5JLZB

Crystal structure of hla-drb1*04:01 in complex with modified alpha-enolase peptide 26-40 with citrulline at the position 32
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
193
structure length
193
Chain Sequence
GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRASSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterization of a Novel HLA-DRB1*04:01-Restricted alpha-Enolase T Cell Epitope in Rheumatoid Arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 44
structure length 193
sequence length 193
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jlzB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5jlzB01
1P2CA 4ZODA 4NIKB 5IMKB 4TTDC 3MV7E 1FIGH 2BNUB 3D0LA 3GJFB 5FAAA 5MEPA 5A2LH 4OFDA 5GIRA 3CFEA 1H3UA 4C56D 4WUUA 4U1KB 3WDJA 2FYYA 3DVNA 1VPOL 2N7BA 5ESVA 1MCBA 3QWOA 5GGSY 1CR9L 3HR6A 3OKOA 1F8TL 2UY7A 3MPCA 1C08A 2ORBH 4LRNH 3O4OC 5F88B 3V2AR 2PW2A 5BXFA 1LO4L 4S10A 1U95A 2EDJA 3QUYB 1CVRA 5K59E 3EDJA 5DQDL 1SEQH 1VESA 3AU1B 5CSBA 1OT1A 2MPAH 5CJQL 2YPLB 4G8GA 2OI9B 1NKRA 4FZ8L 4XI5D 4KVCL 2VDOH 3O4LA 1KJ3L 3UBXG 3ULUL 5B21A 1SHMA 3QNYA 3TA3D 1BM3L 3D5OF 2BSTB 3MRIA 3D18A 4M48L 4FA8A 5IG7A 4MAUH 1A6TB 1DQTA 4NZTH 4HWEL 5ANME 5EWIL 3UTSD 1FBIH 3UP1A 4A2MA 3PHOA 3MBEB 4G8FB 3TESA 2WBWB 1QLEL 3CMOL 1IC1A 4WI3A 4Y4FA 3PHSA 4U0RB 4WY7H 2R2HA 4ONGH 3VD5A 1IM9D 2NQCA 1RZ7L 2LVEA 5J11C 1JNLH 1I1AD 5C09E 3FQXB 4OUOA 2CO6B 4LSRL 2HVJB 3X3FH 4DN3L 4YXKH 1HZHL 2CSPA 3CFEB 1CLZL 3V6ZA 3MMEB 4Z7NE 5IB1B 4MB5A 4M43H 4RRPG 5D7KE 1FRGL 5IMLA 1A6AA 2ZJSL 1XF1A 1CG9A 3FT4A 3GIVA 1OCWH 1S7WA 4MDJA 3I9GH 3QAZB 3BAEL 4HMDA 5KSVB 5FUOH 4XXCA 2HFFB 3KPOB 1KELH 4NSKB 2XQBL 3MOAH 5HHMD 1BZ9A 4PLKC 3WIFB 4TUKH 1F2XK 1BWWA 4QLRA 2R1YA 1DCLA 4F7MB 4KZEL 1E6OH 4N0FB 2BVYA 4R4BB 4DVRL 3QULA 1FL3B 2FJHB 3DETC 3UTTD 1Q0YL 1HK6A 3VG0L 2HLFD 4I0CC 4F9LA 3RWCA 2P48B 2F54A 5DSCB 1JNJA 5C08A 1KB5L 2DQFA 3RWFB 3HRZB 2YPLE 3MR9A 5IB3A 3MRIB 1GSMA 1KXVC 1LO3H 2R0WH 2I9LA 1PDKA 3QHTC 1JP5A 4K23L 4H0IA 3KHOA 2G75A 1MRCH 1NGWB 4PJDE 1MWAH 2GKIA 3ARBD 3PWNB 5IB2A 3PWLA 1XGPA 1X5JA 1A4JA 4P9HC 1PY4A 1JWSA 4M6AA 3CIQA 5TFSH 2W9DL 1KJVA 3OF6A 2A1WL 1QNZH 2VDPL 5F7MC 3W9DB 1TIUA 2APTA 3B8YA 2D03H 1JF1B 4PJFF 5EU6D 2HYMA 2OZ4L 4MQ7A 5E8OB 1HHGA 3EW3B 1QLRB 2YPLD 3VXUB 3L3IB 5TPWH 4KMTH 1CIUA 3PL6A 4QOKD 1CD1B 1URLA 2BY2A 3JWDC 5F7EL 1ZA3A 4Q0XH 3P0VH 2UWEB 5B39B 5C6PB 4LVOB 2K3TA 1S7XA 5I18H 3UJIH 5IB1A 3IDJB 5C6WH 4OF3A 1WTGT 2GHWB 3L5IA 4QHUA 5DFVD 4UQ2B 4M6ML 3ARDA 4JDVB 1LE9B 3U83A 1QFWL 3FRPA 5C0BA 3H42L 3NACL 1A1MB 4LGRB 2X4TA 2V7NA 1IM9B 3QO0A 4OZHF 2M26A 4XMKH 2J5LC 5SX5K 2QSQA 5CJ5A 4NQEA 5EU3A 1INDH 1HXYA 1NH6A 1MNUL 4ODTL 4JRXD 3MRFB 1ND0A 4HV8A 1YN7B 2YD6A 4UILL 3QDMA 1RD6A 3HZMB 3H3PL 1NC4A 1JHKL 1T7XA 1D7FA 5J6HB 2H1PL 1MFNA 3VFGL 1KEGL 4NO3A 4TQEH 1JPSL 4X4XA 1S7RA 4K9EH 2X1QA 3ARDC 4PGCA 4RMSA 3MNZB 2AXFB 2CLVB 3C6LD 1R5WA 3TBYA 4JZJC 3U4EA 5JHLL 2AK1L 1AIFB 3UTTE 2EE9A 1YJDH 2D4FA 2QLVB 2N56A 5GQBA 5CBAB 3F6IA 3WFHA 3CAFA 1CTNA 3BWUC 3NCYS 1B88A 4Z7VF 2Z8SA 2O93L 5BMFH 5IFJA 1MQ8A 2EDKA 2IANA 2LTQB 3IDUA 1VKXA 1GL4B 2P5WA 5DD0L 1FVCB 4Y19B 3QB7C 3GMNB 4XCCH 1INQA 4MJ4A 5J6GA 1I8KA 4JM2B 1BEYH 4LP4A 1Z6JT 4U7MA 1P1ZB 3RAJL 4S2SB 4YXKL 2DRUA 2VN4A 3P30H 1ZE3C 4MD0A 5TE4L 1ZT4B 3O9WB 1IT9H 3MBXH 1R3HA 4UT6H 5D2NE 3RDTB 4LLMA 2Z35A 4Z7QF 5F6IC 1R3JB 3FB7B 1AGDB 4ONHB 2NY1B 3UYOD 5I1KL 1ZGLB 3V4VH 5C0IB 4OFYD 2VQ1A 4KUZL 2F8VA 1VACB 3EGSB 3BPCA 4LEOA 3OJMB 1SYVA 5HI3D 1S7VB 1F4HA 4OLYL 2APBA 3BRDA 3JV6A 5DFVC 4AIOA 1QPXA 4OBRA 3GDBA 1R3IL 1KC5H 2QSVA 4N9OB 4OTXL 3AXLB 4LF3A 2AJZB 3NBNA 4YDVB 4OD1L 4MQ7B 5E8OA 3EFDH 1N26A 4GW4A 4UBDC 3TA3C 3GMLB 2C9AA 4BQCA 1A21A 3CFBA 1NFDE 5KN5B 2UZIH 1MHPH 4NKMB 5FKAB 3U1SH 5I1EL 3IGAA 3HMWL 3I6KB 4L4VB 3GHEH 3LKRB 4QRPA 3T04D 1PLGH 1KCUH 4L1DA 2BHYA 1GAFH 3MRPA 1OAYH 5LGKA 1YNTB 3B2VH 3ARBC 4IHOB 4WNQA 2X1PA 4Q0XL 3QIWB 4MD4B 2DM2A 5L7XL 4LLQA 2AV1B 2ICWJ 2BVOA 5E5MB 4MLSA 1K85A 4M8VA 1F42A 3L7EA 2OI9C 3S36X 3CDYA 3CPLB 1EEYA 3B5GA 1IILE 3D9AL 5B8CA 5JW5B 4GKSB 4YBQC 3ULVC 3F7YB 5K9JL 1SY6A 5AWNH 3QUYC 3KPMB 1CGSL 3FHAA 5EO1A 3WFEH 2QSTA 1ZHBB 4X7DC 4YR6A 4MJIB 1IM3A 1S7VA 3HI5L 5E6ZA 5C7XH 1CWVA 1HINL 2ZOLA 2R56L 5EOCL 1FJ1A 3OHXB 4TVSa 4YHIB 2ZG3A 3IFOA 1BOGB 1C5CH 1HIMH 4PB0L 1IKFH 1JHKH 1K8IA 4CVXA 2OR9H 1PKOA 1GJIA 4P3CH 3A6OA 1KIPB 4DZBA 1L0XA 4HX1B 3LB6D 4MWFB 5FA4B 4P2OB 4NN6B 3RDTD 3BDBA 4J1UA 4UUJB 5C86A 1O7VA 4KGJA 3CCHA 4FFVD 4NZRL 5IVXE 4LBEA 3VWJD 3ZHKA 5B38A 3L9RB 3CFJB 1MJ8L 3RNKB 4NKMA 2V7HB 5FKAA 5EORH 4NQCE 2BNRD 2JB6B 5CCKH 2V7HA 3O2VH 4JHWL 4ZTOL 3RWDA 2OTWA 3HS0A 5D7LB 4LSTH 3MA7B 4R8WL 4X5LA 3FMGL 3LY6A 5ESVB 2FR4B 2BVQA 5HVHC 1YEHL 1WT5C 4WO4B 5DUML 2UY6A 1NANI 3FOLA 2OMNA 1FFNA 2HLAB 5DQ9B 2ESVB 1NEZA 5I1AB 3FOLB 1UJTA 4F2MB 1LVEA 2JELH 3ECBB 4RISL 4GKOA 2PXYB 2CJUH 2GYSA 4GMSH 3IU3B 4PY7B 5ERWA 3SKUD 3LKOB 5DUBB 2FEEI 3R4DA 1DFBL 1MPAL 5IVNA 3ZTNH 4XPFH 1ZXQA 4EEEA 1OAUL 3TJHC 1KG0A 3QO0B 1EBAA 2YD5A 4Q9RH 4QO1A 3NCMA 3SDXA 3OG4B 3VGHA 4P2RB 2VAAB 1TZIB 2ID5A 2VQUA 2NY1D 