5JLZB

Crystal structure of hla-drb1*04:01 in complex with modified alpha-enolase peptide 26-40 with citrulline at the position 32
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRASSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Functional and Structural Characterization of a Novel HLA-DRB1*04:01-Restricted alpha-Enolase T Cell Epitope in Rheumatoid Arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jlzB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5jlzB01
4R0LC 4X6EA 2ATKB 5FM4A 1G7MB 1SJVA 3AFLA 3VW3H 5EUOE 1ZT7A 4P46D 4FZ8L 2JJWA 3T2NH 4D2NA 1YYMH 1YEKL 5TGBB 3BZDA 2X9YA 5LCVH 4GS7B 3RJQB 3RUGF 4L29A 3QIWD 3ROOA 3ZKND 3U30B 5HHOE 4EDXA 4PS4L 5FB8A 3BP5A 3GEWB 4FQXD 5DA0B 3BZ4B 4XX1G 1FC2D 5B39A 1JWUA 3U7YH 1OAUH 1EK3A 5DVKA 3EGSA 5C09B 1LK2A 5I8OL 3CH1B 4N8VB 2GK2A 4PJ5A 4EKXA 5BW7C 2C4XA 4RAUA 1EUTA 1FNFA 2VLRA 4S1QL 5IBUB 3N1QC 2V9RA 4OZHA 3IXAB 3OR7A 1IGYB 5D8JL 4F58H 3ARZA 3GGWA 3LH2H 2B0SH 2YD7A 4X80L 4MA7H 4P5MB 3LQZA 3TC9A 4ELME 1FAKT 4KVCL 4QRPE 3VRIA 4Q7DA 1RUPL 1GL4B 2DBLL 3WNPA 2DTML 1W8OA 5I71C 2O61B 3X3GL 5CJXA 4C56B 4X6DB 1IEAA 3T0AA 2YPVL 5F9WB 5EUKA 1HZHL 3VU2A 2DQEL 1NJ9B 3VFVA 1LK3L 1WAAA 5E70A 1Q9KB 1RUQH 4IRJC 3QPQD 5C0CB 4X6FA 5DMGC 2W9DL 4QXTA 4JO1L 4AEHH 1T4KA 3OKKA 4HKZB 4UT9H 4Y19A 3SY0B 4NZTH 2WLYA 5DRXB 5CP3H 2IQ9L 4XP9L 5B3JE 4PJHA 3JXAA 4OQTL 3G5ZB 3ALPA 3O8XC 1X5XA 1S9WA 4X6EB 4H1LG 3DIFA 2A6DB 2NTFB 5C0DB 3ZMRA 1TPXC 3QWRD 3C5ZB 2RAMA 4U1SA 4KDTA 4JFDE 4TVPL 3OG6B 4UAOB 5D7KE 2OI9B 4R2GD 3OR6B 4LKCA 3B6SA 3QCUL 3KLDA 4O2FA 3RBSA 2NY3C 4M5ZL 4OCRH 3IAQA 4L29B 3PDDA 4TUKL 1JF1A 2Z31D 4K7FB 4EDXB 3KPRE 3QDAA 4JG0H 4CN1A 4U05A 5JDSA 1B4JL 3DVIA 4G6JH 1Q0YH 4YDJB 2XZAH 4RAUB 1LO0H 3DOSA 4JDVA 4Z7WE 3QUKB 1QFWI 4X7SL 3MJ9L 2VLRB 3L3DB 2OP4L 1JPTH 3QT2A 4UT6L 2Y06L 4OZGE 3VGFA 2QQKH 4Y1AB 1Q1JH 4L3EE 1K6QH 4I9WE 3GGWB 4LCCA 1J1OH 3LQZB 3MRFB 1P4BL 2VXSH 4N1EA 3QFDA 3VRIB 3KYKL 2Z91A 3KPQA 4KDWA 1OVZA 2DYPA 1DE4A 4PRHE 5IBTH 2FSEA 4JQVA 3U0PA 3GUTA 3IFPB 2GYSA 1C1EH 2BP3A 1ZVHA 5GS0H 2V5RA 3VMPA 1M05A 3Q6GH 4DZBA 4PRBA 1ZLVH 1XGPB 5I0DA 5GGQH 1J0YA 4RX4A 5BRZB 1UJ3C 4YXHL 4QXTB 5HGAB 3OKKB 3LS4L 4Z76A 4KY1H 2IFFL 2BOCB 1ZLUK 2Z8SA 4PJHB 1KJVA 2CDFA 2PR4L 4FN0A 4PV8A 4MA1C 1MJ7H 1QBLH 4X6DE 1E4WL 4PJCA 1UCBH 4ZUTA 3WN5A 2APTA 5EA0H 1E28A 2WV3A 4TSBH 4U7SA 3TEUA 4JO4H 2AI0L 4LSVH 4PJ8B 2QTEA 1AXIB 4DZ8A 5C0CE 4LKCB 3RJDA 1IBGL 1GGYA 3UPAA 4KHTH 4O2FB 3A6CH 4AENA 4U4BA 3O6FC 4ZOAA 1GGIL 2XTLA 4HW6A 1X6LA 4WTWA 5DURD 3Q48A 4HBQA 3HRZB 3S37H 1TFHA 4ZPTA 1R3JA 1CGYA 2VLKD 3BSZH 1DANU 4EOWH 1FNEB 2XACC 1MCPL 1VSCA 1ACZA 2AERT 1G1YA 2DWEB 1VESA 2PO6D 4O51B 2Z92A 2NLJB 1OGTA 4NN5C 4JDVB 3MR9A 2DI7A 1G9MC 1FNHA 2AJVL 5I15L 1MNUL 4UDUB 4FABH 1HXMA 3NN8A 5E5UB 3HG1D 3DVGB 4LCCB 4WI8A 3HMWH 4GKZB 4LVHB 3CX5J 1DVFD 5A43C 5D7IF 1NGQL 3Q1SH 2FO4A 3QFDB 2D7OA 4PLJC 2Z91B 3IU3B 3KPQB 1HCFX 1JF5A 1SJHA 4YEFA 2DYPB 4J2XA 1P2CA 1DE4B 4YC2C 3I50L 3GNMH 5FYJD 4PJ5E 2C3VA 3OTTA 5EDXA 4WJ5B 5IESH 2AS5M 3HAEA 2KKQA 2KDGA 4Y2DB 4OZHE 3STZA 1MY5A 3ULVD 3G5VB 1R3HA 4XAWL 4G5ZL 2YRPA 4M02A 4QRSA 3T0XA 1CDYA 1A1OA 1TZIA 4JKMA 2CKNA 2XWJA 4QHLB 4XC3H 3NIDE 4Z76B 4AG4L 3QIBD 3BIKB 5BMFL 3REVA 5DEZA 4HUVB 3MJ8A 4JQXA 1OAYH 2CDFB 5DVMA 1CFNB 1MREH 3BXNA 4ZSOA 2OQJB 2UZIL 4KK9D 5T3XD 1P7KB 4AEIH 4YJZL 1F6AB 4KKBD 2WBWB 4PJCB 3LEVH 4ZUTB 1E28B 1C5DB 5ITBL 1I7ZB 4LDLB 4O4YL 4OFIA 1Q38A 1TQCB 1AFVH 1QO3A 5JOFA 2FGWL 1FL6A 1P7QB 4Y19E 4NO0A 4TSCL 3ZL4L 3H9SD 4AENB 4JVUA 5HI4D 1TVDA 2AGJH 1QR1A 4NP4H 3LN5A 1A7PH 3HS0B 4P4KC 4D0DA 5D6DA 5CCKL 4GKNA 3HI1B 4ZPTB 1B2WH 3F12A 1E4XL 4CAGA 4KK6C 4M00A 4PD4K 4XCNB 1VFUA 4WEBH 4HIXL 3LRSB 3QIUB 1H5BA 4U1GB 1JYXA 2Z92B 2C4FU 4U2ZA 4K8RD 2D7PA 1OGTB 4Z8FL 4XGZB 1LEGA 5IEKB 4IOFD 5AYQA 1RU9H 2JK5A 5TQ0H 4NGHL 1MOEA 1HXMB 3MLTA 3L3OA 3QB7C 3NN8B 4LSUL 4PBWD 4DKEL 1BF8A 2XPGB 4QRRD 4X4MA 1NMBH 1MJ8L 1U3HA 2FO4B 1Z9MA 2X4QB 5JR1H 1CE1L 1G9NL 1QFPA 1YECL 4LRIA 3BDXA 1P2CB 1S9VB 3QR2A 1ADQL 2W0KA 1I1YB 4OGZA 1JFQH 2DQFA 3G9VA 5B38A 2YXMA 5JW4M 2C3GA 4NWUH 4ODBD 1OTUC 1IT9H 3VXUB 1LEKB 5J11B 1INDH 1N64H 3STZB 4Z0BH 1R3HB 4WWKC 1G6RB 1NC2D 3SDAD 4QRUA 1TZIB 3QXAA 1DP0A 5D6CA 4BYHA 3REVB 3MJ8B 4BH8A 1CGVA 2P4AB 4Z7NF 4ODHH 3NFSH 1ZHBA 4FQLL 2XN9A 1KJ2L 1NAKH 3TA3C 4YHKH 4PR5A 4LF3A 2JCCA 4QHMB 3DX6A 2NY1B 3SDYL 3W81A 1OP9A 1X6NA 4XWGL 3SE3C 3SKNA 1QO3B 4JPKH 5JOFB 1CFQA 3HPJA 4NO0B 2QL1A 4MWFB 1F3DH 3UBXI 2R0LL 1A5FL 5GGTH 1W8NA 3EJYD 3LN5B 3DXAD 4UI2A 4D0DB 2IBZY 4WI5A 2UYLB 4R4BA 2AJXL 1JUFA 4PJCE 5E1HB 4G7VH 1CWVA 4NN6C 3SDDA 2R2CA 1CGUA 1E4KA 4JFED 1OB1A 3MLWL 5LG1A 3BMVA 1N3NB 4KC3B 1NCCH 1QOKA 4JB9L 1W0VA 3FB6A 3MRNA 1I4FA 2BVUA 3GIVA 2R56L 5IV2A 3PWLB 4H1LH 4I2XB 4C57C 1WEJH 3S98A 3CDFA 2YSSA 4P2OB 5ID1A 1U3HB 1FNAA 1XF3B 4MA3B 3OJVC 1MAMH 2IAMC 4GG8A 3ARFB 5JTWA 1NUNB 5DVNA 2WINB 4MDJA 4YO0A 5B38B 1IGIH 5DEFA 2J12B 3QDJA 1Q9WA 3HUJE 3VXOA 3BZEA 5CBAB 4MD0A 5KSAC 4GOSA 3ECBB 4WHTA 4QGYA 4HWEL 3C5JB 2XFXA 5HVFB 2UUDH 3P9LA 3G08B 2X1OA 4XC1L 2FATH 4WI4A 5TE7L 3QXAB 