5JNRA

Crystal structure of human low molecular weight protein tyrosine phosphatase (lmptp) type a
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
154
structure length
154
Chain Sequence
b'ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Diabetes reversal by inhibition of the low-molecular-weight tyrosine phosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jnrA00
5FWXB 4KRFA 4EGSA 2DRIA 3CZ5A 3H1EA 3KS9A 3QEMA 4F11A 3GL9A 1QKKA 3EDCA 4G0MA 1DC7A 3GWGA 1SXIA 3K9CA 3R0JA 2HPHA 1ZDMA 6CHYA 4LE1A 3KYJB 2VUHB 4Z4CA 3QLTA 3HV2A 4G0ZA 1ISRA 4WXMA 3CG0A 4W5QA 4MR7A 1F51E 2V0NA 2IOYA 2MYUA 3HXMA 5EWLA 4MLCA 2R48A 4N0PA 2NZVG 3ROFA 5DLEA 4KQ9A 4MQEA 1MIHA 5B3JA 2WJWA 1XHEA 3KCNA 1JF8A 3CFYA 3F7NA 2M98A 2JBAB 3MA0A 2FQXA 3OLXA 3OM1A 4G0YA 2NUBA 3G85A 4TN5A 2L2QA 3OMWA 3D02A 3O2SB 5DTEA 4EUKA 9ABPA 2P9HA 8ABPA 4O5AA 2FMKA 3JTEA 5JNRA 4LE0A 2A9PA 2R25B 2ZWMA 2HJ9A 4Q6WA 4DQDA 3LOPA 4F8JA 2CHEA 3LUCA 5F64A 3H6GA 1TJYA 2PL9A 4MS1A 3OQOA 2E4WA 3C97A 4DN6A 1BA2A 2OENG 3KG2A 3H5IA 3TO5A 4MRMA 4HNRA 4LRQA 5HKOA 2AYXA 1NXPA 3HUTA 3IP7A 1S8NA 4HNSA 2JB9A 4NQRA 4RXUA 3FDFA 3LFTA 3O1JC 3H5TA 4WT7A 2B1JA 3H1FA 3UUGA 1URPA 2PAFA 1USKA 3HJFA 4MAAA 1UDRA 4PEVA 5EWMB 3TD9A 3W9SA 1A0OA 2FEKA 4JP1A 4RS3A 2FW0A 3EULA 3O75A 1L5ZA 1RPJA 1TMYA 4LDZA 4CBVA 5FWYB 1JH9A 1TM2A 2ZAYA 3CHYA 3O1IC 4MR9A 4ZMRA 1LBIA 3A10A 3NHMA 1TLFA 2ID9A 3N8IA 1JDNA 4QYWA 5CNJA 5FWXA 3QX8A 5TE9A 3LUHA 1U2PA 3CLKA 3N0XA 2LUOA 4RV5A 7ABPA 4OTZA 5C5CA 1EWKA 3EODA 4TLLB 4N41A 1MB3A 4N47A 1USIA 2R47A 2L19A 1JDPA 2QXYA 3QELA 4MR8B 4LZLA 1JYEA 1CYEA 2GBPA 3UKJA 3F6PA 1M5TA 4MYRA 2FVYA 5PNTA 3ROTA 1APBA 1KRWA 5FBKA 4OLBA 2GKGA 3OO0A 4MQEB 1NTRA 4YRZA 3RQIA 1PNRA 2IPAB 1Z15A 4Q6BA 4YWHA 3N0RA 1CEYA 1M2EA 2JBAA 4IILA 4RU1A 3SM9A 2X7XA 1D1PA 3I45A 2IKSA 4PICA 5TQ0B 1LJLA 3KYIB 1PUXA 4ETIA 1E6KA 1GCGA 1AB5A 1EFAA 1ZGZA 3JS5A 3Q41A 1ZN2A 3TB6A 3NNDA 1USGA 3I09A 4DADA 4WWHA 2A9OA 4JOQA 2QW1A 4EVQA 3RVOA 3CKMA 4PYRA 3KKEA 4XXHA 4D74A 3RVPA 3MQ4A 3LUFA 1QO0D 1Z17A 1QPZA 3MF4A 3O2JA 1GUDA 5JS2A 2W42A 3LMKA 5DCLA 4EYQA 2FTKE 3P9YA 2FLWA 2O20A 4E7OA 1MVOA 3BBLA 3IP5A 4L4UA 5IUJC 2HQRA 3RVNA 2IPMA 1DCKA 2YHBA 4XASA 3SQNA 4TLMB 4RKQA 3KTOA 4ZMSA 5EWMA 1DJMA 1MB0A 3FGZA 4RDCA 2PUDA 3H5OA 3ILYA 3JPYA 3Q7TA 2FLKA 2E4ZA 3LKVA 5FWYA 5IX8A 2JRLA 