2ATKB 5I1KH 3JV0A 1CL7I 2QR0A 1LK3L 4JFFE 2YRLA 4W68A 3MQIA 1BAFL 4FOMA 3TBVA 2XZQL 4NGHL 4PJAA 1GGTA 2YWYA 3OX8A 4WWKD 3PWVB 4PJHE 3IDYC 5F7DA 3UPRB 5T5NF 5DWUH 5C07E 1QR1B 3IJYA 1FGNL 2X4SB 5D8JL 2DQTL 1ADQH 1DR9A 1UM5L 2D0GA 5EPMB 3GB7B 4L8BB 4DKDC 2V5TA 3CFJA 3T0EE 5CS7A 1T2JA 3GBMH 4L8SA 2ORBL 2VZTA 4Y1AD 3UYRL 3K2MC 3MMEA 5ACLA 1ZLSH 1FZJB 3EJYD 5I1GL 1F4WH 4OLWL 4K7PL 2AXHA 4YAQA 4KK8D 4HZLB 3EO9L 1RY7B 4DEPC 4WO4A 1MAMH 2A83A 2W0LA 4K3EL 3VXNA 1R24B 1EX0A 4FABL 5D93B 1IAMA 2DWDB 5FHAH 1KCRL 3REVB 5L2JA 1MFBL 5C9KA 4PBVC 4LHUA 3OKEB 3U36B 5C0RH 3L3JA 4K7FA 5DRXA 1JNNH 3VGEA 1U8NA 5JIPA 2QQLH 3ARGA 2VJXA 4Q6YA 4NBYB 3ZKXC 4J3OC 1NCAH 4HJ0D 4K7PY 4WFGE 3NZHH 1DBKL 1I9JL 3EYUH 2VDRH 3STZA 3C09C 5BOPA 4WFFD 3S9DB 1X6NA 4M7JL 3GBLA 5L8LB 1S5IH 3DECA 3MXWH 2CRYA 3NA9L 1YEFH 1MRDL 1J1PL 4UT7H 3ARYA 3REWB 2DWEA 5D96B 5DEFB 1A3RH 1KF9B 2E6JA 3K4ZA 2B5IC 1AR1C 3B9KC 2ZJSH 4ZSOE 2UUDK 2P5WE 5T3ZE 2BNQE 4JN1L 4AIZB 3OPZH 5A43C 2PXYD 3WO3B 3QQ9D 1K4CB 2YWZA 2D2OA 2Z93A 4J4PC 2XY1A 3QH3A 3UC0H 1CLCA 1I7TA 4PD4J 5GGVY 2DI8A 4QGTA 3UDWC 4YGAB 4PJ7F 4G6KH 4YUEL 4FN0A 3MLRL 1JGUL 2IEPA 3DTXB 4KJPC 3N1FC 2MTPA 1HQRA 4I13B 3ZDYE 1UJ3C 4O4YH 1CD1A 3NGBB 3S3JA 2P4AB 2GSGB 2VE6B 4TRPH 5JLZA 3ILQC 3BAEH 3P73B 4KI5E 2MQ3A 4JO4L 1IE5A 3U4BH 3MLSL 4JREB 3RNQA 3PGCB 3TZVB 4ZUVA 5F1KC 5HHOE 5GJSH 4P5TD 1WCBA 4UTAL 1VADB 5IESL 3TZVC 2DICA 4NQXB 5KSBB 4OCYL 4PFEA 4JKPL 3ZDXF 2Q7NA 3FMGH 2HAZA 1BZ7A 3ALPA 2HG5A 5GS0C 1K6QH 4OCMC 5F1NA 1IGTB 2YC1A 3V7AG 1FN4B 3TCLB 1MY5A 3SDXE 3GMOA 1TNMA 1CFQA 3UTPD 5C9JA 2VWEE 5F9WB 4P4KB 5I8OL 5GGRA 5LG1A 3P0VL 1CXEA 5FGBA 4Z7QE 2V2WA 3UX9B 1I1YB 1RUAL 5GISL 1UADC 3C6SA 1YZZA 2DM7A 3MV9A 1XAUA 3DGGA 2P7TB 1WBXA 1FZOB 2FL5B 5HI4C 4BZ2L 5IJKA 1HYSD 4P2QA 3V5HB 4PREB 1MI5D 8FABB 1I9IL 3U30B 1IGIH 5DGRA 1IAOA 4XP9L 3D39A 3U7YH 2NYYC 4JVPA 4LPTA 4BK4A 5KW9H 2EDYA 1NMAL 4LHUG 2GI7A 5IOPA 4ODTH 3JTTB 4ZOCA 1I3GL 4JO3H 4ZFFA 4MSWB 4R7DA 5D8JH 1S7UA 1ZAGA 2NCMA 3SOBH 3QXDA 4S2SA 4LMQE 3GSNA 4P46A 2AK4A 3D0LB 4LPCA 5F1NB 2XWBB 4JANA 5D6CB 1KPUB 4ODXB 2X6MA 4HSQA 4WI7A 3G5VA 4MCZB 1G0XA 2WINA 4MNGA 1A3QA 1A4JB 3WN5A 3UMTA 5CD3B 3K2UH 4LLDA 2DI9A 4EVNA 3AAZA 2F5AH 3P4NB 1MJUL 1AP2B 3GM8A 1TCRA 4KAQH 5ESQA 4WDIA 3S35X 1BBDH 4LOUC 3W39A 1F4YL 3N9GH 2E9IA 5HJ3A 1QBBA 2IAMA 1UVQA 3FB5A 5F3HA 3LKQA 1LE5B 2XZCH 3RL2B 3T8XA 5ANMB 1P1ZA 5D70H 1C1EL 2HT2D 4TVPH 1MSPA 1IAIH 3UPAA 4PRHA 1Q9LA 1A7NH 1AKJD 3W9EA 1FQ9C 1BZ9B 4OCXH 4FQXA 1HHKB 1R3HB 2RIKA 3HE6A 4ZYKB 3V0VB 5JR1H 3T0ED 5C0NC 4PBWD 3TPUA 3HRZA 2NW2A 2QHRL 4W4NA 3L9RA 1WWAX 4XRCB 5ALBL 3WXWL 1NJ9B 5EFIA 1WIUA 4Z7UF 4NQEB 5DJ6B 4A6YB 2HJFB 3RBGA 3RJQB 4MNQD 2EICA 3ULUF 2IADB 4KKLC 1Q9WB 3EUUA 5AYUL 3RA7L 1SJHA 4P57B 4XVUD 4XX1G 1TJHH 2FHBA 1BZQK 1EH9A 1JI2A 4I3SL 4WU5A 1SMOA 3QRFM 2Q76B 4L3EB 3NN8A 4PRDB 2RB8A 3FQUB 4FQCL 4YQXH 2AJXL 4LARH 3Q48A 2DDQH 3D85A 1VPOH 4JZOB 1QVOA 4H88H 1YY9D 4H1LG 4OBSA 3C60D 1CR9H 5C0AB 1WZ1L 1SM3H 3GMQA 1D6VH 2ICES 4GJTB 4EQ2A 5AZ2L 4IM8A 3G6JB 1QBML 1YEEH 4JFDE 4P3DB 4M7ZC 1MUJB 3DXAE 4HGKC 4P9HH 5GS0L 2W60B 2B4CC 2X4UA 1K6QL 1VHPA 4F57L 5DD3H 4JCMA 1QRNE 3T8XB 2R39A 5J1AA 3BDXA 4KVCH 2YD7A 2AJUL 2ADFH 3V0AC 3B2VL 3STBA 2J88H 1QEWB 1HEZB 5I66B 1BQLH 1UB5B 4P2OA 1TETL 4PRIE 3D39B 1CBVH 2Z91A 4NC2B 3ME0A 1F11A 1FNAA 4UU9B 1T7VA 2OL3A 3SE8H 1FSKB 3AREC 3MJ6A 2FWOB 4EI5C 1I1CA 1ZANH 3CH1B 4WI4A 5BS0E 1R5VA 4LASH 3P9LB 4DGVH 4F7EA 5E03A 3CFDA 4MYWB 3MGOA 1ZHBA 5A3ID 3B5HA 5K9JH 1HQRB 3LZFL 3NVQA 4RFEA 4QXWA 3RGHA 3QIWC 4JFXB 4QRUB 4EZMA 4XCYA 5I74B 1NCCL 1UKQA 5DJ0A 3JV6B 3ZTJH 3N06B 3QJFA 1MAJA 1M7IB 4PS4L 5DZNA 1OB1B 4HC1A 4J8RB 1ZSDA 3KYMA 5BRZD 4I0KA 1ZK9A 3RZCC 2V5SA 3TT3L 4BZ1H 4YZFE 3TM6A 1HCVA 4XTRD 5EN2B 3RVVD 3DWTA 5EU6E 5T5FL 1KG0B 4KHXH 4OCSL 4XPHL 3FOMA 2Q8AL 1UM6H 2JE8A 5AG8A 1CFTA 1MIEH 4JO1L 1BFVH 4OLZH 2VDKH 1DANT 2FO4A 5IK3B 2CH8A 4HEPG 3EOAA 4NYLB 4X6CF 4MDIB 4OLUL 5B22A 1R5IB 5JUEH 1F11B 4M93C 2JJWA 3LKSB 5D70L 3PWPA 4Z7VE 1L9NA 3I6LD 2ZZUT 2RHEA 2R9HC 4WEMB 1J88A 1MWAL 2F53E 2PW1A 3KLAB 2GTWA 5EZIH 2R29H 4MCYB 3D85D 2RQ8A 4L8SB 3CXHK 5DHYB 3OKLA 4BKLA 2I25N 4YDLB 1MRFL 1V3JA 3DMMB 2DQGL 4LP5A 1IGYA 5DQJA 3O3BB 3TBYB 3LH2H 4U4BA 4GW4B 3FO2A 4APQA 1F3DJ 1I7ZA 3EFFB 1HHHA 4I77H 3QUXA 4OIIL 5DD6A 3S8WA 4PJCF 2NY3D 3MLPA 3NCEB 3I6LE 1FFOA 4J1UB 3KLSA 3SKJH 5JNYB 1I1AC 3ZTJG 1SMAA 2A6DA 3ZDZF 2CLZB 3QCUH 2VLRD 5IBUG 2R2HB 3H7LA 1S3KL 4H25A 3LN4A 2IQ9L 4FQQB 2PYEA 3ARGB 4Y4FC 2X9XA 3VFMB 3G6AB 1XF3B 3EDKA 3I85A 5GGTH 3QNZA 1XGQB 2X9WA 5CSZA 2MSPA 3MV9E 2DQJL 3N0PB 5I1IH 2KUTA 1KLFA 2GSIA 2OYPA 5BQ7A 1J0YA 1IGML 1QFWI 3KXFB 3SDDD 3SQBA 3U4AA 1CCZA 4QWWD 4KK6D 3MLTB 1XZ0B 1K4DA 1RZIA 3ARGC 2YMXL 2NYYD 3SKOB 2HP4A 1ONQB 1N6VA 3GKWL 3KYAA 4R26H 4PJ9B 3MCLH 2I5YL 3OB0H 4MCYA 5CJXC 3EOBB 5IB5B 4D2NA 2OSLB 5FHAL 2Y5EA 5JOPD 2IFFL 2AJUH 2G5BA 5EO9B 2ZSWB 5KOMC 4N0UB 1TNNA 4HWZB 1DQJB 2NY5L 3ZE0F 3B9KB 1A2YB 1AKJA 1G6RH 4KUCD 2ADJA 4B53A 4J23A 3H0TB 3WKMH 1YEGL 4Q97A 3D39D 3GZKA 2GK0B 2IPUG 4A6YA 4YPGB 5KN5A 1FCGA 1NGZA 2N1KA 3NH7L 2G75B 4YHZL 4J3TA 