2XG5A 5JXEC 4IHOA 4OM1H 4CN4A 1U0QA 3REWA 4BH8B 4AQOA 1MVFA 4DN3L 4E5XA 3GRWH 3RTQB 5IIEA 1ZHBB 3QPXH 1HCVA 2XN9B 3V5KB 1AO7E 3P4NA 1CDHA 2JCCB 1CDGA 3MC0A 3BEVA 5A2FA 1JCKA 3GMMB 2VDMH 3NPZB 4FFZL 1IGTB 4MAYC 2DQJL 3WDIA 3HR6A 3L3KB 3SKNB 1I3UA 3MGTB 3O11B 4RGND 4BZ1H 1CFQB 4XP1H 2B4CL 3HPJB 1U58A 1CGXA 5CSZA 3SKOB 3DMMC 5MHSD 3N9GL 4K7PX 3VE0A 3ZDYE 5C0NC 3DV6B 4FTVE 3ZKSD 1T83A 3VXRD 1V3JA 4OD1H 4PBXA 4ZSOE 2IALB 3CFBA 4TNVF 4R4BB 4J3VA 3SDDB 3WNOA 2ARWA 1CZ8L 1OB1B 4DVRL 3BJ91 2FEDD 4HAFA 1EFXA 4DFHA 2P48B 4TNWF 5EZOH 4D9LL 4NT6A 1W0VB 3FB6B 3VXMD 3NCYS 4UNTA 5CBEA 1SY6A 4M62H 3DX7A 2RCSH 2VABB 3ARDB 5KVDH 2NY0D 2HH0L 1M7DB 2YSSB 3EYQD 4EUPB 5ID1B 3K46A 1KLUA 3UEZA 4MXWL 3IVKA 4RGOH 1CCZA 4Y0GA 4YPGA 1K85A 3FHQA 4NNPL 4AK1A 1BWMA 3W39B 4GG8B 2ADJA 3QUMA 1QVOA 2E9BA 2ZUWA 1RIVH 4GMTH 1NFDF 3FQXB 4MDJB 4NZDA 4GRWH 4YO0B 4BSJA 2OJZH 5FFLA 1YY8B 2EYTB 4WHTB 5J13C 2XT1B 2Y9RT 4WCYL 4XPTL 2ERJB 2XFXB 4OIBA 1WT5C 1D9KC 1WITA 5J7CC 3BWUC 4RIRA 5B3NA 1PY9A 4X4ME 4KI5C 3BOVA 4J3WA 2AQ1A 3L3GA 1F2XK 4G9DA 3N85L 4FXLA 4OIIL 2JB6A 3JV5A 1OM3H 4LIQE 4OCWH 1KEGH 2W0LA 4HLJA 4C55A 5DJDA 4Z77A 2MJWA 2WP3O 1JHLL 4Z7OE 2A0LC 5I2IA 2EDRA 1PG7X 3PABA 1G7JB 3P4NB 4MXVE 4XHJC 4ZTPH 5DS8A 4J12A 3BEVB 3QEQD 2PTUA 3KS0J 1EHNA 5CLTA 2H2SC 1XR9A 2AJUH 5SV4A 4QRTA 1XIWC 3VFGH 4KKCD 4GFTB 3VXTA 4IEFB 3GKWH 4N90E 5I16B 3CUPA 5CSZB 1CF8L 3VE0B 4LARL 1KSRA 3RNQA 5C0JA 2HJKB 3IXTA 1GZQB 3SKMA 1QSED 3JVGC 4GW5A 3FO2B 4LGSB 2XN9E 3V8CA 3ZYZA 5I0ZA 4FNLL 2EDJA 3MXVL 3NFNA 2YPLD 3H2WA 1F6LL 2HFGH 4KROC 1MRFH 4R97B 4QXUL 1EFXB 4I5BA 5IFHL 4P9HL 4XVTL 1IGML 1H8OA 2SEBB 1G9NC 3NZHL 1CK0L 3QAZC 3UYOD 5CBEB 3C09C 1M71A 4K3EL 1ZTXH 1JZ8A 3EFFA 1DEEA 5E5RB 4U1NA 4YH6A 4YPGB 4D94A 1T21B 5HJ3A 1X7QB 5DUMH 4GKSA 3QUMB 5CUSH 1QVOB 1S9YB 5CILL 5EH1A 4OLUL 3LDBB 5L6YL 4D0CB 1DDHA 3WHE1 1BBJA 1VFMA 4TPRH 4OCXH 5HYIA 1KN4H 3TZVC 4MLIA 5HYQA 5FEBA 4WNQB 2X1XR 2W65A 4FXGA 4BELD 4OGAD 1R6VA 2NY5L 5FGCE 4OFVA 3T2QA 4P2QA 2WUBL 2Q20A 4OCSH 5E2JA 4MNHA 2ZWLT 2WZPD 5FGRA 4G9DB 4HIHB 1F13A 1LQSR 35C8L 5F93C 3X12B 3PDGA 4APQC 1DQMH 2QQLL 5D71H 2H2PC 4Z77B 5GRYA 2R1WA 3QDJE 3PABB 4G6AC 2DQIL 4YX2H 1CICC 1A14H 12E8H 2BVTA 3ZHDA 5IR1A 1EH9A 2N7AA 4C83A 1GGCH 1QACA 1XR9B 5EU7E 4M1DL 5HY9B 4QRTB 5I1JL 1KFAH 2JJSA 3KS0H 4X7DC 2QSCL 5E8PA 3B9KC 1ZT4A 3O81A 3RNQB 1ES0A 3IXTB 1CU4L 1NMCB 4WUUA 1W72A 5D72H 1ND0A 3P0VH 1J10A 3ARED 4NCDA 1CBVH 1A3QA 3NFNB 3O4LD 4Q9RL 3D48R 1A6UH 2W9EH 1E6JL 2VDOH 3RWJA 1Y6NR 4EDWH 3UZVB 4XWOD 2V7NA 3OV6A 4KRLB 3PQYB 3QI9C 3FB7A 3V52H 4YFLF 2VR5A 2HLFD 3FN9A 1QRNB 1RK0A 4HWBH 3LSOB 4MJ2A 4OF0A 3MLRL 3EFFB 2DL2A 1DEEB 2QHRL 5E5MA 3UPRA 4P3CH 4XP4L 3B8YA 3U30C 1XF1A 4X6CA 4U1NB 1I3GL 4U3HA 2CLZA 3SJVD 5FHBL 5HJ3B 4B53A 1ZK9A 1F58L 3C5SB 1LO2H 1BBJB 1MFCH 4LHJB 1ONQA 2JF1A 3PDOA 4AEEA 2VH5H 1H3WM 4FXGB 4JRYB 4JM2D 4D0BB 3MV7A 1IE5A 4P2QB 4NM4L 4RBPH 3TO4C 3EYOA 5EZJA 4NKOA 1FNSL 2BY3A 4S1SH 4MNHB 5D7SL 4ZAKD 5C0EA 1FFQA 3RVTC 2MKWA 4J7RA 2VC2H 3U7AA 3HKFA 1G9EA 1FGVH 3MV8A 4CL7A 3WUWA 2J5LC 3GSNB 1YEHL 5ICXB 2F74A 4NQXA 4DOHE 4WHCA 3W11C 4WWID 2W9LA 1YEIH 4EBQL 3H8NA 5A3ID 4E41D 1MCJA 4C83B 4Y2OA 5INDA 3TBVA 1QBML 1MCCA 3P0YL 3QRGH 4JPVL 1INEH 5DJYA 2VKWA 1I9EA 2ZUTA 3BX7C 2NTSP 3UO1H 2DKUA 5E99H 1R0AL 3MLZH 2GIYA 5DC4B 5E8PB 3QUZB 1T5XB 2FWOB 2FRGP 5IQ9A 2EDHA 4OLVH 3T2PA 4ZODA 5J56B 2WM0A 1DLFL 3L7FA 1DL7L 1G6RL 4HXAL 4JY6B 6FABL 1U6AL 4QTHA 3NH7H 4HPOH 2IH1A 3RWJB 1T1YA 2V7NB 2BNUA 2DRUA 3GJFA 4A2MA 3D39A 4HUXA 4RQQA 3VCLB 4JM4H 4P0DA 5FOBA 5IVOA 1YNTA 2F19L 2ILLA 3IF1A 4X99A 3TH4T 1HYRC 2RB8A 5E08H 5LVEA 3O6LH 3AM8A 2AXFA 1FJ1A 3UPRB 3OWEA 4UB0L 4X6CB 4MVBC 3VMNA 2CLZB 3CLEH 4PJEB 4QHKI 1ACYH 1BVKA 3BUYA 1JHTA 1NLDH 3MOAH 2X42A 2VDQL 3TH3T 1WC7A 4K23H 5DMIH 3WIHH 1PY4A 1IM9B 4PJXE 3TNNB 4EI5D 5I1KL 1ONQB 3PDOB 2QSVA 3S37X 2XIDA 5LXGL 1NBZA 2PXYA 2BCKA 4NBYB 4XP6L 5HHNA 3WEXA 3BJLA 3MACL 1PBYA 2DTSA 2D31B 1I1AD 3LKSA 4KV5E 1J0JA 1WFUA 3EYOB 5EZJB 3GBLA 2QADC 3LZFL 1MCDA 1KF9B 1RMFH 3Q6FA 3K80A 4OTXL 5ALCL 3OHXA 1Q0XH 5AZ2L 4TN9A 4PJ7F 4L8DA 4WFGE 4EXKA 2ZPKL 3MV8B 3QDMD 3WUWB 1XF5A 2WAHA 1NQBA 3B43A 4X7FC 2F74B 4NQXB 4JZOB 5CJXC 4Y4KD 3I84A 4YXLL 3DX9A 1U91A 3O2WH 5CGYC 3BHBA 1XCQB 4P2QE 3BAEL 1YY9D 3ORJA 1SBBA 5EOQL 3N1MC 4RZCA 2Y25A 1K4DA 3K4AA 4UQ2B 2P5WD 2MCPL 5I74B 4EI6A 5F9AC 5GS0D 2WUCL 4XBEL 1DQJB 4P2RA 4P9HC 1IM3A 5E8DH 5I66A 3VWJB 3Q2CA 1GZPA 3L7FB 3LV3B 5I30L 2GSIB 1LDPH 4JFFA 3B5TA 1T7ZA 2EDEA 4NQEB 1TJHL 3QNYB 1YEEL 2IH1B 3E6HA 1T1YB 4RISH 1PX4A 4U6VH 1CLYH 4KDTC 3RWCB 1JPFA 1RUMH 3RIFF 2BNUB 4L5FH 3U9PH 5J3HD 3QUYA 3E1F1 3GK8H 4RQQB 4PLNC 3IT8D 1P5VA 2CMRL 5FOBB 1YNTB 3DXAE 4LCIL 5DQ9A 2AXFB 2CXKA 2ARJQ 3WSQH 3V6FA 4QOKE 4XCCL 3ARTA 4WUUE 4OQ1A 5FO7A 2GTZA 2NY5C 1XGYL 4WHYG 1KPRA 4YFDB 4ZXBD 3BUYB 3DBXA 1UB5B 1WC7B 4FQCH 5D7JA 2GT9A 1U8KA 4IOIA 5SWZA 2X4OA 3WEXB 2GY5A 1WSST 4EN3D 4IDJH 4KVNH 3LKSB 1BM3H 3B2VL 2JKXA 3T3PF 4EQ2A 3GBML 5DMKA 5FIEA 4BSVB 3DPBA 4LCCC 4X6CE 5IMMA 3OHXB 4EIZC 3VH8G 1JZ3A 1J1PL 4YDKH 4YEEA 4OZFA 2D9QB 4G8GB 