5JLZB

Crystal structure of hla-drb1*04:01 in complex with modified alpha-enolase peptide 26-40 with citrulline at the position 32
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRASSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Functional and Structural Characterization of a Novel HLA-DRB1*04:01-Restricted alpha-Enolase T Cell Epitope in Rheumatoid Arthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jlzB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5jlzB01
1HI6B 1WGOA 4YFLI 4FQQB 1MELA 1RK0B 4XI5C 4GAYB 4I0CC 3RWHB 2DQHH 1CLZH 3CFBA 1T66C 4DKFL 3TO4C 3IFLL 4P2QD 2RB8A 2A9NH 4N68A 5IEKA 3UBXB 4GKOA 2BHUA 3VFWB 3HC4H 2DWEB 3ES6B 3N9GL 4LPUA 3PHQA 4R4NC 3GIZL 3SDDC 3JV4B 1NCBH 1NFDA 5HYJD 5TE4L 4MA1C 4OCRH 3S6CA 3GMPB 3E3QE 2X89D 4X4ME 3KPTA 4FQ1H 5AZEH 5C0RH 3QDHA 4FMKA 25C8H 4PY8J 4WENB 4IM8A 2YPVH 4M5YL 4WUUE 1A21A 3C6LC 3FQWB 5C9KA 5BV7H 2FIKB 1GZQA 2NNAA 3X3FL 5DGQA 4OZGA 3EGSB 2Z4QA 1RZFL 1W0VB 3O9WD 1G9EA 3BGAA 2EEAA 3LEYH 4POYA 1P9MA 3R0MA 4PRHD 2FLBT 3WUWB 2FH8A 1KJ2A 2QQLH 5EUOB 4J2XA 2R0LH 1DLFH 1AFVL 2PF6A 4OCYL 1OT2A 3V4VH 5B3JF 3V5DA 5DK3A 4OUUB 3BAEL 4YQXH 1X9QA 5IMMB 2W0LA 4DWHA 3UYRL 1LO4L 4QY8A 3MYJA 3HUJF 5E95B 4G6AD 4NJAH 4QLRA 4LHJB 2A83A 4LSDA 2QL1A 4XNXH 1INEH 3LD8C 3W2DL 4PJAA 5F89B 5EB9A 5D2LB 5I1DA 1KCSH 4GKNA 1JGVH 1KC5L 4O4YH 4J3VA 1PX3A 3SDXE 3SCMD 3HI5H 4Y16B 2EE2A 3ARQA 1K3IA 3QUML 1KXQE 4M93C 1TJGH 4XVSL 4PJDF 1N3NA 1HQRB 2F5AH 4OGYH 4X7TA 1G84A 2KPNA 3BGMB 4ZTOH 1C12A 1OWWA 5IFHL 4C56E 1AGFA 3L7EB 4ZO7A 1LO2L 4XAWH 1JNNL 4NC2B 1AHWB 1NGPL 4YFDB 2HT4D 4JZNB 3O8XD 3RWDA 1QRNA 1V7ML 1RZ7L 4KQ3L 4JHWH 1SMAA 3D25B 3MUZ1 5EBMB 1X5YA 3N50A 1F4WL 1URLA 3MRQB 1AI1L 4S1RH 1A3LH 5J3HC 5DJYB 3HNTL 3BPNB 4ODSL 4WUKL 3NABL 4IOIB 4JG1H 1ZLUK 2PYEA 4GQ9H 4AEEA 3DRQB 3FQTB 4N0CD 1NC2D 3FT2B 2VLKA 4J6RH 4OLVL 5CD5C 3H9SB 3MV9D 4ZS7L 4H25A 1I1AB 3PDOA 5KTEH 1I3UA 1EAJA 3ZE1E 4FQPA 4EUPB 2ICES 1PG7H 5JMRA 5CILL 2DQJL 4B41A 2FX7H 1FYTE 4F37F 1GOFA 3MOQA 4G6JH 5HDQL 1AE6H 1QLEL 5IM7B 1CCZA 4UAOC 5KVFL 1A3RL 1DLHB 1CFBA 3LKQA 2CLVB 3OXRB 4IOFD 3DUSA 3QNYB 3LB6C 4HWBL 1FLRH 3U4BL 5HPMA 1J8HD 4L4TE 5GJSH 3OWEA 2NY7H 1YEIH 3PGFH 4Z77A 1HINL 4U2YA 2R69L 3FT4B 2FJFA 1NBYA 3VFNB 3RDTB 3SDXF 3I6GB 5DZNA 5A2IH 2ARJQ 5AEAA 3KPRE 3KPSD 1DEEB 2FH6A 5FOBB 2PETA 5I1LB 5HGDB 1K9TA 4POZD 4R96A 4Z7UF 3W0WB 3LKNB 4RA3A 2IWGA 2BFVH 1KBGH 1GAFL 4BSWB 4HIJA 1CR9L 2H26A 4CJ1A 1C7SA 4GKZA 1TPXB 2HKFL 2NY1D 4RNRA 4BZ2L 1VFMA 3G5YB 2YBRB 1ZVYA 1L7TH 1IKFH 3RGVB 3VRJB 4JRYA 4FTVB 4JFQA 5F7EH 3H9HA 5L9DL 2CO7B 1AIFA 3ORJA 3CFCH 1RK1B 2XTJC 5D1XB 1BBDH 4OGAD 5GRUH 1H15B 2P5ED 4EJ1C 4MXQD 4UU9A 1ZLSH 3L5XL 1FZKA 4UV4H 4XNUL 4FZ8L 4QTIH 3FOMA 3QWRD 5D1ZC 3B2VL 3MV8E 3E6FB 1FVCA 1QSEE 4JRWA 4YHKH 35C8H 5JXED 5GGTH 1TVBB 1OHQA 3K1KC 2X4UB 2VL4A 3BRDA 4XBPA 2F74A 4WHCA 1AY1L 1HZHL 3S97C 3QBTB 1P2CB 5D1QB 3MA7B 1WC7B 3S5LB 3L9RB 3QFJB 3NFNA 2VABA 4MAUL 5IW6A 2XICA 3ARGB 4NNYA 5ALCH 4PJEB 4MX7A 2CIKA 2F58L 4ZTPL 3W9DA 4XH2B 5F9AC 4AEHL 4G8IB 4JHAH 3V79C 1A6TB 1WCBB 2FHFA 5I1IH 4XPAH 3C09C 2J2ZA 3OQ3B 3SQBA 3VRIB 3UPRA 1JF5A 1MHPH 3U4AA 5ITFA 3REVA 3VJ6B 4CUCA 4JQIH 3IKCB 1DTUA 2WV3A 3WIHH 3FB7B 5I75C 1FIGH 3G5ZB 5F1OB 2HLAB 3DV6B 4YH6A 2FBOJ 3GK8H 4ELMA 1NAML 1BBJA 2HAZA 2R1WB 1F02I 2X70A 1NQBA 2FO1A 1CFNB 1ULVA 3T0EB 1U8QB 3F7YB 3ARED 3VXNB 2IBZY 4KV5F 4PRIE 1KJ3H 1SEBA 1BFOB 4BYHA 2KZWA 3RX7A 4HC1A 3QEGL 4PJGF 2PO6C 3RZCB 5CS7A 4X8JB 4MJIB 3NCFB 2XOTA 4MMZC 3OSKA 3ZHLA 2YD1A 5E8OB 5IVZA 5D8JH 1A14H 4N0UE 4I48B 3F62A 4ENED 1M7IA 2Q8AL 1UWXK 1Y18B 5DQ9B 2OX5A 4QHLA 1HILB 2YR3A 4KKBC 4O00A 2DJSA 4IIQB 4TSAL 4P5TD 1XR8B 3EJJX 4KY1L 4O51A 1WVZA 3DV4B 4U1IA 3QUZD 1A7PL 1MRDL 4JFDB 2XKNB 3SKJH 1FRGL 1VERA 2H6PA 5J6GB 4O58H 1KACB 2EDTA 5C8JB 4LCWE 2ZCHL 2VN7A 3V95A 2IAND 3I02B 5EIVA 6FABL 1QPXA 1NUNB 2QQKL 3HS0B 1KELH 3NIDE 4ONGL 2H32B 4QRPE 4KI1A 1QYGL 5EZLA 2B0SH 3UTPD 3EDJA 4OD2B 3P73B 3SHSA 3GSWA 3VXMA 3HG1B 1ZTXL 4EDXA 2UWEA 1G6RL 1KPVB 4FQXB 4Z0BH 2NW3A 5KSBB 4PLNC 4LBEB 2J12B 1TQBC 2QKIA 4NM8L 4P4KA 4HLZG 1I8LA 2VITB 4TTDD 3RUGE 2VZTA 5J1TC 1QSFE 1UEMA 4KK6D 1NGWB 5DD1L 2X7LA 2XN9B 3AVEA 3VFRB 3IGAA 3QI9B 3E2HC 2D7TL 3FQNB 4WFGD 4TUOB 2O61A 5I30H 4XB8A 4G9DA 2FYYB 1BM3L 4H8WC 3C8DA 1AQKH 1BIIA 3PWUB 4XMLH 1N0XH 2VLME 1EJ6A 1JUFA 5C0CA 4WY7H 3MLWH 4QRRB 3BP6A 5GSRB 2DQFB 1EHAA 4U1JB 4PGEA 3L3IB 1RZJC 5F6HI 1Z5LA 4PBXA 4M6AA 3TBWA 1U9KA 2GTZB 1T0NB 3CIQA 4Z7QF 1DANU 5D6DA 3SY0A 2GSGA 1KEGH 3DHMA 3LDBB 1OSPH 3D2UA 2RFXA 4JPIB 1ACYL 1OAXH 1XFPA 3EFDL 1IGCL 4AMKL 1NCNA 5D2NA 1Z6JT 1KIUA 5GJTH 3RNKA 5BCAA 3U36B 5C09E 3QDME 2R2HB 4WFEE 3TBVB 1EXUB 1I9JH 1MFBL 3VWKC 3CSYA 3QUXB 1IC7L 3PWNB 1B0RB 4UINL 2D3VA 2Z92B 2JCCE 4KVCH 4PR5A 4AM0A 3GKWL 3OKMA 4W68A 4TUKL 3HLAB 4ZS6C 4HGMA 5D9SB 1KLGB 2NLJB 4OFKA 3J8F7 4F33B 2GAZB 5DUPL 4Y1AA 3O3DB 3UTZA 1J10A 3GBMH 5F7HA 1ETZA 3QEUA 1BQSA 1CICB 5EZOH 5EZJA 5C08B 1HH9A 5C0FB 3K81A 3QXAA 1JWSA 4UV7H 2MKWA 2HLFD 5E03A 2VDOH 3RUGF 3B4NA 4JHBA 3BKJL 3IS1X 2P8MA 5DRNB 3EUUA 1ZANH 5E2TH 