4WHTA 1Y6KR 1KFAL 3RL1B 1T4KA 1PGRB 1YEJH 1KYOJ 5D7KD 4WO4C 3HPJB 1NFKA 3D0VB 5FYKU 3V4UL 1N7MH 4B7LA 1GPOH 4M7LT 4WVRA 3I02A 1G1CA 5L88L 1UZ6F 5J13C 4Z7UE 3SEPA 5IEKA 2FEEL 4EOWL 1VGEH 2A6JB 1Q9OA 4DGYH 1MHHA 3BEVA 2H32B 4G9FB 3ZLQC 1RJLA 5DFWH 5IEHA 1MCIA 4FFZL 4L8DA 3QUXD 1A6ZA 2NY7L 1FH5L 1RVFH 3T4YA 3EYVB 5IB5A 5DO2C 3MLRH 1A8JH 2AGJL 3QEQD 1MCPH 1NCDL 5E6YA 4HMCA 4MAYD 4ZFGL 1T5WB 4RFNC 4P23C 4M9OA 5DJDA 3VGDA 3GJFH 4K2UH 1U6AH 1H15B 5KVFH 2GY7B 3IDIB 1RZ8A 4DWHA 4LNVA 4P59L 4RWYL 2GW5A 1JYVA 2LE9A 5AD0A 4YXHH 2CUMA 4DZBB 1FE8H 2BXYA 4N5ED 4XPBL 4X6CB 3SO3B 3VFWA 4S1DC 1IEBB 1NC4B 4OCYH 4G80A 4PJAB 1L7IL 3KXFD 1RUQL 2WSKA 3VWKB 4YO0B 25C8H 1A1NA 3KJ4B 4Z0BL 3WMSA 3CXDH 4M5ZL 4Z7WE 3MCKA 2YEZA 4JFOB 4KK5C 4IOFD 4RFOL 1J1XH 1LP9B 1QRKA 1JK8A 1Q9KB 4DZ8B 5DEFA 4WEBH 2R0KL 4UOW0 5I8KL 2CKNA 3Q0HA 1IC5L 4JPKH 3G6JE 5LBSH 3BZFA 4PRHE 2JIXA 3I3DA 2R0LH 5IEHB 1YMHB 2NXYD 3VW3H 2ZUQB 4AL8H 3L95A 4JG0L 1P84J 3HMXL 1RJYA 3SBWC 2BY0A 1IGIL 2PO6A 1WZKA 2E7HA 1A6AB 4QRTB 4ZPVA 3ZDZE 5KG9B 1C8PA 1ZA3B 5L9DL 3QDME 3VI4F 4ZPVB 4N5UA 1EEZB 3SDAA 5JA9A 5B4MD 5GJTH 1NCTA 4HHAB 4O2FB 2XPGA 5CZKA 4ZUUB 2F19H 2X9YA 4NWUH 1LP9F 4PR5A 5T3ZH 2Z4QA 1ZWIA 2HFTA 2VLJA 4O9HL 3RPIA 1T2QL 2X4TB 2FX9L 5GS2D 3WFCH 4HDIB 4EN3B 3WNLA 2FWOA 3ZHDA 1UWXK 4O2CB 1JBJA 3HFML 4L4VE 5D2LE 3VXSD 2NY0B 2APWA 1P7QD 4P3CL 1A6UH 3LN9A 1NGPL 3HCVB 5CILH 1Z9MA 4PJXB 1OAZH 4NZUH 1TJGL 1PKQE 4ELMF 3RKPA 4J2XA 3ARPA 3O6LL 4F8QA 1CF8L 4PRIB 5CKAA 1M71B 5D7JA 3QIUD 1Z0NA 4JFPA 3IDGB 2AJVH 1E4WL 4YDJA 3GMMB 3UTSB 2UZYB 3MSPA 4MJIA 2QKIA 4YDJB 2F5BL 4C58B 4J4PD 1KPVB 1EJOL 3BPLC 3MRCA 2DD8H 4HF5H 4G8IA 5IEKB 1GC1C 2X4SA 1IEAA 4OF8A 4E9LA 5C0CA 4W81A 2DQFB 1RZJC 4DKFL 5JW3L 4HT1L 5KVEH 2NX5D 2I9LB 3N85H 2CLRB 4GMSL 2JTDA 4JFDB 5DD5H 4RMQA 1WCQA 5DVMA 1TQBB 2EH7H 3F7VB 3ILQD 2FATH 5GZND 2OTUB 5C0AE 4X6DA 2DLIA 1OP3H 4MSWA 1FRGH 2Q76A 4R7DB 4KRPC 5JORB 1OCWL 4I3SH 1ES0A 3F58H 4P2OC 3KGRA 4RFNB 3MOAL 3IVKB 1MCPL 2HVKB 2CMRL 1AGFB 3VI3E 4PJ9A 1XGYL 2BHUA 3D2UB 3TN0A 5CMAA 3MBED 4M93B 1XGRB 5DJ2A 1U6AL 1WSST 4JVWA 4PG2C 4OCWL 3QDJE 1E27B 3RWGB 4NZDA 3L1OL 4PLJC 3SGKC 1EO7A 1NCBL 1NMBH 3DROB 4ZQKB 4YBQD 3ULVD 5CP7B 1G6VK 4JREC 2L4OA 1G7JB 2R0ZH 4C4KO 2DYPB 2M8XA 1FLRL 5CJBA 3GRWH 2I07B 4L3CA 5F6IB 2NLJB 5I16B 3TH3T 1UJ3B 5J12B 1T4KB 3TP4A 4BSJA 3MJ7B 4FABH 5BJTA 1SJHB 1FGVL 5EO0B 3ARBB 5EU6B 5IF0A 4GW5A 3C2AL 2PYED 1IL1B 4D0DB 1S7RB 4TTGA 3MV01 3SE8L 2NNAB 5FYKE 2XZAL 3F12A 1UG9A 5TDNB 4CN6A 3MJ9A 4X6DF 1FFPB 1M6OA 4LLWA 3KNBA 2EEBA 3HNTL 5L2JB 3QEHA 4NKDB 2IPTL 4KKBC 1D5IL 2ATPB 3D3VE 3T1FB 2VH5H 1GH7A 1JPTL 3ECBA 3JWNC 3CX5J 4UT7L 2Z31D 3NACH 5C09B 1CXKA 1RZJH 2H8PA 1UZ6E 5MHSD 1U58A 2YZ1A 4GRLB 5T3ZL 2I60L 3VFRB 1MVFA 4ZOAA 3BO8B 1EFQA 3VA2C 5E4IA 3WFCL 2YD9A 3EO1B 4YHNA 1S7XB 3C08L 5IFHL 5T33L 1MCDA 4NO0A 2ED8A 1KIRB 4JRYD 3EOAB 3DVGB 4IRJB 3C6SB 1DEDA 4R2GC 1FCCA 4EJ1C 1CU4H 3QUMH 5IHUH 2CIKA 5IW6B 1S9YA 3MR9B 1KIPA 3LB6C 3PWPB 4ESKA 1J0HA 4QXUH 1UXSA 2PTTB 5IGXL 1YUHA 5EZLB 3QXDB 4N8CL 4NRYB 4MX7B 1PX3A 4LCCA 3T0WA 2VABA 3MROB 3L3HA 2VDLL 4O02L 3QUXC 1RULH 1XGPB 3SE9H 3GK8L 1J05A 3HE7C 5DYOB 1T3FB 3BIAX 3QNYB 4YX2H 4OD3L 4KXZH 3F7RA 5D2NB 5FDYA 2X40A 5CD3A 2CO7B 3IJHB 3UTSE 1CTOA 1TZHA 3FFDA 3HG1A 2CXGA 2EYRA 3IDNA 3NIDE 4R4ND 1RHHA 4WTXA 3VWJC 3LDBC 2WV3A 4X9IA 1MRFH 3IXAB 4OFKA 3JWDL 1KIQA 2NX5B 4R7NB 1N8ZA 3GSVA 3BKJL 3QJHA 2FX8L 3P30L 3GI9H 5TGBA 4I77L 1MHCB 3AMLA 4OGYL 4NM8H 2JCCF 4NUGL 1L0YA 3FZUD 3LSOA 2VIRA 3E3QC 1A7BA 1P7KA 4P2QD 5M94B 4KMLB 5E8PA 2AI0H 5C07B 3GO1L 5D7SH 2EDDA 2P5EE 4M7ZB 1A64A 5TH2A 5MEPB 1D9KB 4KRPB 1QSEB 2AJ3A 1E6JL 4Y16A 1XH3B 5LCVH 3M17B 4G6AD 2BDNH 5I71B 5F7HA 3U7YL 1RZGB 2OJZL 1U91B 3TYFA 1OSPL 3H8NA 3UCRA 4Y4FD 3RKDD 4PGZA 2IPKA 4OFYA 5ISZB 4ZSOB 1RZ7H 1RIVL 1T1YB 3BT2H 3QFJE 4X80H 5JPNB 4ODVH 1PYWB 5BRZE 5ITBH 1BD2A 2HKHH 3O3UN 43CAB 1SEBB 2DS4A 3F65A 3TNMB 3JV4A 5K93A 2I5YH 1TJIL 4FNLL 4IS6B 3SCMA 3OKLB 4BKLB 1LK2A 3PWUA 4LHQB 4LLUA 1TVDA 4KPHH 2DYPD 3KPQA 2UZIL 4Y5XC 1U36A 4XCYB 4J3SA 3UDWA 3LEXB 3HMWH 4X7FC 4R0LA 3RTQC 2PYFB 4U31A 5EDXA 3G6JF 1F90L 1S7SB 3R1GH 5MI0C 3TF7C 3EDEA 1AO7A 4X6EA 4L9LC 3M45A 4KKNA 1H5BA 3OKNA 4O5LL 3GSWA 1G6RL 2V6HA 5EUKA 3SGDI 3QIBA 5B38B 3BGFC 5TH2B 3SCMC 1Z3GL 4OQTL 3HZVA 1MFAL 1X5AA 3QDAA 1NFIA 5E9DD 4CADB 4QOKE 1MJJB 2MHAA 3PXHA 3HE7B 4DN3H 4XCEB 4M5YL 2ARJQ 5F93C 3SN6N 3TIEA 4NT6B 2H32A 1W0WB 4G9FA 1A7PH 4WCYL 1LE9A 5HDQL 4JRXA 3DVNB 3ARFB 3MRMA 5FA3B 2D7QA 35C8L 2CGRH 1PX4A 2VLKE 3QPQD 2Z91B 4D9QE 4ZDHA 5BV7C 1NBQA 1OM3L 4XH2A 3LKQB 1TVHA 4K8RC 2EE6A 1DBJH 2MJWA 1JF5A 4GSDL 1MLCA 1MCEA 4YHYC 4M03A 1NGXB 4QY8B 1BQHB 3O4LB 2VLRE 3GHBH 2Y9RT 4NJAH 4LSUH 1E6OL 1EEYB 4ELME 2YPLA 3AY4A 2FEDC 1J05B 5DYOA 2G60L 3WE6A 3O6MH 3VGGA 2DMKA 1ZA6B 4F9PC 5KVFL 4JGJA 2XQBH 4FQHB 3MRQB 3U0PB 5C0BD 1HE7A 1UCTA 3I75A 4HUMB 1FC1A 3WEXB 1OB1A 3MRDB 5HHVH 5B38G 4DVRH 4MXWH 4KUCF 2QSCL 4NHUA 1OGAA 1B0WA 1WZ1H 4JZJA 1A1NB 4ZTOH 1Q0YH 3KLDA 1NPUA 3Q5OA 4E41B 1Q9WA 3KYKL 2P49B 4XXCC 4XAWH 3SO3C 1JRHH 1BF8A 3QPQC 3VWJB 3WO4B 3FAWA 1AO7E 