5GOTA 5ED4A 2FKAA 4HYEA 1VRVA 1GLGA 2R4QA 2H3HA 5I4CA 1J56A 1NXOA 3FFXA 3VNAA 1ABFA 1U2QA 3Q7RA 3IDOA 3MYYA 3QELB 4RK7A 3NNSA 1JWLA 2QV0A 4MR8A 4QICA 3QK7A 4G97A 3H75A 4GNRA 3E3MA 4IF4A 5D2CA 1YVUA 2FN9A 3G1WA 1R8JA 5C5EA 4W5RA 3LUDA 2FMFA 3K4HA 4NCAA 5KI6A 5KQMA 4Z4EA 2BGGA 1E6MA 2FSPA 2JVKA 4YR7A 3MMNA 1BDIA 1AB6A 3SY8A 4RY0A 5IEJA 4EYGA 2GX6A 3CZCA 4LE2A 1KRXA 3ILHA 3OLVA 2MYPA 4W5NA 2WY2D 3N75A 5TQ0A 1F4VA 2QU7A 4KVFA 3LUAA 4OATA 3LUJA 4S04A 4EY3A 1DCFA 4KQCA 4P1ZA 3M9XA 4Z9AA 3E61A 2GWRA 4RWEA 4ZJPA 2PUGA 3HUUA 2Q5CA 1DBPA 4OLAA 1W9HA 4OG2A 2A9QA 4NCBA 2P4UA 1JYFA 1PEAA 4H3HB 4KMRA 3T95A 1JFSA 4JA2A 3BRSA 1FFWA 5JNSA 2E4YA 4YGXB 4YS6A 5BQ3A 4FE7A 3GBPA 1M2FA 4MLDA 4Z99A 2F8TA 3FFWA 3OLYA 3DZDA 4F12A 5BR1A 4MS4B 2PE5A 3KSMA 1U04A 4KK3A 5HSGA 2HQBA 3I5AA 3GBVA 4RK0A 4JB0A 4ZPJA 5IBQA 5JS1A 3LKBA 2VYCA 1ZHHA 1DBWA 1ZH4A 3C3WA 3TX6A 3M6MD 4GPAA 2PJUA 1QO0A 2FQYA 3HCWA 3GRCA 4UHJA 1DC8A 1CHNA 2IYNA 3H6HA 2PUBA 1Z12A 3GA5A 4KV7A 4EYOA 2PUAA 3HZHA 4ETNA 2OQRA 4KFCA 1P6UA 2PUEA 3H5WA 4KNYA 2WJAA 3JY6A 1QP7A 3M9WA 3C3KA 4G0PA 4MS3B 3H5VA 1IIBA 1DZ3A 1RNLA 4RY8A 3IPAA 2N9UA 3QEKA 5CNKA 3RVQA 2CHFA 4D6YA 2FXIA 3QLUC 1DBQA 1ZVVA 1DP4A 3T8YA 4O1HA 1EHCA 1JL3A 5BRAA 1YMUA 2A9RA 5JNTA 3RVJA 1PNTA 5TPWB 3DGFC 2WRZA 2E4VA 4FB4A 5HQJA 4Q7EA 1ZH2A 3RVLA 4E7PA 4W5OA 1RZRD 4Z4GA 2ID7A 1YK1A 5KQLA 4KK4A 2E4UA 4F06A 1DRKA 4Z4HA 3O74A 1ZAYA 3IP9A 3OLWA 1FFSA 4UHKA 4OBBA 3SG0A 1NXXA 3HK2A 2PKXA 3HSYA 2I6FA 3A3KA 3D8UA 1NXWA 3CS3A 4H60A 4MS4A 3A0RB 4YCSA 3N6VA 4G0QA 3EQZA 1B00A 4N76A 1WETA 2FEWB 3HDVA 1JHZA 5ABPA 2F8SA 1GCAA 2VK2A 1QMPA 5CNIA 4MPTA 1SRRA 2PL1A 1SXHA 2TMYA 5DGCA 4IMJB 1SXGA 1NXTA 4G0XA 1BDHA 1QQBA 1BAPA 3HEBA 1FSPA 4ML3A 3Q15C 2QSJA 1L5YA 1OXBB 3KLNA 1LBHA 5JNVA 5KQPA 3LTEA 3LUKA 4S05A 4RK1A 2FEPA 2NT3A 1I3CA 1D4ZA 2QZJA 4WZZA 1QP4A 1P8AA 1U0SY 4YP9A 2IDMA 5EWJB 5IC5A 1U8TA 1ABEA 1Y1LA 5T7BA 1VPWA 3DLHA 4XLTA 3KHTA 4RXMA 4MS3A 4KREA 3HM9A 3EJWA 3C3MA 3BILA 3HDGA 3TMYA 1JLKA 3NBMA 3N0WA 4NV3A 3JVIA 3A0UA 1TVMA 3BRQA 1ZESA 3HS3A 2MYNA 3MIZA 1K68A 4RK4A 3HVRA 2RGYA 4Z9BA 4MQFB 3T38A 1KGSA 2HQOA 4Y9TA 4B09A 1YS6A 5TPWA 2FN8A 3IP6A 4YLEA 2L17A 4IGAA 5TQ2B 3QLVC 1NXVA 1M5UA 2H0AA 2VUIB 5TPZD 3FFTA 1Z26A 2CWDA 4Z4IA 2PLNA 1YTUA 2MYTA 4ETMA 4P98A 1MAVA 2MSLA 2IPLA 2NZUG 4N0QA 4KPYA 1KMIY 3N53A 