5JNRA

Crystal structure of human low molecular weight protein tyrosine phosphatase (lmptp) type a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
154
structure length
154
Chain Sequence
b'ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
molecule tags Hydrolase
source organism Homo sapiens
publication title Diabetes reversal by inhibition of the low-molecular-weight tyrosine phosphatase.
pubmed doi rcsb
total genus 63
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jnrA00
4Q6BA 1BA2A 3OO0A 1LJUA 1GCAA 5JNUA 3RVNA 5JNWA 1BVHA 1SD5A 4ML3A 5DGCA 1TMYA 3CNBA 3NNSA 2VUHB 3HEBA 2WWVD 1ZH2A 3DBIA 4RZSA 1A2OA 5GQSA 5IEBA 1EWKA 2MYPA 1D1PA 4S05A 1DBWA 1YS7A 3TMYA 2PUAA 3GWGA 1YK0A 3M9WA 1H9CA 5HSGA 2JVIA 4MGEA 2CHFA 4JAVC 4LDZA 3CFYA 3M6MD 1PEYA 4DN6A 1NXPA 3LKBA 3C6QA 1LBIA 2PE5A 5HM6A 3EULA 3QLVA 3DGFC 3MYYA 4W5TA 4NCAA 3RVSA 4Y9TA 1JFVA 4ETNA 3RVJA 2MSKA 4TLLB 1KGSA 5JNRA 5CNIA 5HQJA 3KG2A 2FEKA 3K9CA 3QLTA 3T95A 4RU1A 4MQEA 4KQ9A 1NXSA 1DBPA 3TB6A 1FFGA 3H5WA 2MYUA 2HQRA 2DRIA 1Z15A 3RVPA 4NICA 1JDNA 3BRQA 5T7BA 3OMWA 4WWHA 1KRWA 3GL9A 3CHYA 1LBHA 1Z2DA 3HSYA 3IP6A 3M9XA 1ABFA 1JL3A 2FVYA 2VK2A 5CHYA 4YLEA 5KQPA 5BRAA 1QP7A 5EWLA 5CNMA 2FQXA 3UUGA 1P6QA 5C5EA 5JNTA 1D2AA 1Z12A 2CD7A 3LUCA 3IPCA 2JBAA 4IMIB 3ILHA 3EQ2A 5CNKA 5TPZA 2FKAA 4XASA 3GV0A 3O1IC 4MRMA 1YS6A 3OLYA 5TQ2A 1ZGGA 3RVKA 3C3WA 1RXIA 2RDMA 1P2FA 3EODA 2QW1A 3EQZA 2IDMA 1MIHA 3LKVA 2JVKA 1A0OA 2X7XA 5C5CA 1M2EA 1QO0A 4MS3B 1K66A 3FMVA 4LDAA 1Z17A 3IP5A 5D2CA 8ABPA 1RXEA 2A9RA 1TLFA 3P9YA 3R0JA 3F6PA 2OQRA 1D5WA 2R4QA 1NATA 1PEAA 2PKXA 3A0UA 1VPWA 3KLOA 3L6UA 4OTZA 1JX6A 4PICA 4Q6WA 4WXMA 3H5IA 3SAJA 3UKJA 5KQLA 4MPTA 3I09A 3Q7TA 1QP0A 3LFTA 2QZJA 3LUGA 3IP9A 1ZHHA 4LRQA 4N41A 3SY8A 3JS5A 3K4HA 1GUBA 2FMFA 2IPAB 1YVUA 4PZ0A 3EGCA 5TQ0B 1Z26A 2PUDA 1F4VA 3I45A 3O2SB 1RNLA 1Z13A 4EYQA 5IEJA 4IMJB 2JVJA 2L17A 3DLBA 2KYRA 4YV7A 3C3MA 5TQ0A 4Z4EA 4YWHA 3F73A 1PHRA 3Q41A 1Z16A 3EAFA 4ZJPA 5KQMA 4NCBA 1MB3A 2VUIB 1AB5A 2A9OA 3BILA 2AYXA 3H1GA 4LE2A 4EUKA 3HS3A 4RK0A 5FBKA 3CS3A 2FMHA 4JA2A 4E7PA 4RK6A 2H3HA 1YTUA 1DCKA 4HNSA 4XXHA 4RSMA 1TVMA 2FQYA 4RXMA 2GI4A 3GA5A 4KFCA 5IBQA 4LX8A 4MR8B 3HZHA 1CHNA 1KMIY 4KMRA 2HJ9A 3VNBA 2PL9A 4OLAA 3OM0A 3UK0A 4W5NA 1EWVA 2GX6A 5E3JA 2IYNA 3C3KA 3T6KA 3RQIA 4RK4A 6CHYA 4XAQA 3GRCA 3RH0A 2JRLA 4XLTA 1EHCA 2PUBA 3BBLA 4DQDA 4EYKA 1GUDA 5F64A 4EYGA 4QYMA 4MR9B 1EAYA 5B3JC 3T8YA 3SQNA 2LP4Y 1E6MA 2QXYA 1W9HA 1USIA 3OQNA 3HCWA 5FBHA 2ZAYA 4Z4FA 3OM1A 4MR9A 1LK0A 1T34A 4FE7A 4JB0A 1APBA 3FFXA 5HKOA 2M1ZA 2R25B 1XHEA 4D6XA 5BQ3A 4FE4A 4G0MA 3A0RB 1U2PA 2BGGA 1Z18A 3KS9A 1SXHA 2JCGA 2F8TA 2ZWMA 1JF8A 1JDPA 5IUNC 4H60A 4G0OA 2LUOA 1ZDMA 5EWJA 2RGYA 4RWEA 1U8TA 2E4VA 2VYCA 2XDYA 3ROTA 3C97A 2J48A 5I4CA 4MLDA 2QU7A 3FFTA 4G97A 1JBEA 4O1HA 5FWYB 3JPYA 3F7NA 1NTRA 1Y1LA 3IPAA 1BDJA 3HUTA 4EGSA 1D1QA 3JVIA 1VLZA 2RJNA 4Z0NA 3S99A 2A9PA 1AB6A 1ZN2A 2L2QA 2FLKA 4LE0A 4RY9A 2Q5CA 4Z99A 3FFWA 3TX6A 3LOPA 4MS4B 1DRKA 2OENG 1ZH4A 1NY5A 2B1JA 5FWXA 3LUAA 3NNDA 4OATA 4G0ZA 4KVFA 2YHAA 1FFWA 4RK7A 4EVQA 3LUDA 4B09A 1ZGZA 4W5RA 2JB9A 4G0QA 3CLKA 3HXMA 5TPWB 1SXIA 2HQOA 3Q7SA 2R47A 1ZESA 3TO5A 4N0QA 5CNJA 4RKQA 4KK3A 5EWMA 1FSPA 1ISSA 5TPZD 3CRNA 2FN8A 2I6FA 1XHFA 2IPNA 3HVRA 3O75A 4IGAA 3Q15C 3OQMA 3IP7A 2V0NA 3LUFA 3E61A 3MM4A 1C4WA 1E2BA 2H0AA 5EWJB 4ETMA 2FSPA 3KLNA 3GBPA 2JBAB 4IRXA 3KKEA 1EWTA 4WT7A 4FB4A 4QYWA 1DCMA 1GLGA 1YMVA 3MF4A 4KV7A 5EWLB 3OLVA 1RZRA 2QSJA 5TQ2B 4HNRA 3FGZA 2A9QA 3RVQA 2QV0A 2R48A 1JLKA 1M2FA 5KWSA 3KCNA 3KJXA 1I3CA 1VRVA 4ETIA 5DTEA 3QELA 2WRZA 1XWWA 4Q7EA 1SXGA 2NZVG 2LBPA 4EVSA 3H5VA 1YIOA 1E6LA 1U04A 1DRJA 1U0SY 1RPJA 3CTPA 5KQGA 3QELB 3G85A 4CBVA 2IPLA 2ID9A 4RKRA 4YCSA 4RK1A 4HYEA 3JPWA 2NZUG 3KYJB 1ZAYA 3HO1A 4KPYA 3RVRA 3HUUA 3D8UA 3I5AA 3RVLA 2YHBA 4KK4A 1USKA 5FWYA 1DG9A 4F06A 1CYEA 1JFTA 2E4WA 1QO0D 3OLZA 4UHJA 1L5ZA 4WUTA 3ROFA 2TMYA 4RXTA 3OQOA 1OXKB 3HJFA 3N75A 1TJYA 4PEVA 3VNAA 9ABPA 1OXBB 1D4ZA 3LMKA 3HV2A 1URPA 3W9SA 4N47A 4OBBA 1NXWA 2FQWA 3HK2A 2MYNA 1KRXA 4UHKA 4RS3A 4MS1A 2FXIA 3N8IA 3NHMA 2P4UA 3LTEA 5TQJA 4JASB 3T38A 2GWRA 3URMA 3LUHA 3DZDA 3HDGA 4PE5B 3GT7A 4KQCA 5JNVA 4O5AA 3ILYA 3QEMA 1A04A 4IILA 4Z4CA 2ID7A 2MSLA 2HSGA 3Q7RA 4F12A 5DCLA 4RXUA 1ZITA 2IOYA 4S04A 2PUCA 1NXTA 3H5TA 4RY8A 4NQRA 3MMNA 2QVCA 1L5YA 2PAFA 4F3TA 3DLHA 3LUJA 3SG0A 1Z25A 2RJOA 2MYTA 1WETA 2CWDA 3E3MA 3CZ5A 1ABEA 3L49A 2M98A 4E7OA 3O1JC 1BDIA 4XFKA 3QLUC 2L19A 5IULC 5JS1A 2WJAA 3SM9A 3G1WA 2WB4A 4YGXB 4ZPJA 4MR7B 4W5OA 3NHZA 4TLMB 1JHZA 2N9UA 4RY0A 1YMUA 3QLVC 1QPZA 1ZVVA 4QICA 4RDCA 3RVOA 1DZ3A 7ABPA 3QK7A 3QEKA 4MR7A 1W25A 4MQFA 4Z4IA 2NT3A 3FDFA 3N0WA 4D74A 4YRZA 5ABPA 1RZRD 4Z9BA 3IDOA 4MS1B 4RK5A 4ZYLA 4YO7A 1J56A 4HNQA 2IPMA 4ZMRA 4GPAA 2FEPA 2FN9A 1QKKA 4JOQA 1P8AA 3MIZA 4G0XA 4L4UA 5KI6A 2LIVA 1PNRA 3O1HB 4TMYA 1DP4A 1QP4A 1SRRA 5FWXB 3EJWA 2FLWA 4PYRA 2E4ZA 2QVGA 1JFSA 5BR1A 3N6VA 2CHEA 4D6YA 5B3JA 4G86A 4L85A 4G0PA 1NXVA 5DLEA 2AYZA 4QPJC 5TE9A 4JP1A 4DADA 5GOTA 4O1IA 3MA0A 3GBVA 2HQBA 1NXXA 4G0YA 3H5LA 