3T0EB 1NGZB 4CJ1A 1SBBA 2EECA 3HB3D 4FQLH 2BNRA 3CVIH 4RQQA 3GSWB 3LVEA 1L6XA 4MCZA 3KNBB 3NIDF 3L3GB 4NQED 1LNUB 3WJLA 4Z95H 1FPTL 2H6PB 4M1GL 3ARFA 3BQUD 3MRMB 3MX0A 3ULUD 1GHFL 1DFBH 4Y5VA 4X4YB 1G0YR 2HVJA 2YHGA 4PG9B 3INUH 4Y2DC 4AMKL 2JJTC 5EBMB 1KUMA 2WNGA 3GMQB 1KEGH 4TNVF 5JO5B 4W4OC 1LDSA 5T1LD 4QGYA 3QUZA 3WO4C 4O2FA 5C2BH 5JHLH 2UWEF 9CGTA 3BD5A 5FHBH 4GLRH 4AEHL 4DGVL 5IUSA 2FNBA 3W9EB 2F19L 1OTTD 3R0NA 4S0SD 3IU4L 1RJCA 4N0FA 1DLFH 4UTBL 4XP6L 3B43A 5ESAA 1IEAB 1S7QA 1AGDA 2D7NA 1MNUH 2E6QA 3VU2A 4H26B 1QFWH 4U1JA 4JPWH 2GT9A 2P5WD 5C6TL 2BNQD 3HC4L 2GJ6E 1Q0XL 4Z77A 3P0YL 5E2VH 4ODVL 4HV8B 1WBYA 4GAJL 1MF2L 3DUUA 4YK4B 2B39A 43C9A 2WAHA 4LPVA 2FX9H 1LP9A 4TSBL 5LAXB 5DA0B 3KHQA 4X6CA 3T2PA 2YUXA 2VN7A 5EC2A 2X10A 2H45A 3MLWH 4L1HA 3HFMH 1OWWA 4BK5A 4HFUH 5FIEA 3FT3A 5K9OB 1OWRM 3F5WA 4KKCD 5FO9B 5MENE 1E4WH 3RWDB 1F90H 5IVXB 1MJJA 5JW4N 3VXRD 3L3GA 5F71A 4MDJB 2F53B 2HMIC 4LSVL 5K9QI 3VXSA 4PJ9C 3X12A 3PDGA 3IRZA 1YN6A 1AGFA 4NO5B 4Z78B 5SV4A 3EYVA 2EXWC 5JDSA 1QFPA 1MREL 3QUKB 5C07A 4M6NH 1K4DB 4OSUH 3OWEA 4NQDA 4MQXD 5F8RC 4NHCH 2YOCA 4TUJB 1G9NC 2VL4A 4UNUA 3MXWL 1TZGH 1ZT1B 2CKBH 3OGOE 2KL6A 4LKCB 4XBGA 1WC7A 4UDUA 3TPKA 5F7KC 3T0EC 1JYWA 1VGKA 2HTKD 5TE4H 4JJHA 5TQ2H 3UTPE 4RGNC 2VXSH 4GXUM 5I0ZA 4LL9A 3U48A 3AM8C 4ELMA 1A0QL 2VQ1B 4QTIL 3PABA 2VLRA 3KYOB 2DLFL 5B8CB 2NY6B 3V4VL 5A3IC 4ONHA 1N6QL 5DK3A 2NY0C 3OKOB 4KK9D 1OF2A 1QO3A 1T04B 2E7CA 4O2EA 3VWKC 2HFGH 3QDGD 4WFED 3QXVA 1FVEB 3L3OB 4ZUTA 5CD5C 1NFDA 4JFED 5FECB 1CXFA 1KC5L 5JHDE 1KJ2L 3DSFL 4ZUSB 1B6DA 4JZNB 1SJXA 2DB8A 4C59B 3EIFA 1B0GA 3FO1B 2EYSB 3L5XL 4XMLL 3L1OH 3LPGA 3FFCA 3FO9A 3VXSE 3MLVH 3MBEA 5TE7H 3QSKB 1S78C 3CVHA 3UBXA 3GRWA 1BQSA 4Z7WF 4RX4A 1A3LH 4JFEE 3BJLA 3O6FA 2D3VA 5IW3A 1T89C 3LN5A 4TTDD 1DL7L 1GOHA 1HHIA 4XWOD 3RX7A 1IGCH 2VLRB 1P6FA 5DHVA 4NKOB 5F7LB 5F3BA 1NBYA 3O41A 3HA0A 2GAZA 4U1HA 5BW7C 1CGWA 3Q3GA 3JWOH 1U95B 5HYJB 1QZ1A 4NZRH 3Q3GB 1A14L 2XA3A 4MX7A 2EKJA 5ITFB 1SYSB 2KZ1B 1J10A 3SPVA 1MI5B 4LSSH 1QP1A 1NLDH 1Q1JH 4BSWB 5TDOA 4ZXBD 3AS2A 3I50H 1J8HD 3IXTA 1G7HA 2I60H 2R15A 4MXVE 2NY4B 4OIBA 3STLA 2Y72A 4LSQL 4Y8DC 2N7AA 1X5ZA 3NABH 4PJAE 5DUMH 3MRKB 5D1ZC 4RFEB 1EHAA 5ALCH 1ZHKA 5EOQL 5CUSL 2XQYG 1XR8B 3O3BA 3P3YA 3SOBL 4FTVB 3ZZ1A 2I9TA 1JE6A 5FYLD 4JM4H 3V6BR 4DK6A 5FXCH 2ERJC 4LQFL 2BRQA 1FV1B 5FUZL 2E27H 5BVPL 3ULUE 1YDPA 3S96A 4BFEA 1RIHH 3PV6A 4PPTA 3MUGB 5TF0A 1UACH 3LSOB 4QT5A 4TUOA 1RQ5A 1L0QA 1PEZA 4UZGA 3MLUL 4N5EC 2PETA 2R4RL 5DI8B 4Q9CA 5HYSG 4Q9RL 1QBLL 1MHHB 4Z0XB 3V6FB 2OK0H 2Y7QB 4XPTH 3DYMA 5T3XE 4PRAB 1R5IA 1CDBA 5E6IA 3VXUE 1JZ5A 2V2XA 2VITA 2KH2B 2YKLL 4I3RL 3QDGB 4JFEA 3KPLA 1F6AB 4OI9A 4HFWA 2RAMA 1HXMB 4PTUA 4NYLA 3KWWB 4HIIA 1E4XL 3GMRB 1D3CA 4I4WA 1S7TB 1RULL 4OSUL 4YFLI 5J89A 1FO0L 4L8DB 1UWEL 4CN1A 3PUCA 1L7IH 2PXYC 5JDJA 3STZB 3FFCD 1CLYL 4LLVA 2MQCA 3ZTNL 5ERWB 4M5ZH 5HGDA 1NFDF 4X4ME 3K8MA 1WFOA 1G9NL 5CLWA 4PP2A 2DKUA 5E00A 4U1IA 1LDPL 2BY3A 2MKLC 1VERA 4Y5YA 1EBPA 4PJEA 2FX8H 4XNUL 4POYA 5D7LD 3RUGA 3HE6D 4WO4D 4LCWA 3V7MA 2UWEE 1ZHLA 4PJ5B 5C0EA 4JZNA 3I3BA 3VXMB 3UROR 4O58L 5SWQA 4LBEB 1H5BB 2RJMA 4JQXC 2IANE 4KROC 4GW5B 2NW2B 2OL3B 3H42H 5LCVL 2EDOA 1INQB 1PBYA 5JQHC 4Y1AE 3ZKMD 4WNQB 1UXWB 3MYZA 4LLYA 2DM4A 2HKHL 1V7MH 2BMKB 4PJAF 3HUJF 1NL0L 4L9DA 5IP4A 4M1DH 5IVZA 2G2RB 5IT2L 1H5BC 4K94L 4MDIA 1MRDH 3BRFA 5C92A 3MA9L 4OZFG 4NDMB 1ORQB 3R8BB 1NBYB 4GBXA 3R06A 2H1PH 5C0AD 3F7YA 5C2UB 2EO1A 4PY8I 3P4MA 3RY5A 5HHMB 3KLHC 4K8RL 2NXYB 4I5BA 3ABZA 1BD2D 3O6LH 1Q72L 2JK5A 2ITCA 4U6VH 4TNVK 3F62A 5EIVA 2Y5TA 1EGJH 4N68A 5KZCB 5F7NC 5KS9F 2AJVL 1PQZA 2NXYC 5KSUA 1FDLH 4FG6D 3QDGE 1ND0B 1YN7A 4Y2DA 5CSGA 5GGSB 1J9CT 2QADC 1EJOH 2DD8L 1ZANL 4AJ0A 1MCWW 4X6FB 4PJGB 5MEND 3VFWB 1WFUA 1YEFL 2WK2A 4G8EA 2BNQA 4HJGB 4PRIA 1GGIL 2GJJA 2VLLA 4UOW1 4LSSL 5JZ7D 5IB4A 3B9AA 5HDQH 3IAGC 4G7VH 1NC4D 3MOBH 3X11B 4V1DE 2Z0BA 4JVUA 2X4PB 3TYFB 3AREB 3OXRA 4EI5B 1JK8B 3I2CL 3BSZH 3OKKA 1D5BA 1DQLL 2BRRL 4W6WB 1ZLWK 2XG4A 3IAPA 2NY0D 4HH9A 8FABA 2EXWD 3FO0L 3P73A 3B2UC 1T20A 3RGVB 5IG7B 4JPVL 4FQ1H 3ULSA 2DQIH 1BGXH 5F1OB 4EDXB 2P8PB 4ZTPH 3EBAA 4Y19A 1OOAA 4HJ0C 3U9PL 4EDWL 1ZLVH 1QKZL 2CK0H 2ENSA 3A6CH 3C9NA 5GS2H 1VGKB 1RZFL 5DO2D 5ILTH 4JFDA 1M4KA 4XHJD 1JPGA 3DV4B 2XRAL 1CGVA 4A6YH 4MQXC 4WTZG 4C54A 3LRSB 4ODSH 3FT2A 2XTJC 4PJCA 1B2WL 1U92B 5D96C 3VRLF 1G84A 4KXZI 4HUVA 1ZHNB 2XN9E 1AXSA 2HT4C 4Y4KB 5CP3H 4U1LA 4I18B 2IMMA 4I48B 3HUJB 3PQYD 4XAKE 4ORGB 1FG2A 2AJYL 4UMGA 4Y16B 2V5YA 2VUYA 2NMSA 3U6RA 1MCSA 2CQVA 3QUYA 2IBGA 3D69B 3CVIL 4MNQA 4NC0B 4XXDB 1JI1A 5CZXC 5JW4Q 5DVNA 5BS0B 1KGCE 3QG7L 4LCWE 4WWKC 3RX5A 5FM4A 1K8DA 2NX5E 4H8WH 3D39E 5DEGA 3MLYH 4Z76B 3S88H 1FZOA 2AXJA 1ZTXH 1JN6A 3QUMB 4GRMA 2IAMC 2NY1C 1S3KH 1MCKA 1ULVA 5DR5H 3H9HA 4MQTB 4XP6H 3E0GA 5T5NG 3SKMB 4AEEA 1MLBA 3TVMA 1NBVL 3VCLB 5JXAL 4FQXD 1HKFA 2ZCLH 4ZUUA 2WWMC 3HR5B 3TJHD 1U42A 3HAEA 5D7JD 5J9PA 5EC2B 4Q6IC 2Q87A 3FTGA 4R90H 5KW9L 4NRXA 2Y06L 2MCPH 5IKCB 4JZOA 5CFHA 4OZ4B 4FQ2H 4K94C 3AM8A 1BECA 3O2WL 1JF1A 3V0WL 4OZ4A 4QRRA 5M7QA 2XV6B 