5DC4B 4X6CA 4EIZC 5BMFL 1VFAA 1B4JL 3VD4A 3CK0L 5LQBH 3JTTB 4ZO6A 3IAGC 3HZYA 2F53B 3HE6A 2J7LA 4PJ5B 3O4OB 2MOVA 4AY0A 5IHZA 2JJSC 4YC2C 5EU5B 4ODXB 3PHSA 4S1DC 5J1SC 32C2B 4OQ1A 4XPHH 4UQ3A 1NCCH 5CEZE 4TYUA 1UJ3A 4XGZA 3UZVB 2ZNXA 3H7LA 1G7QA 1U8PA 2VB5A 5I76A 3LQZB 4WW1B 1E27A 4IRSA 5EWIH 5SWZE 1TQCB 4KPHH 4F7CB 2AJZB 2JB6B 4KTDL 3BQUD 3QDJD 4HJGB 1RIVL 3VD9A 3C8KB 3VFTB 1U41A 3IDYB 4PJIF 4WI6A 3WBDA 1U8MA 1DQQB 3QFDA 2N4IA 5J11B 1EFXA 1S7QA 4NQCD 4XP4L 1T2JA 3GMQB 5DDHB 4LIQL 4UUJA 4TUJB 4QHMA 4NN7C 4GAJH 4K3EL 3GBNL 5EU6A 3VXRE 1DQMH 1E0OB 1EEZA 2JCCF 2R4RL 4KTEH 3D9AH 4P9HC 4Q97A 1YPZF 2BRRH 3MBEA 4EIGB 1S9XB 1FG2A 1WWAX 2WP3O 4NHUA 4O2CA 4GAGH 1WFOA 2CKBL 4GW4A 4GXUM 1RSFA 2V5TA 3GI9H 4YXKH 4IS6A 4LDOB 4OGXH 3S4SA 2X4QB 2VLRE 1C16A 1AKJB 1MF2L 1S3KH 3O3BA 1XAUA 1G9NH 2AK4B 2WINA 1NGQL 5F97E 1PG7W 5DT1H 4M4PA 3VFMA 3VFSB 4WEMB 4Z78A 2WBJB 3B9KA 3MCLL 4XCNB 1TENA 1YEGL 1YJDC 3BI9X 1I4FA 4HEPG 1BMGA 5F9DC 2XXMB 4FQCH 4I3GA 2J8UF 5MHSD 2DTMH 1RUAL 3R8BB 1I8LC 3BVNB 1OGAD 4MXVE 2R4SH 4OI7A 4KRPC 3OKYA 1RV6X 1HH6A 1OSZA 4MVBC 1KTRL 3QR2A 2ESVB 4Z7OE 5TQ0H 3BN9C 4KROD 5JW5B 3WFHA 3L7FA 1IT9L 1IBGH 2XI9A 2C4XA 2NXZB 3VFUA 2ITDB 3CU7A 5I8CB 4EN3B 3HN3A 3M8OL 3MRPB 3HA0A 4IRJB 2CRMA 5TDOA 4WUUA 3WUWG 4X0KA 1E4XH 3LS4L 2XFXB 3V52L 4JFFE 2GCYB 5IB2A 5IB4B 2ATKA 3EOBB 3WDIA 2DQCL 3QDGD 4Y4FA 5T5NF 4HKXB 3B9VA 4AG4L 4CU6A 1QFWM 2IBZX 5C0JB 4P2QB 1IKNC 4DGIH 1L6XA 1OW0A 1UENA 4I18A 1HDMA 4NWUL 2OCFD 4ZDHA 5HY9A 3THMH 1KYOK 4JKMA 4P4RA 2C3WA 5D2NC 1A4KB 1NFDF 3BEWB 1QG3A 5CEZH 5HYJB 1MFAH 3CMGA 5MI0B 1Q0YL 1Z9OA 2VUYA 3OAUL 4UILL 1HEZB 3AUVA 2AXJA 4RZCA 1JGEB 3KXFD 5C0BD 1J05B 2OR9H 4BELD 1GGYA 1IC4H 4YE4H 1DN0A 3EYFB 3QCUH 3RWJA 3KJ6L 4OTXH 4LDEB 1T1WB 4I3RH 1HWHB 4UDUA 5FFLA 1KJVA 4PRBB 5HGBA 3C08L 3DVGA 2OTWA 2QADD 1KIRA 4LVHC 3IFPB 2CRZA 1EBAA 4QYOB 4MQ7B 3C5SB 3FB5A 1BVLA 3RWGB 5BS0A 4OM1L 1WBYA 3WDHA 1QFWI 4WV1C 5GS2D 2ITCA 1YNLL 1A4JA 2QJDA 5GGTA 3GMMA 4C56A 2WLZA 4K9EH 5T33H 3EDEA 2HN7A 4YHOH 2HH0H 3WEXA 5T3ZL 1VADB 3HE6C 2YXFA 3PJSB 4XVJH 3U2SA 3ETBF 1NDMA 4R3SA 4HKZA 3L95B 1UACL 1WTGT 4U3HA 5HI3D 3D39E 3X3GH 4XPGL 1FNEB 3ZYJA 1I8IB 3RNQA 1UCBH 1F4YH 1N8ZA 3KJ4B 5ICYB 4NRYB 4OFYA 1CE6B 3REWB 3CD4A 3SCMB 1MFNA 4WJ5B 3FQXB 1UJ3C 3IDMB 3WIHA 1J1OH 5CUSH 1I7RB 4NDMA 5EBGA 1F42A 1AD9B 1M4KA 4IRSC 1VGKB 4JCMA 3SE8H 2BVUA 4OZIF 5H37H 4PJHB 3RQ3A 3LEVL 1FYTA 4YXHL 4LGSB 3PQYE 3O8XB 4UNVA 3GNML 4HH9B 1CG9B 4XVTL 3VI4E 1OAUL 3CU1A 3MRLA 1LK2A 3G9AB 3MNVA 2BY3A 1KPUA 4L4TA 1IAIL 1U58B 4YIQA 4RMSA 1EJOL 1OPGH 3GSQB 4JFEA 4I77H 5IV2A 3VRLE 1UC6A 3MBEC 3NTCH 3CVHB 3IXTB 2P45B 4K3DL 5FYJD 4QRQB 1S7XB 3TVMD 2C7UB 1JZ3A 1NC2B 5KOMC 2ICCA 3TV3L 4FQQA 2HVKB 1RK0A 4GAYA 4GAFB 3MV9B 1NGYA 5F21B 5GZNC 5FCSH 2D7PA 2FD6L 1CLCA 1SM3L 2APXA 5IWLC 1T7ZA 1OP5H 1ZWIA 3B9KC 1MCCA 2Q7NA 3CC5A 1U8IB 1EVUA 5DJZB 4M61A 3GMPA 4NQDB 1U8OB 1CDIA 1J8HB 1VGEH 3FO2B 1MIEL 4QGTA 4JKPH 5FGCB 4NFBA 4LMQE 3SDYH 2AEPH 3WXVH 4RAVA 3ULVL 3E3QC 1YN6A 5EU3A 1MHCA 3CGTA 3IRZA 4OZ4B 4HSQA 3KPSB 3NCCB 1ITBB 4G43B 4LQFL 4K2UH 4TNVF 4FS0A 5C0AE 5KG9B 2XRAH 2D9CA 4D9LH 2XZAL 2VTFA 4CW1B 4UOJA 1T04B 3TO2A 2C26A 4OUUA 1KCRH 5DJ0B 1MLBA 5DEFB 3MV7E 1JPSH 2XTLA 1WCQA 1U8JB 4Y4FC 5E5RB 2NY1B 1ONQA 5CP3H 2AJVH 2LTQC 4DGYH 4NHCH 3MA9L 4NQED 1P7QA 4RGMB 1GC1C 4I18C 1INDH 4Y8AA 1Q72H 1WUNT 4FRWA 5DJXB 3IF1B 5F89A 1FJ1A 5D2LA 5CZVL 3X13B 5D70H 3PWPD 4M7JL 3MLZH 3MRFB 1UYWL 2P5EB 1JV5A 3QRFM 2D7NA 1CD8A 4D3CH 4ODHL 4AIZB 1LO5B 4HPYL 4X4ZA 5EC2B 3PNWA 3L1OH 1LEGA 1JWMA 2R2BA 4PRHE 1D5BB 1UWEH 1JMZA 2A6DB 4NGHL 5C9JB 3C2SA 1VFBA 3BGMA 4L8CA 5KSVB 5DJDB 4HK3J 4QRUB 3BP4B 4PRIA 5J89A 5I74C 1AHWA 1KTLB 5TPWH 4WI2A 1SBSH 5E99H 2VXUL 4FG6C 5AUMB 3LMJH 3NPZB 2H3NB 2CUHA 2V5RA 3D25A 2V7NB 1CDBA 1RUQL 3MRQA 4PV9B 2C4FU 1K8IA 3PWLB 5I71B 4N0UA 3LIZH 5DJYA 3C2AL 1RUKL 5K93A 3DX6A 1I9IH 2X42A 4WU7B 5JHLL 4PTTB 1OP3H 4TNWF 4D0BA 3X14A 4EI5D 5F6IB 4X5XA 3FQTA 5F9JB 3OKEB 1V3LA 1CDYA 5ERWB 5D7LD 5C0IA 4Z7VB 4NZDA 1QKZH 3DSFL 5KVEH 5D7JC 5CJOH 1HHGA 3FKUS 1MCOL 2Y5TA 5LXGL 1VPOL 4YEFA 4LCWA 5L2KE 3QNZB 4BQ8A 3VWJC 3DNKA 1R3KA 5C0EA 3AREB 2EDDA 3TGXA 2DJ4A 2F15A 3MRRB 4LSSH 4LU5L 2LAGB 3R1GH 4QRPA 1JNLH 2ATPB 4X9BA 2NR6D 3OXRA 2G75B 2KDGA 5E00A 1FVEB 3DO7B 3QZWG 2P8PB 3DUHA 1N59B 3ARDC 3O45B 4XCYB 2JJWA 4JRXE 1P1ZB 2D31A 4P5TB 1V5JA 5IB5B 4OZHE 2F8VA 3I6GA 3IFLH 3IJHB 1JZ7A 2QSVA 1Y0LB 3ZKMD 4ELKA 4G9FE 3TNMB 4LLMB 3IYLW 4Y0GA 2CMRL 1IM9A 1F6LL 2DKUA 4HXAH 2IANB 3VE0A 1E4WL 2D0HA 2Y4SA 2K3TA 5FEBA 2EDQA 3KPLA 4TVSa 5DK0B 3U7YL 3MRBA 4PJ9A 4ZFFB 5JIPA 4HUUA 4P9MH 1XCQB 2P44B 1I1FA 2CDEB 2A74B 1HQ4A 3OG4B 5EBLA 3BEVB 1I7ZA 4AK1A 1TZHB 2BNQE 4OFPA 5F88B 5D1XA 3EJZC 2EE3A 1KCUH 1ND0B 4L8SB 4LKCB 1QBBA 2LAAA 4GRLA 1U92B 1S5IH 3QQ4B 5B8CB 1SYSA 1AFVH 4OCYH 5E2WH 4I2XB 4P46B 3QISA 3E6FA 2ENSA 5C09A 1T4KA 3QDMA 2CXKA 3PV7A 5L0QB 1TVBA 3UYRH 1LO4H 3TLRA 3BPLC 1LDSA 4UIKL 2IALB 1R3IH 4H20H 1XF5A 3WUZA 5I1JH 1QRKA 1CL7L 3MA7A 3S98A 3W2DH 1EMTL 3GMNA 3N85L 1AXSA 3EHBC 2ED8A 3RKPA 1QR1B 2R8SL 1CXFA 3W82A 