4LZLA 4M88A 1USGA 2B4AA 2QR3A 2IKSA 5TPWA 1DC7A 1FQWA 2JK1A 5PNTA 5DKFA 4N0PA 1R8JA 3CKMA 3H1FA 1PUXA 4TN5A 3O74A 3HM9A 3QX9A 3EDCA 3MQ4A 1JYFA 3BRSA 3F6CA 5EWMB 3JVDA 4MS3A 2F8SA 6ABPA 2PUGA 3TD9A 1DBQA 2NUBA 4KZKA 2PLNA 3H1EA 3O2QB 3OLWA 4MQFB 2MSWA 2WY2D 4H3HB 1EFAA 3KHTA 4Z4GA 4H3KB 2FTKE 3QEMB 4P98A 1C0EA 4WXEA 1PNTA 2WMYA 1VKRA 1QQAA 1B00A 3CG4A 1P6UA 3I42A 4F11A 3N53A 1F51E 1DC8A 1YK1A 1IIBA 3CU5A 3Q9SA 4LE1A 4RV5A 4YS6A 1QMPA 3A3KA 5ED4A 4YR7A 2PJUA 1NXOA 2PUFA 2PUEA 3JY6A 4N03A 4EVRA 2GKGA 4XARA 2LPMA 1MB0A 1K68A 3B2NA 3H6GA 5KC8A 1DJMA 2E4YA 1M5UA 2GBPA 3O21A 4EYOA 2O20A 1BAPA 4W5QA 4GNRA 1JYEA 4IF4A 4NV3A 1JH9A 5KC9A 3N0RA 3DGEC 3NBMA 3QLUA 4Z9AA 3H75A 1HEYA 1FFSA 3SNKA 1M5TA 2PL1A 4MQEB 3LUKA 2FMKA 4JB2A 5JS2A 5IUJC 3OMXA 4F8JA 3HDVA 4KRFA 3A10A 4KREA 4MR8A 3H6HA 2NT4A 3JTEA 1JWLA 5IUKC 5IX8A 2HPHA 5BRJA 3H5OA 1UDRA 1ISRA 3GYBA 4KNYA 1S8NA 2P9HA 3N0XA 4YP9A 4OG2A 4Z4HA 2FEWB 1Z2EA 3CZCA 4P1ZA 3OLXA 2E4UA 4MLCA 1E6KA 1QNLA 1ZY2A 1LJLA 3O2JA 1MAVA 1U2QA 3KYIB 4MRMB 5IC5A 4MYRA 1TM2A 4MAAA 3QX8A 1GCGA 4OLBA 4MS4A 2PMCA 4ZMSA 1BDHA 3CG0A 2FMIA 4EY3A 3NNNA 1CEYA 4WZZA 1MVOA 3KSMA 3KTOA 3BREA 2E4XA 2L18A 2WJWA 5JNSA 4N76A 1DCFA 1QQBA 2FW0A 3OO1A 2W42A 5T3YA 3D02A 3RVMA
chains in the Genus database with same CATH superfamily
4DLTA 2I9KA 4Y7CA 4B4UA 2PCLA 4D41A 3C8UA 3VYWA 1TT5A 3HTXA 3AB7A 5B37A 1T24A 1AV6A 4H7PA 2GYVA 3IXMA 1M1NA 2UUBB 1ECFA 5BT9A 4YVFA 2NNLD 1OA0A 1YVPA 3OJEA 4N5IX 2QT0A 1TZCA 1EJ0A 3F6YA 1F8GA 3V4FA 3RWOA 3F6EX 1ORDA 1JPNA 1Y33E 3ZHSA 1VIYA 4BNXA 3FMIA 3GLUA 4FFLA 1WAMA 3JQ8A 5GQSA 1C1YA 1QG0A 3K9WA 2YUIA 3F6SA 4GLOA 1P0PA 3BCUA 5ENVA 3TUIC 2EWWA 4S05A 3OE4A 4TS4A 1R0CA 3A9SA 4YRIA 1J06A 3NTUA 4JYMA 3LQRA 5M7EA 2YMMA 4AF8A 1XZMA 2XEDA 4JL6A 4WESB 2BGIA 1XAJA 3WLNA 1PEYA 2VHCA 3O03A 3ZDEA 1YFZA 4DJJA 1NXPA 1TA9A 4X66B 3TXXA 3KE9A 3ZE9A 1LD3A 3G82C 3KQQA 5AVZA 3VH1A 2F1OA 2NW6A 1HQYE 2IP4A 2Y0DA 3E1SA 3X0DA 1LPOA 2AFVA 3EW7A 5JECA 2H54A 2FW1A 4Q1FA 5HQJA 3IIMA 3IBYA 4ASUD 1DTWA 2C2ZA 3Q3HA 1PG2A 5JAMA 4RU1A 4C6TB 1F9AA 1THTA 1Z35A 2QP9X 1XKLA 4ZANA 3ZHTA 1GHTA 1CEQA 3NHBA 4MKGA 2J0SA 5A03A 2DULA 1CVRA 5F33A 1NVUQ 2AFRA 3OPQA 2K4MA 1E4OA 4WWHA 3PXGA 4DV1B 2ZTVA 1W4ZA 1ZA2A 2XVZA 1I7SB 1NDQA 4WI1A 4Q1AA 2DUMA 3ZJUA 2CK3D 3AUUA 4PG6A 4GYJA 4QOJA 5TJ9A 5BRAA 1N8TA 2GPAA 2O7SA 1IPEA 1C1DA 3A9TA 3ANNA 4K88A 5CNMA 2YHIB 3ICVA 2PGJA 1BIFA 4PC2A 3ILHA 4B17A 1NULA 3DEAA 3QMPA 1CQIA 1KZ7B 2OBXA 3ZIUA 2WUGA 1QQTA 1YS6A 3H9JA 1TIKA 5CEEA 2VT2A 5LQSA 4UDYX 3USZA 3TLEA 2GA9A 3KOZA 3L18A 5CFPA 1LXCA 1YB6A 3B12A 3EGXA 3C45A 5JCXA 3HDQA 1NOIA 2BZSA 3OQJA 1E59A 4OCZA 2ZIUB 1TLFA 3BGSA 1SKBA 3PVSA 3ZW8A 5FAKA 3MS2A 4BNWA 3MJRA 1PEAA 1PZMA 3FYUA 3BEDA 3KLOA 3LDFA 2VSOA 4N3GA 3UKJA 1XMSA 2Y1GA 1KDPA 1T5IA 2I62A 1TKAA 2GTHA 4HUTA 4DSZA 4ZZ3A 5KQLA 3KQKA 4M8IA 2UKDA 2WU0A 1S1CA 1VDMA 4P5EA 2JD1A 4CHTA 1NVBA 3NV9A 3FVWA 1RQRA 4O59O 4AQDA 5BN3A 4JJFA 1YDMA 2OM2A 2G9ZA 3EGCA 3SR4A 4JN6B 2CNWA 4CNBA 1QP8A 3SOZA 4KZPA 1JDJA 3FJ1A 3SIXA 1PJ2A 4IIJA 2EU8A 1WMDA 4LXHA 3SNHA 5JISA 2AI1A 1TNDA 3O3MB 4QJ3A 1GPDG 4ODIA 4JGBA 4YWHA 1ULZA 2GXQA 4WLEA 3D3WB 5I3CA 1N6RA 3AVVA 4NJMA 2YQ5A 2WF5A 4FHCA 3MWKA 4TWIA 4Y2PA 4UNRA 3L40A 1LJ8A 2VUIB 3Q7IA 4WBNB 1GSHA 3GA0A 2R6FA 4YUWA 3PDWA 2FMHA 4WEOA 1A9PA 4CLRB 5JDIC 2BRUA 5LWHA 2ISSD 1PFKA 5ICMA 5AQEA 3AJDA 1SPXA 2JAWA 1KBZA 3NM6B 3P71T 4QPPA 4OI0A 3BHIA 4TQAA 2Y76A 3QV1A 1JHXA 5BOVA 4RXMA 1ZR2A 1H8EA 2RHMA 1KMIY 1PJ8A 4YROA 2RK3A 3GLRA 4UQOA 3SR0A 3ZLTA 4C4YA 4XUDA 2C29D 3DWGA 4GBGA 5H4GA 1Z8NA 5LYYA 1RRVA 4M4SA 3K53A 4Y2UA 3OOYA 1J1UA 4N1AA 2ORWA 4YDHB 5SZIA 4JJKA 5EUCA 1JIJA 9LDBA 1BXKA 3TAUA 1N34B 1EZ4A 4W8OA 1WF6A 2AL7A 5E6UA 1UPXA 4NPAA 5KPDA 3RU7A 1Q91A 1U0HC 1XZBA 2MR6A 3DEYX 4M60A 3WQBA 3T5AA 4XWWA 4AY6A 5EN4A 1YHNA 3CCBA 4DIDA 5I7UA 1ZEMA 1KK2A 3T41A 2ZIEA 1R5OA 1XHEA 2BBWA 2WIJA 3G0IA 4G0MA 4GEGA 1TK9A 4OYLA 5ECYA 1WVIA 2JCGA 1M75A 2XD4A 4Y2VA 1ESEA 1S3SA 5AI6A 4XJSA 2DR0A 3NASA 3MMPA 5FLXA 1D8TA 1FSSA 2XTAA 5JJLA 5EWJA 4HXYA 2G88A 5HQTA 2WLTA 1MFPA 2ZQ5A 2I6TA 2X14A 4F71A 2QZPA 4YAKA 2NUPB 1L8OA 3ETGA 1HKHA 4G5FA 5FPPA 5C8YF 4L5YA 1A98A 3E22B 5LDGA 2PZBA 1ZI9A 2GCGA 2RJNA 1GFIA 3PQ2A 4JC5A 2A9PA 3JVEA 1RBYA 1REQB 1TAQA 2FWMX 4KQJA 4FMCB 5FORA 1Z7GA 4MP6A 5BSWA 2EGUA 4N5LA 1Z8DA 5AKJA 1N6LA 3ZQ4A 3RIEA 3AL2A 3GFOA 3IQDB 1V9CA 1SB9A 5AK5A 1JR3A 1YAHA 2GH1A 5DHFA 4LQLA 2OILA 2NVOA 4AXXA 5FLKA 4CV3A 2B34A 3H2IA 1LLFA 2IV7A 5BWLA 3OT1A 1JALA 3L3BA 3KSZO 4C5BA 1UOPA 2IELA 3D4PA 4LRWA 1JFLA 1Q1ZA 3N0TA 4PYIA 4BCDA 1OZHA 3LW8A 3M2PA 1QZUA 4G0QA 3HP7A 4RLSA 5TPWB 3Q7SA 2YVKA 3NRBA 7REQA 2BR3A 5MN5A 3I9FA 1T9AA 2W8ZA 1OT5A 2AJCA 1FUYB 2SCUA 3E7FA 3L6EA 1U7XA 3NHYA 4UBNA 3KJHA 5AVQA 3GEGA 4LZJA 4B87A 3D7NA 5EWMA 3ABIA 1AKTA 3IB3A 3FCCA 1TEVA 3QE2A 4G0VA 3CKKA 3E7XA 5F77A 2Y1XA 1LDMA 1SVKA 2SICE 1AHPA 1ONNA 2AVNA 3GMSA 4MWCA 4NPCA 1H0RA 3I28A 3ZQ6A 4EHLA 2J08A 1GWNA 2B8NA 4Z8XA 5K3BA 3EIXA 4Q24A 1IRXA 1D0SA 4JI0B 1E2BA 3FYHA 4YRBA 3D81A 3EPJA 1H94A 1Z0AA 4KN8A 2XGGA 4MV5A 1COZA 4TGLA 4E5KA 1BX3A 