1HXYB 1EFXA 4PB0H 4PJHA 2HG5B 1GGYA 5SWSB 4UDTB 4JQIL 4ZNEE 2XQYK 1KLGB 3DXAA 2MPAL 3KPRD 3WXWH 3TCLA 2IMNA 3QP3A 1I7RB 1V05A 1QRNA 3M1BA 3ULUC 2FR4A 1P9MA 4U1LB 1H8NA 4QRPD 3C5SA 1VFBB 3WJJC 1G7IA 5FYLE 4DUVA 2CPCA 2LVCA 4NUJB 4APQC 3GSRA 1EGJL 5E8NB 3FT4B 4YNYB 4XB8A 5KZCD 4Y5XB 3C5JB 1JCKA 3QZWA 2IQAA 6FABH 3JWOC 5DMYA 1FL3A 2FJHA 3ROOA 2WANA 5LVEA 4P2CG 2V2TB 3V4PH 2X5PA 5JXEA 4OM0H 3GB7A 4HULB 4YHZH 4RMTA 3WXVL 1QYGH 4P9MH 5DS8B 4EN3C 1JWMA 1BMGA 1T66D 2IANB 2IADA 1NCWH 3ULSB 2YUZA 4GKZA 5ICYA 2FEDD 3I2CH 1A6WL 3PQYB 3AUVA 5CEXB 3W5MA 1S9XB 4LVNB 5E99H 4PJ5E 5TF1L 1Z5LB 1D6EB 2ENYA 2BC4B 2FHFA 4NQCD 4OZHA 4OZGF 1BFSA 4E41A 4CVZB 4HLJA 3WD5H 3IKCA 3N1MC 3NIGF 3AAZB 1BGXL 5IQ9B 3BP7A 3EZ8A 4WIQA 3QIWD 2WINB 1KT2B 4KGLA 3ZE1F 1OTUC 1A47A 4MHHI 1YMME 4NC1E 5FA3A 3VFPB 4NGHH 4JN2B 1AD0B 4Z5RA 5DJCB 3VG0H 4DAGL 4LVEA 3BQUC 3DX9B 1OSZA 1A7QL 1DUYB 1KB5H 3QDHA 4LOUD 3FHQA 3CDFA 1MLCB 4RWYH 1S7WB 3V52L 1MEXL 1ZVSA 2DTMH 4JAMB 1J86A 1EHNA 2DWDA 1A1MA 1U8LA 4XBPA 3REVA 2W9LA 4X83A 4Z7UA 2ADIB 2VLMD 3WL9B 3EJZC 2ZPKL 3N1PC 3WLBB 3VFNB 1LGVA 4ZO9A 1JZ3A 1NCCH 4ZPTA 1HHJA 3K0WA 5GS0H 5MP6L 1EHXA 4HUNB 4K07A 2AJYH 4HBQA 5INCB 5LGHL 2R1YB 5L2KA 5TE6L 3HG1E 5TE7L 3NAAH 4PJ8D 3RZCB 3DUHA 3H9SB 2EC9T 3NPZB 4PRBB 3BEWB 3PNWB 1ORSA 5I66A 4NKIL 2JJUA 2Y07L 5BS0D 4XNYH 1A02N 5ADOH 2WQ8A 5IB3B 4I0PB 3E6HB 3CFDB 3S37X 1EEUA 4IMKA 4UB0H 2YD2A 4LLWB 2QL1A 1TETH 1BVLA 4PB9L 43CAA 1KJVB 3MRHA 2J8UE 1PSKH 1WZMA 2QJDA 3UTQB 3BP5A 1KTDB 5DUPL 2P5EA 1OP5H 4OLUH 1I7ZB 3W11D 4F33A 5E8DL 2D31A 4WENB 4QRRE 5IJKC 4F9LC 1T7YA 1YC7A 4KKAC 1OSZB 3VDAA 4HPYL 2GQHA 5INDB 2ARJB 35C8H 4LQFH 4GAGL 2R8SH 3MV8A 1BFOB 3DV4A 4K3JH 3BP4B 1U8NB 3PDOA 2E6PA 3CFCH 4IIQC 5ALCL 3LIZH 2VXVH 4XHJC 1YEIL 4EN3D 4HWUA 1MH5A 1G9MC 2W60A 2X4UB 4HKJA 5IR1B 3MUZ1 2BERA 4XPHH 4ZO8A 4M1CD 5LQBH 4QHLB 2VC2H 5I0DA 4GG6F 1U8LB 1S9YB 5B8CC 5FDWB 2FJGB 5GS0D 1OAZL 2MHAB 4NZUL 3K3QA 2G60H 1G7PA 4B41A 2V2TA 3CSYB 1TMCB 4WFEE 1MCWM 2Q86A 4LAQH 3EOBA 1D9KD 1RZ8B 3T0AA 4QOKB 5DJ6A 2YKLH 4EUPB 5JUEL 1FFRA 2J5LB 3QCUL 2X4RA 3QI9C 4WW2F 5GSVA 1OVZA 4NKQB 4R97C 3HE7D 3SHSA 3OAZK 5E70A 1KN4L 1LEKA 3ZKQD 1PG7W 2AABH 5I1IL 1Q38A 1N5YL 3ARFD 3BQUA 3FB6A 2A73B 4GKNA 3BXNA 3BVNA 2J4WH 2DJUA 2OJEB 1N8ZB 3SGEH 1BEYL 3VD7A 5JIIA 3QHZH 3MRLA 3QHFH 1E28A 2XN9A 5BV7L 4XNXH 3IDNB 1FV1A 5DK2A 5J1SC 2RGSA 4MA3A 3VE0A 4G9FE 5MERB 1WISA 4Y19D 4X99B 1TCRB 4OZIA 1IEHA 3WS6C 1BWMA 1IT9L 3DURB 3TVMD 1KTLA 2VLKA 4JO2L 4AT6A 3FQNA 4U3HA 1O5DT 5LXGH 5D1XA 5A2KH 4LMQI 3IJSB 3ARDB 4JDVA 5EO0A 1KN2L 1QACA 1F4AA 2YSSA 3VXRE 4X5XB 5ABDE 1ZVHA 4AEHH 3FZUC 4IBLT 1CIDA 3QPXH 1JFQH 4OKDA 3RU8H 4EBQL 4WU7B 4DCQB 3RKDC 1OW0C 4N90E 1ZKAA 3BESR 3VRLE 4JM2C 2AVGA 2IALB 3LKNB 1TLKA 3KPLB 3V52H 3T0VA 2R2CA 4M4RA 1JNLL 2OSLA 1CFNA 4G6FD 3QQ4A 3TCXA 3SDYL 3V8OA 1X5GA 4LSDA 4K9EC 2NY6C 5D5ME 1WBXB 4FZ8H 5DC0A 3DXAD 3RL2A 1U3YA 1T21B 5DRZA 2W0PA 2J3SA 4TYUA 1QRND 3VXTA 3EKCA 4OV6F 4P2RA 2OR8A 5EWIH 2WLYA 2XTJD 4LF3B 4FFZH 3IDXH 5T1KD 2NY7H 3SDDB 5KBNC 1J1OH 2R1XA 5ICXA 1XR8A 4TUKL 5DK2B 4WHYG 1WF5A 4JB9L 1T1WB 1UKTA 2GJ6B 4HQQL 4OZIF 1HN1A 4X7TA 1UXSB 2PTTA 1U8KB 2L7JA 4Q6IA 1AGBA 1N3NB 3IKCB 4XCEA 4MQSB 1R0AH 4IOSD 4P59H 1FAIH 3B6SA 4P5KA 3MODL 2BCKA 3KJ6H 2Z31B 3RFZC 1MRCL 4D9RD 3IDYB 5CAYB 5HHPA 1GPOL 4LPUA 1JZ7A 3VFVA 1CFNB 3QO1A 4OZGE 2Z8VC 4PY7A 1T5XB 1DN0A 4CW1A 1YEIH 3S3SA 3KVQA 1TQCC 2MNUA 1NEZB 4BQBA 4WWKA 4P3WA 1OAXH 2G5BB 1U0QA 3EYSH 4BSWA 5C3LD 4FQ1L 1K2DB 4Y4HC 5BO1H 5LBSL 1IQDA 5FKPA 4BFBD 4NNYB 2YN3A 4I2XB 2KDGA 1CXHA 3UYPA 2GUOB 1CL7L 5HGBB 4BELD 2XKNB 4F7CB 4J4PA 4JG0H 1DBAH 4NWTH 3S4SA 2JJSC 4YXHL 1AXIB 5IM7A 4Z7WA 2A9NL 2JB5H 2CRIA 4MJIE 3U4EB 3BDYH 4ELKB 3CFKA 3O3EB 2BVTA 1INEH 5A1AA 1U3HC 5C09D 3VD3A 2Z93B 1U8OA 3L6FB 2K7PA 3BZEB 1T1WA 4MAYB 4POZD 2NXZB 4U6HB 4D94A 4YH6A 1T2QH 1AHWC 1OT2A 1WT5A 3NN8B 1X4ZA 3FONB 5D7IE 1EFXB 1F3DH 25C8L 4XCFH 2XTJE 3CZFB 1UB6B 2ZNWA 2ESVD 4OZFH 4RFOH 1MAKA 3NPSB 3GSOA 4OGYH 2CD0A 3MLYL 3QI9A 3MRNA 4KFZC 4X4YA 1AH1A 1QSEE 3O8XD 2CUIA 3TVMB 1JF6A 1DLHB 3P11L 3U79A 4MD0B 4MJID 2DJSA 1ZLWH 2EE3A 4NN6C 5D7SL 3HR5A 2A0LC 3NA4A 1RV6X 4KI5D 2NPLX 5GSRB 32C2A 4DW2H 4JRWA 2Z4QB 1G7QA 1I8KB 4GAFB 2YD4A 5GGVH 1TVBB 2EDFA 5J13B 1XFPA 3THMH 3DJ9A 3RIAF 4PGBB 3CD4A 3VH8B 1FO0B 4GRWB 4NQDD 5JXAH 3X3GL 4RAVA 4GAYB 2RFXB 1QSED 5E2WL 3TO4C 3RWIA 3BE1H 3MRQA 43C9B 1Z9LA 3DI2B 4UOJA 3G08A 3QT2A 4LPYA 5D1XC 4KROB 4G6FB 3QFJD 1UENA 5DD5L 5E7FA 4MNQB 5JHDD 1N4XH 5ISZD 5KAQF 2BSRB 5KSBF 2HJLA 5IB2B 4OCLC 1UM6L 4OB5L 1MAML 2IH3B 5E6ID 2ADGB 2XWJB 1Q9KA 3TA3A 4QRQA 4LLYB 4OLZL 1KCRH 3PWPE 4QY8A 4Z7VA 5C0BE 3MGAA 4L29B 5GRZA 4N1HB 5DJAA 4XBEL 4MLIA 3WNNA 1CGYA 1JNNL 4ETQA 1F2QA 4HWBA 4FMFA 4HF5L 4Y2OA 1NAKL 1BIIA 3OMZA 2B2XH 2FIRT 1IGFH 4GG8A 3WXVH 5GRXG 4OLYH 1WITA 2D0FA 2WBKA 1CICD 4PJ7B 1NDMA 3SGJA 1A6VH 1D9KC 1NAMA 4M3KB 1GGBH 5DURB 2X70A 4CUCA 4KQ4H 2FATL 2DF3A 3KPOA 3QEHB 1H15A 2R2BA 3VXNB 3HI1B 2NY2D 3CUPB 3G6DL 3T65A 5IHBA 3EFDL 3BN3B 3VDCA 4UT6L 4QXGH 4LCWD 4XNQA 1PEWA 2YUWA 2HJKB 1KNOB 2VLKD 3WYRA 1BM3H 4G6ML 