3ARGA 1T21B 4NKOB 1HOCB 1KC5H 2DLIA 3LN4A 5D5MB 2VH5H 4U7KA 2QR0B 1XF1A 3GHEL 3NGBC 1A6TA 1WCBA 1YQVH 4PJFF 4D0CA 3QUMH 3N1GC 2NY2C 3VJ6A 4X7CC 4XVSH 5CAYB 2PKDA 3FB7A 2Z35A 4PGJA 3G5ZA 1U3JA 4ZFGL 4P23A 3GDBA 4ORGA 3GSXA 1JNNH 4HUXB 5TF1H 1NGPH 3GSUA 2W38A 1QBAA 3WL9B 4WWKD 3QXDB 1RZ7H 1U8QA 5LWYL 3P40A 1MREL 3LCYA 2ZOKA 2OS7A 3OJVC 4HIHB 4X8JA 4MJIA 4ODSH 5GXBB 1BFVL 3QWOA 3NABH 4WUKH 2Y7QB 3IFOB 4YK4C 2XNAA 3KYMB 3QEHB 5INCA 2R0ZH 4I48A 3L3JB 2AV7A 3LY6A 4Q0XL 1Y18A 2XA8L 4Y4HA 3L5IA 5DQ9A 1FO0B 4X98A 3SDAD 5SWZA 1CFTA 3GKZA 1N64H 3RY4A 1U93B 1ZE3C 1ZAGA 4JDTH 3BOVA 1BHGA 4YDVB 3BE1H 1OLZA 2I9LB 5CILH 5LBSH 2XQYK 1XIWA 5J6GA 2X4TB 1QLEH 1YMMB 3DROA 1A3RH 1JRHI 3EFFB 1P84J 5EDXA 3MLTB 5KN5B 1BQLL 3PWVB 4HWBH 3HS0A 4RCAA 1DCLA 2H32A 2CSPA 4G5ZL 1GL4B 1YEFH 3HNSL 2DI9A 5BZWB 2R69H 3G5VB 4OD2A 3P73A 2BVQB 1ZK9A 3HG1A 1ZLUH 1I8KA 4N0FB 4HUWB 2VLRA 1X5IA 4DUWA 1V7NL 4RBPK 4EOWL 5KS9F 3ZZ1A 3Q2CA 5JPNB 4ODBD 5B39B 4D0DB 3T77B 3E1F1 3QDJB 3CDFA 4RMVA 2AV1B 2VDRH 5DRXB 1B0GB 3FQUB 3ARFD 2XN9A 2O5YL 5GGVY 1FBIL 3BHBA 3LRHA 1A9EB 3QI9A 2JLLA 2R15A 2IPTL 4MCZB 5K59E 2X10A 4BZ2H 5GGSY 3MUGA 1KCKA 4P59L 5KW9H 5I18L 2B1AL 3FN3A 1XF4B 3PWUA 2ZOLB 1JZ2A 1ZHLB 4KUZL 2ZSWA 1CFVL 4Q6YA 4QNPE 1A0QH 1S8DA 3UTPE 1M6OB 5FA3B 3V4PH 4CN6A 2ZUSA 3DETD 1NBQA 3OJDB 4QWWC 2ICEA 4U1JA 4YZFE 4YHNB 1QO3B 4LCYA 3EIFA 5E2JA 1MFCH 4FZ8H 4L4VE 2ORBH 4PJ9C 4YPGB 4CVXB 4BK4A 4GSDL 5IKCA 2IH1B 5TJWK 1E4KA 1H3PL 1MOEA 3P0GB 2QQNL 4S2SA 4KRMB 4AIOA 4BUHA 1LD9B 5IG7B 2DKMA 3HB3C 2IQ9L 4HWNA 4RAUB 2HG5B 5J1AA 4XI5D 4MAUH 4WFGE 3FRPG 3STBA 4GRLC 3HAEB 3QG6A 1G9NC 2P46B 3IDJA 4PJ7F 1T66D 3WV0A 3MLVH 3TO4D 4ZTPH 5FK9B 5GS1C 3INUL 1NANI 1M7XA 4OIIL 5SWSE 1QSZA 1KV3A 4AEHH 3HLAA 1NH6A 4KROB 3STLA 2NLJA 3S34L 4PGCA 2DYPD 1OLLA 3PV6B 4R4ND 4JFPA 3SDDD 2XQYG 5ETUA 3OKNB 1IZKA 5DS8A 1ZS8B 1FFQA 2CKNA 5C0FA 4GXVL 5D96C 5DJ2B 5J57B 1LP9E 1OTTC 1NAMH 4D9QD 3L5WB 5DRNA 1K6QH 3C6LD 4ZXBB 3CVHL 3OF6D 3QDGB 3QT2A 3QEGH 4HLZH 3S3SA 5K59F 4E41D 3DIFB 1W72B 4U1HB 2AJSL 3IDIB 2DQUH 4WDIB 2OJEB 1KB5L 4QXTA 5EU5A 4TRPL 3CZJA 4LSRL 4Z7NF 1D5MA 2AJUH 4P23C 1IEHA 2P7TB 5INDB 4IMKA 4QNPF 5JO5B 1ZHNB 4ZOCA 1UB6A 2OI9C 4KY1H 5JHDD 4Q6IB 1WAAF 4YZFF 5H35A 5CP3A 3D39A 5C0BB 3FB6B 1A7PH 1MRDH 4IHOB 1FNLA 5SWQA 1P4BL 1FRGH 5DLML 1KTKE 2FX8L 4MD0A 3VFTA 1YYML 5FM5M 2QADB 2BNRB 2ZCHH 3SE4C 3HR5B 4HQQH 6FABH 5HGGS 3FMGL 4Y4HC 5F7DB 3DX9A 1JN6B 2QQKH 3OJ2C 4PP2A 4ONGH 4RFOL 4R4FL 3UTSB 5DDHA 5DQDH 5ESVA 5F71A 4WI9A 1QYGH 4F58L 5AWNL 4HBQA 1TVHA 4MB5A 1TLKA 4HKBB 1CDGA 1D6EB 3M1BA 4FFWC 2BOCB 4PRNB 5GRVK 1ZTXH 4X83A 4U1SA 2EEDA 1S9XA 1XIWC 1UWXH 2YZ1A 5E24E 2NX5E 3ROLB 4I0PA 1UXSB 5LAXA 1HHKB 4NM8H 1LHZA 2YRLA 2FL5A 3RVXC 2YD2A 4ONOA 4ZYKB 1AGBA 3CX5J 1KFAL 5J3HD 5TDPA 3U9UA 1JGDA 1T0MA 2ZUQC 1UT9A 3VFSA 3HI1B 1PJ9A 4JM2B 4BZ1H 1QA9B 2ZKHL 2G9HB 4X6BB 2MQ0A 4NQCE 1BM3H 3EO0B 1I8MB 4KRLB 5CD5D 2AQ3A 4U1MA 5GGVL 3EYUH 3HC3H 4HCRL 2FHBA 3BWUC 1CDHA 5GRVL 2WNGA 1NMBL 1B2WL 4BA8A 2BSRA 2C1PB 1MFDL 4WCYH 4BQ9A 4LRIA 1LNUB 4QGYA 2L4OA 4OLWL 5HGAA 3KPQB 1PYWA 2D2OA 5I8CA 3A0OA 4AMKH 1IGCH 4DEPB 3LB6D 1NEZG 1H3XA 2KQNA 2DKSA 2W9EL 5FB8A 5GGUA 1ZVSA 1KIQB 1KXTB 2XFXA 4O9HH 5EO0B 3TVMB 3QA3B 1MFBH 5DK2B 2GCYA 2VC2L 1IC7H 1Z9LA 1U8HA 3EOBA 3GB7B 4WHDA 3BD5A 4UINH 1YEKL 5CKAA 1A6UL 2YSSA 4EDWL 4F3FA 4MB3A 1RD6A 1MIML 4BSVB 4TUKH 5JOEA 3OR6B 3LVEA 2N1KA 1CYGA 1OGAE 4XCCH 3D0VA 1E4KC 5EO9A 1HSAB 4WFHE 2HTKC 3HMWH 5CCKL 1K2DA 3L3KB 3ABZA 4E42B 3MV7A 5EG6C 4JREC 3ALXA 5IMOA 3IDUA 1JPTL 4L9LB 4DFIA 3PHOA 5JW4M 3T8XB 2X89A 4TULL 5E4IA 1YEDA 5IOPB 4GRWE 2EE9A 1T6WA 3BKJH 1YC7A 3HKFA 2NXYC 3H0TA 2BERA 4U7MA 3BSZH 2XWBB 5BMFH 1B4JH 3CK0H 2NY3C 3M17B 4J3TA 1T22A 1MAJA 2XTJD 3OR7B 5JIKA 3IFPA 3O9WA 3NCYS 3RWGA 1U6AL 3LKSA 4PRHA 3TH4T 5EUOF 3DARA 3G04A 4XXCA 5B38G 2ZJSL 1NBVL 5D1ZD 3DGGB 3F7VB 3T2OA 5LVEA 5HVHB 4WTXA 1C7TA 1Q9LB 1MJUL 3CZFA 4FQ2L 2WWMC 1JPGA 3LQAL 1WIPA 4UOW1 3IETA 5CSGA 4ZSOE 4YGAB 4ZUSA 3N1QC 5E2VL 1OVZA 3QO0A 5I2IB 5L6YL 1K8DB 3CFEA 4NQUA 1WV7T 3F7QA 3RL1B 2HFFB 3VXOB 3KGRA 3PWPB 4IMKC 5F9WC 4XP4H 5F1NB 3QO1B 2AAVA 1JI2A 5HHXL 3SCMA 1YDPA 4WJ5A 3FQXA 3IDMA 2YD3A 4H5SA 5CGTA 3QCVH 5DD6A 4JQXA 1JNJA 1GGIL 1JNHA 2R4RH 1NGZA 1D5XB 2ADGA 3MNWB 1OAYL 5IBTL 4K3JL 2LQRA 4PJXE 1RU9L 3R06A 1G1CA 3G6JE 4JVWA 4PJHA 1C5BH 4HPOL 4JY5H 5T3ZE 2CKBH 2EKSB 3WHE0 2XY2A 3CFJA 1F58L 3S37H 1MF2H 1NFIA 4NN6B 5IVNA 1NGQH 4P99A 2PO6D 1UKQA 4LCCA 4M7LT 5I8KL 1U58A 3T4AA 2VE6A 3MCLH 3GJFB 4JRXA 1W0WB 2D03L 3NFPA 3GMOB 5HHMD 3VGAB 2E9IA 3WS6C 1QNZH 2Q76B 4OZHA 3V9FA 1S7XA 4EI5B 4I0PC 1VKXB 4KKBD 4OF7A 2Q7YB 1A6VL 3AC0A 1QRND 1F2QA 4KUCD 3V7MA 3MV9A 4LVEA 5DHYB 4ERSL 4G9FA 3A6CH 1J0HA 3H3KA 1T2XA 2X09A 3IS0X 3CJJA 4LLYA 3QH3B 3U1SL 1DQDL 1HCVA 1MRCH 1H8SA 1IT9H 4GOSA 1PZ5B 3EJYC 2PYED 4N9GA 3Q3GB 3ESVF 5DFWH 3MNZB 3O6FB 4HWBA 3M8OH 2IBBA 4RMWA 3FN9A 5HVGB 4KTYA 2R2CA 4GRWH 5ENWB 3LS4H 2YRZA 1RUPH 1J8HA 3FO2A 1BX2A 3V52H 1AO7E 5GS0L 2GUOB 2BNQA 2VL5A 1IM3A 5EN2B 3UP1A 3K46A 1U8LB 4OLEA 4N0YL 2DQCH 1WWCA 3WN5A 1C5DA 1FCCA 