1MGPA 2XVYA 5I01A 1GNPA 1DC4A 1RZRA 2VK8A 4G5OA 3TLZA 1SVNA 3OQIB 3HBMA 3OTOB 3RS3A 4GOOD 1TJNA 4EVIA 3NMUF 5FO0A 1I3CA 2O23A 3I05A 1IVNA 1V2GA 1HQCA 2RGCA 1F1BA 2V96A 2EBFX 1UL1X 5LPNA 3FPSA 2VCYA 2NU6A 3L7AA 3E7DA 1MC1A 3LBFA 4DLAA 4YB8A 1D1SA 1FFYA 1SC9A 2XI4A 2FW7A 4TM8A 1F2VA 5JHHB 2DF8A 3KB1A 1A27A 1QC5A 3GPLA 2ZZMA 3G0HA 2O54A 1SZDA 2I03A 4PSAA 1T2NA 1IEWA 4YCSA 1G8PA 3JPWA 1Q0LA 5BVHA 1YIAA 1ATZA 3EMKA 2WJ3A 1QAOA 3G8YA 3NGLA 2IHUA 4MV9A 4PG5A 4X63A 4LYDA 1R6UA 3ZZUA 3HCEA 2EHJA 4KK4A 1USKA 3AJAA 4B7UA 4CF7A 3UHOA 1H2WA 2F2TA 2JLRA 1P39A 1UDBA 3QA3E 5IAEA 1ACLA 4XA8A 4EBFA 1N2GA 2FP3A 3DBHB 5HJ2A 2EQAA 1AQYA 1HRKA 1O6CA 2YRXA 2ZI5A 1NZFA 4R1LA 1JQEA 5AJXA 4ZQBA 2YJ5A 1KOGA 4YJ3A 2E9SA 2C4KA 3OLCX 3HU1A 5B2FA 4EEZA 2X9NA 5JU6A 3WDLA 2C7OA 4FGZA 3ONEA 1U2DA 3I3SR 3DDZX 1SA0B 1YQ9A 2ID4A 3ORQA 1FX1A 3STHA 4KQEA 2IQ5A 5AI5A 4X93A 2Q1TA 5CPFA 4FOLA 3T38A 2ZT6A 1AUOA 4JEUA 4A03A 4JA0A 2FPOA 1U0RA 1PW5A 1VPDA 2OHVA 4DJEC 1QGYA 3W5CA 3AVOA 5EJGA 1XJWA 4QOFA 2MSLA 4H4EA 4ZEWA 1J39A 1MQSA 3DVRX 1IK4A 5CLJA 4RXUA 4NOLA 4F4HA 1T4BA 3IHTA 2JASA 3MMXA 1I6KA 2BE7A 1RCFA 1S02A 4ZOCA 3MMNA 2M6LA 3VR3A 1UC8A 4YBZA 3SG0A 3ZU3A 1Z25A 2GBFA 5KSZA 1UJBA 2RHJA 1T3TA 4CEJA 3EHEA 1TU0A 4UQLA 3TM5A 3WB1A 4W6ZA 3W77A 3K70D 4M1MA 2DUUA 2ZYTX 4M22A 1K8RA 1JQDA 2H6EA 1IOZA 1U2TA 1OA1A 2VJMA 2Z83A 3L7CA 4TLAA 5I7VA 5JADA 1BU8A 2QW0X 2R1UA 4P53A 4JJGA 5JI2E 2QE6A 3SX4A 1HYQA 1RQGA 3OPYB 4EJFA 4JD5A 1HETA 5DT2A 1C1HA 5DNCA 2AA3A 3OUUA 1PL8A 1T0JB 3E27A 2EFEB 4J2OA 4KBGA 5C5IA 5KTSA 1OAOA 2C97A 4TRMA 5AM1A 5HGXA 1QIIA 3CNNA 4R1UA 1KBOA 2O7VA 5BRNA 1FXSA 3EFOB 4PXAA 3U17A 2WFLB 4YRZA 4FFSA 1MKYA 2H4YA 3EZYA 1Y9ZA 5HEKA 3REQA 1FYWA 1M1YA 1X1BA 2EYQA 4JR0A 2M6SA 1RWWA 4XX0A 3KALA 4DILA 4AJHA 4TTJA 1GZDA 4NENB 4OQYA 1IXSB 2JLCA 5A02A 3A1NA 4HDSB 1VL6A 3VR5D 3L1IA 4JB3A 2L42A 1R3UA 2NXEA 1DEAA 2HIAA 3KXIA 1DRWA 3O1HB 4AN0A 3WIDA 3GD7A 4CI9A 5AJYA 5HCUA 4LY0A 4DS3A 2RKBA 1K92A 3AP3A 2VUUA 4FGKA 4LHZA 3UH1A 2GCNA 4LZPA 5EJ4A 4NAUA 3G88A 2W6ZA 4TVBA 1RKQA 2OG2A 3NWBA 1E9BA 1L5FA 2NTYC 2NZXA 4I1PA 2OBMA 1O2DA 3FSRA 4M8SA 4CU5A 3U5TA 4RVUA 4E09A 3C1UA 1XJCA 4HNGA 1O5TA 1W2HA 4HNUA 3WL6A 1Z6PA 4TV8A 4LOAA 1HMYA 4BLTA 1MVNA 5JCJD 2I6SA 1A4RA 4H4CA 1ZZGA 1E8DA 1QZXA 2BW0A 2W6IA 2X1HA 3E7PA 1Z0JA 4H27A 1P2GA 4MS3A 1AZLA 4X94A 3JAWB 3JZMA 5LA6A 6ABPA 5CA1B 3NORA 2WY2D 1Z7BA 4CCYB 1HFJA 2H51A 3U7EB 4FMDB 2IODA 1A5TA 2XCOA 5D7NA 4E88A 4DV4B 1C0EA 2WA2A 3GC6A 3DAHA 4WXEA 1RKXA 5IMBA 1ZAKA 1RD4A 3TRIA 3DV9A 4DHWA 1ZVQA 2YYYA 4AG6A 1J23A 3B52X 2VZ0A 4LBVA 1V1RB 2XKKA 3S7TA 3WRXA 5LOVF 4KFSA 2GFQA 3OIGA 1RIFA 5GZ1A 2D59A 3K5IA 3R0XA 5HE8A 5EZQA 4YR7A 4WZBB 1O94D 1T3GA 2NZJA 1X74A 4ZT2A 2GKGA 1EH5A 5C80A 4MP8A 5KC8A 3BFJA 5KBYA 1BN7A 4YIHA 5HW0A 4O2LA 1LV7A 1M5UA 1OWLA 5CYPA 4Q7QA 4E2YA 4MPPA 5E6SB 3D6AA 2D6FA 1ZNYA 4HMQA 2DCMA 3QFRA 1ZXBA 4IF4A 1HKUA 1YVDA 1GGVA 2X9VA 3LF1A 1Z2PX 1U8UA 2RC5A 4M9RA 1F8YA 2VOEA 4XJVA 3IUPA 2ZZNA 4MKZA 1KXJA 3MPOA 5DM1A 5U1PA 2X1MA 1HR0B 4B3IA 1E20A 1B41A 4DL9A 5JS6A 2ZS7A 2ONZA 4MVJI 1C14A 1JSCA 2C9CA 2Q4BA 5REQA 3NUZA 4ZT6A 1QO7A 1ZS9A 2ZE6A 1KP9A 1RQ7A 1VPLA 3DL2A 3KVOA 1HYHA 5F76A 3HBJA 1P9RA 3PYLA 3RS9A 4EATA 2DETA 2COUA 3OE1A 1EDZA 2ZYWX 4QGFA 3S4YA 3TJZA 4PZLA 3V4VB 2XKBA 3TSYA 4LOLA 2WVAA 2EF0A 2ZRKA 5EIFA 2O1XA 4A6PA 1FP4B 1V2HE 3Q12A 5E3HA 4L6CA 4LSGA 4UDNA 1VHJA 2NAFA 4CM1A 3ETEA 4UJ3A 1FYDA 2AKYA 3LTNC 4KFUA 1W59A 1Z2EA 2J4FA 2ATIA 4PPYA 4OEHA 4K9MA 3KQPA 4U9HS 3BFXA 2BIFA 3QTTA 4YMSA 1GPJA 2G17A 2WD7B 4MLCA 4BFZA 1ZY2A 3KZ1E 3N8DA 4LXGA 4JHXA 4BQSA 3SJCA 3BJIC 3QFCA 3GRUA 3AFGA 4B6JA 1F60A 3DTNA 2J3KA 3QUQA 4MS4A 2VZEA 3M4XA 2IGTA 4YRQA 1VIVA 2OV1A 2AZMA 3STXA 3ZE1B 5BQXA 1BDHA 2EKZA 1K6XA 1RAAA 2WTNA 5CDTA 3BREA 5CX1B 5JALA 1Z68A 4X7PA 4GZLA 1W2WB 1QOQB 2YC4C 4BMDA 1G3RA 5JBNA 1TUBA 1FUIA 1W93A 1Z33A 3VTZA 1QQBA 1FE8A 3WMRA 5KHLB 4A5SA 1GOTA 5GJVC 1A95A 4KL8S 3ZW9A 2YV4A 3ET5A 4WBXC 3VGPA 2ZJ1A 1BA2A 3WMGA 3PXCX 1IY1A 5JLJA 4UUMA 4BNNA 5D6OA 2YL2A 2REXB 3EK2A 1ECJA 5FUMA 1Z6YA 2PPLA 4OAQA 1QH1B 5LQMA 3M83A 5G2OA 1HDOA 2POCA 1X9HA 3SZMA 4NLLA 4H7KA 4OQXA 2C0PA 3ANMA 4RZSA 3O8RA 1R0BA 3MS7A 1GO2A 2RHBA 2QXTA 3BJMA 3W0LB 2G0AA 2VK4A 2ZB4A 1H9CA 4IJQA 1H8HD 4KDRA 4YUYA 4NH4A 3ZEIA 3M1LA 4JAVC 4KQ2A 5F5XA 2P9BA 3W5BA 3KP1A 3DE5X 7AT1A 3JD2A 5LYJF 3D4NA 3LK7A 4C76A 2DY0A 4BVKA 4Z5XA 3L2OB 4OFZA 4RNDB 3K71B 4EHFA 4B85A 3GCDA 4XPIA 5KVCA 4GQAA 2B82A 2MSKA 3G8AA 1SBNE 2HUNA 3JWPA 3REFA 5JNRA 4PXSA 1C30A 5LZ9A 3GRYA 2JLWA 3OKFA 1DJPA 4MPJA 1J42A 2CJYA 3E35A 3FDIA 1XWFA 1FFGA 2JFVA 2M6RA 4X8LA 5ERYA 5MF6A 2O8EB 2XGOA 3U4AA 3ZDXB 3AY6A 3I92A 4ZVTA 2REBA 4G2NA 2AOTA 3OMWA 4H16A 4YO8A 3HCNA 3ZDCA 3GL9A 3QSYA 1W85A 3Q8MA 5DB4A 2Q3HA 3HSYA 1O6BA 3FBWA 5AIBA 4EELA 1G63A 4YP6A 4Q93A 3G2MA 4XLLA 4ZO6A 4PAQA 3VC3A 1QP7A 4D25A 4OKIA 1TW3A 2WR8A 3GQBB 1D2AA 4TROA 3AF1A 3TKYA 3OU2A 4FR0A 4AM8A 5JYEA 4PC6A 1FLDA 1SUBA 3X1XA 5BYBA 2NSHA 1D5CA 3O1IC 8ATCA 1UT6A 1ZGGA 4P32A 5DNWA 3U4MA 2X7XA 3BXGA 2DX7A 4HCJA 5EE9A 3AESB 3G0CA 3GLFE 2H57A 3GNLA 5SY6A 