;  2X4H A;  4LOC A;  1ZN2 A;  3M1C A;  4V2F A;  3GUD A;  3T1B A;  2FE3 A;  3CJT B;  2DI3 A;  1TQM A;  5LGN A;  4P55 A;  2BYV E;  3HOT A;  1YX3 A;  1BJA A;  5H6R A;  3JRC A;  2K40 A;  2KQR A;  3FF5 A;  2CWE A;  3LSI A;  4ZYD A;  1A6Q A;  2QYO A;  2R5Z B;  2L9V A;  2VT2 A;  3TMO A;  2E2J J;  1XSD A;  5E3M A;  3AG3 H;  3BG7 A;  1FOX A;  2EZH A;  2JVH A;  3D5S C;  3GO5 A;  1IUF A;  1Z3Y A;  2OTL I;  3JRD A;  4G8X A;  2P4W A;  3PSF A;  5L3D A;  1YJ9 I;  4XQF A;  2EH3 A;  2QKL B;  3IV5 A;  1JKQ C;  2A6T A;  3KYC B;  3HRM A;  3I71 A;  3HEF A;  4MGR A;  1EH8 A;  1Z7U A;  3CF2 A;  2MAB A;  2CUJ A;  3HXL A;  1A31 A;  2NS0 A;  3HRT A;  1D5Y A;  2K9S A;  1QZZ A;  1YS6 A;  2LRE A;  2LFB A;  1R4M B;  3TP0 A;  3J7A Y;  2BVL A;  2V6E A;  2DPD A;  3ZQH A;  2M4K A;  2K9Q A;  2XAJ A;  3IKV A;  4AD9 A;  2BZT A;  2Z5U A;  2BV6 A;  1X1B A;  2M5W A;  3WTT C;  2H1L A;  2RQP A;  2VIX A;  3CZ6 A;  1GV2 A;  1TWC J;  4C2U A;  3EYY A;  3DKY A;  5F1R A;  2DA7 A;  5KVR A;  5D8L B;  3LAP A;  1OCT C;  3I54 A;  2FBI A;  2HQA A;  3HOU J;  5M5Y J;  4HQE A;  2ZFW A;  3ONQ A;  1X2M A;  2LC2 A;  3SFI A;  3WG7 H;  1RIO H;  3E1S A;  2ZKZ A;  3IRQ A;  1Q1V A;  1HW5 A;  2RQQ A;  1QZY A;  2BE5 F;  1YIT I;  1XB4 A;  1X3W B;  3MCZ A;  3HTS B;  2XF5 A;  2M2E A;  3D1N I;  3VPR A;  1POG A;  1U6G A;  4XLN F;  2CUF A;  3HIF A;  2QEN A;  4D9J A;  2ID6 A;  2OQG A;  3KP7 A;  3CCQ I;  2EFP A;  3NEU A;  2LOO A;  1U2W A;  5E8G A;  4DYR A;  3EDP A;  2QZ8 A;  1KQ0 A;  4EMS A;  1KZH A;  3SZG A;  1X1C A;  2GLO A;  3KP3 A;  4XID A;  5A2Q K;  3NQO A;  1HC8 A;  3PNV A;  1LKX A;  4KNY A;  4EQQ A;  2QBY B;  2HQN A;  2LRD A;  1G6N A;  2X0L A;  3AG4 H;  1TP4 A;  4XKV A;  3L7W A;  1LPQ A;  3LOC A;  1S72 I;  3NAU A;  1PUE E;  4HQM A;  1Z6R A;  5EG0 B;  4WK8 F;  1PP7 U;  2RNJ A;  1FP1 D;  2HI3 A;  3VYU B;  3ABT A;  3BJA A;  4IQ4 A;  1WJA A;  4IHV A;  4M3D A;  2XF7 A;  4UVA A;  2P5K A;  2YX7 A;  4GO1 A;  2Y9Z A;  2P7C B;  1WJC A;  4XLA A;  2VUM J;  4HF2 A;  2XIG A;  3ZN0 A;  5D5U B;  2XB0 X;  2Y48 A;  4RGR A;  3DEU A;  4UVC A;  4ZDL A;  2VBY A;  3J81 K;  3I56 I;  4UUT A;  3K69 A;  5CVV A;  1R22 A;  2ISY A;  1YI2 I;  4RM3 A;  1FTZ A;  2Y0M A;  4HDU A;  