5CINL 3SKMB 3O2DL 1GGCL 4AG4H 5CP7B 5LGHL 4OZ4A 1O0VA 4P3DA 5IVXE 3JWOH 5EU7E 4QT5B 2V9TA 3D6GA 4PJXF 1ZT4B 4HAFA 2XG5A 4CW1A 1EHLL 4YR6A 4DVRH 1HHJA 4QOKE 3SGDI 5DZLA 1Q0YH 3G08B 3OAUH 4UILH 1JL8A 3QIBB 4R8WH 1G9ML 5DEFA 3TJEL 3JWDH 2FZ3B 1AXTL 5F7NC 5F1SA 5FHAL 1OAQH 3MZGB 2MSPA 3SDCA 5DJXA 4HX1B 3IF1A 3QUKA 3VH8B 3H42L 1A1NA 3X13A 4NM4L 1N6QL 3F58L 1J18A 2DB8A 5DUMH 4CN1A 4JY4A 4DQOH 1TCRB 3B5GA 1YNLH 3KLDA 5C86A 2FECL 1TZIB 2P24B 4K7PY 5F9OL 5KVDH 1B3JA 4RSVA 4APQD 5JXEA 1B6DA 4I5BA 4KJPC 5KSVA 2VDML 4QRUA 3BMVA 3VWKD 4N5UA 5AUMA 1MI5B 2H41A 1MWAB 4WVRA 4HZLB 3H3BC 4XPGH 3TBTA 3TYFA 2V7NA 4W4OC 4PJEF 4NQEE 4ZS6D 4G7YL 4U1LB 2YC1B 3NIFF 3CXDL 2A9ML 4U6TA 2C9AA 1ED3B 3FFCD 43CAA 1FC2D 1A6WL 2D4DA 2BSTB 1JYNA 3WFCH 3BP5B 4Z7WB 1J0KA 1LQSR 3LEVH 2ZUUA 5A2JH 2GIYA 4PRAB 4F9PA 1JBJA 2YUZA 3G6DL 2B20A 3MJGX 4XP5L 3QNZA 5I0ZA 4WWKB 2Z0BA 3ARSA 4C54A 1NCTA 4KJWC 1J87A 4QRSB 4OT1L 2OK0L 4HW6A 3MRRA 4K71C 2OL3B 1CDJA 1IAIH 3KLHC 2RIKA 4U6XB 2YA0A 1G0YR 1DBAL 2EYTA 4YNYB 4JCLA 4S1DD 2AXHA 3OZ9H 4L3EE 2V2XB 5I15H 1RI8A 4EXKA 4U1KA 4DTGL 2HKHL 2E9BA 4H26A 3ULVF 3WMSA 3SDAB 4PBWD 4P5TA 2IPKA 3CLFL 2JK5A 2PW2B 5DFTA 2I9TA 2FD6H 1ZEAL 5D71H 2BVPA 3K7UA 3QUZA 3FZUC 4LCCC 1ZLVK 4P2RB 5D7LE 4N8VB 5FO7B 1Y0LA 4XPTL 1I1RA 5IVOA 4HT1L 2P5WE 2SEBB 1DBMH 4XWGL 4AEFA 4NOFA 2IANA 2JF1A 1U8KB 4WNQB 4YBQC 5E1AB 5KANG 4H0IA 12E8L 3SEPA 1W72L 2CGRL 5FCUL 3U7AA 1R3JA 4WIQA 1TZGH 4NYLB 4PLJC 5FV1L 4OF6A 4YJZL 3BEVA 4Y88A 3FFDB 5TGBB 4XPFL 5IJKA 1TZHA 5T1DL 4YAQA 2XWJB 1NL0L 1OQOA 5KSBF 3V6FA 3VMNA 4ZPVB 4L4VA 4NC1E 4W6XB 4U1NA 1IAKA 4XP9H 1ND0A 1YEJL 3T2NH 3V8CA 4LQFH 2R29H 1QPPA 5MENE 1ZA3A 2P42B 2CLRB 1S7TB 4L8BB 3I6LE 4O2EA 4YFLF 3VXMD 4AL8H 5C92A 2OXHA 3WN5C 5ID1B 1EO8H 3ZSSA 3SGEI 3MJ8B 5HYFA 3MA9H 3NA9H 3VXPB 5AD0B 4TTGA 7CGTA 5SWSA 3MMEA 4GKSA 3GJEA 1KJMA 1IGML 1QR1A 4P57A 2BVOB 4HIXL 1KTDB 4K3HA 5AYUH 1FL3A 3L6FB 4MVBD 2BVEA 1IRAY 4M7JH 3NBNA 3BN9D 1UYWH 2ADIB 5D5MA 5HTSA 3ZE2F 2J88L 5CIPB 2RBLA 1QFOA 3LSOB 4DW2H 4OIBA 3SE9L 2C3VB 1KCVL 2XG4A 1LP9A 4JDVB 4BFEA 3U46A 2CDFB 3Q5TA 5HGHA 1DVFC 1QHOA 5CWSB 2EC9T 3LZFL 5IB3A 3S36L 2Y72A 2R23A 3HHRB 3SDCC 3BXNB 5I8EB 5C0CD 5F7MC 2XT1B 4KRNA 1FGVH 4ETQA 2VXUH 1I7TB 3QQ9C 3U0PB 5KVMC 4QCIB 5IIEA 4MXQC 4K7PL 1DQJB 4NO2B 3TO4B 4UIMA 4EEEA 1JYXA 1BD2E 2C3HA 3D2UD 2EH7L 1FFPA 1RUKH 4HIHA 4HKJA 1RHHB 1PX4A 5JXEC 2PTUA 3B5TA 2DYPB 5HHOD 2EO9A 1I9EA 2W9LA 2DIJA 3KPOB 3SDDB 4OD1L 2V2WB 4MA1B 4MAYA 2JB5L 4S1SH 2V7HB 4JDZB 4F7PA 4Z95L 1OP9A 3DSFH 4DZBA 1LILA 5DD5L 5IGXL 2BVYA 1BVKA 3BH9A 4MNGE 3Q5OA 4PJBE 1MCOH 2PN5A 5LXGH 2GTWA 1YUHB 3F5WA 3C6LB 1MCPL 4M9PA 1LGVA 2ICWJ 5I1GH 1MCSA 1AH1A 5DA0B 3ULUL 2X4TA 4OCMC 1YN7A 2PXYC 5MERB 4E41B 4ZFZA 4OCXL 1S5HB 4K8RL 4M7KL 1S9YB 2FSEB 2WBKA 4XT1C 3OMZA 3QDAA 2YD4A 3WCYA 4MCYA 1JGUL 4F9PC 3RIAF 3QXVA 5BZWA 4F2MB 3G5VA 2E7LA 2D9QB 3PP4L 1FVDB 4AEIH 1RJCA 3EDFA 5J6HB 3HE6D 3MRJA 2APVA 3H7BA 3QHTC 3O4LD 3LPGA 4B0MM 2OYPA 4R26H 5B39A 1JK8A 3BQUA 2DI8A 3LD8B 3QDJA 1JZ5A 2CMRH 3MRGB 1T1XA 3TESA 1B0GA 2E27L 5E8PB 5EUKB 2EIDA 1BLNA 4LAQL 1A9BB 1BZ7A 2X4SA 3U83A 4NQCA 3QJHB 1A9EA 4RAHA 3DXAE 4RMRA 5EOCL 4MCZA 3FO0L 4MA7L 4DAGL 2B5IC 4IRSD 3T09A 1DR9A 1E4JA 4PB0L 5I6XC 3FO1A 1DUZA 2F19H 5CJBA 2G60L 2CKBA 5FUOH 3N1MC 4ZPTA 1VACA 2GHWB 5MEOA 4Z76A 1BQHB 5IEHA 2WMPA 3QHFL 3OJDA 3ZDYE 1EFXD 3S36X 1KB9J 1AGEB 3QQ3A 4L4JA 2RJMA 4LNRA 5D7IB 4CVXA 3BKYL 2MCPL 2WQ8A 1KN4L 5E8DL 4K7PX 5JXAL 5IB1A 3MBED 3U4EA 3RJQB 1LD9A 3QPXL 1SHMA 3ZKQD 1CL7H 5I66B 1EMTH 5DUBB 2MTPA 5L2JB 3HAEA 1OB1B 4OZFB 4EKXA 3HZMB 4JO1L 5GZND 1OGAA 3TIEA 2ZUTA 2QSCH 4NZRL 4U6YB 2FO4B 4DFHA 4XB7A 2J8HA 3K1DA 4MZ3A 3PV6A 1FSKC 2QHLA 1L4IA 4IMLA 2QHRH 1ZS8A 3FN0L 1QBML 2YK1L 3T3MF 3ZKXC 1GPOL 4ZFGH 4RWHA 4QF1B 4NNPH 1BEYH 3DHJA 4LLWB 3VDCA 5DXWA 5DQJA 3L5WA 3GUTA 2F54E 3MFGB 4HS3A 1N2RB 4F37K 5LWYH 2E6JA 5FIEA 1MREH 5IMKB 3LRSA 1RZ8B 5EZIH 2OSLA 1I85A 2BVTA 1XF2B 2WP3T 4WDIA 1MCJA 4WUUD 2DQIL 3MRMA 2NY4C 2R9HC 4HIEB 1N4XL 2CK0L 3QNXB 5INDA 1H5BC 5JO5A 1NCUA 1ZHNA 1KLFA 5FGBC 4NO5A 3KYKH 1Q1JH 4OLUL 4Q6IA 3ZDYF 1AQDB 4Y4FD 4JGUA 2X9WA 1FFOA 3CFBB 3KXFA 5C0BA 4NNXA 4HUMB 1JPFA 4TVPL 4LEOA 2B4CL 3EOTL 5C3LD 3W39B 1F45A 3BN3B 1IJ9A 4IHOA 1OCWH 3FB8A 5IEKB 1I9RH 4QTHA 3I3DA 1UKTA 4MAYC 3TZVC 1BQLH 5HXMA 4F15C 1Q8MA 4M6OL 3EYQD 1PKQE 3HNSH 4GW5A 4LF3A 2ZCLL 2ERJC 2PCPB 4HKBA 2Q8BH 3AXLA 1D6EA 1R5WA 3QIWA 2NNAB 1GZQB 4JM4L 1K4DA 4PJCE 5AZ2H 4OZGB 1V7NH 2XV6B 2CUIA 1FH5L 1Q9WA 2Z4QB 4PG2A 5JHDE 5BZDA 3V0AC 4MWFA 2QSQA 1JFQL 4L3AA 1HIMH 3JV5A 1KJ2B 2E6QA 3TYGL 3VFVB 4OV6F 2PTTA 1Y6MR 5FGCE 2DM4A 5DZOA 3VG9C 2O5YH 2CPCA 1FBIH 1QVOA 4G80A 2E7LC 4TOYL 3VXSE 4NKMA 4EVNA 3C09B 2I5YH 5D7SH 5HSFA 2W9DL 3MYJB 1QA9A 5GZOC 4FFYH 4P59H 5I18H 1E6OH 5I75B 4MS8C 2A83B 4NRXA 3A6BH 5JA9A 1MY7A 4KUZH 4LPVA 3CSGA 4PYHA 4PJAB 5I1DB 4GKNB 5D7JD 4Z8FL 4OFYD 3VWJD 2NW2A 3LN5B 4M6ML 4UB0L 2C1PA 4HF5H 3T3PE 2PO6B 1FIEA 1MWAL 5I0DA 3RVTC 2GJ6E 4ODUA 5L7XH 4JN2B 1N3NB 3QEQE 4X7TB 2VDKH 2QQNH 1C12B 5IK3A 1AGFB 5HHMB 3TIDA 1FYTD 2UV3A 3ARDD 