5DNAA 4LDAA 1TGYA 3BZWA 3MJ4A 3ILVA 4V1CA 3RYCB 1DBVO 1JXAA 2QP4A 3MGCA 2PGDA 5EIBD 1CT9A 1FQOA 1YE8A 4PU0A 2VTDA 5WRFA 4R0VA 3RI3A 3JQGA 3S7ZA 4DOMA 3O31A 4L5CA 3UC9A 1K75A 3H5IA 3SAJA 1PD0A 3VUEA 1Q7GA 1WXGA 3B38A 3FCEA 4B3BA 2ZANA 3BN3A 2Y0PA 2VH5R 4KBFA 4R5HA 2HLDD 1T1GA 3AV0B 4IXDA 2ATCA 4DDTA 4L16A 1RYMA 1TEXA 3BXOA 4OFBA 5CPBA 3HJUA 5HDBB 4J6FA 4P0PB 3L4BA 2IPAB 4NVRA 1C3JA 4XGQA 4E30A 5FTLA 5K4HA 2AXPA 1KORA 2EXXA 4XB1A 5LP6B 2BKLA 4IMJB 1NC3A 1XDUA 3EN0A 3UFXA 4G63A 3ZV4A 3DMGA 5HF6A 2X9LA 1ZBDA 5TQ0A 1QJCA 2IS6A 1FMFA 4FUTA 1DAMA 3CH6A 1DBIA 4O4JA 1AZWA 1I4DD 1YB7A 2ZJ4A 2RGBA 3LHIA 4D9NA 4JUBA 1B0ZA 1ZD1A 3IMGA 3QVGA 3MJCA 4LYAA 3SQOA 1NYQA 5GGXA 4EOGA 3D6HA 3ZDFA 1YSCA 4FMDF 3SEZA 1S01A 4NFYA 2FZGA 4NMMA 3UAVA 4RGBA 2D1YA 4DG8A 4HNSA 4XXHA 4MO2A 3T7SA 1SCKA 4GD3Q 2VXCA 4C5AA 5IBQA 1V5WA 2IYYA 3IAEA 4MR8B 5KNCD 2FWRA 1N3IA 3G79A 2GR9A 2GX6A 5E3JA 3S44A 1ND6A 1KY4A 4ZEMA 2FMXA 1OI7A 2BFWA 2EQ5A 1E1QA 1U8YA 1EHCA 3IA7A 1JR6A 1S5PA 3ENZA 1QV6A 4JYBA 2ZIZA 5FUXA 3R6LA 2VQEB 2YDYA 2H5EA 4R6WA 5BQ5A 1EAYA 1PR1A 1WZEA 4RVGA 5ALHA 3JQQA 3V80A 1N5RA 4CMGA 5JWOA 1QYIA 1EX1A 3FZQA 3OURA 2JA1A 1QK5A 2GAAA 3OM1A 3IBFA 2RHLA 4GMXA 4RC9A 1AQIA 1DZIA 2MU1A 2ZI4A 3FHCB 4PPNA 4PGHA 1G8JA 3P9PA 5EAIA 2CVHA 5IAJA 4WXRA 4PG8A 2HMWA 2NXCA 4HI0E 3CWQA 1U7HA 3D8NA 2BGGA 1E2DA 3CMCO 5K0BA 1X7GA 1CDEA 2ADOA 3KT6A 3NAMA 3HU5A 5BSHA 1FYFA 5C34B 1Z38A 2XCSB 1Q20A 1VFPA 3J81k 2DPMA 2QTCA 2GESA 2BOVA 1QF9A 4MP3A 3D5TA 1M9NA 3M33A 4RZ2A 1QTIA 3JW8A 2GETA 1CV2A 2OUKA 2JKYA 3KBBA 3FRIA 4N7MA 1NAHA 3B1FA 3HUTA 4MCAA 3D8HA 1F06A 2GQ0A 1KU0A 5HRAA 1KZGB 3E5RA 4QYIB 4MVJG 3RWBA 4QE3A 4PQRA 4BO5A 1UBRS 4H1HA 4TV9B 5DCUA 3W2FA 1I5RA 3FNIA 3MWLA 1XSEA 1AK2A 1ZH4A 1FP1D 3LZ6A 1TAUA 2WP0A 3CT6A 1XTRA 1ZGBA 3E48A 3OX1A 6ADHA 3ONDA 2I6UA 3NNDA 2DPHA 5GJCA 2YOGA 4FYHA 2SECE 1Z7WA 3KKNA 1U98A 1BS2A 5ALXA 4EAAA 5KCMA 2XE8A 2KHZA 1N5OX 2W6CX 3IAUA 5TGTA 3WDMA 2YMQA 3QU4A 2H4HA 3PU6A 4FW9A 1G6HA 1G7RA 5A4KA 1XTJA 3DB2A 4HUQA 5AP9A 2ZREA 3TE6A 3W6ZA 2I4NA 1BRTA 1B0AA 2R6AA 1EUQA 3GQVA 3O8CA 1QU3A 2QTWB 1FSPA 4DYVA 1GA6A 4NULA 1XCMA 4MB0A 1BYIA 4H18A 1PJTA 1QDLB 2PMFA 3HJTA 2HV8A 5ECDA 3IEUA 4IGAA 5ALLA 5KNBA 1H3EA 3FMFA 1F6BA 3FKJA 3LUFA 4JXZA 1F2UB 3JWGA 1R64A 4TS9A 2DKOA 2B83A 1ISGA 2C4NA 5CDHA 2HRRA 2JBAB 5C51B 1DHTA 1DCMA 3DQZA 2IU0A 3THYB 3MF4A 3V2UA 3F49S 2I1LA 3ZHRA 1E2JA 5AESA 4FQ7A 3AHIA 1PLJA 2EYUA 1LF0A 1BRMA 3IDZA 3KSRA 2QRVA 1KVUA 2FAXA 4ZKDA 4PRYA 4HTAA 1Y7HA 2CXNA 2QX4A 3BFKA 4BNMA 1LKZA 5DXJA 3FWKA 1NUHA 1XDWA 2VJOA 3KELA 3W4KA 1W4CA 5M3BA 1EEXB 3ILSA 1JILA 1E6WA 3PCXA 4GPBA 4J8PA 4JT8A 2P1ZA 4OKNA 4Q4DA 5DOZA 4RNCA 3STVA 1F2TA 4F9FA 1YOBA 4AROA 2XQFA 2P2CA 5AJHA 2BKXA 3H2BA 4NP6A 2R97A 4BNYA 3UB2A 3RG2A 1PJZA 2J7KA 4Q9HA 1Z2AA 2QLNA 2RGGA 4KV9A 4RK1A 1V0JA 2VWPA 1I6WA 3AFNA 3KAJA 3AF5A 4DREA 5HUHA 2JIDA 4P83A 2OBNA 4PINA 3RRFA 4N3CA 4QBGB 4C6RA 4RULA 3CN7A 5B64A 1FPMA 2OP0A 5CFNA 5GM1A 3RRXA 4P3XA 3KNZA 3G9QA 1ZNXA 1UBCA 2KQUA 3ESCA 1WTAA 4IO0A 3WB0A 4LZAA 4WUTA 5IMSA 1QSGA 2D2VA 3H16A 1FTWA 1UMKA 4KDEA 4L50A 4ZTBA 4N18A 4QQNA 4QAJA 1UKEA 3HV2A 1SCDA 3SHWA 5BWBA 1Y6GA 2OXEA 4NBKA 1RFGE 2HC9A 2DHCA 3C3AA 3JVVA 1CRQA 4OBBA 4A9AA 4PYJA 5BV2P 5JIBA 3QP9A 1P1JA 4CIWA 4BOYA 1MX3A 3V7NA 2P4UA 3LWNA 3NDBB 2GCIA 2CY0A 3QHQA 1LSOA 4YC7A 1E89A 3B6KA 2PX0A 1AKEA 1ZSNA 3KJFA 3OT4A 3MOSA 3COSA 5AVSA 1VMIA 4JVMA 5AYVA 1LW7A 1UQRA 3A32A 3VKVA 3BEOA 2PUCA 4QXRA 3H5TA 5IZ4A 1P7ZA 2QVCA 4HMPA 1K7CA 2BPOA 1MW8X 4YMLA 1LI7A 5FEUA 5GIOE 4HGQA 5FTMA 1YOVB 2QRJA 5KTMA 1WQ4A 1PVOA 1KMMA 1MA3A 1UFRA 2FZLA 2H4JA 2IW1A 1TMKA 2TMGA 1ECCA 2VSQA 4L5IA 1U8XX 4R51A 1RHMA 1QYCA 2QE7D 3WO1A 1CUZA 3HZOA 2EGGA 2GYUA 4KDCA 3O2NA 4TLMB 3RODA 4JT9A 1E9AA 2JCVA 4QBHA 2IDZA 4RHCA 1EGQA 3UXEA 2A0KA 1NE7A 1TTPB 4UXIA 5LLDA 3CO5A 1E98A 1MABB 3GUUA 4LC9A 4PONA 2XWQA 4A8JB 3PNSA 3RS4A 4EBBA 3KQVA 3VOSA 3TZKA 4D74A 1YZYA 3FLEA 1E63A 3QYPA 5EVJA 1VJ0A 1PR4A 4DIEA 3T4EA 4EI7A 4KUHA 1KP2A 1GZ6A 4GH5A 1CRWG 1EVQA 3AWIA 1U9CA 2ABWA 3PJDA 2R7NA 1EXNA 2VQ6A 4XVHA 3U31A 2O0LA 5CH3A 3IBGA 2IPXA 4L4UA 5KI6A 4P0QB 1B23P 2RMKA 1SO8A 1JR3E 4JS0A 4DV5B 4P35A 3K70B 1ZCBA 3HSKA 1QYRA 2UZ1B 4PBRA 2P8SA 3EJWA 3FKQA 4CQJA 1FS4A 1NNI1 2P6UA 1Q50A 3L1JA 1C7RA 5K8LA 1JFSA 1ZM7A 2YTZA 4LMAA 1WULS 3DBOB 2QRUA 1AUPA 3LPNA 1GQOA 2PSHA 2XCQA 4IZOA 1JYSA 3W9YA 3BXEA 3NYIA 2AYZA 3M0EA 5JCOA 4D4MA 2Y1FA 2LRHA 5HZKA 2BGKA 4H77A 4U9IS 2KS6A 2IUEA 1YDWA 1ZONA 2LNDA 3KL2A 3WGIA 3EEQA 3R3WA 1PEKE 1USGA 4DSUA 1RJEA 2QTRA 1KZ6A 1NHGA 3FPAA 3FTQA 4K86A 5TPWA 4DT1A 7REQB 2JAOA 1NPTO 1HH4A 1NZDA 1PE0A 4OHZA 1NPYA 3HM9A 3FUTA 3ZDQA 1WPXA 3WLSA 1VJ1A 5IM4A 2A9KA 3HJNA 3VR4A 3BRWD 5JRZA 5EWMB 1YA6A 4KXWA 4DCCA 1JVSA 4AUKA 1U2ZA 3AFIA 3Q1KA 1CB0A 1KZ9A 3E15A 4N5HX 2SHKA 4JSYA 2ZWIA 2ZUTA 4ERNA 1E69A 4H3KB 4M9QA 4D80A 2WNIA 4NCHA 4P2BA 2PA3A 1CE8A 1T5SA 2VPTA 2ZBEA 1B00A 2FSSA 4QNNA 3TK1A 4YCCA 3AGPA 4ZO7A 5A4JA 5ITZB 3ID6C 3LC0A 2Q7DA 4OXXA 1ANKA 1ZL2A 2XAAA 4WK2B 3I4LA 1YJBA 4YDRA 4ZO9A 3PPVA 2VZ8A 1KMHB 5CVTA 4L3OA 3KOOA 3ENNA 1AO0A 