1T66D 1F4XH 4JQVC 3IDGA 5EPMA 3QEHA 3BHBB 3MV7E 3HI5H 3W0WD 4HIEB 3HLAB 1OD9A 4OD3L 4XPAH 4RZCB 5HHPA 4ZFZA 1K4DB 1A7NH 3ZE0F 3B9EA 1T89A 3RVWD 4G7YL 4OLXL 3MYJB 4P2RB 3WJJA 2W60A 4LSRH 2CUMA 3MV8E 2XZQH 1CTNA 4QNPE 2IF7A 3CFDB 3KLSA 1OLZA 3SE4A 2BOBA 1IMHC 4HG4K 4YDVB 3E6HB 3WN5C 1UB6A 4RFEA 5H94A 1X5HA 1FDLL 1V3MA 1U42A 4OIAA 4MNGE 5FUOH 1EX0A 2OMNA 2G9HA 1JGLH 1DBBL 1G9MH 1U8IA 2KL6A 5IHUL 1G0DA 1W0YT 1GIGH 4PJAE 1VACB 5DQ9B 1BVLB 4W4OC 3V6FB 3JWOL 4HC1H 4IRZL 1DBKL 3ILPA 1EBPA 3UBXA 1RZIA 1MCFA 1EO8H 3MTRA 1H3UA 1REIA 1HHHA 1S5IH 3LY6A 5D7JB 4PJEF 2HG5A 4ZDHA 1FFPA 4IOIB 2E8YA 5K9QI 1HK6A 3D39E 1RK1B 2WBJD 4AT6B 3GI9H 4O2CA 3HMXA 5TDOB 3UJTL 3ZT7A 3FRUA 1Z5LA 2COQA 4C58B 3W2DL 3V6BR 4S0SD 2J8UA 3MOBL 1LILA 5GRUH 3CCHA 2B1AH 5ADPL 5IMMB 2XTJD 2H32A 5KZCB 4G3YL 2AK4D 2OK0L 3BKML 3BVNB 2P8MB 3OKMA 1OGAD 2HVJB 5EOCL 2VXTL 2F53B 3UTQA 2AV7A 4ZO6A 1SY6L 2X1PA 2O93L 4AL8L 4OZFB 1UFUA 4FZ8H 2ARJA 3KR3L 2BHUA 2WQRA 1MF2L 3FO9A 3PXJA 4MNQA 3WNKA 3QEHB 2FB4L 2FIRT 4M9OA 2EKJA 3QNZA 4FP8H 4JDZA 5ESAB 1L9NA 3OKLA 5J11C 3RDTB 4PS4H 4ZFZB 3QUML 1PLGH 1MFBL 4U1IA 3U48A 5D1XD 3WMSA 3HE6A 5JHDD 1RD6A 4J3UA 3HZYA 2EC8A 3V4VH 4JQXC 4LPWA 2FZ3A 1DCLA 4LHUG 5IEHA 4LCWB 5JMOC 5F6IB 1IAIH 2WIMA 2BOBB 5F3BA 2VZTA 4S1QH 4M4RA 5H94B 1QFWM 3D25A 5D8JH 2R1YB 1GSMA 3RKDD 2VISB 3EO1A 2E9JA 4U3XA 4X80H 3UTTD 2VTFA 4NQCA 2QKIB 4KVCH 1B6UA 3IFNL 3WJLA 4RDQG 2G5RA 1F8TH 3ZTNL 2DBLH 3MRRA 4P2RE 2DTMH 1DQQA 4GRMA 5T1LD 1LP9A 5ACLA 1DQLL 5GSVA 1XGRA 3X3GH 1B9ZA 2RGSA 1P9MA 4JFFE 4Z0XA 3ILPB 1N6UA 5TF0A 4NZRL 2HTKC 4PJGB 2DQEH 4JO3L 3UBXB 1RZIB 1ZMYA 1BQHA 1LK3H 2OXGA 3MRMA 1HHHB 5IMOA 2QBWA 2NY7L 4NNYB 2QHLA 5DJZA 5C6WH 5TPWL 2Q76A 4X9GA 3RY4A 3FFCA 1Z0NA 3AXLB 4JO1H 1H5BC 1P1ZB 4O2CB 4XNYL 3G6JB 3L6FB 4HBCL 4HULB 4JANA 2IQ9H 4XP9H 5I1EL 1W0WB 1DN0B 4PP1C 1XGUA 5K9JL 1A6TA 4X6BB 3S36L 5CGTA 2H32B 3MBEB 1IAKB 2EYRA 1DEDA 1U3HC 1T1WA 4TVPH 4Y4FB 1J9CT 4QXGL 5I8EA 2AV7B 2XG4A 4LRIC 5IM7B 2ARJB 3FO9B 1YMMA 4RGMB 5CZXD 1D5XA 1YMHB 1ZWIB 3QCUH 4MNQB 4XP5L 5SWZE 2X2YA 3MRIB 3QNZB 4M5ZH 3GBNL 1YN7A 4I8DA 3UROR 4TUKH 1JPGB 4GW1B 4WW1A 1H3PL 1MFAL 4KPHL 4M9PA 4KJYB 5JUEL 4U1IB 1A64A 1T20A 4OGYH 5EN2A 2XY1A 1D5BA 3EO9L 3LKRA 2FZ3B 1B4JH 4OLYH 5JPMB 4N8VG 5IK3A 4X7SH 3MJ9H 5F3BB 1UCTA 4ODUB 1IGFL 3U4EB 2OP4H 4GAJL 2AKRA 2EZ0D 4GBXA 3H9ZA 4NN7C 4XXDB 4UT6H 2Y06H 1A8JH 3D25B 1Y6KR 2XWTA 4Q9QL 3T4AA 3VDBA 4O02L 1DFBL 3P30L 5FYJU 1CL7L 1RI8A 3GSNL 3KYKH 5C70A 4M3JA 1ZGLM 3MRRB 3T08A 1DQQB 4GRMB 1LP9B 2DS4A 2VQ1B 1NCTA 3NOIA 2YA0A 1J88A 2VDLH 4V1DA 4Z0XB 2Q3AA 4OF3A 2Y5TB 3ET9F 3HB3C 3GMPA 1TCRA 3AROA 1UH3A 1OP3H 4R26L 3SDDC 1N2RA 2BC4B 1E4KC 1JPST 5DJZB 1Q9LA 2Q76B 4AYFA 3FFCB 4YXHH 2OMBA 4ZOCA 3LS4H 3MNWA 2ZUQC 1FLTX 3FZUD 3K1DA 4R3SA 2AV1B 4D9RD 1WBYA 1VB9A 1XGUB 2PR4H 3WLWD 3U4BL 2YD4A 4JZJA 5C86A 2FX7L 3O2VL 4LEOA 1E4WH 3QNXA 4PJ9D 2OX5A 3MUGA 2EYRB 5C0BB 1F97A 2DLGA 5TH2A 4OF5A 5K9KB 3T3ME 2AI0H 4MS8D 4OKVB 3N1PC 4OV6F 1YMMB 2DMKA 1IBGH 3DTXA 4IDLA 3VGAC 3GKZA 3QQ4B 3VWKD 2IBBA 3MZTA 5GZOD 4GO6B 3MRLB 2X4TA 2AEPL 5KANG 4WHYH 4XNQA 1CR9L 4FXKA 5HYFA 2J8UE 3PIQB 4WW1B 1GGIH 2P5EE 4RRPA 2ERJC 3F7YA 1I9RL 5TDPA 1UG9A 5EU7C 3ZT5A 1J05A 3RIFK 1T20B 5TQ2L 3T0EA 5EN2B 1CT8A 5B39G 5DVLA 1IQDA 5L2KB 1BOYA 3LKRB 1MCPH 2XWBA 1AY1L 5C07D 1TTUA 1MQKL 3DYOA 4ZS7H 1IAOA 2B2XH 1QSFB 1G0XA 1CDJA 4F8QA 3SDCD 5KSVB 3IJSB 3QQ3B 1MNUH 1P4LA 2AKRB 2HLAA 4GBXB 1QFWL 1FIEA 2JB5L 4I0PD 3T4AB 4LCUA 3TJEL 3OKOA 1NGQH 1ED3A 2W1NA 4LVNB 2Z93A 4R90L 2VQUA 3KHOA 5IB5B 4O00A 4U6HA 1T83C 2VQTA 1XT5A 4OUOA 4F7EA 4P46A 5C6PB 3HNSL 1I8IB 1U8OA 3GMPB 1TCRB 5CMAA 3QXUA 3P77B 3MRKA 4LNVA 3RU8L 4Z7VA 1NGXB 2NY4D 4XAWH 3DV4B 4G5ZH 1Q9LB 1GH7A 4PJGF 1LGVA 4BZ2L 4ISVB 3MLSL 43C9A 4NQCE 4AG4H 4J8RA 5BMFH 1U8NA 3VMOA 4P4RB 1A6ZA 2X70A 1FBIL 2X40A 5IMLB 3LMJH 1LP9E 3BH8A 4M7LT 3G6JF 1OTTD 2UZIH 2NNAB 4L4TD 2Y1VA 3QNXB 2R29H 5JO5A 3MUGB 1OAQL 3VG9C 3FAXA 4UILH 1KOAA 3OMZA 5BQ7A 4HKBA 4O4YH 1S8DA 1MFNA 3H9YA 2FGWH 4ENEC 4TSCH 4GXUM 4XNQB 4KXZH 5JORA 4M48L 4PGEB 5E6ID 5TDPB 3BIAX 4HGWB 3MJ7A 3VD4A 4LPXA 1DBAL 3ZLQC 5F1OB 1J05B 2O26U 3T0EB 4MJIA 1CT8B 1E4XH 3NPSB 1IQDB 2FH6A 4M1CD 3RBGA 2XWBB 4HIXH 1VFBA 2EH7L 5AZEH 2F54A 4X7EC 1TVBB 3C2AL 1YMME 2MHAA 4Z8FH 4TUOA 4P49A 1SM3L 2BY2A 4F37K 1P4LB 2HLAB 5ENWA 4WUKL 2NXZB 4LBEA 5J1AA 3I02A 2DN7A 4PB0L 1F45A 1UQSB 3D1MC 4LSUH 4DKEH 1N8ZB 3ALWA 3NACL 4BQ8A 1MJ8H 2GHWB 2NZ9D 3OKOB 4OJFL 5E8NB 1ED3B 1JN6B 1G9NH 1YECH 3TBYB 3IDJA 5EC1A 4C4KO 3PGDA 3QWRA 4U6HB 3JTSA 1ADQH 4F7EB 2Q87A 4YZFE 3DVFA 2HN7A 4P46B 3U36A 5IF0B 1JI1A 5GGSA 4Z7VB 3MRKB 4XCFL 4A6YB 3IFOA 4FFYL 2R69L 5DD0L 3UTSA 1XZ0B 2Q6WB 1YEFL 3QIWB 3ARBA 1A6WL 1HDMB 1X5YA 4WEMB 43C9B 5FGBA 1U8NB 4NM8L 2X4PB 5DEGA 2WIIA 1BZQK 1P69B 1JWSA 1X5FA 1A6ZB 5FV2A 2X70B 4ESKA 2JJVA 3BQUD 2VN7A 2VZSA 4FQLH 2CXGA 4TTDD 3ARPA 5JO5B 5JW5A 2XKNA 1ZVSA 4V1DE 1JZ6A 1I1RA 3OZ9L 4HKBB 3SDYH 4S10A 1WFOA 2XY2A 1S8DB 2ADGB 4XWGH 5GGUB 5D5MB 3LKQA 2QV2A 1YPZB 3ZHKA 3EZ8A 3BPNC 2ICES 3QWQB 5MENA 1DZBA 5JORB 2R0LH 1A5FH 1BZ9A 1OAKL 