3KJXA 3URMA 1FQWA 1GUBA 2QR3A 2JCGA 3QX9A 4RK5A 4PZ0A 2FMHA 4D6XA 1D1QA 1Z18A 1ZGGA 3C6QA 3F6CA 1SD5A 3L49A 2PUFA 3EQ2A 3LUGA 1JBEA 4EYKA 1JFTA 2LPMA 3GV0A 3H5LA 2FQWA 3S99A 2WMYA 2XDYA 5KC8A 1VKRA 5KWSA 1RXIA 5DKFA 1RZRA 4XFKA 3QLVA 1C4WA 1OXKB 5JNUA 1BDJA 2L18A 3F73A 1RXEA 3T6KA 3BREA 5KQGA 2M1ZA 4JAVC 1K66A 5JNWA 2HSGA 2MSKA 3CTPA 3OM0A 1FFGA 1QNLA 3JVDA 4EVRA 3NHZA 3DGEC 5TQJA 1T34A 3KLOA 2E4XA 1ZITA 4M88A 4RKRA 1LK0A 4RXTA 3VNBA 2YHAA 5EWJA 4FE4A 3DBIA 3O21A 6ABPA 4H3KB 5IUKC 3SNKA 1ISSA 1BVHA 1NY5A 1P6QA 3UK0A 3QEMB 3RVMA 1YIOA 5T3YA 4JASB 1QQAA 5FBHA 1P2FA 3Q9SA 3EAFA 1YK0A 1H9CA 1PEYA 3JPWA 3GT7A 3H1GA 1PHRA 2JVJA 2WWVD 3GYBA 4QPJC 5HM6A 3DLBA 4KZKA 4MQFA 4MR7B 4PE5B 4EVSA 1Z2DA 4G0OA 2JK1A 3IPCA 2RJNA 5EWLB 3RVKA 2PUCA 1EAYA 5CNMA 1DG9A 4XARA 4Z0NA 1ZY2A 5TQ2A 4IRXA 2KYRA 1EWTA 4IMIB 3EGCA 4F3TA 4LDAA 1YS7A 1DRJA 1NATA 2LBPA 1A2OA 3CG4A 1HEYA 2FMIA 2RDMA 2QVGA 1Z25A 4MGEA 4Z4FA 3NNNA 1D5WA 1XHFA 3OQMA 2JVIA 4RY9A 4TMYA 3HO1A 3QLUA 2LIVA 2GI4A 3CU5A 5GQSA 5IEBA 2J48A 3Q7SA 3OMXA 3L6UA 4MS1B 3I42A 5E3JA 4WUTA 2LP4Y 1E2BA 3SAJA 1EWVA 1LJUA 2AYZA 2IPNA 4G86A 3FMVA 4RSMA 4W5TA 4RK6A 3OLZA 2WB4A 4MRMB 5IUNC 5KC9A 1W25A 5TPZA 2MSWA 1NXSA 4WXEA 3O2QB 3O1HB 3CNBA 3RVRA 4QYMA 4YV7A 1Z2EA 2RJOA 3MM4A 3OO1A 2B4AA 1JX6A 1C0EA 4L85A 4LX8A 1XWWA 4XAQA 4YO7A 1YMVA 3CRNA 4N03A 3RH0A 4HNQA 1E6LA 4RZSA 2PMCA 3B2NA 1DCMA 5B3JC 1A04A 2CD7A 2QVCA 1JFVA 2NT4A 4ZYLA 4NICA 3RVSA 1Z16A 1Z13A 3OQNA 5CHYA 1VLZA 4MR9B 5BRJA 5IULC 4JB2A 4O1IA 1QP0A 1D2AA
chains in the Genus database with same CATH superfamily
3EMVA 4A8HA 4D9MA 1QH9A 2WVAA 1WR8A 1I5OA 1M2JA 3PUYA 4TTPA 1WBDA 2V9ZA 1E96A 1UMKA 3DAFA 3D4LA 3EDCA 4D46A 1I2CA 4LWZA 2O0HA 1QDUA 4KQWA 4N6NA 2O2HA 3QPVA 1OA0A 3NTVA 5AK4A 1U0NA 3TMKA 5KX5B 3ILXA 3PU6A 3TTXA 2QRHA 4Q3EA 5IH3A 3HH8A 2V0NA 1PVOA 4G8DA 3DE5X 4LZOA 4B6GA 1NPYA 3E35A 3TR0A 1FFAA 1I8TA 2BE7A 2NZVG 3O5AA 2OK7A 4R8RA 2V1UA 3C4QA 3MLEA 4ENQA 4LDRA 1GVNB 4E5NA 1OZGA 3LW7A 2G77B 4QXQA 3ZWDA 2P6RA 5FQOA 1UKZA 1UIMA 3U3XA 3C8UA 3WOHA 4Q7QA 4QUIA 2LCIA 4O5AA 3BPSA 1GTZA 1XLWA 3LQKA 2I9KA 5ILQA 1KJNA 3QEOA 3ZD6A 2XQGA 4J0KA 2HZBA 3AUTA 5E4FA 2DE0X 4E13A 5HUQA 2UKDA 3PDCA 2PT7A 3ZTYA 3HN6A 4MYDA 3VR4A 2Q9CA 1V35A 3SE0A 5KX5F 2PSEA 3D43A 3JQPA 2D0DA 3DE2X 3L7YA 2E1RA 3H99A 4ESEA 5DN6D 5FBRB 2HAEA 