4C22A 3EPLA 3BB3A 4Y9DA 4DR4B 3RFCA 2O3SA 1NKTA 5CBKA 4F2GA 3SI7A 1HE5A 1KZ1A 1Y7IA 3PNVA 3GJ6A 1H85A 3NR2A 3SYNA 3FCAA 3LPDA 2NU6B 1EFVA 3VH3A 2CMKA 4BB9A 3IJ5A 1P2TA 3CZ4A 4M36A 3TZBA 2GPJA 2PX8A 2OHHA 4BP9A 1UPUA 5FNZA 2HWWA 4D6PA 5ULLA 2W2XA 4IDCA 1E3SA 2ZBQA 3LBIA 5LIPA 3QTBA 1Z6QA 2E1RA 4IL5A 2FN7A 3CF2A 3HCRA 4BZWA 3A6PC 4OVKA 3GF4A 1QH0A 3B5IA 5ALRA 2QUBA 3HO6A 3CW9A 3RJZA 3LKDA 1NUPA 4G85A 2RAFA 2IEBA 4IS2A 4XYMA 3TIIA 4B7ZA 1Z88A 5I7SA 3T3OA 1SIBE 1ZUNB 3CW2A 4NX2A 1UXJA 1UF9A 4TKUB 4UHCA 1J0DA 4HLNA 3OWXA 2J3IA 4KPUB 1WHTA 1R10A 4XJTA 5AKYA 2PQMA 5SV2A 2PSFA 4M1WA 5ECGC 1UP7A 1ST3A 4QUAA 1NVEA 1I1QB 4CF3A 5IUKC 1U31A 5IX8A 4F8YA 1JTVA 1RPNA 3JWEA 5AI4A 4YJ3B 1I0ZA 4OG2A 4JU8A 5CURA 2XYGA 1WZNA 1GDHA 3BMCB 3VR0A 4AZ0A 1TMGE 4YMTA 2BEUA 1J20A 2LR0A 3IQEA 3GDHA 5BORA 4L5AA 2TSYB 4H1TA 3T1HB 4TKMA 3DLIA 3UJ9A 3BF8A 1XA3A 4RJTA 2P1RA 2Z30A 4B47A 2Z8ZA 3S29A 2VWQA 1XI2A 2J32A 1GGEA 1RJDA 1IDN1 5AIAA 3RUIA 2VDOB 3WZLA 3O47A 1FF9A 2Q41A 1SXJD 1P5RA 1MNQA 2JEOA 1O3YA 1LI4A 1UKVY 1WXHA 3E5MA 5D8DA 1V6SA 1IJFA 2Z2JA 5C31A 1NQVA 2CDAA 1B2RA 2PTHA 3F1KA 4P82A 3OFVA 1FP6A 2Q6TA 4UKDA 2FUG6 3K0HA 5FWDA 3QVJA 5BOSA 1I4TD 2BFAA 3D64A 4G09A 3QI7A 3VDRA 5E4JA 4KX5A 1OB5A 1MX9A 4RDIA 4ZPXA 3JWHA 1U9JA 2J3MA 2PD3A 5L7TA 1MW9X 5DGCA 4DKXA 4KBYA 2YWXA 3QM1A 1IJEA 1YS2X 1XQ6A 1X8XA 4Y1EA 1BKYA 5ALNA 3KKPA 2V7WA 1NR7A 5GOZA 1ZM9A 3DPSA 5DLQC 3B9QA 5FTKA 4EO7A 4ZTZB 1A2OA 1OGIA 3UMFA 4DANA 1OPRA 4ZYXA 5JTUA 2RIPA 4X00A 2B98A 5ERGB 3U3KA 1OAKA 4RTSA 2OV3A 4CQMA 2A58A 4FU0A 4IQ4A 4CMEC 5JTTA 5LVAA 1M8FA 2FX2A 2IEZA 4BUCA 1AS2A 2QN6A 2AFIA 5HM8A 1R6AA 2DHEA 3PRKE 1RRFA 3ZCVA 5BXYA 1XYVA 3PDHA 2UZ3A 2ZCJA 3W3AD 3UK1A 4MUYA 4DN6A 3VNRA 5EE1A 3C6QA 1O7JA 5B4UA 3JASB 5HM6A 5K0CA 1U99A 3P8ZA 3REQB 3I6ZA 2W8BB 4KH1A 2NZ8A 1LFAA 4MMZB 4WNCA 4XM0A 4TKVA 2C20A 4HNAA 4GT1A 3ZIAD 2AN1A 4AYTA 2YC2C 2C5GA 3KG2A 1TIPA 1NPDA 2Z0MA 4IOKA 5CGQB 4BGVA 4CL3A 4XI9A 3RROA 7GPBA 5GMOA 1YZNA 2WT4A 1JTFA 3DLPX 3SYTA 2FPXA 3TI7A 2WUDA 3MWGA 4ZJUA 1ML4A 1KKMA 3RV3A 4P4GA 3KTDA 5D3ZA 1OBCA 5CB0A 1YQEA 1PJCA 4I4LA 2NYUA 1U02A 2Z1MA 2F17A 1M7GA 3K20A 3N2YA 3GROA 4FOTA 4P7JA 1HQDA 3IP6A 1QR2A 2AOUA 5EJ5A 2FVYA 2HFJA 1I4WA 1UIMA 3NYRA 4Y1RB 3RT7A 1N33B 1SY7A 4E4YA 1OFIA 3DOFA 3ETJA 1U2GA 1RMQA 4WZAE 4Q15A 1F8FA 4IMIB 5K0NA 4URZR 3FWYA 1D0VA 1XVUA 1QFMA 3TCXB 4D4JA 1XLUA 3H86A 4I19A 3EQZA 3JR7A 3ZWWA 3DAYA 3V8QA 2Y2VA 4Q19A 1Z4JA 2EFCB 4BVFA 1I0IA 3G6KA 4MS3B 3ICWA 1LRLA 2XQIA 2OC9A 1RLOA 4L8FA 1RZ3A 2VDWA 2WF9A 2X58A 2YJ6A 1C4KA 2BCJQ 4AZ3A 2OQRA 1D5WA 2FUG1 3JQFA 2R4QA 3P2YA 4PFQA 4WCFC 1EDEA 3UQYS 2IITA 1ESCA 1DQRA 3OIFA 3ZVLA 4MMYB 4Y6SA 2NU8A 1JX6A 1KJQA 9GPBA 1ZGJA 2GPYA 2H1SA 1G38A 4TRRA 3I4FA 3LX6A 3HPQA 3OI7A 2H5IA 3W8EA 3BTUA 4FCWA 1AM4D 1D7OA 2OD9A 4QUGA 2VP5A 1EINA 4O4LF 4XD7D 4UU1A 3R7SA 4CMIA 1KWKA 3Q0TA 1CX9B 1LUAA 3MWEA 1YCDA 2AHRA 3FG9A 2NMVA 1YS9A 5J2UB 2WTAA 3B1KA 1U4SA 2PUDA 2NTVA 5ALIA 1RNLA 1T9DA 5B12A 3ZWNA 1ZW1A 4DMCA 5CGZA 2G83A 1PZNA 5KSPA 3C6YA 5G0VA 4UREA 2NQTA 1ZLYA 1ODCA 3DEKA 4NE9A 1FB5A 3W8RA 1W0KD 1WXFA 4Y9SA 3X2FA 3PX3A 1Y5IA 1O95A 1C8LA 3EAFA 1J8YF 3QU9A 1Q11A 1JIXA 1RMTA 3DCJA 3BILA 3HKEB 1E3TA 4PYQA 1NI4A 3VHXB 5DGTA 4JKIA 3SZ3A 4ERXA 3EXEA 2H8KA 2Q3MA 2W71A 2WSIA 3CS3A 2AUNA 2RBEA 4B3FX 1UMCB 4WZAB 2P0AA 3CPJB 3T94A 5ILQA 1YKSA 1DCKA 3EWNA 1RC1A 1GRQA 1HQKA 2G9QA 2MTBA 3PSAA 4KUEA 5A4IS 5JT1A 4KFCA 5H3HA 4Y6PA 2B78A 4BN0A 5KREA 2AG5A 4EHKA 4BYMA 4HGYA 3RHSA 3PDCA 5JAIA 2D4AA 4GOXA 4OB8A 3KBOA 4DCOA 4LJ9A 1YI8A 1HTWA 1MVLA 2QMZA 2EW8A 2E89A 3AHJA 4LXTA 2NTJA 2WK1A 4NYIR 1PGNA 4B0OA 1R12A 1W7AA 2VR1A 3ST7A 3WYAA 3KHKA 3H9QA 3KXDA 2PBLA 4BMYA 4MR9B 2IF2A 1RU3A 3B6EA 4BO6A 3L1HA 3BXFA 3PL1A 1SU7A 1E6MA 2FK8A 4O1MA 2EFGA 5D86A 4KX3A 2B92A 1QH9A 1Q57A 1XX6A 3I72A 3CLSD 3PWZA 1TLTA 3GCWA 2VAVA 3HNPA 3RS0A 1U3GA 2H2DA 1ODFA 4EQZA 1JVBA 3MSCA 1QCCA 4S1WA 3TRJA 3FHOA 1G8YA 4DV3B 1UKBA 2WB2A 2GN1A 4JJ6A 5H02A 3H9GA 3AEQB 1FJHA 1X1CA 4LNUA 4N40A 3RSZA 4DAOA 3AF6A 5B57C 2FRVA 2WU3A 3L6DA 3D1LA 1X7WB 3OIDA 1Z2NX 2IOFA 3AU8A 4ARIA 1WCIA 5LBIA 3GLIB 2O2DA 2P6NA 2XRMA 4MI1A 5JE8A 5I4IA 1ULHA 1QH1A 2CYBA 4FHZA 2I2WA 2F62A 2R96A 3JCZA 1X13A 8MHTA 4WNAA 2IFTA 4J7AA 3FLBA 1VLZA 1AA9A 1Y1PA 5JW6A 3O4IA 2DLDA 5COQA 1DPGA 1ZN2A 3KB6A 1JEOA 3EMBA 3VU9A 4RGQA 5BNFA 4OFWA 4RY9A 5JD6A 5BV8A 3DUFB 4C78A 4IDOA 2ZJ5A 3RIHA 4B3DA 5KTOA 4NZOA 1DWPA 3G2KA 4C7OB 2MSEB 5FWXA 1SCNE 1QPGA 1B6RA 2C99A 2JIZD 1U9IA 3AM4A 3BD8A 2X7HA 3INRA 3KQMA 2Q1SA 3PUWA 5ELLA 5GINE 1ZUWA 1Y34E 3BAZA 4GWGA 3WA6A 5G0TA 3WC4A 1ZD2P 4BATA 4NJOA 2PLWA 1KR5A 3DB1A 4KO2S 4ZAFA 3PBKA 1Q7BA 2O2YA 4REOA 4HAWA 4S35A 3BIJA 3D7SA 4Q4CA 2R47A 4IDGA 1LX7A 2WMDA 1O8BA 4LV8B 2COKA 1T36B 2CLLB 3R3YA 4I4CA 4UCQA 3TD6A 1R9NA 3C5WP 4KB5A 4PYNA 4JCOA 5K8UA 3MUEA 1RAGA 4BS9A 4F60A 3ER8A 3M6UA 3Q3CA 5JZSA 4GF5A 3THXB 3O75A 3K0SA 1UPCA 2V0NA 3IQZA 3ZY4A 4GE3A 1HZZC 5IS2A 2P0YA 3E9RA 5FLYA 4H15A 2AEJA 3AFHA 4S1OA 1XA4A 2W58A 4HLDA 3KKEA 3EQ6A 3AILA 4HR7A 1XTTA 4ZOAA 3CEPB 4ANFA 2WDPA 5HDQA 2GEBA 2QMQA 3OLVA 4DCVA 