3O41B 2Y36H 5L7XL 4IOSD 4LCYA 5EIVA 5F71A 3TV3L 4AJ0A 1T5WA 2AJXH 1A6AA 3CSYB 2HJLA 2W91A 4MB3A 25C8L 3UZQA 1JBJA 1IKFL 1I3RA 3BE1L 3MXWL 4JO2L 1U8PB 4CMHB 5EU5A 3GJFK 3RZWA 1L6XA 3E0GA 4JB9H 1CD9B 4OZ4B 1ZLSL 2LV4A 3B2UC 1S7VB 1AQKL 2NXYC 2R56H 3QG6A 3ETBF 5J1AB 5EU3B 3I02B 2JJUA 1YYLL 4JGUA 2C7UB 1N0XL 4TQEL 3T0EE 3QH3B 4KRPC 2JJSC 2MSPA 5L9DL 5EC1B 5H8DA 4NNXB 3PGDB 2ZUXA 3DSFL 3F6IA 1O5DT 2HN7B 5E6ZA 3B83A 2E8ZA 2RFXA 3HAEG 3TIDA 4HWEH 4L8BB 1PSKL 4OZIB 4XC1H 3IFOB 4LLMB 5TE7H 4M4PA 1WBZA 2EDTA 3ARBB 3MRJB 4Q0XL 1FN4A 3O3BA 2C1OA 1B4RA 2WIIB 4DN3H 1JWSB 4GG6E 1K3IA 1VGKA 1S9KC 2Z35A 3RVXC 3OB0K 4D3CL 5F88B 4U7KA 5JW5B 4M7ZC 4ZNEA 3HC3L 4FFZH 3QSKB 2IGFL 3BIBX 3QEGL 2DQJH 3WNNA 5KAQF 1ITBB 5C7XL 3EOAA 2VDPL 1QPXA 1T80A 1EJOL 3HUJF 4ODSL 2HKHL 4LSTH 2YC1B 5EU6A 3UMTA 1GYAA 1KV3A 3IDNA 3N9GH 2PYED 3NGBB 1MWAA 1ZGLP 1NCDH 1MLCA 1GGTA 1SJEA 2K1MA 2X44D 1RUKL 3DYMA 5FYKD 1A4JB 3WS3A 4NBZB 2JELL 4F7CA 3S8WA 3QEUA 1NDMA 1CZ8H 3HMXL 3T0BA 3WD5L 5EU5B 1KTLB 4D9LH 3M1BA 4IRJD 5GISH 1HEZA 3QCTL 5DMGD 4K3DL 2X4SA 3VFTA 2HH0H 3I2CL 1ZT1B 1IQWL 3OF6A 4QKXB 4GKOA 4LL9A 3P2TA 3K2UL 3FKUS 3O8XD 4MXWH 3QHFL 4MJIE 1ZEAL 3ULUF 4NNPH 3B5GA 3MRBA 5I74C 5DGRA 4U1HA 5B4MC 5H2BA 2F54E 2PW1A 3CFKA 1X5AA 3HNVL 5B38G 1U8QA 4D9QE 5DRZA 4XPTH 3TIDB 4RAVA 3SGEH 2NY3D 5EOTA 1A9EA 3MRHA 2H3NB 4LRNL 3HPLA 5FCSH 1VHPA 1WBZB 4QHNA 3MRQB 1B6DA 1FN4B 3O3BB 2C1OB 4K9EC 3RWFA 5DURB 4NKDA 4M7LL 4Y8AA 2GITA 3N85H 4KKLC 4OIIH 1VGKB 1C5BH 1FSKC 1F11A 2VLKB 2Z35B 4XVJL 4X5XA 3CVIL 1N6QL 5KSUB 3IDXL 3CDGA 5D1ZA 1JHLH 3AM8C 2JLLA 3BP7B 3CSBA 5F7DA 3PWUB 1J8KA 2V2XB 2PO6B 5SX4H 5C08A 2VLLA 3NCYP 3KJ4B 4PRNA 4AM0A 3MLVL 5LGHL 3EOAB 3UTSE 3MLXL 2I27N 3HG1B 2Z9TA 3FQRB 5FF6A 1IEBA 4PGZA 4X9IA 1CF8H 1DVFB 2PXYC 5D5MF 4LARH 1XGTA 2YUVA 3T0DA 1MWAB 1VENA 3BN9C 3D18A 1OQOA 2CLVA 4WRLA 5D7LD 2FL5A 2X05A 5FCUH 3LPGA 4FNLH 3MXVH 1TJGL 4NYLB 4LKXA 4HPYL 3HCVA 4UQ3A 1KIPB 4QXUH 5IFHH 4MCZB 4P9HH 4LLDA 3GSVA 4L9LB 2GK0B 4XVTH 1IGMH 1HEZB 3K81A 5F44A 2AEWA 2FX8L 3NZHH 1CK0H 1NC2A 1FV1A 5B8CA 4PJIA 3VFTB 4K3EH 5MENE 3O45A 1BAFL 4N0FA 3QIBB 4GRLD 5FM5O 2BNRD 5F70A 3MRDA 2YBRA 2WWKO 3BGMB 1R3LB 1AD9A 4I48B 4QXWA 2BNQD 3MRBB 1BQSA 5BS0D 2DM3A 1MRDL 2YD1A 5L6YH 5H2BB 3WE6B 7CGTA 5MI0B 5F9JA 5AAWA 4ZUWB 1CDIA 1U8LB 3G5XA 1J8HA 1LO5A 1Z9LA 2NY5H 5DRZB 1BF2A 1BX2B 4FQ2L 2WUBH 1KYOK 2CSPA 2KPNA 5HVWA 4OT1L 3K2MC 4BSWA 3VXQA 3MRHB 1RY7B 3HPLB 3GSXB 3H9SB 3O6FD 4XMPH 4AZ8A 1RZJL 4KTYA 1QUNA 4QHNB 5JW3H 4K7PY 2D0FA 5I18L 1LHZA 4OZIF 3BD3A 4S2SA 4KDVA 35C8H 1MCWW 1KCSL 4O2EA 4X5XB 1URLA 5D1ZB 3C9NB 2ZP0T 3LIZL 2DQIH 5DD1H 5F7DB 4HWBA 2R2EA 1X44A 5EIIA 3BEWA 2VLLB 4H20L 4AM0B 4N9GA 4M1DH 5I1JH 1S7SA 5D7JC 3W5NA 1U8HA 4TRPL 5HGGS 3VXSA 5I1GH 3WDJA 5FF6B 3K7UA 5J0BA 2QSCH 4QRRB 4PLJD 5I73B 1AQDA 1FYTE 2HWZL 3F65A 2VAAB 1A1NA 1CU4H 1NFIA 2CLVB 2FL5B 1XEDA 4OLWL 3IS1X 3EYSH 3O3UN 2H1PL 4YHYC 4S11A 5EULV 4AIXA 4ORGB 5HYSA 4Q9RH 1E6JH 4G8EA 3T2OA 4DUXA 1Q72L 4YHIB 2I9LB 3ZDZE 2HAZA 4JFZL 4F8TA 4PG9A 1ZSDA 3ES6B 1XGQB 1RVFL 4XZUA 1NC2B 4Z78B 2JIXD 2IADA 5B8CB 4PJIB 3FT2A 5EU6E 3SDAB 5T1KA 3O45B 4JGJA 3V8OA 4N0FB 4DEPC 4GRWE 2HT4D 4GW4A 3MLRH 1JYNA 5BJTA 3MRDB 2QHRH 3D0LA 4XP4H 2YBRB 3RNKB 1I3GH 4KK5D 5FHBH 1AD9B 3L95A 1T89C 4K71C 2FECI 8CGTA 5EORH 2E9WA 1QA9B 1F58H 4DKFL 3WJJC 5F9JB 4EXPX 3R8QA 3G5XB 1J8HB 5E9DD 4QRQB 4NM4H 2I60L 3SE4C 4CNIA 4R4NC 4BSWB 4Z95L 4RMUA 4P99A 1FNSH 3QYCA 5D7SH 2GW5A 5CD3B 4P4KD 4U31A 3RL2A 5IWLA 2NR6C 4M43L 3AMLA 1CD0A 4KK6D 4O2EB 4W6WB 4QLRA 1A3RL 4X4XA 1YEHH 4JFEB 3INUL 5I76A 5KS9B 3M07A 3PWPA 2FH8A 4HKJA 2VXUL 3TT1L 4N9GB 4X5WA 3NA9L 4JPVH 1KPUA 3F58L 3H0TA 5EZLB 5I19L 1U8HB 3VXSB 5FM8A 1R0AH 4CDHA 3WIHA 5HHMD 2CUHA 5FYLE 3MCKA 2V9TA 3MMEA 1FZKB 2DIJA 2YXFA 1A1NB 4EZMA 1NFIB 1DLFH 1JGEA 3KJ6H 3CXHK 5FECA 1DL7H 1G6RH 2MKLC 4HXAH 4A6YL 6FABH 5HYSB 2IPKA 5EZIL 5C08E 5HGHA 2VLMD 1IGJA 4KGJA 3KPNB 3NBNA 5IB1A 1ZSDB 3V79C 1K4CB 4FHBD 4H0GA 3O6ML 1W2KT 4OCMC 1FH5L 5MEOA 1NFKA 2IADB 1H15B 3QUXA 3OJDA 1OOAA 2B7DT 2F19H 5LGKA 3ULVF 2ED8A 4GW4B 1ZAGA 4BJLA 3T4YA 4XTRC 3TYGL 4UB0H 4FS0A 5IVXB 3L95B 3TA3D 3HE6C 3SDXF 2VDQH 5AAMA 5FDYA 2OR8A 4KRMB 2OZ4A 4HJ0C 4MSWA 5I1KH 2BVQB 3RGVD 1NLBL 4OB5L 3EDJA 5LXGH 4NHUA 5CEXA 1BGXL 4XP6H 3MACH 4RGNB 1P6AB 4CNIB 2ZUYA 1B0GA 2VIRA 3VD3A 1E6OL 3LZFH 1I7RB 1JK8B 3MLYL 3VXRB 4LNRB 4OTXH 3WJLC 4GUPA 2IPUK 3EIFA 4ZNCD 1JNNL 2ZPKH 3GSQA 4OF6A 2PKDA 4JQIL 2GJ6D 3TYFB 4MD4B 1P9MC 1J8HE 4YXLH 3PWPB 2CRZA 4HKJB 3VXMB 4ZD3H 1EHAA 1ORQB 3BAEH 2ICWJ 4X5WB 2HKFL 4FFVC 4W81A 1YQVL 1LD9A 5EOQH 2X89A 4PJXF 1KPUB 1D5IL 2NY0B 3H0TB 1KNOA 3MROA 3GSUA 3T65A 1MHCB 1RULL 3V7MA 3DVNB 4R4FH 2MCPH 5T33L 5C8JA 2EDWA 3UTOA 1I8KA 2WUCH 2IAMD 5CKAA 4HUWB 4PYHA 1MEXL 2NW3B 5C0GA 3GMLA 4MAUL 5EO9A 4JE4B 5FECB 1HI6A 5I30H 3EYUH 3RWGB 5IB2A 1UXSA 2IPKB 1TJHH 1YEEH 1Y6MR 3ARVA 5HGHB 2ESVA 1IGJB 1Q9OA 3U9UB 4KI1A 2A9ML 3WL9A 5IB1B 5LJYH 5C3LD 4LLQA 3NFPB 4ZS6C 4P5TD 3EJZD 3VXSE 5D2LE 5MEOB 2I9TB 1A7OL 5GRWA 2NX5A 2CMRH 3OJDB 1KCLA 3KPSD 1MQ8A 5CJOL 1PQZB 5I1DA 4XCCH 