4I8DA 4TV8A 3TMAA 2C7BA 5DLPA 4B8WA 4U2KA 4GPTA 2ZVJA 4HNSA 2Q7XA 1G4HA 4M54A 4HC4A 4RXUA 2ZLBA 4YRSA 1SRQA 3TN7A 2JLUA 3CUKA 1PQWA 4ZV9A 2ZYHA 2J7PD 2DKFA 3HV0A 2FZCA 4IIEA 4QOSA 1O57A 4J0EA 4EQZA 1U7PA 2P90A 3DE7X 3OZCA 3S2SA 3AC0A 1SCJA 2A7QA 2YZGA 2VATA 5IMBA 3UICA 4BNWA 3R2JA 1TMYA 4DJJA 4HYQA 1FYWA 2R00A 3PFGA 3GLUA 2OPHA 4FMCB 4A6XA 4BQNA 3CUUA 1TMKA 3VJLA 2V59A 1D2CA 3LG2A 1YWGO 1WVMA 1XU7A 3ILVA 5E9JA 2F3UA 2ECOA 4N6OA 2V54A 1GZ4A 3KSDO 2IUSA 4HAVA 3RHFA 7ABPA 4I55A 1V16B 4WJLA 3FOBA 2XRMA 3LZ6A 1O6ZA 1AV7A 2O23A 2DSTA 3AR9A 2VPWA 1NQWA 1PK7A 2BKLA 2WJPA 3DSRA 3JD0A 4MW4A 4ZQIA 4TRMA 2Y67A 3TIVA 2AJ8A 3WIEA 3ZWMA 1WW3A 4DLYA 1FQOA 3MRXA 4OUDB 1APBA 1W0CA 1KRWA 4R9NA 2ZEJA 2X86A 2GKGA 1X3LA 4I5GA 4MO9A 3TQOA 5C8DA 1PNRA 2IP1A 4RHYA 1GAXA 1ZCZA 4KH0A 2AG8A 4YASA 2NVBA 4FMCF 1QG4A 3WAGA 1A27A 3DUWA 4F3TA 3DB2A 5C8ZA 3WJAA 5CLIA 3B38A 3LBNA 1L1EA 1QE5A 4KDFA 3TEFA 4XIJA 1LJLA 1DZIA 3KYIB 3VGJA 4D0SA 3WKCA 2BGLA 3HCRA 3O82A 4NBLA 2FF5A 1A77A 3VPSA 1YAHA 4ZGWA 2H5EA 4QREA 5ALRA 3I09A 4F6LA 5ERGB 1QG0A 2AW3A 2G4LA 2XNCA 4JOQA 5CGZA 4IJVA 4EB3A 4YH1A 1EFLA 1ZEMA 3K30A 3KYDB 3ZD9A 3UB4A 4AVYA 1RKVA 4C0JA 3JZMA 4DV4B 3VRHA 1XVVA 3O2JA 1M10A 3CEJA 5LIRA 3EVZA 1ZNXA 4F38A 1YBAA 2Q27A 1UUFA 1J1IA 1X9GA 4TMXA 4J0QA 2OA0A 1BD3A 5LL6P 2GK7A 1MVOA 2EFYA 5TMEA 4HQ0A 2H9IA 3ESBA 3EZLA 1DE0A 3NQ41 4IVRA 3DTVB 4K7JA 4XASA 2WR8A 3SYNA 4C20A 5LVAA 3NG1A 1M8PA 3NFRA 4IVNA 3FG9A 4UHCA 3A27A 1YL6A 3OPQA 4EG6A 3GHHA 4OK6A 3HCNA 1LRJA 4ER7A 1K5DA 3B53X 2C98A 2BMVA 3R3JA 4M21A 5AKEA 4JBHA 5C3MA 1DL5A 2HA5A 2JRLA 4KPUB 3TL2A 3EVTA 2ZXEA 3QLEA 2YX1A 1GLGA 2QBYB 2ZANA 3QXGA 3DH0A 2EARA 3PYLA 4XUGB 1M33A 3KDAA 2PVSA 5DHRA 3UCEA 2NU6B 3DFIA 3K7EA 2IOFA 1M2OB 3CZ4A 3A11A 3F1LA 3A6ZA 4POOA 1U31A 3F8WA 3ZNQA 2QNRA 4DS3A 2A9FA 4UMEA 2NZYA 3K8OE 3UH0A 3G8DA 3N8HA 3CXUA 4OYLA 4Y2UA 5KJFA 1NP3A 3NEPX 1DOZA 1N2JA 3JCZA 3KDPA 1TB4A 5L40A 4QT0A 4MKRA 4RKYA 2ZTUA 1I10A 4A73A 1JEQA 2DG2A 1DBIA 3WMXA 1MJGA 3F7MA 1Y8ZA 3RU3A 4W5NA 1VXOA 1IAQA 1ND5A 5C7LO 4JXKA 1ZO8A 4EPRA 1Y1QA 1Y9ZA 5DXAA 5JYCA 4W7HA 3KV1A 2F3PA 2XUAA 1HLPA 5IJXA 1PJAA 2A58A 4CV0A 4ZTUB 3GCWA 5C8YA 2XGOA 4HTAA 2WYUA 1RPNA 1KFCB 5JCJA 5JXHA 1T0BA 1AIPA 4FYKA 3RRJA 1U0EA 4YRRA 3FIJA 3ENKA 3FYSA 3KWFA 1ELOA 4LF6B 3DW3X 3I0MA 4BNJA 1JEYB 1XG5A 3KZCA 4CR7A 