2A69 F;  4CYD A;  5AON A;  5GPA A;  3U1D A;  1X19 A;  2WAQ N;  1MJB A;  4BE1 A;  3SHF A;  5M5W J;  1XN7 A;  2BY0 A;  3VEP A;  4JK1 X;  4UB6 C;  3Q9V A;  1W5S A;  4BAY A;  3L9F A;  2O7O A;  4JYK A;  3X2Q H;  3HRS A;  3C7J A;  3BTI A;  5FD6 A;  2M7A A;  1YW9 A;  3H9G A;  1GXP A;  3QYB A;  2EV0 A;  3BR6 A;  4BEH A;  3L00 A;  5DS9 A;  4UHT A;  2HFH A;  5JVG F;  2JA8 J;  5K7H A; 
#chains in the Genus database with same CATH homology
 5F27 A;  2DMQ A;  2DN0 A;  4JP0 A;  2LD5 A;  4CYC A;  1NTC A;  3S1N J;  1ZKG A;  2M0C A;  5EGO A;  1Z0X A;  4XK4 A;  2DA4 A;  3MVP A;  3A01 A;  2DA3 A;  3BQY A;  1JKR C;  3JRF A;  2XGD A;  1AU7 A;  4G12 A;  2XSD C;  2MW8 A;  1AHD P;  2LTP A;  1FIA A;  4BY7 J;  3CCY A;  2CU7 A;  3NAR A;  1VI0 A;  2NVY J;  2HOA A;  1T56 A;  1IGN A;  2O9L A;  1GVD A;  4J19 A;  5EG0 A;  1WGX A;  2FQ4 A;  4MLO A;  1ZR2 A;  2HXI A;  4A3M J;  4C3I J;  3PO2 J;  2HXO A;  1QPI A;  5F1J A;  1ITY A;  1VFC A;  1VND A;  5FKM A;  3S14 J;  1HF0 A;  2VKV A;  2NS8 A;  3LSR A;  5BNG A;  3TW7 A;  3GTJ J;  1HLV A;  1F43 A;  2LVS A;  5FKK A;  2HOS A;  2EZL A;  2EZK A;  2L9R A;  2M34 A;  2XRL A;  1QRY A;  5J3L A;  2NVT J;  3GTM J;  4QTR A;  1XS9 A;  5FJ8 J;  3CQZ J;  5M3F J;  3S1M J;  3RQI A;  2GBY A;  5GP9 A;  5J1R A;  3JRB A;  3OSG A;  3BTC A;  2ELK A;  2ECC A;  5FKO A;  1HCR A;  2H8R A;  3TED A;  1PUF B;  2XB5 A;  3M3Y J;  1RES A;  3BQZ A;  3HB9 A;  1BW5 A;  3I4M J;  3S1R J;  1U8B A;  1JKP C;  3GTO J;  2JN6 A;  1NK2 P;  4AUX A;  4L5E A;  1MBH A;  3JRH A;  4X6A J;  2LR8 A;  4A3F J;  5J1Y A;  1LFB A;  3QPL A;  3W6V A;  1VF9 A;  2K9N A;  1ETO A;  1NK3 P;  3LSP A;  1BJZ A;  4AC0 A;  4HNV A;  2R0Q C;  1O4X A;  1ZQ3 P;  3PO3 J;  1BW6 A;  3FIW A;  2E19 A;  3HDD A;  2VI6 A;  1W0T A;  4JX6 A;  5IP9 J;  1ETW A;  3FK6 A;  3BG3 A;  2HQ5 A;  3HOZ J;  4FCY A;  1JUM A;  5FLM J;  1JJ6 C;  4A3G J;  1GDT A;  2Y2Z A;  2HDD A;  3JRE A;  3S15 J;  5JLX A;  3LSG A;  3CDL A;  3SDG A;  2E2H J;  4C3J J;  1BA5 A;  1FTT A;  4M3G A;  4X1E A;  1HDD C;  3ZQC A;  2NOG A;  2CJJ A;  3BR2 A;  4S0H B;  3S2H J;  1X58 A;  1R9T J;  1P7I A;  2JMW A;  3L1P A;  2X48 A;  4A3B J;  1Z77 A;  3OSF A;  2AHQ A;  2DJN A;  2XPW A;  4C3H J;  2MSY