2ICEB 1EHXA 4PTUA 2C1PB 1MHPL 3L5IA 2LU7A 3PGCA 3KWWA 1NC4D 4MSWB 3H3PL 3Q5TA 3VI4E 3NIFE 4MAYD 3QEQB 3RWEA 2DQCL 5HGDA 1VGEL 1P5UA 1XCTB 5CEXB 2BSED 2IMMA 3KXFD 1MCWM 4XNZB 1BHGA 3DMMD 3B2VH 4GBXC 4H0IA 2ADIA 4M1GL 5C0ND 3CAFA 3GBMH 4HIIB 3T8XA 5F3HB 1J86A 2VZVA 3OKDB 4ONGH 1EGJL 4YR6A 1QSEB 2A6IB 4IRSA 5ELIA 3QFJA 5IB3A 4GUPB 4HDIA 3AREA 4LVNC 2PN5A 1J1PH 4GSDH 1HH9A 4F3FB 2YPLB 5IFJB 1XH3A 3GSQB 3KYMB 3WUWG 4HFUL 3KNBA 5JPNA 2VITB 4EUPH 1QYGL 4G80B 3QZWA 3TT3L 4LU5L 1Q8MA 1AKJA 5KS9F 3F7RA 4HC1A 1OPGL 4OD3H 3WXWL 4M6OL 3UJIL 3MO1A 3GSUB 1VADB 3V9FA 1F4HA 2H26B 1PYWA 1JVKA 1GOHA 5EFIA 4G7YH 4OLXH 3S4SB 5C8JB 1TZHB 1I8KB 3IDYB 1PAMA 4P48A 4U1LA 1WIUA 2X4NA 1NKRA 5F8QC 4PJBA 4J1UA 4JRXA 5EO9B 2DQDL 3IETB 1HI6B 1UM4H 1TDQA 4DQOH 4JZJC 4NQDA 2EXWC 1UXSB 4PRAA 3BWAA 3PWPE 2ESVB 1CVSC 2EC9T 3QQNA 1D9KD 4R9HA 4ONHB 4X8XA 1FDLH 4F7MA 1BEYL 2J6EA 5DHVB 1F00I 3NVQA 1DUZB 5JLZB 5KBNC 2QSQA 1DBBH 4KI5D 2R39A 4WI3A 2OCFD 1KLFA 5IHUH 3VDCA 3BD5A 1AGCA 4KU1A 5I1DB 5BO1L 4RAHA 1EEZB 1DLHA 3JWOH 3TBTB 3VJ6A 2O5XL 3S96A 4PTUB 5CJQL 2A0LD 4IRZH 1DBKH 5CINL 4XHJD 3T0EC 3PGCB 3NPSC 2AK1H 5E2TL 2H2SD 2YZ8A 5IVXF 4E41A 1XIWD 1MWAL 1DUYA 4PUBL 3UJTH 3L5HA 4EVNB 4DAGL 3MOBH 3M45A 5FYJL 3QBTB 2ZG1A 3T8XB 5JOPE 2R1XA 4CDGC 5HHOD 3FT3B 4G3YH 2FYYA 2RBLA 3BKMH 3WFDL 4YR6B 4BFIB 4BQCA 2OK0H 5EOCH 2VXTH 4HDIB 3AREB 1Z0MA 3ARGA 4KROD 1SY6H 1HH9B 4PJAF 4AL8H 1GC1L 3OKNA 1XH3B 4IIQA 1MF2H 3IYLW 1TZGL 2ITCA 3S88L 2FB4H 1YC7A 4P46C 2AAVA 1V8HA 5ETUB 1AKJB 2CJUL 4FFWC 5T3XL 3QUMH 1S5HA 3MO1B 3CSPA 1AP2A 3P11L 3QJHB 1YNLL 1MFBH 2M2DA 4DJMA 3K0WA 5C2BH 4CJ0A 3NIGE 4DK6A 4HZAA 3VFOA 2X4NB 1A9BA 2R23A 4PJBB 4JRXB 4OI8A 2D7NA 3DECA 2UWEB 2Q7NA 1DTUA 4P3WA 1IL1A 4LHUD 4NQDB 4PJFA 4KMTL 3TZVD 3V2AR 4PRAB 2DLEA 3M17A 2DMBA 4OQTA 5DRWA 4JM2B 4WWKA 4G8FA 2YHGA 5FYLL 1PEZA 2VUOA 5F72S 2I07B 1E27A 5L8LB 1ZANL 3TESA 4ZAKB 1RIUL 2Y7QA 4M03A 3ZTNH 1V7NL 1R5WA 3T04D 3RWIA 1AGCB 3KDMA 1DQLH 3IJHA 4APQD 3WIFB 4XPGL 4I1NB 1T7WA 4K8RL 1DLHB 4O58L 4HUMB 2P7TB 2H2PD 1EBAA 1D6VH 4P57A 3QDMA 4NZRH 4JO3H 1CICD 2ESVE 3ZE1F 2NY7H 2P8LA 5FDWA 4JFDD 5ICYA 1BOGA 3GMRA 4E41B 4M3KB 4B50A 1DUYB 5D7KD 4XNYH 3OL2A 2NX5E 4HLZH 4HBCH 5F6HJ 2BNRE 5I1EH 4JFYB 3B9KD 5K9JH 2A83A 3S36H 4Y4HA 2R1XB 4LASL 2G75B 3MJ9A 5E4EB 3SBWC 3TBSA 4JJ5A 2FYYB 3KPRD 4PLOB 4TULH 1IEHA 4QXGH 3FB5A 5ICZA 1GAFL 4IIQB 3PHSA 1FRGH 2KQNA 4OZFG 4Q58C 3NABL 2D4FA 4M6MH 3QI9D 5DC0A 4XP5H 1WWAX 3Q5YA 2VL5A 5ERWB 2Q7YA 1C8PA 3GBNH 5CIPA 1FZMB 5HYJA 4KPHH 4NQTA 4ODWB 4X9HA 1EEYB 1IAMA 1S5HB 1ZXQA 5C0AA 5JUEH 4L3ED 4JJHA 3QP3A 3ARBC 2FJGA 2G2RA 3QFJE 3VFOB 4HEPG 3EO9H 1A9BB 4UV4L 2AW2A 2R23B 1WUNT 4ZXBA 4UTAL 3CD4A 4HXBL 1IL1B 4PRHD 5DD5L 4PJFB 5KSAA 4G43A 4ODVL 4HUNB 3ZTJG 1IGFH 4KAQL 1FYHB 2E6PA 4GAJH 2FIKA 4G8FB 1O0VA 2W0PA 3TO4D 1T1ZB 4Q9QH 1BVZA 4O02H 4EN3A 4WW2B 1I1AB 2CRIA 1XAUA 1DFBH 3HZKB 3P30H 2EDOA 1CL7H 4K94L 3RVTD 4S0TD 3GSNH 3QDGA 3LRGA 5F1IA 4AEFA 4JKWA 2LAGB 3NGBC 5AWNL 3GMQA 4FMFA 4HH9A 1NCWL 5KG9A 1NEUA 3I9GH 4NQDE 4P57B 3QDMB 2YUXA 4P23D 4PYGA 1VFAA 4WENB 2EDLA 4R26H 4UNUA 4Y4KB 2P8LB 1F4AA 1UVQA 5ICYB 3C6SB 5CJ8A 2HP4A 3GMRB 5T1MA 1YA5A 2VDNL 3E6FA 1U92A 4KGLA 1R3IL 5C0CD 3J7HA 2Y5EA 2P5WB 2Q86A 4HMDA 3T0WA 5BVJA 5HHQA 2A83B 3U0WL 2FGZA 1A1MA 3U4BH 5JA9A 2WW8A 3H9HA 4WO4A 2FX7H 3O2VH 5JXAL 3GM0A 5J6HA 1S78C 5A40E 1GGBL 3F6LA 4JDTL 2DF3A 3MRGB 3KPMB 2ORBL 5E9DE 3RUGA 4Z9KB 2VL5B 4U1MA 2AEPH 1VCAA 1X5GA 5EBMB 1CR9H 1TIUA 5E2VL 3RX8A 3BGFC 3OKEA 1I9RH 5C0AB 1UYWL 3MRCB 3BKJH 2V5YA 5MEPA 4ZOEA 5TQ2H 4JPIA 3O6KH 4MVBD 4PRPA 1WZ1H 2CK0L 1JGVL 3T09A 1AY1H 4ZXBB 1MQKH 3CFEB 1CE6B 4MHHG 4L3AA 3QQ9C 4G43B 4PJ5D 1JV5A 4WU7A 1V5JA 2UWEF 4XNMB 3T3MF 3KYOA 2RQ8A 3G5YB 2VLRD 4MB5A 5I9QB 2JB5H 3KJ4C 4EN3B 3TJEH 2EIEA 3S9DB 2QADD 4R90H 5F1IB 3RWDB 1NPUA 1FVEB 4IMLA 1HHGB 5D4QA 3D3VA 4HH9B 1FPTL 1AR1D 4HWZB 4P5KB 3HNSH 5IGXH 5ANMA 4Y16A 3RU8H 5CGYD 1BQHG 1WVZA 5AG8A 2P44B 2L4OA 4H5SA 4BZ2H 5DJAB 3E6FB 2KZ1B 3MLSH 1U92B 4ZTOH 3S3PA 1F4WH 4TVPE 2VMFA 1I9JL 1JHKL 2Q86B 4Y19D 1HINH 5HBBA 5HHQB 4YFLI 3AS2A 4XCYA 3AS1A 4YGAB 1HILA 3WNLA 2H6PB 2V7HA 3QIBC 1L0QA 4WO4B 1N5AA 3PWVA 1NGWA 1OAQH 3SKJL 2Q8AL 3UJJL 3GJFH 3HTLX 4K55A 1F3JA 4YHNB 1RJCA 4Y5YB 3VI3E 3E2HB 3O2DL 5MI0C 1A4KB 2FEEI 4U1MB 1U9KA 3VXNB 2VLJA 3UTTA 3EJJX 2JJTA 4N0YL 5DDHB 1LNUA 4XI5C 4R8WL 3B8SA 2ENSA 5MEPB 1DBAH 3TN0D 4HX1B 4Z5RA 5J9PA 4JPIB 3QJFB 1FVCA 1EO7A 2X4RB 3ZKQD 3WLBB 2DI9A 1CGTA 2EH7H 1QKZL 3GJEA 4F7TA 2EDQA 4YAQB 3C2AH 1MY7A 5D1ZC 1NEZA 4XPFL 3V0VA 1JV5B 4K7PL 3QXVA 4UU9A 3DYPA 4WUKH 3KYOB 5HYJE 3PJSB 4PB0H 2HJFA 1KJ2A 2BSTA 5C0AE 1XR8B 2L7JA 3MNZA 3NACH 4KK8C 4NQUA 5CEYB 4WV1A 2OTUB 5BOZG 1WF5A 1ZKAA 1KCVL 4OJFH 5AEAA 4BUGA 3VFSB 1CFTA 2XTJB 4YNYA 2AK4B 1OGAB 4GQ9L 3S34L 1I1CA 3D3VB 2BY0A 3O4OB 4KHXL 1ZHNA 4ODXA 1NSNL 4XCEB 3WFEL 5ANMB 5ACMA 1UEMA 3BFOA 4FFYH 2R69H 3RA7L 5J12B 5DD0H 3S35L 4YUEL 3WS6A 3HN3A 4KJWC 1YEFH 5HI5C 1A6WH 4PGDA 4ELKA 4RX4D 4NM8H 3QDGE 4FRWA 5B8CC 3OB8A 5JHDB 1H8NA 1FLRL 3Q3GA 1ZVYA 5FUZL 1N5AB 3R1GH 1JNLH 2Y6SD 4LVOB 