1GIGH 2IQ9H 5F96H 3MLUH 4PB9L 3TVMA 1G7PB 3RWDB 4YEEA 5CJXC 1YYLH 1QRNB 5IVXA 3U7WH 3U0WL 5ALBL 3INUH 5C2BH 4BSVA 3H6JA 2OBGA 3B43A 4MHHG 5EPMA 1T2QL 4QOKA 2NTFA 4GMTL 2PYEB 3T4YA 5CZXC 4E42A 4PJCF 5JORB 4Y16C 4HXBL 2GKIA 4JAMA 5DURD 3KPRD 5FO8A 2Z9TA 3T8XA 1F5WA 4BQCA 4H25B 2OL3L 3PDOB 5IOPA 1MCDA 4FQHA 5ADOH 3MR9A 3CCHA 2CD0A 1A02N 1CXIA 3IFNL 2Z91A 3M17A 4LPWA 3HPLA 3EJZD 3OR7A 4LASL 4POUB 2AJSH 1TQBB 3LKQB 1S9WA 1KB5H 4Z7VE 3MO1A 3BPNC 3DUSB 4TRPH 2DAVA 5HPMB 4YDLB 3I84A 3D0LA 3EYOA 4Z77B 3F7VA 4KDWA 4UT6L 1CFSA 4MJ4A 5E6YA 4NKQB 5L8JB 3E2HB 1Q9LA 4X6DE 3M07A 1IC1A 3ZE0E 2IBGA 3JV6B 2BSED 2B1HL 2VOTA 1WEJL 1MNUH 5IW1A 1MCKA 4NQEA 1I85C 1P4BH 4R96B 3MV8D 5DLMH 2FX8H 2ADJB 3EHBD 1QSED 3CUPA 4KMQA 3UO1L 3G5XA 1QR4A 4RWYH 1BFSA 3VXOA 4TSBH 3FMGH 3PWPA 4V2CB 3UPCA 3B5HA 1X4ZA 5F1NA 2MCG1 2ZSVB 4RMTA 2H26B 2XTJE 3GRWH 4IEFB 4OB5L 4F58H 2YMXL 4LLQB 2NY2D 4RNRB 5I1KH 1BAFL 1RZGB 5BRZE 2W60B 1A7BA 2WZPD 1P7QD 1G7IA 1L0YA 3MLXL 3F6LA 4JRYB 3D3VD 1MCHA 3H9HB 1AIFB 4X7SH 1OM3L 1P7HL 5DEZA 4O02L 1CTOA 4UU9B 2AJYH 1KFAH 4X6FB 4V1DD 4KAQL 2VDLL 4L3EA 3FOMB 5LGJA 4X4XA 1NMAL 2EXWC 1FVCB 1QFPA 3QIWC 2YKLL 3SGJA 1JWUA 2DICA 2ZKHH 1Z3GL 1S7WA 4XBPB 4PRID 2XY1A 3GM8A 2F74B 2Q76A 2OJZL 4EI5A 2I26N 2LABA 5GGRY 3VI3E 3NFNB 2VABB 5M7QA 4K3GA 5D7LA 4Z7VF 1EVTC 4NNYB 5HDBF 4MX7B 2CIKB 2P5WA 3W9DB 4MDJB 1VCAA 3ARVA 5MEPA 3E8UH 1MFDH 3UPRB 1A1OA 1H3TA 5ITFB 3LV3A 3UJIL 3Q3GA 4LLDA 3REVB 3MNZA 4L5FL 2FX9L 5KZCB 4YC2B 2JE8A 1FFNA 3V5KA 2EXYC 5ENWA 2X1QA 5E7FA 1BBJB 4G6ML 2X70B 2VC2H 4DGVL 5EN2A 1EFQA 4LCWD 1QBLL 4NZTL 1U8LA 4Y5XA 4YDIL 4P3CL 4UTAH 1SEBB 3GI8L 4EDWH 2GYSA 5CP7A 1MIMH 3O2WL 5MENA 4XWOD 5KVGH 5FO9B 3DBXA 3VGFA 1U3ZA 4ZQKB 2DL2A 5IVZB 4HS8L 5EORL 1NBZA 2Z8SA 4JR9H 3K0WA 2W59A 5CCKH 3EYSH 5BVJA 5C0NC 1M7IB 3MUHL 3PIQA 1T7YA 1CE1L 4QHLB 3LS5L 4TULH 3V7AG 1D6VH 4YXLH 4CBPA 1BOYA 4NN7B 3LQMA 3U6RA 4JO2L 4ZFOA 5FKAA 2FZ3A 1QSFD 4YHLH 4RISL 2H6PB 1LO0L 4XP1H 3QHZL 1CFQA 1GVIA 3MXVL 3IDNB 4MJ6A 3GBLA 4QWWD 2DBLL 3WHE1 2J6EA 3GSNH 1CXHA 5C70A 4ODWA 3ULSA 2AABH 4LPYA 1RMFL 1LO3H 1G7JB 4PJ9D 2VLMD 2V2TA 2APFA 4G8EA 1Q0XL 2IFGA 1S7SB 3I2CH 1A7QL 1IEBB 1MJUH 3GSWB 3VXMB 4EDXB 2UWEB 2ZWLT 5FYKL 2NW3B 3RA7H 1UH3A 3HB3D 4PP1C 5DYOA 2NY6C 4WHYG 2QKIB 4GRLD 5E2VH 1BD2A 1UH4A 5L6YH 4LHQB 1CF8L 3ZTNH 4KRPB 1J8KA 1NDGB 4QRTA 2X7LB 5D5MF 2NY0B 5JPMA 4WFED 3IGAB 2CRIA 3EKCA 3RP1A 5I73C 2MMXA 4XBGA 3OKDA 1GGIH 1NCDL 4G9DB 4K3JH 4PJBA 1VFOA 1RU9H 1BIIB 3AS2A 4IDJL 1OTTD 5JOPE 3W9EA 1DQLH 4HPOH 1EO5A 1CLYL 5DJCB 5C0CB 5MP6L 3BP6B 1VFUA 1F58H 1VEOA 4PGEB 1IGIL 1OAZL 4WWKA 5DO2C 3TBWB 2DLFL 4QRSA 3ARXA 4OLXL 3MUJA 2GSGB 2QTEA 2WLYA 4HHAA 4HWZA 1X6LA 2RFXB 3D2UB 5I8KH 5GS3A 4U6XA 3OGCA 1TNMA 2UVEA 1AP2A 4P23D 2VJXA 3FTGA 5D2NB 1YQ2A 3RNKB 1PLGH 5C7XL 4RRPG 4UDTB 5DVKA 1A6VH 3Q1SL 1F3RB 4LCUB 3CSYB 3MYZA 5IBUB 3MFFA 3SDAA 1QEWA 4X6EA 5BXFA 1X5LA 3BESR 3FFCE 3S88H 5ILTH 4RGNB 4PR5B 4AM0B 4JJHA 3QB7C 1SY6L 4JGJA 3DMMA 4N8VA 2DM3A 5K33A 4IJ3C 3SGJC 1XF3A 4Y1AB 4I4WB 3UTZB 4LVHB 4BSJA 3DXAA 4ZG1A 4MQXC 1ETZB 3QEUB 3CLEL 1ZMYA 1CZ8H 2FB4L 3LDBC 4Y4HD 5EZJB 3UTQB 1HH9B 1G0DA 5SWZD 1X4XA 5E1AA 3QXAB 1JWSB 1FZMA 3AY4A 5GS0H 2P8MB 5BV7B 5J7CC 4JFZL 1JI1A 4X6CB 1JP5A 1VFAB 5JR1L 1GGCH 5TGBA 3HZYB 2I07B 3HE6B 2XWJA 5C71A 5LGHH 1G6VK 3O4LB 1RFDL 5IHZB 3VXRD 2C5DC 3RVXD 5I1AB 4OZFG 1DFBL 1WSST 2GJZA 3DOSA 4UQ3B 2APWA 1SJXA 3ARFA 4U1GC 3RVWC 4MD4A 1UJ3B 4FXKB 1UGNA 4NC1C 1G9MH 2X4OA 4LAJH 1U8PB 2VUOA 4K23L 4J3SA 2VLRD 4UNTA 4JG0L 1E27B 5IHLB 4IRSB 4Y19E 1T83A 5FHAH 5DTFA 1FLTX 2Y07L 1T80A 3ZDZE 2A73B 4X9GA 4KI5E 3LAFA 4AZ8A 4G6FD 3ZMRA 2XQBL 2VXQL 5FM8A 4NM4H 1WISA 1N6QH 2X1OA 1ZT1B 2JJUA 2O5ZH 3QFDB 4OCLC 5DVNA 5C0DA 1EFXB 1S7QB 1MFEH 2V5MA 3ARTA 4UUJB 2P48B 5F9OH 3O6ML 4WO4A 1QLRA 3O2VH 5IQ7L 1EEZB 4NO3A 4ZOEA 4HWEL 5CWSA 2VDMH 4CDGC 4F8QA 3MBEB 1VESA 3SOBL 4NHUB 4O2CB 1I7UA 5I8EA 5IMLA 1MCEA 3P77A 1SVZA 4GW4B 5T3XD 3WJLC 1I7TA 4JVUA 4YWGL 4IS6B 4CVUA 3S4SB 3AFLA 4HS6B 2LU4A 2C3XA 3O3BB 4YX2L 4H1LG 3BIAX 5CBEA 1DQJA 5T5NG 2WINB 1ROWA 4G7YH 2P47B 3VFMB 4JFFD 1MCWM 3B9KB 5FECB 1TJIL 4GG6E 2A9MH 3WNMA 2HTKD 5L88H 1D5IL 5HYQA 3BD4A 1AR1C 1J88A 3KS0H 1T1ZA 1HYRC 3VA2C 2J8OA 2NXYD 1HH6B 3G6DH 1OSZB 4XP5H 1YUHA 3BZDA 3C6LA 2NY3D 1CD9B 3L7FB 2QQQA 3WFHB 1MSPA 1KB5A 4RMQA 3VFUB 1PKQA 3D48R 4E41A 2RCSL 3CVIH 4BK5A 4ZUUA 2WBJC 5BOZG 1S9YA 2DQTL 3P4NB 3CPLA 1ZHBA 4LDLB 4WUUB 3T65A 2X9XA 3QCTH 4KI5F 2EKJA 2HKHH 2VQ1A 2JIXD 5IB2B 2HRLA 4N1HB 5HHOE 5JHDA 2YA2A 4KWUA 1ZEAH 4Y4FB 2WWMD 2NZIA 5DMKA 2LTQB 3SKOA 1B88A 2E7MA 4I18B 4TNVK 4X7EC 1HDMB 5E8EA 1CGSL 4XPTH 4WWID 1TNNA 3KG5A 4ZDHB 4HT1H 2VDNL 4XWGH 1UZ6E 3VXSA 1A1MA 3T0BA 4NO0A 4P4RB 4ODVL 3UPAA 1I3GL 1A9BA 3TBSA 3GRWA 4JZJA 3WO4C 1NEZA 3GGWA 2NPLX 4O2FA 2CGRH 3D39D 4RZCB 3T04D 4U31A 3MLSL 1L9NA 4GUPA 3RWJB 1MCNA 3GIVA 1SJEB 1OD7A 3DMMC 2BCKB 4W81A 4PGDA 2OP4H 2DOCA 2PR4L 1KJVB 3BW9B 4UDUB 4FABH 3SDXB 5T1DH 2XZQL 4N0RA 1KIRB 2VZVA 1RIUH 1MHHA 4M48L 3FB5B 1BVLB 4JO3L 4H0HB 1NC4A 1ZLVH 3WFDL 4NBZB 1A4JB 3AY4C 3ZKNC 3GMMB 4H88H 