2HLNA 3LQFA 2ACWA 1BA3A 3OSUA 2V3VA 2XTJA 3QG5A 4A5OA 5IS2A 4NH0A 5BQ3A 4Q02A 3ZCRA 2WHQA 1NSTA 3IAHA 3GBPA 3ZQKA 1M2FA 3ZQ6A 2J0UA 4PAWA 3U3ZA 1D1SA 1F0KA 2COKA 4YECA 3F7OA 4DIBA 3OQ1A 3PXCX 2AJBA 5BW4A 3PD1A 4RMGA 1GFIA 4RX1A 3NV9A 4I9FA 5TX7A 3U4GA 4BNYA 1YKGA 4GR4A 1XI2A 3MJ4A 1HDOA 3OD1A 1NMXA 3GBVA 1YQGA 6REQB 1BN6A 1P5RA 1XTUA 4XUDA 1I4EB 3DBVO 4QUAA 1J23A 4RZHA 3DVRX 2REQA 3GFQA 4OMDA 4XB6B 2IS6A 4GPAA 2J87A 2YMPA 3OZBA 3A25A 5DP2A 3A1SA 5I9NA 5SYNA 1TTHA 4A03A 5NULA 3N5CA 4O2RA 1TRKA 2GCOA 5D7NA 3GH1A 1U2GA 2RHWA 3JQGB 5AVKA 4BLTA 4BFZA 4NZMA 2IYNA 8ATCA 2IZ7A 4WKCA 1AU9A 3V8EA 1KEEA 4JJ6A 1G2OA 1XZDA 4EA6A 3P9XA 2N1MA 4CG1A 2OBFA 4POAA 2VAVA 1W85B 2WF6A 3OOWA 1Q1ZA 1OI2A 1ZINA 3V33A 3ESYA 3B6ZA 1LQUA 2BEUA 3PDIA 4PYKA 3ZHSA 1IIBA 4XWOA 2VN8A 1K8YB 3PD0A 3OOYA 5FYQA 2CXHA 4QDOA 1Y5RA 1JSXA 2PKRA 1S9DA 1PSZA 2WSMA 3EIXA 3RS5A 5JHHB 1X1DA 4D6YA 1SZDA 3FSJX 3K8YA 4C0QC 4E08A 4Y2YA 3FUVA 4UCWA 4L9WA 3SF8A 1Q1BA 1BEUB 3GGOA 3KEQA 3IH5A 4HDNB 1NDHA 2IYUA 3ICVA 4N5LA 4ENRA 3A8TA 3I73A 3TSOA 5JNTA 4UCXA 1U28A 3NAQA 2H29A 1GOTA 3F71A 1HE5A 2E4VA 2N3ZA 2MOKA 1IDN1 1R0BA 3IKLA 3H0KA 3MBOA 1JG4A 2PD6A 2Z1MA 5DB4A 3RVLA 4A0HA 4W5OA 2WWXA 1C8KA 1W93A 3DE1X 3QOYA 4L5YA 4YRFA 4N3AA 4PSVA 4DLXA 1XCMA 3F97A 4NRDA 1UWKA 4MV7A 5CT4A 3AR3A 2FYTA 3KLMX 4JNKA 4B4DA 4KMMA 4LHVA 4DWWA 3SG0A 5KWVA 3TINA 1SBYA 4JVSB 5HUJA 1E0KA 1P3Y1 1EJBA 4P35A 1K7CA 4REMA 4OMCA 1SVUA 2AC4A 3GCDA 4UM5A 2X77A 3EXAA 4KFRA 2XB9A 1UJCA 4CM8B 1TNDA 4MA5A 3A6JA 2C5LA 3AI2A 5T3UA 2FEWB 1M34E 1KTVA 1TJPB 3N2NA 1H3FA 2AH5A 4QSHA 4Q00A 5ITZA 3O3OB 4YUXA 4LXYA 2FETA 3KQYA 3KJHA 4QSMA 1X7YA 3GAAA 5EGSA 3KJEA 4AUMA 1IM2A 2C1ZA 1XZKA 3OP1A 4ML3A 4E3ZA 1KY2A 4OI1A 2VXOA 1H4SA 4M0FA 1S2MA 1CUCA 1P8AA 4J9UE 3UWKA 3DTYA 2QT9A 1N2OA 1SIOA 3KCQA 3PEYA 3MTIA 1SKBA 3EB9A 1EWRA 3GLFE 4E5KA 4UHBA 4G3XA 2OBXA 5HWSA 3GROA 3K72B 2O8DA 1TMGE 4I0WB 4F8EA 5IDVA 2GM4A 3WYEA 1ZOIA 3N0WA 3MS7A 2PFKA 4I6GA 4QQFA 1L7QA 4JKYA 4Y0NA 3G5MA 4BMOB 3CIOA 2BMWA 5AM1A 1MQSA 3ZWAA 5AJTA 1WX1A 1Z4JA 3HXPA 4FQ7A 4QVKA 3KR1A 2B7LA 2RGYA 1OIVA 3ZGOA 3PHHA 5CB6A 4TV9B 5HIIA 2ISCA 2W2LD 4A27A 3DXFA 4HLUA 3FUTA 5K05A 1P2TA 5K7SA 2PX6A 2IXTA 1MJHA 4IGAA 2J9GA 3GRAA 1MA3A 5JZ9A 1CY8A 3CVOA 2EKQA 1IJBA 2OZEA 3EVEA 3RE1A 2PGDA 3SDBA 5AW2A 5JJKA 2RIPA 1CLUA 3OPYA 1H42A 