5TQ2B 3RHZA 3MJEA 4S1VA 1I5OA 4QUDA 3RVQA 2O0KA 2R48A 3GRPA 1DKQA 3H7IA 4LZWA 3KCNA 4MRVA 5AW4A 3JQPA 4V2UA 2FP4B 2BDTA 3LS2A 1IOLA 1GP2A 2P2YA 5JROA 4HH3C 1SUWA 1XQXA 4ZIRB 4N0DA 1K8YB 4DA8A 3IX7A 4HLUA 1NW8A 3D9QX 4R7TA 4UVDA 2R7MA 4EVSA 1WUHS 3HN2A 3OOHA 4I99A 4HXEB 1OC4A 4BNJA 5LMNB 5IHPA 4MV0A 2JCSA 1XQ9A 4PFKA 1BEUB 4MA4A 2Q45A 5BNWA 3I73A 4KLZA 4MAFA 2QPAA 2ZUWA 1BROA 5BQOA 3RT9A 2F7SA 1NY6A 1C81A 4W7SA 1CUXA 4HYEA 2PGLA 1SZCA 4DZRA 3AUKA 3G9ZA 2RKWA 3CNOA 3HUUA 4LJSA 5EIAA 5HX7A 3SP1A 2CD9A 2JG3A 1UADA 3M6WA 2V6IA 4ZWNA 1V1JA 2XYPA 1MEEA 3IEKA 3IURA 4IIJF 5AK3A 3NIDB 1V1MA 2NYAA 2NZ2A 4BGIA 2NN3C 2ZRCA 4J3NA 5LQAA 4ITRC 4BKQA 3OESA 1Q21A 1HFWA 3GMDA 2TMDA 2TMYA 4YQFA 2ONYA 2W4QA 4KGDA 3HJFA 4EQ6B 4MQ6A 1HYBA 1XRNA 3N75A 1V7QA 4KODA 5IM4F 1VL2A 5G0UA 2C04A 4YTEA 1NN0A 1L7QA 2G9VA 5A5VA 2I71A 4BB5A 1OT3A 1G42A 3AM5A 2HA7A 4N65A 2QAGA 2BMDA 2FXIA 3WR5A 4E6EA 2IIVA 3UJ3X 4XLZA 1M54A 1RAHA 4HQLA 4PIPA 3I2HA 1V4BA 2CUZA 5KDLA 4F91B 3LZDA 3K5WA 1AY0A 4O8ZA 2JGNA 3L0CA 1VE3A 5LLSA 3U3OA 2CBGA 3SZLA 1WUIS 3CEHA 1Q74A 3AQIA 4PANA 1NMXA 4Q0MA 4RYDA 1RHUA 2C61A 2GHTA 1VHLA 1U2GC 4IJWA 1A04A 4PLPA 4YP5A 2VAWA 1WZIA 1NF2A 4FN5A 1F9EA 5I6DA 1ISMA 3HGTA 2WF8A 3CZMA 4RDHA 2ZRNA 3FROA 1XPOA 4WA8A 5CRIA 5AJTA 4J4BA 3B1ZA 3JSXA 1L5NA 4XZ3A 2A3NA 1V11B 2FWAA 1QF7A 2I67A 4IWYA 3GT3A 2EBHX 2H9AA 2OORC 2NU9A 3HA7A 4JJ7A 4IDHA 1CFZA 1ZN7A 3F5DA 2Y4NA 1Q7EA 4AYXA 3BPSA 4NECA 2A5YB 3MLAA 4HX2A 2L19A 4J0KA 4YMWA 3ZGYA 4F1JA 2WJAA 3G1WA 4NL4H 2IV2X 1U3FA 2VBIA 2V55B 4AN4A 4W5OA 4PLVA 1P33A 2CXPA 2OCYC 2UVPB 3WIUA 2OLKA 3IMFA 3WNVA 1L7XA 2E4AA 2OBLA 2OBYA 2OTCA 4B5KA 1NONA 2GHRA 4CEIA 1PFUA 4LEIA 1DZ3A 4X24A 3N70A 3GJYA 4HFRA 1JHVA 1TI7A 4LPSA 2MINA 3N3AC 3P2OA 1SG9A 2LE0A 3FDFA 3OEED 4KR9A 1RZRD 4CM4B 1BOOA 3I04A 5SYAA 2JLXA 3LFUA 1HDCA 1T3ZA 4YJ2B 4DQKA 1NE2A 3EX7C 3EFEA 1N78A 1WCV1 2NGRA 3O4RA 3QX7A 2D1QA 2KM1A 2FX5A 1SR8A 4JWTA 4TN1A 3ZC3A 3NHKA 2X77A 3Q8WA 2ZJ8A 1FRQA 3LYAA 1I1NA 2HSWA 2O3JA 3C1OA 4CKWB 4HAOA 1WCYA 2YOFA 4LHXA 1UMBA 2EP5A 2D1TA 1GNVA 2OZKA 3NGXA 3CLUC 1QR6A 1SVSA 521PA 2ST1A 2VT3A 1SVIA 3KVVA 4INPA 4B31A 4O4IF 5KDOA 3HUDA 4ND3A 1E7MA 4NS4A 4P31A 2NIPA 3AOEA 4BAZA 1PGPA 2DY1A 1NVTA 2IU3A 2JNWA 1M6VB 4JC8A 2JD0A 4KNWA 2WAYA 5DOVA 5TQ0B 1KMQA 3D7MA 3A9WA 1ICIA 4YT5A 1P5ZB 4Q66C 3FA2A 3L0ZA 1DLIA 4LQ4A 1RRCA 4IHQA 3OJFA 3KYCA 1M34B 5FB3A 1PRYA 3S1LA 1EB8A 4UEKA 1T9GS 2VPXA 2F1KA 4Y9UA 2BLLA 3HXPA 3UWDA 4OYYA 4Z1MA 2AI3A 3SSNA 2NOAA 2NSYA 4TS1A 3W1WA 3VYVA 3BDIA 2C4VA 5KYGA 3HBFA 2IS2A 2ZSUA 4LF4B 4WK4B 5G4KA 3V1MA 4B35A 2PYZA 4D42A 3QEMB 4Z4GA 1U6JA 2CDBA 2A30A 4JBGA 1GTMA 4RLQA 5HZMA 1PZGA 3NPAA 3OA2A 4CMJA 4A23A 4KYTA 2ZRGA 3EZFA 2CC2A 2IEAA 4LISA 4OF4A 4UDXX 4G0UA 5D01A 2Z3WA 2ZGVA 1RAFA 3SKVA 3C6BA 2RI0A 3UV7A 1YK1A 4Z1MD 1BCSB 3ESQA 5DM70 1F4PA 2VJQA 3FNGA 3VYUB 2XADA 3P1JA 1FCJA 4RA9A 4AIIA 2ZYVX 3CE6A 2NVBA 1GG9A 2XB8A 1C3OA 4KXYA 4QLBA 2FPLA 4PLGA 1K68A 4OHCA 4JYCA 4A4DA 5L4SA 4QOGA 1PQYA 3IUMA 3L1UA 3AMVA 4YNBA 4KACA 5KMGB 2GBPA 3L8CA 4BO3A 5DASA 2QM8A 2IU6A 5D5PA 4C0WA 5AM3A 1IBMB 1UWLA 5F3DA 4XWGA 2OVBA 5FCDA 3RIXA 1ONPA 5BYKA 1UFQA 1VB5A 2XSZD 5EHGA 5ICFA 3U4HA 4RAQA 4BNLA 4N39A 3UUFA 2Z4RA 1P3DA 3NBMA 4OBEA 4PSCA 3W2GA 4G23A 3ZWDA 1JKJB 4OK6A 2BMVA 2UDPA 3W6PA 3U4IA 1WUYA 1J2JA 4QU9A 1E1MA 5KTTA 3UUWA 5DYGA 4DV0B 3JYNA 1TQ4A 2UVDA 1N3BA 3VGJA 4JH0A 4BYGA 9LDTA 5IN4A 4X45A 2OORA 1UDCA 4I1VA 2ZS8A 1OV4A 5A7FA 4G9EA 1D8AA 4Z6KA 4KREA 4XYGA 1Z39A 2QJOA 1KQOA 2Y9PB 3K4PA 5CU7A 4ZOBA 1TUGA 4X1IB 3H5OA 3OQPA 3PICA 3WIOA 4D0SA 3NYQA 4MMXB 3UMRA 5HBRA 4KNYA 1B8NA 13PKA 4YP9A 3LBHA 1ZK1A 4TYQA 1EG2A 1RPZA 1U5BA 1U1CA 4QGHA 1Q6ZA 2IYLD 3DMNA 4PLTA 5MN6A 1MJFA 3U7QB 5K4GA 1IQ0A 1RHQA 2E2WA 1DQNA 4JL5A 4CTJA 4V0MA 4BQFA 4OLBA 1QHFA 3VPHA 5FI0B 5B7NA 5ALGA 5JH7A 2B2NA 4AMUA 4RZHA 1Z07A 1NQUA 2VRWA 1DFHA 2Y77A 1FTSA 1Z0UA 3BGWA 3TLKA 4ABYA 1KR2A 4N76A 3CH4B 4D8TA 3LP5A 4PCAA 3PKIA 3SHFA 4UTVA 4Q3AA 5HCNA 4HQRA 5LU9A 1XCPA 5LMCA 2BFEA 4HT3B 5D1HA 4C3ZA 4FYPA 4H3VA 3C4JA 1T13A 1KJIA 4CTKA 1R9GA 3NOVA 1WNTA 3UICA 1KEZA 3PD1A 4FS3A 2Q6VA 3A14A 2VHEA 3B5JA 4OOFA 3KUXA 4RDXA 1BMQA 2G06A 4Y2SA 2AJ8A 2ZBFA 2W98A 3JQ7B 3DYBA 4JBIA 2H0RA 1TC2A 2PL3A 1V7PC 1AA6A 2P40A 1FRVA 1KI1A 5KU1A 4B6QA 5IWAB 3CUTA 1K86A 1ZRNA 4IDNA 4PQYA 1V37A 1LC3A 1T3LA 5ANRB 5F1OA 3TMYA 1Q0UA 4EKNB 3FM9A 1MABA 2GEFA 4G5QA 3PFWO 5HSGA 5C53B 4LYGA 3YASA 5SZJA 3E2IA 1M2GA 5AVUA 1I1OA 1C9JA 1N2IA 3FSJX 4KMOA 3V6MA 4P4NA 3EULA 2ADMA 4J49A 3DGFC 4PLCA 1V45E 4DA4A 1XZDA 4ID3A 1J2YA 2A78A 1DL5A 2IZ5A 2LCIA 2ZSJA 3ESYA 3KWFA 4HATA 1VKZA 4RTQA 2JLZA 2I29A 4H6WA 2VF2A 3CPEA 2CNBA 4G8CA 2X4GA 3ZE2B 4DDUA 2JJQA 2V7PA 4RJLA 2G5PA 3WLJA 2X6TA 1KE2A 1HDZA 3AF4A 4MQEA 2CL7X 4GHWA 2R751 1HZZA 4MWTA 4DEXA 3PCTA 4D2IA 4PZDA 1KQFA 4Q21A 2DRIA 4ND8B 3RVPA 1QU2A 3R0IA 3IUBA 5C7LO 2ZITA 1QRRA 1TC1A 4BBZA 5LJIA 1PFWA 2IA5A 4ALMA 4L6IA 1G2OA 5DRYA 3W2EA 2JHFA 2ZWPA 2AJLI 4CR6A 1U80A 4A1OA 1A76A 1AOXA 1PUJA 1F8UA 5BSRA 2HM7A 3EZLA 3IPCA 3LXMA 4WFQA 5FX2A 3WA7A 5CX4A 2AE1A 1C5KA 4L8LA 1EUCB 