A;  2OPT A;  4JX4 A;  1B72 B;  3FK7 A;  2R92 J;  4DYC A;  4FIS A;  1YRN B;  2DTZ A;  3PM1 A;  2N8G A;  3A02 A;  2R93 J;  3RZD J;  3TW6 A;  1MBJ A;  3OOU A;  5DTD A;  3G1L A;  4D5C A;  4A3L J;  1WCM J;  5EF6 A;  3CMY A;  3Q3S A;  2DMT A;  2CRG A;  2TRT A;  4GFB A;  1K83 J;  2NVX J;  5EZG A;  4IHX A;  4A3E J;  2EQR A;  5IYD J;  4Y52 J;  4XRM A;  3SJM A;  1PUF A;  3JR9 A;  2DA6 A;  2L7Z A;  1ZTR A;  1WH7 A;  4MIM A;  2R5Y B;  2DA5 A;  3O8G A;  3BTJ A;  4A69 C;  1LE8 B;  1BL0 A;  4A3I J;  3S1Q J;  1GV5 A;  3LSJ A;  2W48 A;  3E7L A;  3HKZ N;  4W1U A;  3BTL A;  3ZQL A;  1W0U A;  1OFC X;  4V2G A;  2JA6 J;  2DA1 A;  1JUS A;  2LP0 A;  3DEW A;  2R7Z J;  2MGQ A;  4JX5 A;  1A5J A;  1IRZ A;  2XGE A;  1QVT A;  1TC3 C;  1OCP A;  2LY9 A;  3OIO A;  4XRS A;  4FE7 A;  2DMP A;  5IP7 J;  3ZOB A;  4A3K J;  4MO7 A;  1FIP A;  1SAN A;  5FKL A;  4AYB N;  1IDZ A;  2HOT A;  1K61 A;  3IH3 A;  2EZI A;  1IV6 A;  5M5X J;  4DZP A;  5K7F A;  4BKX A;  4M3B A;  5IPA A;  5IYC J;  1I3Q J;  5IP6 A;  2O8K A;  3JRI A;  3H0G J;  3GTK J;  3HOX J;  3S2D J;  2YU9 J;  2Y30 A;  1I50 J;  3O8H A;  4RDU A;  1FJL A;  2L0K A;  1U9N A;  2D5V A;  2P81 A;  2QCO A;  1GUU A;  5F0F A;  1ETK A;  4BY1 J;  1MH4 A;  2COB A;  4DZJ A;  1B72 A;  2E2I J;  1YRN A;  5JLW A;  1WI3 A;  1E3O C;  2E1O A;  2YUS A;  1IC8 A;  1MH3 A;  2AO9 A;  4C2M J;  2ME0 A;  3FIS A;  2XGC A;  1ORK A;  1JTX A;  5M3M J;  1JJ8 C;  1JUP A;  3HOV J;  3HGY A;  5C4J J;  3GTG J;  1OJL A;  2X6O A;  4ABZ A;  3G1O A;  5F04 A;  4UUS B;  3K7A J;  4M3E A;  5EZH A;  5IOZ A;  5E3N A;  2R5Y A;  3TP3 A;  1TWH J;  3Q0V A;  4IEJ A;  1S7E A;  1MBF A;  5FKN A;  1LE8 A;  5FLV A;  2NS7 A;  2VPR A;  2DA2 A;  1ZR4 A;  3QQA A;  1JGG A;  1MNM C;  4EEF G;  4A93 J;  2DMU A;  1T33 A;  3Q0U A;  4M3F A;  1G2H A;  3MN2 A;  3MKL A;  3I4N J;  2EBI A;  3ZQI A;  5C3E J;  1AKH B;  2ID3 A;  3Q0W A;  5E3O A;  1DU6 A;  1UG2 A;  2XPU A;  4FTH A;  3RKQ A;  2M9H A;  1X2N A;  4I76 A;  4LOC A;  4B3A A;  4IHY A;  4V2F A;  4IHW A;  1Y1W J;  5F0H A;  1B8I B;  2JA7 J;  1UHS A;  1ETV A;  3S16 J;  1WPK A;  4QSH A;  3JRC A;  2K40 A;  1MBG A;  2R5Z B;  4BBR J;  1SFO J;  2NVQ J;  1XC5 A;  2E2J J;  2M8G X;  2RAE A;  2VKE A;  