1U8YA 1RI4A 2QJTA 3RKRA 1SCDA 2Z5VA 4D1YA 4D3YA 4CYMA 3LVQE 1ZVKA 1XRLA 4J6FA 1FBNA 5IC4A 1RABA 2BI7A 3Q2KA 3K16A 3QJGA 1KQFA 3QWFA 1SHTX 4ADSG 1G21E 4EZBA 1WXEA 4C5BA 1XAGA 1TAHA 3LIPA 5G0WA 4JLVA 1V43A 2WT8A 3NXSA 4P3YA 2G0AA 4ZOEA 4HHEA 2HSDA 5CU7A 2PNFA 4JQYA 4ITRC 5GVRA 2IUUA 1C0IA 3RLIA 1T0HB 4TV9F 3TCKA 1K8RA 3KBBA 2FQWA 2I8CA 2WJGA 4LY9A 2QRGA 2XDYA 4RS4A 1CYDA 4CM3A 1N8KA 1N1MA 2QL5A 1MG0A 4DYVA 621PA 5JADA 1OUMA 1E59A 1BS1A 2DPXA 2IZOA 4NFLA 4XFKA 3B3QA 4GYKA 4K0KB 3N7AA 3WAKA 2RSLA 4RWZA 4XIFA 4O4HA 1DV1A 3QNUA 4DJDC 5A9SA 2ECQA 5F98A 2HSGA 3G9TA 1VL8A 4KRXA 1M6YA 1ZUWA 1Q17A 2JLAA 1ECFA 1PO7A 3DGEC 1JSLA 3KZKA 3D6UA 3VNBA 3OUUA 1FDUA 1L8LA 4MWTA 3DEZA 4JYMA 1PDOA 4FE4A 4W9MC 1F3LA 3ENZA 3FB4A 3RC1A 2RG7A 3WX0A 1PU2A 2X42A 4WNAB 3ZDZB 1OAAA 3EYAA 1B74A 4UDYX 1FUKA 3ZV7A 1OC4A 2C2KA 2EEZA 4Z2AA 5JFGA 4JASB 1PFUA 4S12A 5F2OA 4BX0A 2P30A 2KJQA 2OZLA 3F5QA 3C43A 3PGKA 3X1YA 3E8MA 3OZUA 3AIKA 3K9WA 4OCZA 2ZUUA 3ZHOA 3CINA 4Q3OA 3TG2A 1GRVA 3RVKA 2NV0A 1GUYA 3HCCA 1ZS9A 1ZIDA 5JRJA 4IRXA 4C4SA 5EMKA 2ENWA 2JIMA 4U6QA 3ZDBA 3PQ7A 3IUNA 1ZJJA 3R5SA 3PT9A 2FN3A 1ZM7A 2FMIA 3L6BA 1VJGA 3PIIA 1YBHA 1VE3A 5ERYA 3KU4A 1DKUA 4KLNA 2Y2VA 4HDOB 5I7HA 3M3HA 2VBIA 5IP5A 2IHNA 5FXMA 3QNMA 1PNVA 4JI3B 4HNVA 2PGJA 5JO0A 5JXJA 1IBKB 3DT8A 5T4BA 1Z5UA 3GN1A 1QHFA 5G2OA 3T06B 4FCWA 3TZEA 5JJBA 3DDOA 2J3JA 4R9VA 4M8IA 2I1QA 2R751 2AUTA 2H2AA 3HYNA 4B3XA 2WB4A 4NYMR 1W25A 3VZCA 2H4WA 1JLRA 1MX9A 3WMGA 1R0YA 4F56A 3ROEA 3F96A 3KRTA 1WUTA 3DVLA 4XTRA 1X7ZB 5CDGA 1CS0B 4CTJA 3DVQX 1KIAA 2WE7A 1JNYA 1FJXA 2BPOA 2XCTB 5IYZA 2EXXA 5C32A 2ENUA 1EE2A 4KTVE 2EATA 2HIGA 5K6AC 1E5QA 5IJZA 4DLWA 3QVXA 1V4BA 2JW5A 1A04A 2CW5A 4OHYA 5EZ5A 4OIMA 1UT5A 2NT4A 3KKOA 1QB7A 1NWHA 1CUVA 1Z16A 3HADA 1LKZA 4PZCA 4WESB 1FF9A 3HGTA 3A2KA 2OLJA 1GZHB 2F9LA 2P6UA 3PXUA 1WDKA 1E3TA 3N59A 4LXTA 4U7PB 2ZJ6A 4EGSA 5JZSA 4L6CA 4BBAA 1MO2A 2G9NA 3W3AD 4B3IA 1YDWA 4BPBA 5LA6F 1F9AA 1NVAA 2JAXA 4CM4B 4J2HA 4MI6A 1VMKA 3FDZB 4LJ8A 2PH1A 3ZHTA 1SVIA 2JBWA 2Y3IA 3KPYA 2W6PA 3KYBA 4KKVA 3V1NA 2RGXA 4GECA 1VBMA 3GIWA 4K1LA 2NVOA 3W4KA 2XWPA 3NVKI 4DNOA 3NOVA 3JZIA 4ZPXA 3TRKA 3ER9A 5HBGA 3UQYS 3FHOA 2E18A 2R48A 3L6RA 5J4HA 1SUEA 2FP4B 3H2KA 1S1CA 5TS3A 1SBTA 2XX3A 5EE5B 3FVVA 5KOJA 4EUNA 1WLSA 7YASA 4F85A 5IK2A 2GYVA 1OX6A 3MMXA 4O4JB 