4JEGB 2QEJA 4H26A 4YUEH 3QI9D 4MJ6B 5HDBF 2A6KA 1HOCA 1KCUL 1I8IB 2CXKA 4HUXA 3L3KB 3R0MA 5GRUL 4JM2D 5BO1L 4M7LL 2XZAH 1B3JA 4OCWH 4I8DA 4KDTA 5AAMA 4N8VA 4K71B 1OAKL 5F9JB 1U3ZA 5FGCB 4AG4H 4LLAA 4L9LA 1DEEB 1H8SA 2HT3C 4D9LH 1TQBC 3FN3A 2XXMB 3WHXB 4LRNL 3KYKH 1QVOB 3AU1A 5MP6H 1DVFD 1K8IB 4H20L 3C6LB 3Q5TA 4FTVD 3GIZH 1CLZH 2OR7A 3DX7A 1NCBH 1NMBL 1WZLA 2IFGA 1OL0A 3H0TA 2P46B 4UT9L 5BOZG 4ZUWA 3ZYOA 4U6YA 3ARVA 1FLRH 3NZ8A 1IAKB 2PXYA 4RDQF 1OAYL 2B7DT 5TE6H 5I19H 2A83B 3ULUH 1IKFL 4OJFL 5L8JB 4CMMA 3LS4H 4JHAL 4MAYC 2V7NB 5L7XH 4KRMB 1JYXA 5CD5D 1DQDH 3DBXB 4IOIB 4N8VG 2E7LC 4XT1C 4ZS7H 3S34L 3CMOH 4IIQB 3TV3L 4JKLA 5IMMB 4OFVA 1OTSD 4OKVB 2VH5L 1W0WA 4KTDH 1KIUA 1MCHA 5I75C 2ZWLT 5AG9A 1QFHA 4TN9A 1QLFA 5J11B 1KFAH 2W9EH 4GOSA 1CT8A 2GFBB 1IC4L 2VXUH 1A6ZB 4Y5VC 1CICB 4X7SL 4OQ1A 2ZUVA 1BX2A 3VFOB 4GQ9L 2R56H 3HZKB 5L88H 5B3JE 1EAPB 1QQDB 4G8GE 4ZUTB 1LD9B 3LEYH 5KSUB 3V5HA 1YQ2A 1JV5A 3IFOB 4DGYL 5EUOE 2I07A 3JWDH 2CRMA 2BOBA 5CINH 3UEZA 3D18B 4JGUA 2DQIL 1YMHA 1JHLL 3NIGE 4U1MA 4LAQL 5CLTA 3RVXD 2H9GB 1G1YA 3H3KA 1ITBB 2EKSA 4HZLA 2VR9A 1D6EA 1T20B 5DJZA 4AM0A 2BHZA 4L4VA 5FGBC 3GSNB 3N9GL 5IIEB 4PJBF 4W70A 2D7MA 1MCLA 4K3GA 5KTEL 2ZCKL 1FN4A 4IIQA 4HKZB 4M1CC 3MLZH 3VD4A 1RAMA 1N5AA 5DVOA 3PP3H 2EDXA 3DRTB 4H1LH 1ACZA 3MNVA 4HXBH 4QNPE 4NHCL 4M62L 5JW4R 1GGBL 4V1DB 2CKBL 3T1FA 1RIVH 3BRGC 5IV2B 1J0KA 1CK0L 4N9GA 5HI5C 5CGYD 5JIKA 2FECI 4HUKB 1SYVB 3EO1A 1TJIH 3MGTA 3RVVC 3ULVF 2ICCA 5GGRB 1OARH 3SDXB 4P23B 1X5IA 2LAGB 3CNKA 1FJ1B 3OHXA 4Y89A 4YHIA 2AQ3A 3HKFA 5KS9B 1HNFA 7FABH 2ICWA 4X6DE 4U1SB 4AZ8A 4MAYA 2RCSL 3NTCL 1I7UA 5BRZA 4CVWA 3QEGH 3HI6H 3MC0A 2Z8WC 1RHFA 5D6DC 5EU3B 2H3NB 2IAMD 3MLXL 1LP9E 2XWJA 4Y4KD 5ELIA 3Q1SH 1OTUD 5D71L 5GRWA 3KJ4C 4OF0A 3ZDXE 2BVQB 4J12A 2WIIA 5E9DA 3SDYH 3ARED 4EI5D 3LCYA 3G5VB 1R3LB 4J3UA 1S5IL 1MLBB 2EO9A 1EUTA 2W38A 3R06B 3ZYJA 2J8HA 4P46B 3L3DA 3V5KA 3VA6A 3VFSB 5C0FA 1AGEA 3UPCA 5FK9B 3MBXL 4U0QB 1QHPA 4PRDA 1VEOA 2LU4A 4XZUB 2BVEA 5ICZB 5A2JH 4PJXE 1EDQA 4IEFB 4XWGH 3JTSB 5IROA 3TLRA 4WWKB 1FO0A 3ARSA 5EU7E 3KPTA 3K81A 3ES6A 4WW1A 4MA7L 1EPFA 1DL7H 5EU7C 4FP8L 1BJ1H 5D2LB 5E2UL 1L7TL 4YDLC 1T7WA 1QSFE 4QHUB 4L8SC 3NZHL 5J1TC 4OQTH 1WFTA 1GXEA 4ETYA 3GJFA 4MNHA 3V4PL 1BQHG 3SKNA 1KGCD 1F3RB 1XIWD 3TYGL 5EG6C 2R69H 3LZFH 4FHBD 4KQ3H 1UH2A 3N85L 1OLLA 4HIIB 3U2SB 4L3ED 1MIML 3QEUA 5D7IB 1A5FL 3QXUA 4RMUA 4H0GA 1UFUA 2VABB 4UAOC 1F6LL 4HGMA 1MHPL 4PS4H 5D9SB 1KB9K 1T22A 3LEYL 1CD8A 5DMKA 1BVLB 4JCLA 4JM4L 1P9MC 4OM1L 2QKIB 2MFNA 1RURL 1N6UA 2HWZH 4NJAL 3S6CA 2O26U 4I0PA 1T0NB 3MJ8B 3QUZD 4ZS6D 4H1LB 4JFXA 4QRUA 2CDEB 3X13A 1JL8A 1V3MA 1QSVA 4WUUD 3GJFK 1MCRA 4XZUA 3FO2B 1S9XA 4RIRA 4DN4H 4XPGH 2MQ0A 4YDIL 1AR2A 1WBYB 3WN5B 1JPGB 2J8OA 3FCTB 5GHWL 4MXWL 1RZKL 1GGCH 3CLFL 2OK0L 5CEYB 4RBPK 3VXMA 3NIFE 3U7AA 1YPZE 2DM3A 5DJDB 4FQIL 4RQQB 1W72L 5DMJB 1BQUA 1UWXH 4WW1B 3VH8G 1OP9A 4JDZB 4P0DA 4YBLB 4R6UA 4X8JA 1K5NA 1OQOA 1F58H 3HPLB 1CGSH 1XR9B 5ANMA 3GSQB 3MUGA 2C3VB 5KANG 2JLLA 4M1GH 4HH8A 3WNPA 3VFMA 3GBNH 2F74A 3GRWL 5DJ8B 2NW3A 1A4KB 1IJ9A 3BJ91 2HT3D 5DRNA 3CVHL 4CMHC 2VR4A 1P4BL 4FQLL 2WBJD 1N59B 1MQKH 4ZDHB 5CZVL 3ELAT 1SY6H 3QRGL 4QYOA 3C5SB 2ZP0T 3OKYA 4U1HB 4LCIH 2O5XL 1F00I 1JGDA 3MLWL 3U2SA 4DZ8A 1NSNL 3RWGA 3P4MB 1P84K 1ZGLP 5DC4B 2YA1A 5KSVA 3QIUB 5KS9E 5FYLH 5GSVB 3T3ME 1KJ2A 5E95B 4LVNC 4EIGB 1VEPA 4E0RB 3PG2A 3WJLC 5GGTA 5CEZL 2RFXA 5K9QG 1S8DA 2VERN 3RNQB 1YNKL 3HE6B 4ZYKA 1T03L 4WU5B 3BQUB 4GKNB 1YEHH 4PRPA 1KCSL 4NNPH 5ACZB 1I3VA 1KPRA 1EAJA 4HAFA 4ENED 2IAND 5CEZE 4XVJH 3THML 4M6NL 1YDPB 4RISH 5EBLA 3S96B 1I8MA 2V9QA 4ZUSA 4TSAL 5C7XL 2CDGA 5I1DB 2HKFH 1H3XA 4PRNB 3MTRA 3VXME 2CDGB 3PWNA 4YWGL 5JR1L 1HI6A 4P5TC 3H9SD 4PJEE 3OKNB 1D5BB 5FYKL 3QCTH 3PL6B 5EPMA 3MYJA 3CDGB 2XOTA 3MXVL 4M6OH 4ZO6A 2X41A 3FO1A 2VDOL 1UEMA 4LDEB 5A16A 3RA7H 2VZUA 3RIFF 1HQ4B 5KG9A 2XZCL 1XF4A 2FGWL 1P53A 3WKML 3FAXA 4R7NA 1LE5A 1BFOA 2DQHL 2J8UF 3CLEH 3VFVB 3WIFA 3VMOA 1W72B 3SE9L 3O41B 3BIBX 4BSVA 2HFFA 4W6YB 3NFNA 3NMEA 4FG6C 4TULL 1B6UA 3RWEB 4U1MB 3WUZA 3PGFH 2J4WL 5HD8D 8CGTA 2O5YH 2QHRH 2GUOA 3UTZB 2QQQA 3BP6B 3ESUF 5EZJA 1F3JB 3LQZA 4NNYA 1TDQA 4ZD3H 3GJEB 2EH8L 2VWEC 3BSZL 3GI9L 4JFYB 2YS4A 3B5TA 3AS1A 3PGDA 3MO1A 4LEOB 4HC1H 4KJQD 4QHMB 5CGMA 3MNWA 4I1NB 5TQ2L 3HAEH 1RURH 2YBRA 4JO2H 5GPRA 2FECL 1Y6NR 1VADA 2VTFA 4WTZA 5I8EB 1T6VN 3WFDH 4L5FL 5EC1B 4E42B 2YEZB 1WAAE 2DLEA 4JN2A 4EDWH 3HZVB 4X7CC 3DSFH 3QYCA 4Q7DA 5FCUL 1VA9A 3FQXA 2X7LA 3EYUL 4L4TB 1D6VL 1VFUA 3EJYC 2F58L 4HBCH 5H94B 3O0RH 3PHQB 2X4OB 1MCQA 5DK0A 4DQOL 1YEDB 3HUJE 5J6GB 3T1WA 5IJVA 4POZC 2EXYC 1MI5E 5C0DB 4G42A 12E8L 4N0CC 4YJZL 2FIKA 1UM5H 3DX9A 4KJWC 3CSBA 1PZ5A 3C60A 4ENEC 1J18A 1AI1H 3C5ZC 3VGBA 5HI4D 5SWZB 3UC0L 2UYLA 3U82B 3G5XB 2VITB 2APXA 3KPRE 1JV5B 2ITCB 5CP3A 3C9NB 1D5ZA 1SVZA 1T7ZA 2A6IA 1OAQL 3W82A 1IGJB 4BQ8A 2W1NA 4LPWA 1RK0B 4ZS7L 3IDXL 3MRRA 1S7QB 3N50A 2DQEH 4ZSOA 3SQOL 2VNCA 4PTTA 5I74C 1X5FA 1I85A 3FKUS 5F70A 5J6HA 1PG7X 5HYJA 4AIZA 2WUBL 3CH1A 3DMMA 5EA0H 3GSRB 2E3VA 2EXYD 2APVA 4KK5D 5DR5L 