3TQHA 3H13A 2BJHA 3UAGA 3RFUA 5EXPA 2J0UB 3DZBA 2Z5GA 3QWBA 3JQ9A 1FQJA 1AQNA 2R4TA 5AVVA 4X85A 2BKVA 2FUKA 1B26A 2I99A 3C6MA 3D7KA 4R2HA 5DHSA 4D0GA 5D2CA 7ADHA 4MQLA 3I9NA 1F5NA 2QDXA 4LJLA 4ROTA 4TQGA 1K08A 2W5UA 4YPVA 2E55A 5GZ6A 1UKYA 4PICA 5A6SB 2B1QA 3ZTWA 4UFPA 3I2IA 3E03A 4GGPA 1N7JA 1JKIA 3ICQB 2D5CA 4PX9A 2CVPA 1T0HB 1N1DA 1T2EA 5IJXA 4BZZA 3D6UA 3JS5A 5JVDF 4FFVA 4MV8A 2XTMA 3UKOA 1F6DA 2EDAA 1X94A 2QRGA 5FL7D 5CB4A 5DX0A 1WBBA 2C58A 2QTNA 3PR2B 5G3ZA 4AMVA 3TQQA 4UDOA 4Z3KA 1QHGA 3A04A 3GLHB 3IB6A 4JSRA 2H5LA 4Q48A 4NV0A 2F67A 1CUGA 4JUAA 3SXUB 4HAYA 3SJZA 2I4MA 3ZDYB 1SPBS 4OIFA 2EZ8A 3CJRA 1JTEA 1VIMA 4LQDA 1N9GB 4U2KA 5BYAA 4WDRA 3BKXA 4HTFB 1MTOA 5DBFA 2F3UA 5A06A 5JJBA 2QD4A 1KSGA 4R2MA 1AB5A 2A9OA 3D54D 3H1GA 2W6OA 4RANA 2A2ZA 4MICA 3S8MA 3TMKA 4YRKA 4KVGA 4JA2A 2QL5A 3JZAA 2YIDA 5HS6A 4DR2B 2GARA 2PUJA 1NUSA 5CLQA 1B8OA 4RFSA 1WHTB 1UPFA 3H6KA 3EWAA 3MOIA 2XZOA 1J0AA 3DBRA 4IYJA 2H2IA 2GVZC 3RNOA 6REQA 1BTOA 4OMFG 1J21A 3CH7A 4U2BA 1WM1A 4I4TF 5KWIA 4ITVA 1XNRB 1I2DA 1WVMA 4DQDA 1YRYE 2HDNB 1GUDA 3CURA 5I4KA 5CEFA 2J9YB 1J9EA 1BDMA 2Q9AA 1YDEA 3TJRA 3TLYA 4WV3A 1NYLA 3R9XA 2H4XA 3ZIDA 4N0MA 2OSVA 1M1XB 2C57A 4N6NA 4BFCA 3K05A 5ITWA 4MW1A 3ZVMA 1JEYB 3KJZA 4YV0A 1KVRA 4DCNA 3K9GA 4CL2A 4KKXB 3PKJA 2Q8PA 3HKBA 1IQPA 2YY7A 5EQDA 1EFCA 3FDZA 5HKOA 2AEEA 3BB1A 1ADCA 2QLTA 3AKDA 4NJEB 1IBKB 2ZB2A 4IG9A 3ZD9A 1Y6QA 2GEKA 3DFUA 4UUQA 1NVGA 4OBWA 1C4OA 2EJVA 2V3WA 1K98A 4KCGA 3GJZA 3E5NA 3K31A 1TGVA 1ZNQO 4AJ2A 3P20A 4BNZA 2R1VB 1KK0A 2Y8EA 1ZMBA 4A2PA 4FILA 3DULA 1XTQA 3Q9UA 3QPCA 3VR2D 5EJ8A 4HB0A 1XMIA 4QXPA 3OWOA 1WHSB 1MJNA 5HIKA 1BGWA 2Y99A 2G5TA 3FHLA 4Q1DA 1IATA 4CZ2A 5FWAA 4NFSA 5BW5A 3WQSB 1J0EA 3R3XA 3ESBA 2JGDA 1E1QD 4AS3A 2DEUA 1DXYA 1N0WA 1SQFA 4ZQEA 1XCGB 3VR4D 2IYPA 3DS8A 5JO0A 3WZ2A 3UWMA 4EX7A 2CHGA 1KEEA 1OCEA 3IJEB 3VO8A 5HRCA 3B1VA 5EC8A 4YRPA 2WINI 3H9UA 4E1BA 1QH8A 5K2MA 2JGFA 3N7TA 5EZYF 4G0ZA 3LQKA 4FDVA 2WZQA 4KVFA 3NHJA 2FJUA 2GEUA 4NBRA 4W5HA 1QDUA 4UOZA 4AX4A 4KMSA 3ZU2A 4DJTA 2D8MA 1JWBB 3SBEA 1CPYA 4HVLA 4KRXA 3HXMA 2HNKA 4PW0A 3LPLA 4IH4A 1UFOA 4MGIR 1QE3A 4HNAB 2I1VB 1G8AA 4N0QA 2FHPA 1M83A 3GJSA 4UW9A 1YL6A 3BMQA 3WBBA 5KYUA 3T7DA 4KR3A 1JQAA 1XVIA 4PC3A 3Q15C 5K6TA 3CWCA 2QRHA 3WBKA 4EY8A 2VP9A 3KSBC 4NCKA 5AHKA 2QGZA 1UAYA 1NG9A 4ETMA 3R3ZA 4IRXA 2PA0A 3CRVA 4WACA 2Y1CA 3BCHA 4PHTA 3TAHA 2FKNA 4GX0A 4P3PA 4D46A 4EUNA 1KZYC 2XXAA 3OF2A 4UTZA 2VHTA 3FGZA 1JAIA 3A8TA 4DM7A 5KWEA 1U0JA 2HMUA 2XUIA 3AOEC 3SQWA 5C1DA 2ORVA 4KXFB 4PN7A 2ZYUX 4XUEA 2IJGX 5EUQB 1X70A 2GERA 1FFXB 2IXAA 4LHWA 4CR7A 3ENWA 5GADl 1DAPA 3AX6A 2BTOA 3NHPA 1YC5A 4W4TA 2A59A 2PXXA 4K9LA 4G1BA 1KF0A 3AY3A 3NIWA 4LYFA 2O8BB 1LI5A 2ALJA 3CISA 2DMRA 3QELB 2Q9BA 5EGSA 1SK8A 1RXSA 1ZVMA 3A27A 4ZD6A 4OFXA 1JA0A 3TPFA 4YT4A 2AG0A 4GVXA 3B1YA 4A0GA 3NOXA 4BVAA 2QL7A 5ADHA 1LDYA 1TO6A 2HRQA 2ES4A 3HZZA 3RDPA 4EGFA 3JR3A 3I5AA 3RVLA 1V41E 1JNXX 2WUEA 3WKEA 1QO9A 5B1IA 4GG1A 5A2QA 3EUWA 4C2TA 4LGCA 1CETA 3QKWA 5ALVA 5DI3B 1CQXA 2P5SA 1PTKA 1L5ZA 4TSRA 3T4UA 2MDTA 2QMYA 2XQKA 4RADA 4J1SA 2QN8A 1XMPA 2Q5QA 1TJYA 1WXQA 1Z5UA 4LV6A 3MJHA 3KR9A 1YR6A 4F4FA 4DB4A 1Z0KA 3E3LA 3O9MA 4QNRA 1ZMTA 2XR1A 4N47A 3RYTC 4BQEA 2CNOA 3M1AA 1JZQA 2MYNA 4EG7A 2O2CA 4JBHA 3N8HA 3HMQA 3UJNA 1Q92A 4CL8A 2FE4A 2Y0BA 1DUVG 4EG6A 4TS3A 1PGQA 1UMCA 1YUNA 4ECAA 4ZYZA 5LLTA 3T5PA 2WSYB 1OFUA 1WRBA 4UPEA 3AWDA 2DPYA 4MVJF 3ZBUA 3MHTA 1A9XB 4JK3A 3LDHA 4K9SA 3HB5X 3JALA 4FCCA 1Q1EA 5IT9A 1Y98A 4HH4A 2PY6A 3LIIA 1IY9A 4MUIA 4DDVA 2IOYA 4BXOA 1YV9A 3G5UA 5B2ZA 1QXSA 1O96A 2G7MC 2JLBA 2Q1XA 5DYNA 1WPGA 1WP4A 4BNKA 1RWVA 1KEVA 3AETA 3LUJA 1P0FA 5CLGA 4DMMA 3RS8A 1OJ7A 2P3OA 1E3WA 4O8CA 1S2MA 1ZSYA 4BO9A 4XQEA 3FVRA 2JLQA 4HDKB 4XFKA 3HGQA 1O5OA 3GJ7A 5EJIA 3LYUA 1AXRA 4RO0A 1ZQ1A 1XTSA 4YGXB 4KYIB 3HXLA 4KQ1A 3DTVB 5IYZF 3MC1A 1QLJA 4LNAA 4ZJYA 4P7KA 1OLOA 1PDVA 1DUSA 4ME6A 4DCUA 4W82A 3SFTA 2Z1NA 1N3LA 721PA 2NLOA 5JQWA 4MVJH 1LBEA 2FUNB 3DFIA 3WGNA 3SIRA 3DVSX 4MWOA 1KI6A 4EO9A 1CB7A 3M5CA 4C4ZA 5DWDA 3TTWA 5LA6F 4DIKA 1G6OA 3KJGA 2NVUA 3H18A 3OJLA 3R7BA 4BJHB 2DSTA 5CT8A 2ZRMA 3H2JA 2CJWA 1RLTA 2WW8A 4Z9BA 2PX5A 1RE0A 2CF5A 3MINB 4NAVA 1TD9A 3GVCA 3M1YA 4IIHA 1GIAA 1FU7A 2JAXA 1EHYA 1SN7A 2CHVA 4GPAA 2FPGB 4JOQA 1EBFA 2XUQA 3JQCA 4TYPA 5BN5A 2XYQA 4H6XA 4GR5A 4NH0A 3QIAA 4WNAB 5DT9A 3U3RA 1X8LA 1A8IA 5AO9A 2W6JD 4P92A 2C2GA 3PC2A 2Q0SA 3JV7A 4MYSA 2HMSA 1E6CA 2R00A 3NRCA 4PYRA 2C9OA 4ZVNA 4DCGA 3AVWA 1BXZA 3D43A 3RAPR 4BZXA 3KKZA 2BP7B 4MHSA 3IEXA 3GZNA 5EKDA 1NXVA 2C9MA 4MV4A 3UTCA 1EQUA 4WLFA 3R3UA 3FDJA 3MTAA 3UV6A 1UKZA 2G1UA 4O1IA 3C6XA 2FVXA 4YJDA 1PR3A 2AOWA 2HQBA 4PNZA 5IBPA 3ZCTA 4ENTA 5CFOA 1SHZA 3K6SA 2HL6A 3OPYI 1SUFA 5IJ0A 1UWCA 4BNTA 3LT2A 3PEYA 2HSEA 3HHPA 1KDOA 3MCAA 1CY0A 4Q7LA 5JLAA 4EMTA 4OQMA 2HHLA 3V8MA 1PCXA 1XFDA 2B2XA 4HEQA 4QTZA 1XCJA 3QLEA 1CQIB 3BB4A 4PYMA 4K6KA 1Q0HA 4MEAA 1USVA 3PXBA 1V35A 3V5NA 4G81A 1N8NA 3OZVA 4OGFA 1W1WA 1XMJA 3WO0A 3KLPX 4HEJA 1ZD8A 3KUUA 3TB4A 2QROA 5HKKA 3U7JA 1HI9A 1JFFB 2X6QA 5CXUA 5F2KA 1C7FA 3N2EA 