5TF0A 3WIFA 5D7IA 4C56B 3CFIC 2A2QT 3PQYD 3TBYB 1A7OL 3FRUA 2HN7B 3Q6GL 3BT2H 4M1GL 4JM2F 1L6ZA 2W65B 3CDGB 2B2XL 2HMIC 1QTYT 1RZJL 4I0PD 4HKZB 3UX9B 5E5MB 3MBXH 2F9BT 3BKCL 3SQOL 2XPGA 4ACPA 4J8RA 5IFAL 5L2JA 1IGMH 1QQDA 3HZMA 1CDUA 3O6KL 3P3YA 2NQCA 4L29A 3KPPA 1LEIA 3TT3H 3CFKA 4LOUC 4U6YA 2FO4A 3BRGC 4IRZH 5CMAA 1TETL 2EIZB 3L5JA 3HZVA 1AXIB 2Q86A 1EV2E 3SE9H 3BGFC 1KCVH 2EEBA 1HWGB 5B38A 3EJYD 4OUOA 3NH7H 1X5HA 5A2LH 9CGTA 5ACZA 4XMKH 2AEQL 3S36H 4W6WB 1SBBA 4G6KL 4IBLT 4G42A 4HFUL 2H2PC 5E1HB 2NY5L 4QF1A 5MEQB 5EA0L 4MDIB 3EZJB 5B3JE 1FYTB 3P0VL 3ARDB 4YHZL 1FL5B 4FXGB 3ULUF 3EOYG 2MPAL 4G8GE 3HUJE 3UJTH 3AU1A 2OTUA 4JB9H 3MRLB 1LK2B 1W8OA 3MNVB 3H9YA 4YBLB 2A1WL 1CVRA 4WO4C 4KDTA 4L4TB 4HGWA 2Q6WA 3KJ4C 4YIQB 2HYMA 4JN1H 5GIRB 4OF0A 5IV2B 3F6IA 4LNVA 1TJHL 4CMHC 3EO9L 3UEZA 2JB5H 4XTRC 5DURB 2VISA 3KPRB 5DF0A 5DD5H 5IGXH 1NGYB 1AQDA 4DN4L 1EDQA 4OF3A 1MRFL 2X4RA 1UM6L 5C0AD 4PJDE 2I60H 4D94A 1F2XK 1CGTA 3EOAA 2CIIA 2BJMH 1MCPH 3W39A 2FEEI 1ZWIB 4ZNEA 4X80H 3WLBA 1RVFL 4ZUWA 3GSNA 1XR9A 3CC5B 5JUEL 3MV7D 5GGQL 4A6YL 3SKUD 1WBZA 4K8RH 2D0GA 4M61B 2DMKA 2DD8H 5BRZA 3I9GL 1JGUH 1A7NH 4PG9A 5D1ZA 4LHUG 1FZOB 2PCPA 5ESQB 1J1PL 1KENL 5D4QA 4KJPD 1AD0A 1SQ2N 1NCWL 5F7WC 4RAVB 1YN6B 5EU3B 1MHCB 5GRWA 3MV8B 1QSEB 5FDYA 2VRAA 5FYJU 3VFVA 2E27H 1MAML 4N5EC 4LAQH 4PRPE 1F90L 3QJFA 4MLIA 3S96A 3TO2B 3NGBB 4OM0H 2YPLE 4MSWA 1MLBB 2EE6A 2NY2B 3IXAB 3PWJA 1ONQB 3FL7A 2BMKB 5A1AA 4PB0H 1FAIH 1P7QB 4P49A 2HFTA 3S9DB 5DD3L 4XMPH 5DMYA 2UY7A 3HPJA 1FJ1B 1NLDH 3P30H 4F7MA 5DVOA 2DWDA 1JV5B 1CGVA 2VDPH 2XXCB 4JZJC 3JTSA 3LN5A 4KJWD 3MUY1 5CJ5A 4WW2F 3P11H 2PO6A 3PNWB 4FZEH 3KLHD 15C8H 1A6ZA 1LEGB 3BKYH 2MCPH 2MHAA 1JWMB 4NN5C 4Z7UE 2R2BB 4JN2A 3MXWL 3V0WH 3AM8A 4YK4B 3WNNA 4J3OC 1VFBB 2J3SA 3UC0L 5L2KD 4L8CB 3WFEL 3QPXH 4PRIB 5JLZA 3AS1A 1G7PA 1CTNA 2IADA 4B50A 2PTVA 4RGMC 4UT9H 4JO1H 1WK0A 3STZB 2I27N 4NUJB 4ALAL 4U49A 1IGFL 1K8IB 3FZUD 4N0UB 3UTTE 4LPXA 3DX6B 2L7JA 2YN3A 4JRXD 1EH9A 2AP2A 4D0BB 3X14B 3FN0H 5JORA 1QBMH 2CK2A 2YK1H 4X5XB 4Z0XA 3DYMA 4YBQD 5C0IB 1FGNH 3WKML 1PQZA 4D2NA 3OV6A 4G9FD 1FYHB 4LARL 2AK1L 4QXUL 1HHGB 4PLJD 2Y5TB 5HYSG 4LCWB 4XC1L 1R3KB 5C0EB 4HK3N 1F3JA 4S0TD 5ISZE 1UM4H 4D9RD 1OTUC 5M95B 3D18A 4QRPB 4UQ2B 5IF0A 1KLUA 1LDPL 5F3HA 2A9NL 3O81A 2MNUA 5E00B 1ZLWK 1SYVA 2OZ4H 2BNQD 4GS7C 1NCBL 1P69B 3X11A 1BREA 4XBEH 4OLUH 2D31B 1PDKA 2UVFA 1NAKH 3BDBA 5IROC 3KNBB 3RUGB 3FONB 3PDGA 5I16A 3EOTH 3JV6A 5AZEL 4KDTC 5BJTB 1NGXA 1QSFB 2BC4A 3GM0A 4KQ4H 2ADJA 4DOHE 4ELKB 2H45A 1UA6H 5BV7L 1GC1H 4OLZL 1QD0A 1IM9B 3KHQA 3VE0B 1JYWA 4KV5E 4M6OH 3KPLB 3IU3A 2ZSVA 3LEYL 3ZTJG 4N9OB 4PJGE 3MRBB 4PJ9B 2QQLL 2ZCLH 4LLQA 2FATL 4HUUB 1P7KB 1MVUA 1I1FB 4MB4A 1DVFD 1RZGA 2W60A 5HYEA 5GQBA 1HQ4B 4APQA 5EBLB 1V3MA 1I7ZB 1JHTA 4LMQI 3SDCD 4YQXL 4FQIH 1BGXL 1FFRA 1IGTA 3QQ9D 3VWKA 1FNSH 3UCRA 1U42A 4GRLB 1FE8H 2G5RA 4XNXL 4Q58C 3O3EB 3DWTA 1INEL 1SYSB 4PRDA 4X6FA 5GS1B 1JTPA 1JGVL 4JFYA 4LL9A 4PY7A 4O4YL 5C09B 1T4KB 3QDMB 3WIIL 4U6HA 1CDCA 3BISA 1NUGA 3HI5L 3GSRA 4YHYC 3P4OA 2VLJD 3FFCA 3NCBB 1XF5B 2JCCB 1TJGL 5D96B 3GMNB 4OGYL 2F5AL 1AXSB 4Z7WF 5GRXG 5GPRA 5DMIL 2MWCA 1TMCB 3LN4B 3RRQA 4XAWL 4MDJA 3K8KA 3NCJL 3D3VE 2HJLA 4L8SC 4M6MH 1OAKH 3BMWA 4UB0H 1X5GA 5J8OA 4D0CB 3B8YA 2PXYD 3LEXA 5KAQF 2YWYA 3RPIB 4P46C 4S1RL 1A3LL 2JJSA 5CD3A 4NIKB 2Z35B 4V1DE 3U30C 3PXJA 5HI5C 4K94L 1J12A 4P23B 1TTFA 4ORGB 3GSXB 5GISH 3GSUB 2E7BA 1DDHA 4GQ9L 3V7AE 2LU7A 2OI9B 5GSVA 5T1LD 3U0WH 3TP4A 3UJJH 2YD5A 3ZDXF 2ZOKB 4LLUA 3BPCB 5EC1A 4B7LA 5KTEL 2DS4A 5FO9A 1C08A 4FN0A 4ZQKA 4YPJA 3QWOB 4OFDA 3AM8C 2XNAB 3FCTA 5INCB 3DURA 1PFCA 2ZUVA 1ADQL 2AV7B 4G6JL 4Y4HB 4X98B 1U3YA 5SWZB 1CFTB 4Y19A 4Z7QE 1T5WA 4OQTL 3BZFB 1FLRL 1WITA 4BKLA 3AROA 1IFHL 5GJSL 5HDLA 2WM0A 2NY7L 1YEIL 3PGFL 3QXTA 2H8PA 1HKLH 1XIWB 3IFNH 5JW3L 3DROB 4LASH 4KVNL 3DSNA 3IDNA 3WJJC 3QXWA 1PSKH 3VXRB 5GS0C 3RX8A 1G7JA 5FA4B 5CEXA 3GSOA 4UT6H 1S7SA 2FGWH 3HNVL 4ZAKC 2BY1A 1IEBA 2BFVL 1KBGL 4HFWA 4MJ5B 1I8KB 2VLRB 5ACMA 4NZUL 2DQGL 4QXGH 4JKLA 2DIAA 4L4VD 3EZ8A 4MGXA 3VW3L 1KGCE 1CXEA 4G6FB 1NDGA 3UO1H 4G7VH 3D85A 5F7EL 4GG6A 5TE6H 2R0WL 4Q9CA 3CFCL 1G9MC 2AS5M 4PD4J 5E08H 3BHBB 3MOAL 2DDQH 4AIXA 4EI6A 2YPKB 1AJ7H 3HMXL 3OJMB 4OB5H 2COQA 3AS0A 2YMXH 4NKIH 1WTLA 3Q6FB 4UV4L 1BAFH 3MUGB 5BQ7A 1WZKA 1CIUA 1RJZB 3MLXH 1CI5A 5SWSD 3MJ7B 3UYOD 4YHKL 35C8L 3NACH 5GGTL 2ZSWB 3AAZA 4PTUA 1S8DB 5DJCA 5FYKE 1MUJA 1NJ9A 2OTPA 1KT2A 2ICEB 4LCYB 4KAQH 3WHXB 3MZTA 1CBVH 3DI2B 4U6VL 1NMAH 1IKNA 4R7NA 3TFKC 5IKCB 4CKVX 3X17A 5ICXA 2YKLH 4JFFB 3VFGL 4LLVA 4APQC 4PJIE 4JHAL 1RHFA 4S2SB 5HHOA 3UDWA 2NY4D 2R9HD 4R97C 4JREB 5C6WH 4Z5RA 4UDTA 3IVKB 4YUEL 3CX2A 4LCUA 5J1AB 2HFEB 3F7RA 1FIGL 3QG6B 4ONFH 2WUCH 3IDJB 1K5NB 1MPAH 4OF8A 2NXYB 3GK8L 2O5XH 3OB0K 1KNOA 1QFHA 1NLBH 2XA3A 4GBXC 1FN4A 1RIHH 1I1YA 3STLB 1YPZE 5TH2B 5DJ8A 2ENYA 4OAWA 4PGCB 2NY3B 3X12A 3IAQA 4I4WA 4MZ2A 5B21A 1FG9C 4HMDA 4JFPB 5DMJB 5ETUB 3UJIH 3MRHB 4L5FH 3PL6C 5DS8B 4MAYD 1GOHA 3TZVD 3UTQA 3C9NB 4WV1A 2YD6A 1BZ9B 1A14L 1DE4A 4Y2DA 4G6MH 