3LSYA 5IWCA 3USZA 2R85A 3DL4A 1RAAA 2QL6A 4MPJA 3L4KA 4DRXB 3F3SA 4MMXB 1NDQA 3GGGA 4DQDA 3EXEA 4IDPA 3CO0S 3A4NA 1JDBB 1U4OA 3MVEA 1FNSA 4MPPA 4WFJA 4QUDA 1UEJA 3ZLUA 1H3EA 3T0GA 1XZLA 1J99A 1NP6A 3DNFA 1EA5A 2XMSA 2VO1A 3LPCA 5DLQC 5B1DA 1PWEA 2ZR0A 3FCXA 2G17A 5HEKA 1G59A 1OKKA 2FDCA 1EZ4A 3FNIA 1DCTA 4C7OB 3QMMA 3IQXA 5K0LA 4E94A 1G6KA 3FDFA 2AVNA 2P1RA 3GJ7A 3ROXA 5BSKA 2ZU6A 5AKKA 4L0QA 1SB8A 2PX4A 3O1JC 1OMOA 1U0TA 1V6CA 3KPVA 5U1PA 5DI3B 4X63A 5A1TA 1N34B 2IUYA 4O4JF 3SZOA 3WBJA 4WQMA 3CJRA 3UJCA 1UDRA 3PHCA 4PEVA 4A92A 4MV3A 2Z83A 2OHFA 5LQMA 1NBMA 3NBAA 4WX2B 1RRPA 1YCFA 1V96A 1DBVO 3GA0A 2D1RA 3FF1A 3O75A 4GH5A 2BHLA 1GPDG 4ROSA 4XCXA 3UAZA 1OTYA 4DIEA 1GQ2A 3GRRA 4BX8A 3CPJB 4V3CA 2F6RA 1KGDA 2PJRA 4BWYA 1M0TA 3N0XA 1XZQA 4B34A 4ZQHA 2XCOA 1FS4A 1V8DA 1MEEA 3DF7A 4RV5A 4CF3A 1TQDA 1ULSA 3NRBA 1LVGA 4E15A 4N41A 3PC8A 4N47A 2VL7A 4MR8B 2GJ8A 3K6JA 3F2IA 4Y9UA 5JDCC 4CR8A 2IE0A 3R3UA 1BW9B 1QS0A 3PCRB 5KTYA 2I1LA 5LMUB 3G1UA 5J63A 1CZOA 3E70C 4MYRA 2WJ4A 2QJWA 3ASVA 4EDFA 3U7GA 4LOAA 4KYVA 5TNXA 3W2FA 3HLYA 3PE4A 4MA0A 3IV9A 4WZ6A 1L7PA 1Q16A 4YWHA 3V8NA 3VPHA 2ZM6B 3SM9A 2W8BA 1LWOA 3CF4A 1R8XA 1TT5B 1QH0A 3VZRA 4ZVUA 3KALA 2AQKA 5AWFC 3M83A 3LQ4A 2LGJA 4IGEA 2UYHA 3BGWA 4NFYA 1WWKA 3U3MA 1ZU4A 4O63O 2PM8A 3TM5A 1KQ3A 3L8YA 3NVMB 1R3UA 3JQBC 4N5MA 4NPHA 1E66A 3ZDRA 4WADA 5IT9A 3K9NA 3CA8A 3TLBA 4X93A 1RHRA 2P65A 3ME5A 4CIWA 1SXJD 3BQ9A 3ZI0A 2IW1A 1TVKA 4D0GA 2ZB3A 4KE8A 2OCDA 3OESA 4P4SA 5A3QA 5BN3A 4OJMX 1T1GA 4EW2A 1TO2E 4ZYYA 4DCNA 2NU8B 3B1VA 4PZYA 2FTKE 3WRXA 2HRRA 4X7MA 3A9UA 2ODQA 4EI9A 2VP5A 1QZTA 4JODA 3JASA 2P7HA 4MLPA 5H83A 1DCKA 3EXIA 1MW8X 2FWJA 2I4OA 3WK9A 3QXXA 1G21B 3QFTA 3B3AA 1UMBB 1DJMA 3GRKA 4FBMA 1MB0A 3KAKA 4HEA1 3PB3A 4REOA 4IZIA 3CH4B 3AJ9A 3JPYA 3QFHA 4E4TA 4H0NA 2VF2A 3VZPA 4DMCA 5CCDA 5F9HA 1KFJB 1C0PA 3AHFA 1U8FO 1B3BA 1UDAA 2YINC 3IP1A 2GCGA 5JD3A 1I7PA 4K03A 1UM9A 3VR2D 5JJCA 3O8OA 5DN6A 5TEWA 2PG3A 1A9TA 2DU8A 5THKA 2ZUBA 4XRRA 2B6HA 1B6GA 3EH1A 4BCBA 3R23A 2NU9A 1LQTA 1E4OA 4LZZA 3WDKA 4C6SA 4DWJA 4NEQA 5FOWA 3VU9B 2DEUA 2PX0A 4R54A 5KSYA 2J7PA 4RD2A 3E3MA 3PL1A 1RQLA 4P4UA 5CB8A 3ZCSA 5HS4A 1C30A 1FP1D 4IY1A 5B55A 2G4VA 2H06A 1OLXA 4JOSA 1H4TA 4BE9A 1XCOA 4IFBA 3PNOA 1YOBA 3MMNA 2HF8A 3E1KA 3N2GA 4X1IA 3SZGA 3W6PA 4YAIA 3FM9A 5DBFA 