3B1JA 1GD1O 4OQNA 1R4ZA 1TYCA 3FYDA 3T99A 3V1NA 2ZVDA 5T4BA 4C4PA 4MW4A 5EMHA 4ALKA 5ED4A 1DAKA 2FP4A 1KVTA 2BM8A 2XNDD 5HKKD 3PGKA 1RVDA 5GV7A 1LF5A 3RSOA 3V4RA 3H6GA 3SR3A 2JGEA 3NHWA 2E4YA 1EHIA 3PLNA 4K6CA 3PUZA 4KWIA 5C4GB 2BTQB 5FYDA 5LD2B 3KEQA 4LY3A 3K2IA 4QULA 1QYXA 5DWVA 3T3PB 2COEA 1PWEA 2GLTA 1VKNA 1CVIA 2BFCB 2TS1A 2WJVA 3NTVA 2O5EA 2J9FA 2QJRA 4EG3A 1T0UA 3N0RA 5DGHA 1I80A 3PPIA 1GUAA 1KO8A 3TOZA 1KAQA 1UBMS 3I2YX 2B20A 3ZHYA 5KYNA 4M0MA 5EERA 5JAHA 3EYAA 3DW3X 1G21B 1V39A 2QF7A 4O2AA 3V9PA 1M66A 4H1UA 3LO5A 1NOKA 1PWXA 1SIWA 2KLBA 2Z1DA 2CXHA 4D56A 3WRXC 2FZKA 1CNMA 3PC6A 1PKEA 4WA7A 1XQ1A 2YQZA 1EQ2A 3PEFA 2QLLA 4V1CI 4YLYA 3AFOA 1QAQA 3INNA 5DYIA 5BRJA 3OTGA 3DCYA 2XBUA 4L78A 2BUBA 4BCBA 4CLXA 1XUOA 3KOWA 2AW3A 5KOHB 3LCVB 2DFKB 2A4KA 2BGJA 1QFJA 4POAA 4BZPA 1EGHA 1N2HA 1E6KA 1FVOA 1QNLA 3O8BA 4H17A 3FVQA 2BEVB 3CJTA 5JXJA 1YIDA 5B30A 3K0FB 1TM2A 1NDUA 2AYYA 2OK7A 3L9WA 4E07A 1BMDA 1YQXA 2PMCA 3L84A 4RA6A 5CT9A 3EGXB 3WTCA 4ZZ0A 2Y1OA 5A4DA 4DDWA 2BELA 5E6UB 1NRWA 2JS7A 3LU1A 1N1GA 5B7PA 2NPOA 3L8MA 1NVWQ 3WRVA 2PO5A 2E4XA 4CRWB 5F3RA 1O89A 3VDXA 3I37X 3I1JA 1GXSA 5TEVA 1MGOA 3FVTA 1L4NA 5K0EA 4E33A 4ZA2A 4P38A 4ZK6A 1GQ2A 4DG5A 5JNWA 1YFJA 1LNSA 1IJBA 2V7BA 4J9UE 2ACEA 2EW2A 3R9KA 3K92A 3T5TA 1VMKA 2I0FA 4ML3A 3TVYA 4D9CA 3R6DA 3AZOA 1LTQA 3BYZA 4URFA 2PKEA 1T5BA 4TWBA 3B8EA 2G08A 2VUHB 2J3QA 3C70A 3HA5A 4LZOA 1DX6A 2P3LA 2OZEA 1RYYA 3WMWA 4C03A 4MHTA 2AE2A 1KDVA 1JI3A 1MMFB 1VHDA 3KZOA 4GNKA 4JIMA 4DRYA 2J0VA 1PYGA 5TRTA 2HA6A 3VVBA 1W34A 2C84A 4FMCF 3M9WA 4JBXA 5AHXA 5DLPA 5HF9A 1G16A 1Z47A 2J6BA 3BG5A 1Q0SA 1XKXA 5HRUA 1QONA 3SJAA 4BLWA 3FUWA 2O0MA 2XUZA 2JZNA 2UU9B 4MVJA 1HM5A 4EMBA 2FA9A 2PH7A 4FINA 3G7UA 4N9QA 1VSTA 3AVTA 5EL0A 2PKWA 3E0QA 4NCAA 1T9GR 3EEBA 1F5SA 2PYDA 5BMOA 2ENWA 1GPAA 1H6DA 1KGSA 2B2CA 3DV0A 2HMVA 3OFNA 3I62A 2GPWA 2IYQA 4HH1A 3ECAA 3UHPA 5KSYA 3IJPA 4QWMA 2XZTA 5JAZA 3UJ6A 3IOCA 2ZRBA 2BJVA 2EC5A 4CM9A 3WRWA 2MYUA 2R6R1 4PZPA 2HWYA 3TGPA 2W0MA 3BRQA 2AFHA 3JARA 2R8PA 4QQ8A 5T67A 2PJRA 3KYDA 1MZVA 3BA1A 5JYDA 4U4AA 4F4JA 2GZHA 2C3OA 2NO5A 4I6GA 3BJRA 4DXHA 2H1WA 3CVUA 5IK2D 3DMHA 2EJWA 5T8KC 1C7QA 1XD8A 3RIGA 5KKAA 3UUGA 1WD5A 2XUJA 2QOEA 4F6RB 3A2KA 2HH9A 4OHWA 1NUQA 5HIJA 4YH1A 1N7GA 2B37A 2EIXA 5FV7A 2UXBB 2PCJA 2R9VA 2YHSA 4RPHA 4LE0A 1K6MA 3EODA 4PLYA 5K1ZA 5ADWA 5BW6B 4ZARA 3HI4A 4GQIA 3CCCA 2YN2A 1PK7A 2FG5A 3WAGA 3K9LA 4UOQA 3L93A 2R0QC 4AIRA 3IP1A 2A9RA 2DLNA 3EXFB 1Y1TA 3GJRA 4NU8X 5SY4A 4BGDA 1L5LA 3TYXA 1MORA 3OQBA 1DQPA 3O84A 3KVNA 1SQ6A 2AMYA 2ZIGA 3REGA 3U19A 4WIAA 1VPWA 1RKVA 2GAFA 2VH2A 1REQA 3QUCA 1VHTA 2YICA 5AVWA 3CX6A 3RT1A 1EUDA 2JCYA 2HTEA 3O0DA 3UM9A 2QZJA 2HJSA 3G68A 2SBTA 1WXEA 3IP3A 3K8QA 1QHSA 2XMDA 4N41A 4CLOB 5CLFA 1WE2A 3P2MA 2PRYA 2VDVE 2DECA 3BFPA 3CSUA 4WX2B 3VKWA 2IE0A 4CMEA 4NHEA 3N2GB 1VI6A 2JDID 2JGJA 2YINC 3STYA 1NVMB 4MVJM 4EB6B 1GTL1 3C41J 3G5MA 4TUYA 5JFGA 4HN2A 3PUVA 4AZWA 5AW7A 2H0QA 1WNFA 5LR6A 2R7LA 1X7XB 1WLSA 2HSJA 3S2YA 3AEKA 1Z16A 3R24A 4G6ZA 4UMFA 5EFOA 3AF2A 2PZJA 5IXSA 1BGXT 3WK8A 1N2JA 3RF7A 5EJEA 4PSVA 1K4KA 4IKOA 3AJ8A 2E87A 2FCAA 2NXJA 2WNSA 2XEXA 2Z9BA 1Y89A 1IVYA 5CA1F 5AOCA 3GELA 2I4LA 1N5KA 2EFDB 2F48A 3RAJA 1K63A 2HCRA 3RK1A 3VNSA 4FHFA 4V39A 8ADHA 1RACA 1HWYA 4K9PA 3F97A 4MUNA 1O95D 1QGED 1U5CA 4WN9A 4IDFA 4XEUA 4YHBA 4ZRMA 4OLAA 4CCWA 6CHYA 3LCCA 1UJ5A 1OFHA 1UXIA 3BOSA 3ONNA 3Q8XB 4Z0HO 1GG2A 4V0ME 3IKLA 3WGGA 5EJ6A 3OQIA 3N2LA 5K9ZA 2BEKA 4BNHA 4OO3A 5BR4A 3V8VA 5CFQA 2X5OA 3A9CA 4W1PA 1EAMA 1RKUA 2OFXA 3NCHA 1W9HA 1USIA 3BMNA 1PIWA 2GXSA 221PA 3CWZA 3GDGA 5FBHA 5K3CA 3TNDA 4CV2A 1IXYA 2ZT8A 2G25A 3FCOA 4ZCMA 4F3RA 2CVOA 1E1NA 5CHEA 4CJXA 3F74A 1UOOA 2PG3A 4UC0A 4CG3A 1UP6A 1Y4DE 1NNUA 1EKXA 2PEZA 5HBGA 1KQGA 1EFRA 4K40A 5EMNA 5LB2A 1UBNA 1TEZA 3LNTA 3NM4A 2H3EA 1XVTA 2YFYA 4ZYTA 1Z5OA 4KI0A 1I5EA 1KDRA 4XEHA 5HQ3A 3ZWYA 2BEWB 2ZYHA 2UV8A 2XUKA 4QJIA 3C3DA 3NVDA 4M8NE 5D00A 5BMVA 1DVRA 2HREA 3K16A 4ZCPA 1UBKS 3HYLA 2VDLB 1S2LA 3RRYA 2ERCA 1PT9A 2OMKA 3JZIA 3UEOA 4YRCA 1XD9A 1CNFA 4BMOB 3QEBZ 2WFLA 2ZSIA 4YRDA 3P9KA 4WZ6A 3W79A 2NQ8A 1CZLA 1I51A 2W4MA 1CULC 3F7NA 1YCFA 3LP6A 1DC3A 3BMOB 4JQOA 4MB2A 4E13A 2RFLA 3DEFA 3JVIA 1Y3BE 1UBTS 1YZTA 4D3SA 4E2FA 5BURA 4RLHA 3WB9A 4NENA 5B4TA 2ZUUA 4UVHA 2CNDA 1BD3A 4C7MA 1Z83A 4Y2TA 4JOSA 1GSAA 1Y9AA 3TX6A 2V6GA 4HHEA 2Z56A 2BZGA 3LBAA 1IHOA 4JDPA 1YDFA 3KD2A 2BFDA 2C1EA 3X1YA 4N7RA 1VSVA 3FJOA 4H59A 4JROA 1PNOA 3IIIA 5C8ZA 2WAXA 2VLBA 1OXMA 1CSEE 4IX9A 3MMSA 4TTQA 3LUDA 4TZKA 1D6NA 3II6X 1JJVA 4YP0A 1RIIA 3MGBA 2J67A 1PX2A 1G2IA 2YFKA 4R40A 5T8KA 3ORRA 2R60A 1PT6A 3DZJA 5M5BA 3VSBA 3W2HA 3JAKA 1MIOB 5AVKA 2I55A 1GZVA 2FG7C 3KPUA 1WBDA 3HXOA 3QFTA 5A0TA 2I6FA 2WIKA 4GMKA 4O4JF 2O06A 4JEMA 2H48A 5JSHA 5EKSA 2GZAA 2P41A 3DMPA 3HG7A 2VWHA 5EZYA 1PQUA 3EG5A 4IJVA 2QZSA 3MAAC 4KQFA 3UXMA 1M76A 2QTZA 1AO3A 3NANA 4EEKA 2FE1A 3RC2A 2GPBA 4Q5IA 1EM6A 1YRQA 1DJLA 1JQ3A 2NV2B 1OU4A 2RI1A 5HTKA 5KX5A 2GCOB 4C7BA 3L7OA 4RKEA 3D3JA 1NF9A 3CSSA 4RVNA 2DJIA 5AKIA 1E18A 3TNFA 2XUOA 1DIGA 1SIOA