5DWUL 2NCMA 5F7KC 3RZWA 1QBLH 2JIXB 4NZTH 4EBQH 2WWKT 3RU8H 4P3CH 2VZSA 2X4PA 1ORQA 3BKML 2I07A 3L3DA 2R2EB 1C1EL 4FNLH 3B6SA 3O4LA 4BQBA 2J8UE 4N90D 1WICA 5EORH 2WANA 4QXTB 1SJHA 4LRNL 1XGYH 5I1AA 4XHJC 1D5MB 5IR1A 1PY9A 4JPKH 3BO8B 3NFSH 4CGTA 2NX5D 3KPMB 3LS5H 1UB6B 4FXKA 5LG1A 3GMLA 2CDGA 5H35B 5J13C 1KELL 3D39B 4XNYL 5GZOD 4JO2H 4WI8A 5AG9A 5T1MA 4MS8D 3MREA 2VLLA 2B0SL 5SWQB 4M7ZC 4RISH 2A73A 1LO0H 2FCBA 4ZXBC 4MD0B 3O0RH 2CR6A 1XGRA 4Z0BL 2VXSH 1GCFA 1WZMA 1ZT1A 4UT7L 1OT1A 5H8DA 3HI6L 3DX9B 4FXLA 4PP2B 3W81A 1QSVA 5ESVB 2CQVA 1Q0XH 4KI5C 3RVTD 1TVHB 5T5FL 5D7IF 3M1BB 3PQYB 3RWFA 1QFUL 1VB9A 1G7LB 4U1SB 3NN8A 1UG9A 1NFDE 4G8GA 3HUJA 4I0PB 5LAXB 1EGJL 4FP8L 2FL5B 1CF8H 4HS6A 5GHWL 1JHLL 4LVNB 4M3JA 1AGBB 3CNKA 1EEYA 2KL6A 5FYLE 5TDPB 3U9UB 1JGDB 5IWLA 1T0MB 3NPSC 4OI9A 1AR2A 5FECA 1KG0A 5K9QG 4S11A 3UBXG 4WU5A 5CZXD 1NCDH 4Y16D 1KEGL 5ANME 1OSPL 3BJLA 1XGPA 4PJDA 4IDJH 1B0WA 3HE7A 5IFJB 4OCWH 3VMPA 1OAXL 4U1MB 1CLYH 4Q2ZA 5FYKU 1IGJA 5GJTL 4MMXC 2E9JA 4WFHD 1OAZH 4JPVH 1I9JL 3L3OB 3QRGH 2ZUWA 2BSRB 4TSCH 3JZ7A 5T3XE 2EDFA 4LGPB 2W07A 4X4MA 5HGAB 4JHZA 1PYWB 3GEWB 3TNNB 3TT1H 1HYSC 2OZ4A 5D6CA 3ILQC 3P4NA 4IOSD 4JM2C 5C7XH 3RTQA 4AJ0A 5GGUB 1ZVSB 5FB8B 2OR7A 3GBML 4MD5A 3Q1SH 4M1DH 2W0PA 2Z8VC 1DJSA 3K2MC 1U8HB 2DM2A 5IHUH 1T03H 2Q87A 1MQKH 1T3FA 1JF6A 5EFIA 3H9SD 2IH3A 2OQJA 4JY6A 2YSSB 5TQ2L 3TA3A 4F3FB 5C0AB 2CLZA 4OZIE 3S7GA 2RAMA 3JVGC 2UY6A 3D0VB 2VYRE 5EO9B 1T1YB 4NSKA 2CXGA 3UDWC 2YPLA 5LQBL 1K2DB 4MA3A 2XWTA 2FB4H 3CLEH 3MV7B 4P2OC 5IMOB 2M8XA 1ES0B 3PHOB 1EUUA 4DZ8A 4XCFL 1FDLH 1YEDB 4OD3L 1CD1A 4XPHL 3H0TB 4JFZH 1H9VA 4R7DA 2R0KH 1NCCL 1SJEA 3ULUC 1YECH 2BCKA 5JR1H 1H3WM 3TWCL 3BW9A 1QUNA 5CLTA 3SDXA 3NCEB 4OZGF 1T22B 1VA9A 4K8RC 3KYNA 3O9WB 2VLKE 1RFDH 4H1LH 1DL7L 3RI5F 3O41A 5I8OL 4KPHL 4WGVB 3LKSB 4Z7UA 4PRHB 4YFEA 3PP3K 3I6KB 3W0WD 4Y2DC 3G04B 2X6MA 2EXWD 5T3ZD 5A40E 3WFZA 3QIWD 3TBYA 2R56L 4HK0A 4U3XA 4K23H 2W65A 3CDGA 4QHNA 3CZFB 4HV8A 1PZUB 1JPGB 3IETB 1JF1B 1F13A 5E5MA 2Y07H 4KTEL 4ZUSB 5A43C 3QO0B 3UTTA 3CFEB 5J12C 5FYLH 3F7PC 4PJAF 3J7HA 5L8KB 5D7JA 4GAGL 2DQEL 1CQYA 3H8NA 2EIZA 4EUPG 3VWJA 1YDPB 3QUMB 3S3JA 4YXKL 5E2UL 4A2MA 4H5SB 1S3KL 1K4CA 4P5MA 5IQ7H 3MJ9H 5DD6B 1JNHB 1NGZB 3HFMH 4HWEH 2ADGB 5DT1L 5K9JL 1U2CA 3R06B 5L2KB 2G2RA 2EXYD 3I50H 3FOLA 5MEQA 4MDIA 3ARDA 1FL5A 5ISZA 4FXGA 4ESKA 1U3HC 4M43L 4NUGL 2M26A 3CFJB 1ACZA 3EBAA 2DQDH 4PUBH 5T3XH 1NFIB 4FQCL 4LLAA 4YX2H 3H2WA 2DTML 4PV8B 1CXLA 2R4SL 2VKWA 5FV2A 4LCCB 3ZLQC 2I24N 1AO7D 3T4AB 5TQ0L 2VE6B 5HHNA 5GIRA 4JRXB 4BQ6A 1IQWH 1CK0H 5C0ND 3NFPB 4LSUH 4OZHB 5E8NA 1D5IH 4G3YH 1VENA 1DUYA 3DTXA 3KPRA 4ZUTA 2RGSA 3MACL 3QIUA 3RIFF 1Q9OB 4G9FB 1A7RL 1J0JA 4E5XA 1XCTA 1A5FL 4LLYB 3P9MB 1JHKH 1CQKA 4IDLA 4XPBH 4QOKD 3K4ZA 3GMRA 6CGTA 3K2UL 3WNKA 1JZ6A 4N9GB 4WW2C 4PJGA 1PAMA 2RCSH 4LEXL 5CHNA 4DGIL 3HE7C 1BJ1H 2BRQA 1HHHA 4R2GC 1BX2B 1FZOA 2BNQB 2VL5B 5ESQA 1IM3B 3ULVD 4QHUB 5CEZL 2YN5A 1P4LA 5C07E 4CVWA 1IMHC 3BDYH 4NPYA 1DBJL 2VXTL 3WN5B 1C5DB 1HE7A 4PP1D 2NY6D 4YHMH 5E0QA 2UZIH 1MVFA 3IDXH 3MOBL 4P3DB 1IC4L 4OF5A 1CGSH 3MV8A 1A2YA 4PREA 1QSEA 2IAMC 3S5LG 1EA9C 4OTXL 4C57C 1WZ1H 4ELME 4ODVH 2X2YA 3RTQC 4YR6B 4KC3B 1DBBH 1H3UA 1HHJB 3O6FC 2GK0A 4P5KB 3ELAT 3MODH 3AS3A 2X4NA 3MLSH 2FRGP 3IXAA 3KHOA 3OAYK 3TA3C 1YMHB 2BMKA 1DVFB 1XZ0A 5CFHA 5E9DE 4K9EL 3D69A 5T33L 3IJSB 3SDCB 3D3VA 5JW4R 1ERNA 3QUKB 4YHOL 4EQ2A 1MQ8A 1F3DJ 4R4BB 1A1NB 2L0DA 4XX1G 5AAWA 4M48H 4XVJL 5KOVC 3SO3C 1T7XA 4JY4B 5KJRH 5DO2D 3QULB 4V1DA 3WFDH 3EYQC 5SX4H 5SX5K 1A6AB 3KS0J 2E3VA 4F80A 1UCBL 2KZ1B 1A7OH 4OGZA 4I5BB 4M1GH 2B2XH 3ARZA 2VQTA 3QIBC 1KEMH 1U0QA 5CUSL 4J3XA 1UADC 1II4E 3BKCH 5E70A 1CXKA 2XACC 4HD9A 3STZA 3TBTB 2V6HA 3TYFB 4NUJA 3SKNA 3GSVB 1RULH 4L3ED 3BX7C 4MA8H 1ZSDB 3EO1A 4QRRD 1CS6A 1TETH 3NZHL 1X44A 4BFBD 1HNGA 4KMTH 5KSAA 5ADPL 3DVNB 5DGRA 1FORH 2PXYB 4MQXD 5FUCC 3P9WB 43CAB 2AEQH 2WSKA 1D9KA 4G6KH 1NAMB 1U8NA 2EECA 4J1UA 2V5SA 4HFUH 2W1NA 2NY5H 1SJVA 5EA0H 4CU8A 2YUWA 4ELMF 4I77L 4X8XA 5EH1A 2P5WD 2PUQT 4XRCB 1SEQL 4M1CC 4R0LA 2YWZA 2AGJL 4KZDH 1IAIM 4UQ2A 2D7OA 1DANT 1NSNH 2EYTB 1XMWA 4XXDA 1KF9B 1NKRA 3B8SA 4GG8A 5DRZA 1TJHH 3EO9H 4NCDA 2BNUA 5EOQH 3RIAK 4U1KB 5K9OA 2FGZA 4H26B 2X1WL 2UYLA 3RVWD 3TN0C 5C08D 4PJFE 1H0DA 2IPKB 2Z93A 2JK5B 4BJLA 1MRFH 2I9TB 1UM6H 5HVWA 4DKFH 3KNBA 1TTUA 5MEND 3DX8A 2BVPB 3FONA 3RUGA 3QUZB 2JKXA 5CBAA 5I6XB 5BJTA 2HJKA 1QSFA 3I6LD 5A3ID 2GFBA 3Q0HA 3N9GH 3FAXA 4LPCA 5JUEH 3N1PC 3WXVL 3GIZH 4WHTA 5GGQH 4A6YH 2FIRT 2ZG3A 5TE4H 2A6JB 2VIRB 2FWOA 4D9RE 4DCQA 3I9GH 1WWWX 1IAII 4MNQE 3QIUC 1R3JB 4RRPA 2XRAL 1BIHA 1J1PH 1KENH 1P7KA 4JFHE 4M5YH 1PVHA 4Y1AE 1NCWH 3X3FH 3FO9A 2LU3A 4HIIA 2UWEF 1KCRL 1V3JA 4YAQB 1W0YT 1RZFH 3V6FB 4L4VB 4U1NB 1IAKB 1EBPA 2AJVL 3CH8A 3B9DA 1ZA3B 1INDL 3O3EA 4HWUA 4KJQC 1MAMH 1Q72L 2Z31C 4PJIA 5GS1A 1KIPA 3BZ4A 3WE6B 4O2EB 3BAEH 2EDHA 1T20A 1EERB 1H3VA 2OM5A 1S7VA 2N56A 3OXSB 1FSKB 2YD8A 3TC9A 2RHEA 1AR1D 3ZKXB 5ESAA 2JCCA 1BD2D 5DD3H 3MMEB 5SWSB 5E94A 4GKSB 1PY4A 2BHYA 3GJEB 5J9PA 1KJMB 1YEEL 