2ATKA 3OZ9H 4UBDD 1G7MA 1IAII 5GHWL 1EZVY 2IPUG 2GQHA 1FNGA 3O0RH 4N0CC 4JFHE 1HHJB 3PG2A 5FYKU 4YZFF 3FRPG 4LDEB 3UTTB 2YD9A 5TGBA 4JRWA 1OAKH 2YPKB 4RRPG 2DJSA 1FORL 3G6AA 5DQJB 4LDOB 5L7XH 1CLOH 3TV3H 5T1LB 3VXPB 2PW2B 4Z5RB 5J9PB 1FVCB 3BZ4A 3EJYC 1N26A 1EEUA 1GOFA 1PZ5A 25C8H 2K9UA 4LSQL 2PETA 1IKFH 1OTSC 3MXWH 5C09A 5IOPA 3TCXA 2G5BA 4JO2H 3GJEB 4F7TB 1ZLWH 4JKKA 3CH1A 1MCQA 1WIPA 4K94C 1ZLSH 3MX0A 1NEZB 1U8MB 4PJDE 3RUGE 5IHZB 1AQKH 3HR5A 3V0VB 3D6GA 3MGAA 3GHBL 4OCYL 2CDGB 3W5MA 1IC7L 5D7IA 3IXAA 1IGYA 1YYLH 2UY7A 4WV1B 4TQEH 3UZEA 4OZFH 3ELAT 4XBPA 5L9DH 1FO0A 4PRPE 2ITDA 1OHQA 3V95A 3QA3A 3DSFH 4GAGL 3SGDI 2O61A 3BKCL 1ZHNB 2EDFA 4ODXB 4C56A 4M61B 4JVWA 2XKSA 4OSUH 1PSKH 2IMNA 3TM6A 2PF6A 5EBGA 3T2NL 4IJ3B 4YK4C 4NOFA 1C5CH 2E7HA 3PV6A 1Q9KA 1ZS8A 3WFBL 1QBBA 2EXYC 3GMNB 4GXVL 3SY0A 4YDLB 4C54A 1UKSA 1CS6A 4FZEL 4D3CH 1VKXA 3G5ZA 5DTFB 4FTVD 4KFZC 4HKXB 1KJMB 5LQBL 3HC3H 2A6DA 2NTFA 5C0DA 2J6EL 2YWZA 3ZDXE 2OS7A 2EH8L 3C5ZA 3RAJL 1EMTL 3BISA 5F89A 2XKUA 3SDCA 2IGFH 3VFWA 3QEGH 4O5LH 1FNGB 5C7XH 2VDPH 1EJOH 3OR6A 4ODSH 4AH2A 5E8OB 2V6HA 4NO0D 3G6AB 2J4WL 2Y72A 4NIKB 4MA7L 4RMRA 1RUKH 4K7FA 5CP7A 4U0RB 5E7FA 3ZYIA 1F4YL 2ZG2A 2FJFB 1PZ5B 2JELH 2J8HA 5IWLC 3HC4L 5IOPB 3HMXH 2G5BB 1CYGA 3WD5H 2D7MA 3K8KA 4GG6F 4QEGA 4YBQC 2EKSB 1QEWA 4MXQC 1PFCA 3IDUA 2OTWA 4YDJA 3HR5B 4K3DH 5TE4H 1F5WA 4JAMA 3QUKA 4ONFL 2VLJE 5TFSL 2H32H 2LVEA 3FB8B 3L3DA 3I2CH 1IQWH 1QLEH 3QO1B 5D7IB 2AXJA 2FHFA 4X5LA 3SE9L 4I13B 4PP1D 2VWEE 4Y1AA 3K2UH 3MV9A 4KMQA 3QHFH 4XBPB 1JF6A 3MRFA 3MNVA 1FO0B 2R8SH 2N1KA 2ITDB 1U3HD 5TDNA 1MCOH 1FCGA 4NBXB 3QA3B 4UIKL 2ZOKB 4R7NA 5DO2C 1NGZB 1KC5L 2EICA 1TQBB 3HNVH 2EDBA 4M5YL 3IFPA 3BRGC 2XQBL 2R0KH 5CAYB 1LE9B 1QHOA 4CGTA 1Z9SA 4LRNH 1XGPA 1MH5A 3DLQR 4NSKB 3PV6B 4QHUA 5D70L 1ZS8B 3CXHJ 5BRZA 4F33B 3DUUB 5HGAA 1JZ4A 2DLFL 1IZKA 4YHML 2ZUSA 4POUB 3QUXC 4N90D 4XVJH 3CVIH 4F15C 2BOCA 1N6QH 3IDXH 3TVMA 5F1NB 1VKXB 4HEME 3NTCL 3IKKA 4NCC1 4KZEL 2XN9D 3CZFA 1UKQA 5F89B 4P9ML 3SDCB 3VFWB 3MLVH 5LGHH 4PJ8A 2BVEA 4Y88A 4MJ4A 3MLXH 4FQHA 4WI7A 4XPHL 4I0PB 1JPTL 2E7LA 4AH2B 4ZUUB 4NO5A 2E3VA 5HHVL 2AJSH 3D85A 1X9QA 4Y5XA 1DSFL 4UZGA 5CP7B 4XMLL 4GLRI 4XRCA 4KUCF 2VXSL 3HRZA 5LAXB 5MERB 5IT2L 4PPTA 1TJGH 4LMQI 5E03A 1FNEA 4AMKL 5IBTL 5IFAL 4MX7B 4HPYH 3KG5A 4UNVA 5K9OA 1GXEA 1QEWB 5C3TA 4DGVL 2OTWB 1B88A 3CXDL 2DWEA 3IRZA 2NY4B 1QFUH 1C1EL 2FX8H 4O51A 1K5NA 2NLJA 3Q6GL 4JAMB 1BD2A 1BAFH 4K07A 1MJJA 4UDUA 4W68A 1IGCH 5SWSA 3MV9B 1Z6JT 3DVGA 3VGHA 2EIBA 4GKZA 5ESQA 3MNVB 1D3CA 3EOYG 4L4TB 5TDNB 1KELL 5C0IA 1MRDH 5IBLC 5C09E 3IU3A 1IC5L 3IDYC 4R7NB 4BFGA 3MLUH 5AUMB 4PRIA 3FOMB 3ABZA 3H42H 5EA0L 4WJ5A 4TSBL 2GAZB 2FDBP 3QDJD 1UA6L 4FQ2H 4LSVL 5DJ8A 4JR9L 2XQYG 4OT1H 3CSGA 4Y2DA 1QD0A 3KPPA 1MH5B 4NUGL 3G5VA 3AC0A 1RZJH 4QHUB 1FZJB 5I18H 2FLBT 1V3KA 5E6IB 1M7IB 2DMCA 4QHLA 3B9AA 3BIKA 4CN6A 4HUVA 1KCSH 1FC1A 4JY5L 2CK2A 2NCMA 5MEQA 3TVMB 4LPCA 1CFNA 4HK0A 3RHWF 3GB7B 2LU3A 2OQJA 3L1OL 3LIZH 1P7KA 4C56E 1F6AA 2EDDA 4KKAC 4Z7UB 3K74B 3CZFB 3NCEB 5KSBF 4NKMB 1R5VB 1C5DA 4H20H 1I7ZA 3DSNA 5C6TH 2F8OA 4TRPH 4FQHB 4PY8J 2Q3ZA 1BECA 4J23A 1P7QA 5DRNB 4PV9B 4NO5B 1KCRL 4LSDA 4W4OA 3D85B 4Y5XB 5SWQB 3EHBD 4XRCB 4U33A 3HS0A 3Q1SL 4OLWH 2E6JA 1T2QL 2OXHA 2H1PH 3S3SA 3HI1A 2IBZX 1WLHA 1CFVL 4FQJL 1Q72H 4IRSC 4JFZH 4XCNA 4Q6IB 5K9OB 3AREC 3LRSA 3QIUA 2HRLA 1WWCA 1RVFH 4NCC2 1OW0C 1K5NB 2ZUUA 4XGZA 4PRDB 3TBWB 5IEKA 1BD2B 1HQRB 4YHOL 1HNGA 1MJJB 4UUJB 3WYRA 5SWSB 3BZFA 2XPGA 3BQUB 1NGYB 5ESQB 1NFDA 2X4QA 4XB8A 5C0IB 3DETC 2DIAA 1RJYA 4DKFH 1S9VA 4AEIL 5GIRA 4PRIB 1I1YA 1MI5A 1UXWB 4E9LA 1ZHLA 4ENED 3BPOB 5DJ8B 3VXUA 2VLRE 1LEKA 2IPTL 5I6XC 3KPPB 2FO1A 1FG2B 4JM2C 1G6RA 4RA0C 2DM7A 4Y1AE 1K9TA 5KOMC 2PYEA 5IVZA 3ZHLA 1RZGB 1JNJA 5IB4B 2R9HC 3VRJB 4M43H 4NP4L 4ZAKC 4EJ1C 1AC6A 5DK3A 4XNUL 2BHZA 5MEQB 3FJTA 1WWBX 1A3RH 1BFSA 1RJLB 2JTDA 4HK0B 4MCYA 3INUH 2Z4QA 5F7KC 3ESVF 3IDMA 4QHMA 2VXUH 3I6KA 3TT1H 1BIIA 3PGFL 4LSSH 2BHYA 1OL0A 1A2YB 1WAAE 3NA9H 1F3DJ 3F58H 5I19H 1OP3K 5BRZE 4I3RH 2IJ0C 4Z7NE 3DO3A 3PNWA 5ABDE 1QR4A 1RJZA 3LVEA 4MWFA 2GCYB 2CGRL 3AUVA 4HQQH 4R0LB 5C71A 5HDQL 1CIDA 1SHMA 4WU5B 4PJHE 5GGVY 5K9QG 1NCUA 4A6YH 2UYLA 1HKFA 3PWNA 3CLFL 3GI8L 5EZIH 3CU1A 1L7TL 3P4MB 4OV5A 3ARGC 1N3NA 3ZYOA 4IIQC 1FH5H 1N64L 1I85A 5FKAB 3SQBA 3PWLA 4I2XA 1A3LH 3X3FL 4JY4B 3TYGH 3BZFB 3JV6A 1L9MA 4P2OA 1NFDB 1NUFA 1MUJA 1XF3A 2X41A 4MA3A 4QY8A 3V5DB 1RJYB 3KAAA 3ARFA 2OYPA 2FECL 1BQUA 2WINA 5GIRB 1MCLA 5JOEA 4I77L 1MI5B 3TLRA 4WFGD 1NLBH 4H0HB 4PGBB 1ZHLB 3LB6C 1BGXH 5CBAA 5DLML 3ECBA 3GZKA 1BD2E 4PGJA 3LAFA 3WBDA 3C5JA 5CZKA 3G08A 4P2QD 3LD8C 2PYEB 5IVZB 4PLKD 2HFEA 1L7IL 5KVEH 3MLYH 3RL1A 3EYVA 5IHLB 4ERSL 5F7HA 2D7TL 1HHKA 3FCTB 3RTQA 1JNNH 1MCRA 4MCYB 1SMAA 4JQIH 4PRIE 1MCNA 2XI9A 2Z4QB 5GS2D 3V5KA 3B2UD 4IRJB 1N7ML 2XA8L 3IDMB 2NXYD 3I6KB 1BIIB 3GMMA 2HKFH 1NCCL 4TVSa 1S7TB 1IGTA 4Z7UF 1RZ8B 1D5IH 1T0NA 3L3KA 2ATPA 4JKLA 3MGTA 1RULH 4GRLA 3O11A 1FNLA 3IDIA 4LLAA 5T33H 1YY9C 1T04B 1PZUB 1U2HA 1NANI 3PNWB 4JHAL 1RJZB 2B5IC 4KRPD 