5E3M A;  4RBO A;  2EZH A;  5HOD A;  3C2B A;  4Y7N J;  5IYB J;  3FKI J;  4D7N A;  1IUF A;  1MSF C;  3ZQF A;  4B1R A;  3JRD A;  2JWT A;  4MFE A;  1GT0 C;  3GTQ J;  3M4O J;  4DW6 A;  3BR3 A;  5GPC A;  5C44 J;  1P7J A;  2EH3 A;  5F08 A;  3IV5 A;  1TWG J;  1JKQ C;  2JA5 J;  1DU0 A;  3B6A A;  3HEF A;  1A6I A;  1ZK8 A;  1UMQ A;  2MG4 A;  1IJW C;  2L7F P;  3A03 A;  5K7Z A;  1H89 C;  4BXX J;  3BR5 A;  3BR1 A;  1D5Y A;  1TWF J;  2K9S A;  1IG7 A;  2JJ7 A;  2LFB A;  1JT6 A;  3IH4 A;  3TP0 A;  9ANT A;  3ZQH A;  5C4X J;  1QVU A;  2K9Q A;  3GTP J;  4UUS A;  1FEX A;  1IDY A;  1APL C;  2IBD A;  1GV2 A;  3BG9 A;  1TWC J;  3G1M A;  1Y1V J;  2OF7 A;  2DA7 A;  3IH2 A;  1H88 C;  3BT9 A;  1OCT C;  2JK3 A;  3HOU J;  5M5Y J;  2WB1 N;  3JRG A;  3LNQ A;  1X2M A;  2X9D A;  3SFI A;  4I6Z A;  3GTL J;  2ZB9 A;  1AKH A;  4B4C A;  4FE4 A;  1Q1V A;  3UKG A;  2H1K A;  2M2E A;  2LLK A;  3D1N I;  2CUE A;  3VPR A;  1POG A;  4D5F A;  1B8I A;  2CUF A;  2L7M P;  1ETQ A;  1RET A;  2ID6 A;  3HOW J;  4CYC B;  1U78 A;  2I10 A;  4DYR A;  1U9O A;  2R5Z A;  3S17 J;  4M6V A;  3ZQG A;  5EGO B;  2XPV A;  2GLO A;  1ENH A;  3A01 B;  2HYJ A;  4XID A;  2LKX A;  3GBG A;  2QF7 A;  2FD5 A;  4A3D J;  1MBE A;  1H8A C;  3JRA A;  4MFD A;  1XG1 A;  1I6H J;  2CQX A;  1MSE C;  1RKT A;  2KT0 A;  2FJ1 A;  3LOC A;  1RPW A;  4XRS G;  1F36 A;  3NAU A;  2IAI A;  5F0C A;  3WHC A;  5EG0 B;  2GM4 A;  2HI3 A;  4DYQ A;  1CQT A;  5EDN A;  2KDZ A;  2YS9 A;  3B6C A;  2Y31 A;  3RZO J;  4IHV A;  4M3D A;  1ETX A;  2Y9Z A;  2PMZ N;  3QPS A;  2VUM J;  2XB0 X;  1MBK A;  5IOY A;  4BBS J;  2CQQ A;  3HBL A;  1ZGW A;  4W97 A;  4UUT A;  5EEA A;  2B63 J;  3HGG A;  5J1U A;  2DMN A;  1JT0 A;  1FTZ A;  2G0E A;  3BR0 A;  1TWA J;  5GPA A;  1HOM A;  1JTY A;  2WAQ N;  3HOY J;  5M5W J;  2ME6 A;  4A3C J;  1RR7 A;  2FX0 A;  3DCF A;  5EYR A;  1HDP A;  2LK2 A;  2O7O A;  2ECB A;  4JYK A;  2TCT A;  3BTI A;  3K2A A;  1JKO C;  1WH5 A;  4NDL A;  5E3L A;  1EF4 A;  4XIC A;  2WV1 A;  3F0C A;  4D7M A;  4QIW N;  2Y0S N;  3H3V K;  3BR6 A;  4A3J J;  1ETY A;  1RKW A;  5DS9 A;  1LFU P;  3WHB A;  2IEK A;  2Y9Y A;  2JA8 J;  3HM5 A;  5K7H A;  3BG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...