3DLQR 1BZQK 4P57B 1YPZA 1DSFL 1FL3B 4HUKB 2HVJA 3ARYA 2GITA 4XZUA 1CWVA 1SBSL 5E99L 4CADA 1AKJD 1OGTA 5KS9E 1CU4L 3MCG1 1LP9B 3L5HA 3U46B 4KK8C 3RPIA 5HGHB 4LSPL 3LIZL 5IB3B 2WBJD 3UC0H 2R23B 5IFHH 3NCYP 3WFEH 2NY4B 1LO2H 1H5BB 5A16B 4ETQB 1MCQA 4OKVB 1V7MH 3NIGF 4AT6B 2J8UA 4KQ3H 5IIEB 1YNKL 5I19L 2R1YA 4ALAH 2VLJE 1F4WH 1IGFH 1AI1H 5EU6E 1QKZL 5CEYA 3BPCA 4UIMB 2MKLC 1FFPB 3HNTH 4HKJB 4PY8I 5CJOL 1KPRA 5J4MA 3SE4A 3ZTJH 3KDMA 2NXZD 3ZYOA 4LSSL 4MAYB 3R1GL 4EN3D 3WNLA 2EZ0C 4OLVH 4F7PB 3LN9A 4ZS7H 3JUYA 4DZBB 3SN6N 3WKMH 3BZFA 1BVKB 3BH9B 2AK1H 4LARH 4QXUH 2ERJB 3V5HA 1A3QA 2GTWB 1TVDA 3F5WB 4XC1H 2DQJH 3DMMD 4Y4KC 4X6CF 5FGRA 5KSAC 4H1LA 5HDQH 3BUTA 1YN7B 3DXAD 5KVFH 1R3LA 1LDPH 1T0PB 4WTZA 4ZFZB 5EOCJ 4U4BA 1D9KC 2IG2L 3U82B 3VXRA 1Z2KA 4PJ7E 2Q3AA 4M7LL 4RFEB 1F00I 3U0TA 3U4BH 3O11B 5FA4A 2X41A 4HBCL 4MCYB 3VG9B 3ZKND 2M1KA 1HINH 2NX5B 4HXAL 2AVGA 4MJ5A 4R0LC 2HMID 5JDSB 3MRJB 3H7BB 2YOCA 4Y5YA 5J06A 4XWOC 4P9ML 3R4DA 5DRWB 1JK8B 3BQUB 3MLPA 5JDJA 4YO0A 1INQA 1BFTA 4OLZH 4XP6L 1T1XB 4LOUD 4MXWL 4PD4K 1BLNB 1GAFH 1BZ7B 2X4SB 4FQJL 1KCUL 4NQCB 5ANMA 1CR9H 3PE9A 3MJ9A 4YHIA 4PFEA 2YPKA 2HKFH 1OF2A 4ETYA 5LJYH 1S5IL 3V4UL 2FATH 3Q6FA 4KXZH 3VXUE 3QAZC 5E2WL 5ELIA 2IEPA 1RJZA 3OKLA 1GXEA 1ZLWH 3KYOA 3FO1B 1DUZB 3RFZC 2H2PD 2CKBB 3MJ7A 4Z7NE 3L3HA 1BGXH 4ZPTB 5L9DH 1VACB 4JJ5A 3N1FC 5MEOB 3BP7A 4OFVA 4Z76B 5IEHB 5LKNA 4WGWB 3VGBA 3WDJA 1WAAE 1R3IL 4H20L 5I1JL 3SJVE 3L5XH 3MRIA 4XNUH 3WHXA 3P2TA 1P5UA 3QUYA 3DJ9A 4BH8B 3QQ3B 1C8PA 4WO4D 3B2VH 4LNRB 5DR5L 2BZDA 3WIIH 2HP4A 2VH5L 4JFFA 3BYYA 2F54D 1GSMA 1BOGB 5IB1B 1YQVL 3U4EB 4PGZA 1R5IB 1AY1H 1HZHH 3RHWF 5HHPA 4XTRD 1B90A 3TPUA 3IVKA 1OTSC 4HDIA 4UMGA 5BS0E 1F11A 1XGTB 2HFEA 4OZIA 4S1QL 1OGAB 3BH8A 5DMIH 5EOTA 3TIEB 5I9QC 1K5NA 2F58H 4JFOA 5TF1L 1LK3L 4YGVA 2Y06L 3NCJH 3R0NA 1G7MA 5TH2A 5ITBL 3MGTA 1ZHKB 1R5VA 3KLSA 4WI5A 3MRHA 4KK9C 3O3AB 4IMLB 1YA5A 4WI3A 4GRWB 3WLWC 1H8OA 4J4PC 2E7HA 4K94H 3C9NA 4F9LA 1BZ9A 3DX7A 4NQTA 1X5FA 5JQHC 2R0ZL 3C60C 2BHZA 5DQJB 3GUTB 2JIXA 5C6TL 1OY3B 2H1PL 4HS3B 2V9RA 3LRSB 1ZGLA 1CD0A 1N64L 2OSLB 2EYSA 2IQAA 1CL7I 1SMOA 2R2EA 4JDTL 3VGDA 3BE1L 4E0RB 1QACA 5GRZA 2ICWA 4HH8A 1IC5L 5LBSL 3RKDC 1ADQH 3U9PL 3MRMB 4N5ED 1J86A 3BO8A 2Q8AH 2IMMA 3RVVD 4TSAH 3KPMA 4XNQA 4NO5B 2D4FA 4OQTH 5AAMA 3GO1L 4ZSOB 4NQDD 3L3GA 2K7PA 5EU4A 1FFOB 1IFHH 5K9KA 3KXFB 4NNXB 1JPFB 3MPCA 4LEOB 1YEFL 2DJUA 2HT2D 5C3TA 2ZP0T 4CVZA 4JFEE 3FB8B 1UQSA 3OHXA 5JW3H 3VXSD 4QTHB 4NO0D 3KWWB 4KVNH 3BZEB 1Z9MA 3T1FA 2HTLC 5C0GA 5FHBL 5ICZA 1A8JH 3VGHA 1VEPA 4PJXB 3IJYA 2I25N 4N90E 3G6JB 4GW5B 2VDRL 4LF3B 3HNVH 3V6ZA 3AXLB 1R5WB 3PQYA 3QIWB 1D5ZB 1A6PA 4LSQL 1G7LA 1G6RH 1LMKA 1K4DB 4NZUH 1ZKAA 4JLRA 5LCVL 2DQGH 3WS6A 1Q9WB 1MJ8L 3VW3H 5BZDB 1H3GA 4MWFB 5KW9L 1TTGA 2GJ6D 4OV5A 1RUML 1NMCC 2EIEA 3QEQD 2H9GB 1NC4D 2PTTB 2R0WH 2IMNA 1A0QL 5DD1H 3OX8A 1QVOB 4G80B 3V4PL 3MOAH 2D7TH 3NZ8B 2P49B 4NKMB 4EVNB 3AGVA 3HMXH 2AXFB 2BY0A 3HRZB 3KR3L 5H2BB 4EXPX 3B83A 1CIDA 2H2SC 3MV11 4LIQE 4LHUA 1MFCL 2XZZA 4MNHB 2ORBL 2PYFB 4Y5YC 2EYRA 4NRXB 2IPUK 3ZE1F 3MTRA 4AH2A 1FC1A 5IFJA 5EUOE 5IESL 1HSBA 3ECBA 5D7KE 7FABL 4NZJA 2IGFL 3L3OA 2NW2B 1P9MC 1OTUD 1JTOA 2YD9A 4U6VH 3R8QA 2CO6B 3MLVL 4ODUB 1AO7B 1T7VA 3TNNA 3VFGH 1ACYH 3EFDH 3T1WA 5D2LE 5C07A 5DHXB 5IK3B 3TIDB 1RJYB 4YUEH 2YXMA 2N7AA 4GH7B 3ARBA 3MCKA 5IVXB 3KLAA 1JPST 2G5BA 2HRPL 4KGLA 3QP3A 4W70A 3QUYC 3V0VA 3GKWH 5C0AA 1FNAA 5HD8D 4YDKL 4JFXA 2C4FT 1K6QL 5DUPH 5EPMB 4Z18A 4A6YA 2P8LA 1T1YA 5DHVH 4QOKB 3TPKA 2NTFB 3T4YB 4JEGB 3G6AA 4JAMB 1ES0A 5FO8B 2DQUL 3CDYA 5E9DA 5B4MC 2ZNWA 5DWUH 4S0SD 2AJUL 4FQHB 3LKPA 4C4KT 3MR9B 4DK3A 3CCHB 1Q9KA 5T1KD 2CJUL 4PGBA 1W2KT 2UUDK 3BKMH 3PGCB 2HT3C 1C1EH 2Z91B 2NY6B 5JIHA 1O7VA 3HPLB 8FABA 4Y5VA 4Z6AT 2FJGB 2FR4A 5F1IA 1YC8A 1S9WB 1HHIB 1LVEA 3H9SE 4Q74A 4FA8A 2VAJA 3MO1B 5BRZD 4LRNH 4JANB 3OB0H 1GRWA 3I6KA 4W4OA 4F9LC 3S8WA 3D0LB 4RX4D 3WS3A 2ZG2A 3EYOB 4GMSL 2J5LB 1CFSB 4HQQL 4N8CL 5I73B 5CKGA 2VZ1A 4OFIA 3I75A 4XNYH 5DQDL 1FL6A 5DI8A 5HYSA 3T2PA 1JF1A 5IW1B 4GRMA 4KTDH 4NQEB 3ILPA 3NAAL 1RIVH 5FOJA 2IPUG 3FHQA 3CUPB 2DIBA 5D2LF 1IL1A 3G5XB 4UT7H 1UEYA 2J1KA 3MQIA 3HI6H 5DSCA 2MQ3A 3QUMA 4LIQH 3QZWB 2AXGB 2FEDC 4K3EH 3GBNH 3MRCB 5T5FH 4YDLC 4P46D 3ARWA 2BSSA 1W8NA 1G7IB 1QFUH 3EYVB 3LKRA 3W0WE 5HI5D 5L2KA 4Y89A 3QG7L 4PPTA 4BZ1L 1CLOL 4Q9BA 1EGJH 4CL7A 4FP8H 5GHWH 4V2BA 1D7FA 1JHLH 4PV8A 4L3EB 3EYUL 3HC3L 5LGJB 1MHEA 4X4XB 5EO1B 1E28A 5CZKA 1ZXQA 4IJ3B 1N5YL 4FTVE 3K4DA 1JWUB 1MLCB 1WFUA 1YEGH 4KJYA 4PJFA 1S7WB 3BIKB 4WCYL 4NWTL 3MGOA 4L9DA 1IAMA 4M5ZL 1HXMA 1RUAH 3IT8D 5D7LB 1X5JA 2JELL 1Q9OA 3VXQB 4X4YA 2YEZA 3BPOC 2P5WB 4KMLB 4O9HL 1EHXA 4URTB 4X99A 3P9MA 5MEPB 1ZA6A 3IDGA 4PLKC 2WAHA 2E9WA 1A1OB 1N26A 3LV3B 3NIDF 3MRDA 4LLDB 4MNQA 2NY5C 1QFWL 3QFJE 1OWRM 5GS0D 1FFNB 3C5ZA 4XCCL 4YHPA 5HVFB 4PJEE 3V5KB 5FKPB 3FJTA 3HMWL 3NIFE 4ZAKD 4QHUA 4U1GB 1YNTB 4YLQT 3HZKA 4Y5XB 1N5AB 2XYCA 5TQ2H 3QXUA 1FO0L 1UB5A 4NRZA 5MENB 3DBXB 3GHBL 4RFNB 5F7LB 4FHBD 4NWUH 3BSZL 1NBZB 3LHPL 4X9HA 4EUPH 4XX1E 1LEKA