2I5YL 3SKOA 4NJAL 5M95B 1OQXA 1MEXH 3DV6A 2BNQA 4MAUH 5BS0A 2ZOLA 3L5WA 4L4VA 1IFHL 3QHZL 1BWWA 4X0KA 4Y4HC 5KANI 1MAML 2IALA 5I1AB 1EA9C 3PWNB 4QOKD 4WUUD 5HYSG 3MV11 1AC0A 5LGJA 2A9MH 4OV5B 3MUJA 1BJ1H 2G60L 1KN2L 1AGBB 1A7OH 3O3EA 2YRLA 3JWDL 2P8PA 3WFCH 1CXFA 5E0QA 4WFEE 1TTFA 5CJOH 2VABA 3ARDA 4LOUC 1C16B 3THML 1M7DA 3RVXD 4EUPA 3JV6B 4BQ9A 3A67H 1MUJB 1QQDA 4QY8B 4J3XA 3KPLB 1MCIA 3W39A 1RZFL 3H3PH 4HSQA 1BP3B 4X7TA 3FQXA 1N4XL 2X5PA 2B1HL 2DQCH 4ZXBC 5D2NA 3CX5K 3RI5F 1G7IA 5CFHA 3G6DH 1YY8A 1UZ6E 2EYTA 2EDNA 4ZFOA 3CIQA 3OQ3B 1CG9A 3MV7D 4M1GH 2XYCA 3ZKMC 3TNMA 5I9QC 2HFEB 3RL1B 4EN3C 3EYVB 1EGJH 1NFDE 5D2LF 5D7LB 5BVPL 1JYVA 1QSZA 4FQ1L 4RFOL 3IFLL 1HHKB 3O9WA 2NYYC 3TCLA 3MUZ1 3UTPE 4HFUH 5HDBF 4QF1A 1MI5E 2H8PB 2VXQL 4JFPB 1QYGH 3MV8D 4HS3B 1G7JA 2DI8A 3OXRA 4Y5VA 3TT3H 4AIZB 2MQCA 3VXUE 4LU5H 1ORSA 2IC2A 3I6LE 1T66C 5EZOL 1OPGH 1FO0L 3WXWH 3FO0L 3P73B 1U3ZA 1T0NB 3EOTL 4M6OH 5DJXB 3VI4F 2ATPB 3NIFF 2C3WA 4GRLB 4M62L 4L8SA 3IDIB 2PCPB 1GVIA 1JWMB 2RCSL 1EFQA 2UV3A 4IMKA 5FK9B 1AI1L 1X5JA 3HI6L 5I16A 1UGNA 1J5OL 1AXTL 2ADFL 3OBAA 5EBLB 4RWYH 2K7QA 2BNQB 2ZZUT 5BS0B 2ZOLB 2DQDH 3L5WB 3OAUH 4L4VB 2HJKA 5F21B 4X0KB 1GZQA 1X4YA 3I3DA 3FO2A 4R96A 4WO4C 5L0QC 1C12A 3H3BC 2R0WL 5TJWK 5LGJB 1Y18A 2D03L 1BEYH 1IARB 3O3EB 4XAKE 2SEBA 5K59E 3D39D 2P8PB 2WQ8A 1BFOA 4LAQH 4BKLB 4KKLD 4NZUL 5BO1H 2DQUL 2O5XH 3F7PC 5CJQH 5F7EL 5JQ6L 1OCWL 1QQDB 4DTGL 1T21A 1X7QA 1K2DA 3PXHA 4UT7L 2V9QA 4NN5B 1S9YA 4OFYA 5E2TH 4X7TB 3DGGA 4D0CA 5D2NB 3AY4A 4YGVA 5CWSA 1MWAH 4ZTPL 3RRQA 1G7IB 2X1QA 4PUBH 4CJ1A 2V2TB 4WNQA 5KVFL 3KLHC 4ZFOB 4DAGH 1CG9B 3AB0B 4Z7QF 2PXYD 4I2XE 2BVYA 5FYJH 3QULA 3QG7L 3TNMB 3BKYL 3BN9D 4PJ7A 1MSPA 5GRJH 3WFDH 1P84J 1FE8L 3MFFB 3FT4A 1ZHKB 4HIHA 3O9WB 3X12A 4M6NL 5LKNA 3TCLB 1ODAA 5AD0A 4QF1B 3EDDA 1TZGH 3O4OC 3S88H 3OXRB 4Y5VB 2KUTA 1ORSB 2CJUH 2JIXB 4Y16C 5T3XH 5GPRA 4XNXL 1C7SA 5HY9A 3P11H 1YNLH 5J12C 4L8SB 4LLWA 2GUOB 4KUZL 5ISZA 2HFFA 1L0YA 5JZ7D 3E8UL 4U6TA 3OAZK 5L88L 1Z3GL 4JZNB 4P2RD 3UYRL 2A77L 4FMKA 1EJ6A 4R96B 4KMTH 2VDRL 4IM8A 4DUVA 1C12B 2JCCE 2DWDB 4JFFD 3RGVA 4TPRL 1QPPA 1Y18B 5FYLH 2HVKB 1HE7A 3PQYA 5HTSA 1ZANH 2CR3A 4MMZC 3EYFA 1RIUH 3I3EA 1BFOB 4M93B 3QUYD 1QRNA 1V7NH 2JJTC 3LSOA 1H8SA 2W07A 1D5MB 4XPGH 4K8RH 4O58H 3FN3A 4L4VE 2VWEC 5ALBL 4MJ5A 3AGVA 3R0MA 2PTTB 4CVZB 1K2DB 3P4OA 4IBLT 1KJ3L 3HE7D 4A2LA 1OSZB 3DGGB 4HCRL 2LQRA 3C5SA 5I17B 4YGVB 5CWSB 5D7JD 3JV4B 3NCBB 4JRYA 3WHXB 1UM5L 4D0BA 4WFHE 3X14B 5SWZD 1YJDL 1ZA6A 5CSGA 3QULB 5HHMB 3SN6N 4L8CA 2EE9A 1N5YL 3C60A 5EU4A 4PJ7B 5IW6B 2NW2B 4WV1C 4DGYH 4UV7L 3FT4B 1G7HB 1FL3A 1GAFH 5HPMA 2DLIA 5D72L 5AD0B 5FO8B 3NABH 4NJ9L 1CBVL 3GSNA 5ICXA 5BCAA 2V2WA 5EO0A 4P5TA 4EDWL 1AGEB 3QZWG 4I3SL 2D2OA 1T7VA 2E27L 2AEQL 5E2UL 4S1DC 3ZE2F 3JBG7 5C1MB 4LLWB 3H7BB 1T1XB 3WS6C 1C08B 1AGDA 4HZLA 5ISZB 2HFFB 2YKLL 4BZYA 3RZCD 5E8EA 3QUZA 4UV4H 3VRLE 1T5XA 1CFSB 4YDLC 2FWOA 4UTAH 5DK0A 4HXBH 5DD5H 3L7EB 3JWDC 1J0HA 1V7ML 3WIIH 4JY6A 4KAQH 3KPOB 3RGVB 4DGIL 4JLRB 4R4ND 1KCUL 1KB9J 1MJUL 1CDUA 4K94H 3EYFB 3UC0L 4U49A 2NR6D 3VCLA 3ARSA 1KXVC 4F57L 2DQGL 3HRPA 4G9FA 5HVHB 4GS7C 1KG0B 4N9OB 5AWNH 4LEXH 4NN6B 1NCWH 4U0RC 4MJ5B 1VEMA 4PJEA 3AVEA 2PUQT 3EZJB 3P4OB 5FHAL 4POZC 1IM9A 3TNNA 2VDNH 3CVHA 1R3IH 4LGRB 1KT2A 2BJML 2P46B 4ZG1A 5FA3A 1RHHB 5C0RL 2D31A 1ZA6B 3U0WH 4L8CB 3C60B 2P5ED 5JXAH 5EU4B 2IAMB 4R6UA 4WY7L 3V5HB 1AXSA 2GFBB 3I6GB 4HUUB 2EEBA 1QFHA 1GGBH 1FL3B 5HPMB 3MV01 2ORBH 4YHZL 1TQBC 2B4CC 5TF1L 3UCRA 2V2WB 5EO0B 4HPOL 4JZOA 4MS8C 4P5TB 3L5XL 5F9WC 1X5LA 5BV7B 5DT1L 5E2VH 1XCQA 3MZGB 3D0VB 1TXKA 4RCAA 3PWJB 1UYWH 3KPSB 5D1QA 4U6YA 2IG2L 4M8VA 5A1AA 3FQWB 4UQ2A 3TP4A 4LLYA 1AGDB 4HZLB 2CK0H 1JGVH 3O6LL 5E8EB 3HE6D 4FQQB 1DQJA 3GHEL 3BRFA 5DK0B 1FFOA 3VWJA 5C0FA 1ACYL 1NC4B 3LV3A 1NAMA 4MAYB 2GSIA 4CVXA 4NQEA 3QNYA 2R0ZL 1CXEA 2ZCLL 1G0YR 3C5ZC 5FYKL 3RWCA 3SDCC 3KXFB 1PX3A 1WCBB 4NRXA 4UAOC 2OI9C 2GJZA 5T5NG 3RI5K 4NQCD 5E1AA 5A16A 4G9FB 1LO4H 1FPTH 3VH8B 2AXGB 3OJ2C 5JMRA 4GAYB 1ZA3B 4NC2B 3GMOA 1GHFL 4Z6AT 4TTGA 1UB5A 3GO1L 4FFVD 3PQYE 3CVHB 3O2WL 1KT2B 5DD3L 4S1RL 2NY4C 3FFCD 1I9JH 1VA9A 2HT2C 4LLVB 1QHPA 5FA3B 1JHKH 1OAXL 1QRNE 2ICWI 3QRFM 1KBGL 5E00B 2A9NL 2APBA 3BP6B 4QRPA 5JA8B 1EUUA 1CLZH 4W4NA 4BSVA 3SKJH 2Q8AH 4OKDA 3UJJH 1HH6A 2DICA 1AXSB 1YEGH 4PP2A 3G9AB 1AHWA 2VERN 5JHLL 3O2DH 1UKTA 5J13B 1IAIM 4G8GA 2CLRB 4ZS6D 4UIMB 1ZGLA 4JRYE 1YMMD 3U82B 3T3PE 4TNVK 1RUML 1D5ZB 4HIEA 5D1QB 4U6YB 3HLAA 3GK8L 2OZ4H 4YIQA 4LLYB 3RY5A 4TNWK 3MYJA 4RMSA 4WVRA 1I9IL 1QKZH 1JP5A 1FFOB 5C0FB 3TVMC 1NAMB 4XPFH 4KZDH 3BT2L 4K7PH 3CFDA 4CVXB 5EUOB 1XIWB 2X4UA 4JHBA 1T22B 4YDVA 3WV0A 3LQAL 4ZQKB 2VOTA 4GBXD 4H88L 4PJ8C 4YQXL 4N5UA 4NRXB 1KCVH 2X9WA 2GJZB 3T1FB 1SBSL 5E1AB 3MGOA 5A16B 5HHOB 5MP6L 2E7LC 3C6LA 3SOBL 5JNYA 4GQ9H 1J0KA 4ETQB 1VACA 5HD8C 1BVLA 4Y5XC 1OY3B 5F7MC 1NSNH 3QO0B 3IS0X 1MHHB 3B5HA 2BVOB 5DQDL 4YE4H 3WFEH 3GMOB 1YJDC 1Q94A 3O3DA 4HFWB 4MQ7A 4V1DD 5T1DL 3BW9A 2Q8BL 4X83A 3RA7H 1Z9OA 2UZYB 3C09B 3S35H 4YUEH 1RK1A 4AT6A 3CMOL 5TDOA 4QT5A 