4Z6AT 1I8IA 1VFMA 5IESH 1GZPA 3AREA 3JWOL 3OXRB 3TBWB 4EI5A 2ICWI 3O6FC 4YLQT 3X17A 1KB5B 4WHTB 4I3RH 2NY4C 4M5YH 2QTEA 4YDKH 1BREA 1QUNA 4KK9C 4B5EA 5IFJB 5DJXB 4PJBB 1KCKA 1I7TB 1LO0L 3G9VA 5IMOA 3OZ9L 4JN1H 4XC1L 2HKFL 1MH5B 3BKYL 1UACL 4YWGH 2AK4D 3RNKA 4G6KL 5F96L 4CVUA 2BCKB 3QCTL 1Y0LB 3VFUB 4GFTB 4S1SL 5E24E 1NDMB 1JUFB 1FP5A 5JORA 1TJGH 3EDFA 2ZNXA 3VWKD 2EYTB 3TBSB 2EIBA 3UJTH 5I17B 4OQTA 4ELMB 1L9MA 4NPYB 1M7XA 5J12C 4GW1B 5F9OH 4HS3B 2XG5A 4NDMA 1H0DB 3UO1H 1G6RA 2FGWH 3G08B 5D9SA 4DKAA 3C5ZA 1XZ0A 1E4XH 4NQVB 3BP6A 4HWBH 4G3YL 2AV1A 3TWCH 5C09A 1MVUA 3JV5A 1DTUA 5BMFL 5I1LA 4HIJA 5FO7B 4N0UA 5C71A 4ODUA 5IW1A 2EEAA 2O5ZH 1F5WA 2HJLB 1CLYH 4FZEH 4MJ6A 4XVTH 2I27N 4ONFH 2DQUL 4P57A 2X4NA 4F8TA 1NLBH 5F21B 1E28B 4NQUA 4N8PA 3MGOB 4UNTA 2WLZA 3UTQA 4DK3A 4P2QE 5DJXA 1A6WH 1GHFH 2BK8A 4WUKH 5DMGD 4MWFA 1AQDA 5FA4A 5IFAH 3V0VA 3IS0X 4MMXC 1M1SA 1QOKA 2GSGA 2VE6A 3IJYB 3QJFB 1N2RB 3CH8A 1FVCA 1F4XL 3L3IA 1UM4L 3LEVL 3J8F7 4ZO7A 5IHZB 4X9HA 4L5FH 4M48H 4QRPB 3BP4A 2NTFB 4HGWA 2QBWA 5B3NA 3ISWA 2W07A 2CIIB 2X05A 2PO6B 2FO4B 4YXLL 3NPSC 4FXKA 4PRID 4BH7B 4K3DH 5ETUB 5EU4A 3V79C 3U0TA 3MJGX 4C56E 3W81A 1FFPA 2UUDH 3RBSA 5EU6A 3SE3C 1PJ9A 4UIMA 2EDQA 4JY4A 4KHTL 2ZOKA 3DIFB 4L4TD 2CR6A 2NXZC 4X5WB 3O6FB 2C3XA 4P2RE 4DGIH 3GSOB 3GMRA 3EOTH 3BUTA 4U2ZA 3P4NA 1Q94A 2NY3B 5IBTL 4XGZA 3UTOA 4G7VL 4HKXB 3Q5YA 4MNGB 2FZ3B 2X4RB 4HUXB 1ORQA 3RUGF 4V2CB 1XF5A 3GI8H 4NO5A 5LGHH 2VLME 1SEBA 1CICA 3MA9H 3IF1A 3U1SL 3S36H 3QDMD 1VACA 3LRGA 4M43L 3VJ6A 1L7TH 5AD0B 1TCMA 1NKOA 5HPMB 4JFDD 2AP2A 4P46C 4NJ9H 4KI1A 5I8CB 4X6FA 4QRSB 5ADPL 2Z9TA 4U3CA 1IGYB 1K4CA 2XA8H 3OAYH 4FP8H 4NFBA 4FQCH 1M7IA 1NCDH 3NH7H 5A40E 1HI6B 1AO7B 2WUBH 3ZHLA 2JCCB 2AV7A 3GSUA 3HNTH 4PJ9D 1JIBA 3AFLA 3KYOA 2FD6L 3BUYA 3X3FL 2ILLA 1MCCA 2IH1B 4QF1A 5IBLC 1YYLL 3GMNA 2XKUA 1HDMB 4YHPA 1N3NA 1F45A 3RX8A 5K9OA 4KTEL 4J3VA 4UV7L 1ZOXA 4Q58C 4OCRL 4B0MM 1RUMH 2DLTA 3T2NH 5DJAB 1XIWC 3M8OH 1I1RA 2FJFA 4XMPH 3EYQD 3F12B 4K3JL 3TNNB 2G2RA 3CXDL 4G6MH 1I85C 5D4QA 1UCBH 4X7EC 2DLFH 4C56B 3ULVE 3PIQA 5DRWB 3RDTA 1RIUL 1TZHB 4OM1H 2BOCA 3VMNA 1HH9A 3T4AB 4LIQE 5LJYH 1U8MA 2H26B 1D5XA 2VISB 2OLDA 5DJCA 1EO8H 1QFWM 3LRSA 5D1QA 4M7LH 5F6HJ 4ZTPL 3LMJL 3EGSA 5BV7B 2CR3A 4AENA 1MFEL 1WC7B 4UDUB 1ZMYA 4LASL 4FQIH 4LCUA 2YR3A 4QXUL 2RBLA 5SWSA 3SCMD 1LD9A 4PJIB 3MJ9L 1W8NA 2P24B 5HYIA 1VENA 2V17L 5FYKD 2VDLH 4O02H 2XACC 3ARRA 3I84A 4KDWA 3QIBC 1AJ7H 3T2QA 4UBDD 3PWPD 4HIHB 2NZ9D 1AQDB 4H20H 4MD5B 4U2YA 2DOCA 5HHOB 4H5SB 1F58L 1MOEA 5EH1A 4O9HH 1PG7H 5JHDB 4WV1C 4LSPL 4GRLD 3AC0A 3D69A 3QQ4B 3SDDC 1C12B 3O2WH 2ADFL 2X4PA 1V3KA 3QI9B 4Y88A 1JN6B 3CX2A 2X1OA 1FAKT 3KS0H 3VW3L 4FTVE 1IGCL 5IF0B 3B6SB 3VFTB 3KPRA 4U05A 4Z9KB 3LEXA 1FORH 3C8KA 1KACB 3PXJA 3FQRB 4LEXH 2BC4A 1AGCA 1RJYB 1UH4A 3S37H 5KOVC 1CE6B 5E2JA 3FTGB 2BSSB 3ARFC 1UH3A 3KDMB 3NCJH 3QPXL 1KT2A 2W91A 2W9EL 1YYML 1DZBA 2F5BH 3I50L 3HNSL 4PP1D 2E8ZA 1EVTC 5HYJE 5SWZE 3A6BH 4D0CA 3OJVC 4GRLC 1AXSB 4NO0B 2N4IA 4NNPL 3V0WH 3MYJB 1LNUA 5F3HB 4G7YL 1CN4A 1TFHA 3DSNA 1DSFL 5FYKH 4R90L 4NP4H 4QRPE 3W39B 5HHOA 2FCBA 1NGPH 2GK0A 4JFOA 5JW4M 3GI8L 1NAMH 5D5MF 4OIIH 4FQXB 3W0WE 5BS0A 1YJDL 3QWOB 2DTSA 1QR1A 4G6AC 2E9JA 3PWJA 3QQ3A 2OMBA 4MZ3A 4I0PC 4DVBB 4P2QB 3UZQA 1H3TA 3VGFA 1YQVL 3WBDA 1J1OL 2Q7YB 2PUQT 3C5JA 4KV5F 5EO1B 4HQQH 1QHOA 1AGCB 3L3DB 1NCAL 4HH9B 1DN2A 1RHHB 3O81A 4FRWA 3V5KB 1UYWH 1BQHA 1P6AB 3KR3H 3TO4B 1KJMA 1BLNA 2E5EA 4XCCL 4IMKC 3RY4A 2FLRT 2VDRL 3ARBA 3KPRB 1UWGH 1RJLB 4NOBA 3ZSSA 2VKXA 1OGAB 1PAMA 2J8UA 1U8JB 4PBXA 4OM0L 4GS7B 1J1PH 5TDPB 2HT2C 1QYGL 4P9ML 5CJXA 1KPUA 4ODXA 2ITDA 1SEQL 3H3BC 1H0DA 4H8WC 4AEIH 3RVXC 3U0TB 3ZKND 1WEJH 5CJQH 2ZPKH 4LHUB 5IBLD 4Y4FB 1U8HA 4ZD3L 3E2HC 3DV6A 2W0FA 3ES6B 4Y4KA 1KJ3H 2C3VA 1IMHC 1DBJL 1GIGH 5TF1H 2CLZA 3I02B 4V1DA 1JGEA 1NUDA 3VRIB 2D31B 4NM4L 1XGTA 4MAUL 3REWA 1MCOL 1TITA 2C7UB 2BMKA 1XEDA 1DDHB 3TIDB 3WS3B 4I9WE 2YD8A 3RTQA 3O6ML 2IQ9H 3MGTB 5JPMB 2F58H 4HBCL 4WHDA 4JRXB 3DMMC 4PJBE 4DQOH 3BI9X 4MXQD 5D7JC 3X11A 4U1GB 1I1FB 1XF4B 4G5ZL 4NWTL 1LO5B 5DVLA 5M95B 5CKGA 1KTRL 3OKMA 3TO2A 4G6JH 3VMPA 1T1ZB 1LO5A 4CL7A 3O0RL 4JKPH 1N7ML 1I7UB 3QDJA 1V7NL 4YE4H 3JV4B 5GZOD 4F15C 1PG7L 2VAAA 1M7DA 3PV7A 4FQHA 1J0ZA 2HTLD 1TXKA 3UTZA 2NXZD 3IETB 3U9UA 2Q3ZA 5HGAB 5AAWA 3PP4L 4GH7B 5ADOL 1IAIM 1CD0A 4R0LB 2ZOKB 4YHPB 5CZXD 5DJ0B 5FB8A 3SGKA 4U6VL 2AJSH 4WV1B 3NZ8B 5IM7B 2EDTA 5JXED 4C4KT 4YIQA 4BYHA 3OAYK 3NGBC 3GMOB 3MV8E 3EHBC 4B7IA 5I1AA 3EYFA 4J8RA 3MNVB 3RWJA 2YC1B 5EUOA 2IG2H 3F5WB 5FO9A 4HPYH 3LPWA 4G42B 3V95A 5EBMA 3VFOA 5KSAC 2BZDA 3HCVA 2H8PB 2IBZY 4LSTL 2X1WL 2EDEA 4ZNCD 3CFCL 4P46D 5E8EA 3TZVD 3UBXB 4LIQH 1J12A 1T2XA 3OR6A 3WUWG 2VDQH 1TENA 5E8EB 1B0RA 3P77A 4PLKD 4WEBL 3CSYA 2CJUL 4XC1H 3ILPB 1ZWIB 3BKYH 3RIFK 1MPAH 4MMZC 3K80A 4OUUB 1DQMH 1LWRA 1QD0A 3V8CA 3HMXH 4ACPA 4ALAL 1EUUA 4XCNA 1NJ9A 1XCQB 2WBJA 5T1LB 4GG6A 3GJEA 4DJMA 4U6YB 4A6YL 4Z77B 4XP1L 1JWSB 1KN4H 1V8HA 1MCFA 4YIQB 3VFTA 2E9WA 3OJDA 4NZJA 3MRKA 2VL5A 3TO4D 5HVHB 5L2KD 4HFWB 3HLAB 1IAIL 2BSRA 5DDHA 4OFIA 3QHFL 