4P2YA 2YD3A 4J4PA 1FLRH 1FGNL 4G9FE 5FUZH 4QRPB 3DROB 3FQNA 4MB4A 1HH6B 4PJEE 5ADOL 4LVHC 3BVNA 2ZNXA 2P8MA 5DHVH 2HVJA 4PP2B 1T0MB 3TZVB 5GHWH 2ZG3A 1AHWB 2F53A 3OXSB 5IMKA 1GPOL 2D0HA 5E95B 4HF5L 4WGWB 4JN2B 3VFMA 1JZ7A 1HKLL 2CKBA 1ZGLB 5ITFA 3OGCB 2YK1L 1G84A 2OL3B 2FEEL 4KJPC 5ESAA 5HYEA 1FORH 4Y2DC 3RDTA 4MGXA 4F2MA 3LQMA 1MAKA 2GY7B 4YIQB 3DO7A 4NWTL 3DHJA 2Z8RA 4APQB 4LSQH 3HZMB 3X17A 3D2UD 3T0ED 5DUPL 4P23A 1RAMA 1T03L 5AYUL 1CICB 4ZFOL 4F80A 4LCWA 4JFDB 1FVDB 2Y07L 2YD6A 1EO8L 5HHXH 2X4UB 4OCYH 5GJSL 3RVUC 2R1YA 1KGCE 2VISA 4MZ2A 1BLNB 1VEOA 4MDIB 1TQCC 1JRHH 2QKIA 2BDNL 3MGOB 1OLLA 3KPRB 3C6LB 4C59B 5JNYB 1HWHB 2B1AL 1YUHB 4MJ6B 4GAGH 2HMIC 5C9KA 3BKCH 1NCNA 4TUJA 5F7NC 2GSGA 1K8DA 2BXZA 1S7WA 3QI9B 3LKNB 4NQEE 1Q94B 3O3DB 4MQ7B 4PJGA 5DJ0B 4X8JB 3BW9B 2IQAA 4FFWD 4NNYA 4Z7WB 4ALAL 3WFBH 4HWNA 3QIUC 4PY7B 3B3IA 4OF7A 3AXLA 4FP8L 1P1ZA 4U1GC 4KTDL 1G7QA 4GXVH 4PJDF 4QT5B 4OZGB 3G6JA 5GGVL 5CEZE 4L3EB 2VL4A 3L6FA 2DL9A 3NZ8A 1W0WA 1PLGL 4FZEH 1DN0A 4XPBL 3FQNB 4X6BA 4LHQB 2NY6B 5LQBH 5CGMA 2A38A 3MBEA 3QWOB 1IAKA 3BPLB 2J6EH 3V4VL 4PRHB 2EH8H 3RAJH 1EMTH 4Y4FA 4U1KA 3EDKA 5IMKB 2EYSA 5JIIA 1M6OB 1EAJA 5IM7A 1MIML 1IAIL 3VFMB 3UDWA 2CKBB 4XH2A 5ITFB 3TO4B 4ZOBA 1YMHA 1ZWIA 4NFDA 1YEKH 3MRIA 4UINL 1CL7I 4I0KA 1JPGA 4GW1A 2J4WH 4Q9CA 4B0MM 1X4XA 4F2MB 1F4YH 4KJYA 3DO7B 3CK0L 1F8TL 4KI5F 1TVHA 2ZSWB 2J5LB 3HC4H 3OPZL 4GAFB 4MJID 5I8OH 4P23B 1JTPA 5JPMA 2MCG1 1M7XA 3MREA 2VSDA 4G8GE 2F54D 1NEZG 2EO1A 4Q9BA 3ARUA 1UEYA 4ONFH 5TFSH 3ZDXF 4ODUA 4D9QD 3U4EA 3ZZ1A 3SE9H 4XXDA 2C5DC 2NY1C 3V6ZB 4RFNB 5EUOF 4NC0B 1S9XB 5T5FL 4KUCD 1MPAL 4HJGB 4K2UL 5F6HI 4QYOA 3JV0A 3BDYL 4UIKH 1RUPH 1KC5H 3HA0A 5GS1A 2VQ1A 4TUJB 5J1TC 4M5YH 2GSGB 1K8DB 2YPVH 1HZHH 3S3JA 3N50A 2XQBH 1S7WB 2Y5TA 1ZT7B 1SQ2N 2IQAB 2IBGA 2BC4A 5D70H 1HIML 3B3IB 4DW2L 4F7PA 2W9DH 2XRAL 1G7QB 2DLFH 3UTSD 3DRQA 3TJHC 3SPVA 4YHMH 1NCBL 3ROOB 1I85C 3TN0A 3ARBD 4PD4J 3VGEA 4CU6A 5FB8B 3BP5B 1TITA 3NZ8B 3HNTL 1HSAA 2AV1A 4OQTH 2BVPA 5B39B 1JWUB 4OGYL 4BM7A 4P2OC 3EGSB 3NTCH 1LK2B 1EAPA 4KZEH 5C0BA 4ELMF 2VZ1A 3H6JA 5K9KA 4OLYL 5DC9B 4P9MH 4U1KB 4PJ5B 2EYSB 1QLFA 4OKVA 3ARFC 3F5WA 4LFHG 4YXKL 4XH2B 4XPHH 3QQ4A 4OZHB 5JW4N 3OR7B 3MRLA 2QADB 3TWCL 3RY6A 5HHVH 4P59L 1FG9C 1SYSA 3PIQA 5MEND 4B7IA 1DSFH 4XMLH 2WNGA 4HJJL 2J88L 5IT2H 1TVHB 3BH9A 4JCLA 3J8F7 4B7LA 1D6EA 4AMKH 3EAKA 5IFAH 3LQAC 3LRHA 4RDQF 2F53E 3PL6D 5L2KA 1IEAB 2NY2B 4AY0A 5EUKB 4DGVH 3RTQC 2VDLL 3CXDH 3MREB 5B3JF 1QSFA 5KVMC 1X5ZA 4OBSA 3VFVB 1ROWA 2DLTA 3F8UB 3WXVL 5KSVA 3IJSA 3D9AL 3QQ3A 5IBUG 5T3ZE 4OF8A 4X6FB 1EEQA 1TNMA 4HK3J 1K8IA 1T4KB 4Y19B 4JFXA 3V7AE 4GRLC 1B90A 1P4BH 1R5IA 1S78D 1KELH 4FQPA 4QYOB 1IC5H 1L0XA 1S9WB 5IB5A 3AS0A 3DIFB 5BV7L 5GS1B 5GZNC 5CIPH 4LGPB 4XHQA 4DN4L 4LCWE 4U1SB 2A1WL 1UA6H 1I8IA 4JR9H 2EE3A 3P77A 4NUGH 4RSVA 1NGXA 3B6SB 3DV4A 2BERA 4F7PB 4ISVA 3K1KC 2LFGA 3DRQB 3SPVB 3TN0B 1JF1B 4Z7WF 2DLHA 2IFFH 4P4RA 43CAA 4JY5H 2CRYA 1HSAB 4OCNC 3ARDC 2YMXL 1TNNA 5IMLA 3VD5A 2BVPB 4LP4A 4OZGF 3L1OH 2NNAA 2ZCKL 1FYTD 4D8PA 4RNRA 4XB7A 5JDSB 3QQ9D 5GGRY 1EAPB 4KJQC 4PJGE 1OWWA 3RKPA 4ZS7L 2B2XL 4MLSA 1QLFB 3WCYA 1RIHL 3HUJA 3F5WB 3CJJA 2FJHA 5D2NC 3SQOL 2J3SA 4C4KT 4FA8A 3G6JE 1A47A 1AD0A 1FAIL 1KCRH 5EB9A 5EU6D 1SYSB 4PGEA 3AB0C 4HGWA 5ACZA 1T2QH 3BH9B 1RHFA 1CFVH 4FQJH 5A2KH 1D6EB 2H41A 3CVHL 2FSEB 3U0PB 2I26N 5KVGL 4HV8A 3O9WC 1AO7A 4HH8A 2IANA 3GUTB 1TVBA 5F8RC 3IU4L 1M05B 4DZBB 4X6DF 4MNQE 4PRBB 3SCMA 3HHRB 2AJVH 3CDCA 4Y5VC 4YHOH 5I15H 1JL8A 1UENA 1K8IB 3JWOC 1UQSA 1N8ZA 4JFXB 3OF6D 2HT4C 2HYMA 4L8SC 5E8NA 4BFBD 1R5IB 4FTVA 1KJVB 1F3RB 3ISWA 1JN6A 4IMKC 3LMJL 3TBYA 4PV8B 4KK5C 2R29L 3I50H 3EUUA 3WN5B 1A7RL 4UILL 7FABL 5IF0A 3LHPL 4GJTB 4DZ8B 2IPTH 2A6JA 3MUHL 4XXCA 4A6YA 3AS3A 4R97C 4XI5D 1X5KA 1XZ0A 3CH8A 2Q6WA 2MWCA 1PKQA 3QIWA 1HDMA 1U8JA 1UH4A 1RZKL 1QG3A 2X4PA 4FQXA 1NAML 43CAB 6CGTA 4M93C 1NMAL 4OFPA 3QISA 4XNUH 5FYLD 2HT3D 5A2LH 5I8KL 1R3JB 4D8PB 1D7FA 2APFA 4RNRB 4G6ML 5D1ZD 3AU1A 3U79A 5AZEL 2FD6L 5ITBH 3PGFH 5CEZL 3HUJB 5C08D 2ADGA 2VDKL 3MR9B 2FJHB 3LDBC 5GGUA 1KENL 3FFCE 5D5MA 3R4DA 4KK8D 4OI9A 1HWGB 5DUBA 1YPZA 3AY4C 3UAJC 3U6RA 3ZL4H 2CGRH 1AD0B 1J12A 5HDQH 3E3QC 3O41A 4OZHF 3LS5L 1JGUL 1WCQA 5CCKH 5ACZB 2FBJL 1JGDA 2R15A 1SJHB 2AQ2A 3CSYA 3CLFH 3GI8H 5C0BE 3ILQD 3NIDF 4NO3A 1OT1A 2C3VB 4HV8B 1L7TH 4WFFE 1U8PA 1AO7B 2IANB 1RPQA 3TF7C 1RUAL 3HAEB 4OZ4A 4KJWD 3DGCR 5HI5D 1S7VA 2FCBA 3SCMB 4ZFFA 4WHDA 1KCKA 4NGHH 5I1CL 3SGJA 3X3FH 4QRSB 1DQDL 1A1OB 5EU3A 2XWJB 1WAAF 2J2ZA 3SBWA 2AQ3A 1E4JA 2C7UA 2ZKHL 3QH3A 4FTVB 1CE1H 4NFBA 2F9BT 3BXNB 4ZSOB 5L2KE 4NNXA 3IJYA 2UZXB 2OL3L 1TTGA 5BZWA 3EFDL 4I77H 3T0VA 4PJHF 1QSFE 5F97E 4N0CD 1NMCC 1OP5K 5DLMH 5F96L 1J8HD 4L8BA 2A6JB 3RGVC 3SE8L 4OZIA 4MQXC 4LLMA 1FL6B 4CU7A 1L7IH 1PKQB 2Z31A 3DARA 3FFDA 3MRJA 4ERSH 1U8JB 4XMKL 3PE9A 1QR1B 2D7TH 4FQXB 1OTSD 1EPFA 2Y36L 4U2YA 4GKNB 1AR2A 3S5LA 5HVHC 5FKPA 5F88A 3F12B 1EXUA 1KJ2H 1KPVA 5GGRA 1WQVT 3AU1B 3UXFA 2HRPL 5E94A 1N7MH 5HGBA 2XA8H 5ESVA 1XF4A 1H5BB 2EC9U 2R2HA 2W0FA 4DVB