3O45B 4Z0BH 2PYEB 1N5YH 2A6JA 1UVQB 1FNEA 2VZOA 3HG1D 3G6DH 5E6IC 1QFUL 2X09A 4F37F 2XZZA 3I6GA 4JLRA 2BNUA 2I26N 4XP4L 2BY1A 3QUZB 4WDIB 5DMGC 3UYRH 4TQEL 4KROD 2C4XA 2D0HA 3AROA 3LKRA 1CE1H 3DUSA 1DANU 4M02A 5E8PB 5HHNB 4PY8J 2FIKB 3DUSB 3MRPB 1EHLL 4PJEB 4PJ7A 1NFIB 4UQ2A 5E6IB 1IARB 2O61B 4XNZC 3H9SA 3WL9A 4LPXA 1RMFL 2WUCH 4EN3A 1FG2B 3G04A 4HUUB 1ZT7B 1GC1H 5E5MA 4HIXL 4XP5H 5INCA 3T09A 2D7PA 4P4KD 2VLJB 3DARA 1YMMD 5HYQB 3C2SA 5EZOL 5J3HC 1D5MB 3BW9B 2H9GA 2WIIB 4RWHA 1JPFA 1U3HD 4PJXA 1MFAH 3VXRB 2PO6C 2YUVA 1F13A 2MCPL 3R8QA 5AZ2H 5C07D 4P2OD 4ZAKD 2APFA 1X44A 3OX8B 4F58H 4EKXA 1IM3B 3U7WL 3O8XC 2R1WB 4KDVA 4KRPD 1NQBA 3LS5L 2DIAA 3DROA 3MV9B 5DD1H 3WE6B 3EJJX 4JFHE 3OPZL 2QADB 3F58L 1A3LL 1DE4B 1OGTA 4LFHD 3HLAA 1MWAA 2X4OA 3PHQA 3HTLX 3SE4C 5I19L 4Y4HD 1RUPL 3MBEC 3MACH 4RNRA 2VLKB 3LS4L 4JHAH 2V5MA 2SEBA 3ARXA 3LDBB 2C1PA 5EBWB 2ZUWA 3DI3B 5C0AA 3QEQA 1QBAA 3CLEL 4LHJB 2VDMH 3DV6B 1U93B 5I1CL 4JY5H 3LN4B 3MLSH 1A14H 3RI5F 2R2EA 1OP5K 2Q3AA 4PJDA 4NSKA 3AVEA 2PCPB 3MV7A 1IAII 4JG1L 4MA1B 3U0WH 5JW3H 3E8UH 3ZO0A 3VXQA 2C26A 2FD6H 3LKSA 4F80A 3CU1A 5C1MB 5L2KB 3NABL 2F8XC 2GTZA 3TC9A 1JRHL 1D5ZB 2H2PD 4UU9A 2VSCA 4BFIA 2HVKA 4DOHB 4HKBB 1FL5A 1I4FB 3TNMA 4J3XA 4IRSD 5L0QB 4XGZB 3O8XA 1J8HB 3MNZA 3TT3H 4BZ1L 3KPMA 4PJXF 2NY4D 1X3DA 3KLHD 3KLAA 1N0LA 4QTHA 5HSFA 1Y18A 2Q8AH 3OB8A 2R4RH 3GUTA 2HRPL 3BGMA 1CL7H 2MWCA 3O2DH 4KZDH 4N0CD 3K8LA 2XKNA 2OL3L 4JPIB 4DAGH 4KV5E 2A9MH 1AD9B 3SY0B 2A9NH 1KCVH 2VQTA 5CP7A 4CKVX 1U8OB 3HPJA 2HFEA 3MLZL 4Z8FL 2X89D 1IQWH 1MEXH 2DTML 4RA3A 5ACMA 1GYAA 1DBAL 2R23B 1CZ8H 1HDMA 5AWNL 4YEFA 5K33A 4U1KA 2FX7H 2WP3O 1UKSA 4S1QH 4HS8L 4GRWF 1X9QA 1AJ7L 1I3GH 1FC2D 3P0YH 4ODHL 3RVTC 4DFHA 3SGJC 4DTGL 4BH8B 3HG1B 5IQ7L 4BFIB 1A4KA 2FSEA 2DMBA 3NCYP 1T6WA 3VXQB 3TO2B 5E56A 5I1LB 4E41D 3MZTA 4D0BB 5I30L 1N64L 4M7KH 4HFUL 3C5ZB 5FHBL 1QR4A 1T83C 1EJ6A 5HTSA 3P4OA 4IDLA 1I3RA 1PSKL 3DO7A 4U6XA 4MXQC 4OZIE 1AHWA 1XF5B 3O2VL 4JHWH 4PJIA 1RMFH 2WUCL 4LLVB 4YHML 4RZCB 1D5IH 3NCCB 1OF2B 4U0RC 4V2BA 3HAEG 5E8DH 2AJZA 3SDDA 1ZA6A 5E2WH 2B2XL 4I48A 3HC4H 5C08B 3RWFA 2ICEB 1YMMB 2JJTA 1A6TA 1AD9A 2ZUXA 4HIHA 5D1ZB 5CWSB 2BOBB 3TZVA 2B0SH 3MCKB 1A6VL 4P48A 4M8QA 2WWKO 2PR4H 5IT2H 1WTLA 3SDCD 4FQQA 3VGAB 4G80B 4IMLA 3RVWC 2YZ8A 4EUPG 4ELKA 4G7YH 3TVMC 5I1DA 5DJYB 5IW6A 5LQBL 4QXGL 4S1SH 4JDZA 1BBJB 5J8OA 2D7TL 4OGXH 5D72H 2A38A 1LEKB 3GO1H 3PDDA 3H7BA 3F7QA 3DRQB 4XWGL 3MA7A 2ZUYA 1VKXB 4HEME 4AYFA 3LPFA 2R9HD 1HXMA 4JANB 4MA7H 4X4ZA 1UXWA 5D6CA 5HHPB 3TO4A 1Q72H 2BNRE 3H9HB 4P23D 4PV8A 3SJVD 5BZDB 3B3IA 3QXAB 4KZEH 1YY8A 2OBGA 3ZE0E 1UYWL 3HN3A 4FFYL 3CGTA 5IMLB 4ZUVB 1U3JA 3D3VB 1HSBA 1JJUA 1S5HB 2OJZH 3DBXA 4MVBC 4YHLH 4JY5L 3QG6A 4L8CB 1JZ6A 1DVFA 3FQWA 4X6EB 4PR5B 4LARL 1IVLA 1KBGH 4RCAA 5HGGS 5A2IH 4OUUA 1XF2B 3BT2L 1NAMB 1E0OB 4X80L 2DKMA 2LU3A 4JRYE 4KQ3L 4D9LL 4AEIL 2HJKA 4X6BA 5ALBH 4UDTA 4BQ6A 3IF1B 4J7RA 5DHYA 5IWLC 2Y5TB 2Y36H 3GSNL 2F74B 1G6RB 4CU8A 2XTLA 5DZOA 1F3JA 4XWOC 1R3KB 1ZEAH 2ZUQC 2ICWB 4G8FA 4P4KA 1G7HB 3IXTB 4RAHA 1A7OH 4P5TB 4LU5H 3SKNB 5GRUH 3SDAC 1KN2H 2W59A 1BBJA 3RGVC 3L5HA 2GJ6A 1LO2H 5F97E 5DURD 1BQLL 5TQ0L 1C12A 4L3CB 5IROC 3ZE2F 1U91A 5IVXF 5I18L 2B1AL 2XI9A 1RZFH 1C5BL 1JWUB 1QFOA 1DBKH 3G6AA 4LVHC 3VXPB 1IKNC 4WI5A 3IDGA 3W11C 2XRAH 1NUNB 4HK0B 4AH2B 4M6MH 4CJ0A 3BFOA 1BD2B 2H41A 2Q8BL 3WFBH 1V7NH 3DHMA 3PIQB 5DRWA 3BIKB 1A3RL 1T0NA 3MJ8A 4XMKL 1FZJA 3OAZH 1JZ2A 2FSEB 1R24A 1G9ML 1TPXB 2CGRL 4APQB 1N5AB 1T5XA 2JJSA 3ARGD 3SKOA 4D8PA 2FO1A 1MHCA 4ZS6C 4WTWA 2AK4B 4D8PB 5GSRA 1ZT7A 3Q6GL 4FXKB 2R2BB 1MQKL 3AS0A 2EIZB 4Y4HA 4X98B 4DCQA 4JRYA 1FNHA 4KI5F 2NZ9C 1JTTA 2P8LB 3WSQH 4PP2B 1NUGA 4EIZC 3EJZD 4LGPB 2QQNH 3MLUH 3BD3A 4M7KL 1CFSA 4JB9H 4MJ5A 3HB3C 4AL8L 3LQAC 5HJ3B 5ITFA 1VB9A 2NY3C 3KPSA 2VZSA 1B9ZA 3BZ4B 3SGDH 1WICA 2ZOLB 3BMVA 2BVPA 4MZ2A 3TA3B 1XGUB 4PJFB 1ZVYA 5HGDB 3O3EA 2IC2A 1DE4A 2KBGA 5LWYL 3BZFB 1NMCC 5EOQH 3MODH 5DD0H 4AIXA 2VDQL 4XVUC 4F33B 1LK2B 3PWUB 4S1RH 2A77H 4TNWF 4HXBL 4JQVC 4U1SA 4O51A 3RAJH 4XMPL 4R4FH 4F7TB 2Q7YA 3CSPA 1CGUA 3L3HB 2X7LB 4HXAL 4I2XA 1J87A 5JNYA 5D5MB 3B9EA 5D1QD 4OCSH 2PNDA 2EIDA 1S7SA 1BIHA 4LRIA 2OTWB 3HS0B 4RGNE 4F2MA 5CINL 2PCPA 3DYOA 3QUKA 4N0UE 1RK1B 3LH2L 5HDOA 4L8CA 4N0YL 3T3PE 5C2BL 4KVNL 1X4XA 1G7QB 1MFDL 3WIIL 3JSSA 4RA0C 3EZJB 3O6KH 4X6BB 3C6LC 3VI3F 3WJJA 3IRPX 3GEWB 4LCCC 3DRTA 5ID1B 2DWEB 4M62H 3QEGL 3SPVB 4MA8L 3L7EB 4TULH 3GMPB 4MJ2A 3MLXH 3EYFB 4PGDB 1INEL 4DUWA 3PDOB 3RHWK 4PJGA 4P5MA 3TBTB 2AAVA 1G9NH 2JF1A 2WWMD 2J12B 4XP4H 4Y5XA 1EAPA 1QQDA 4N1CA 4FQXC 1AY1H 5AEAA 1D9KA 2E9BA 2PKDA 4XNUH 5DZLA 1QPPA 5E99L 2DYPA 5C08E 4QRQB 3GKWH 3O3DA 1U9KA 1T1YA 4DVBA 3C6LA 4HPOH 1VCAA 3P11H 1JMZA 1KIRA 4NO2B 4Z7WB 1WBZA 3T3MF 3CDCA 1LEIB 2DJ4A 1VSCA 2C5DC 3W5NA 4U7KA 3MRCB 4CNIA 4NRYA 4RAUB 3S37L 2X4QB 4X6CE 5GGTL 1FG9C 1W8OA 3FFCB 1O7SA 1AO7D 1I9EA 4NQCB 3Q6FB 2QV2A 3I3EA 2J6EH 1LQSR 3VD9A 3SDCA 4GLRI 3Q1SL 5IKCA 3VXUD 1DLFL 4UTBH 3LOWA 3V5DB 1P2CB 4JQXA 3QIBD 4MD4A 4RBPH 2AKRB 2CDEA 1IAKA 1LO4H 4QNPF 4LRIC 1X7QB 3GSXA 5HDLA