5ENVA 5AVWA 1Y6ZA 2X8JA 3A3NA 3WK8A 1MLDA 2IY7A 4WOKA 4A26A 1OH6A 5HCNA 5L3QA 2ZYSA 1TQ6A 1ZGBA 2XWJI 4TTRA 3THYB 1ENZA 3BCHA 1A4IA 5F52A 2YY5A 4WFQA 5J5VA 4EGAA 3I04M 4HVLA 2WD7B 3IOMA 1AXRA 1XQXA 1NJGA 3PHIA 4AWBA 4IQ8A 4XYMA 5CYOA 3AGPA 1TUBA 3SEAA 1QH8A 1RXUA 4Q5IA 4ZT2A 2E6UX 3VKFA 1TTTA 4L07A 1QFXA 1OI3A 2HUPA 4OL0A 5C4GB 2CD9A 3IMEA 1E2HA 2FV8A 3W8DA 1H2ZA 2G5PA 3N2KB 5H7XA 4MDYA 4ZDIA 1ULBA 3SLGA 5D8DA 3V2UA 4OFXA 5FKJA 2RHTA 5BUQA 3TW8A 3HN2A 1SFRA 1T29A 2H9AA 3FR7A 1Z73A 2GJAA 2WNHA 2YIVX 2GYYA 3GR6A 4MS4B 3K92A 5A0TA 4DR1B 3A1UA 3UAXA 2GEVA 2H08A 3WTCA 4E6PA 1U04A 3PG5A 5IJAA 4BRSA 3MWYW 3AF4A 4W5JA 3R9IA 4S0XA 5ICMA 1M2NA 4JJGA 2QR2A 2WMOB 4UNSA 3ONWA 1K89A 2AI2A 2FX3A 4C5CA 5JYEA 3TX6A 3KKQA 2HK7A 3M6MD 1QAQA 3RYHB 2VA8A 2Q6TA 5AHKA 1QR2A 4B75A 1PT5A 1MAWA 5HCIA 3WKDA 5K0EA 5K8UA 3REQB 2O4UX 3ZTTA 4IGKA 3BTVA 5IN4A 5MN5A 2IEBA 3G0BA 1M8JA 4KXNA 1C9YA 1WXDA 2BELA 2ZTHA 2B7CA 3C8HA 4I3HA 4KV7A 3FJOA 1XMSA 1N9GA 2A9JA 3W5VA 1IUKA 3NDRA 3GX1A 4CCAA 3ZE2B 3AVTA 4KN8A 2ZI9A 2QW8A 3DKRA 3KSUA 3RWMB 3DV0A 4DIOA 2QW0X 2XUQA 4RSRA 3SEQA 4BAGA 1IN7A 3ZC3A 4GOOD 4AWAA 5L9AA 1ND6A 3L8MA 4X3PA 4ND7A 3MUOA 4B35A 1UEXC 3DPIA 3HA2A 3OZAA 5ESDA 1V1RA 1NP7A 4R81A 2QUBA 1JIJA 3L1VA 4G37A 3H3FA 2FNAA 1JL3A 1CERA 2WDZA 3GJTA 3KIPA 2XKKA 1O5IA 3PITA 5IKEA 4P0PB 1OFVA 3TZKA 1IB6A 2NPIA 4HG2A 4RGQA 4LC0A 4BV8A 1ZRHA 1W29A 4X7RA 1H94A 4X9XA 3FSEA 4B5LA 1OD6A 2GJSA 4Q7EA 1HDZA 1UMDA 1DJQA 1IHOA 1QZXA 2KB0A 3Q72A 4YRLA 3TLGB 5EQDA 2ZRAA 3TFWA 5KNBD 5LZ5A 2BRUA 2P78A 3FBTA 4JB8A 3C5VA 1DUIA 4ARVA 1PQYA 3E1SA 3KQLA 2XZTA 2QX6A 3EIQA 4FONA 1UZNA 3L8ZA 1QONA 2R8BA 1P0PA 4ZKDA 1IOWA 2EL7A 3HCFA 5DHPA 4F2DA 2NO7A 4GG1A 5EMMA 4INJA 4X84A 5D6NA 1CUJA 1YR7A 2MINB 3CS3A 4AJKA 2FEXA 3PX3A 2DHQA 1I13A 1YIAA 2NXJA 3AG5A 1T2FA 3C45A 4G0QA 4I2NA 4X6LA 3WRYA 4QJ3A 4E31A 3O93A 2V3CC 2PQ2A 2DLCX 2OAGA 3ZCUA 1RHMA 1FDTA 2JLWA 1GCAA 5KYWB 1MENA 1Q0ZA 5LN1A 3R4CA 1HLDA 3C7TA 3H3XA 5B36A 3U44A 3WSTA 1Y82A 1V26A 4ZOCA 1G1AA 2PL1A 5DGCA 2EFJA 3TNFA 5H68A 1SXGA 2BFBA 1EFVB 3VVBA 4C7VA 2POQX 2W58A 4IYJA 5KZMB 1KYIA 3ADCA 2FPPB 3GVHA 2B3TA 3Q3CA 5IARA 3RTGA 3CVXA 1LBHA 1TQ2A 4Z8YA 2C4HA 4WASA 1EP3B 1PT8A 1Q91A 4U7FA 1CIPA 3ZI4A 1QZ3A 4YP9A 2JLQA 5M2QA 3U60B 2I2BA 2FR1A 3FN4A 4TVBA 4DA6A 2WKQA 4MQMA 1Y8AA 2PK3A 3ZCPA 1VCNA 2DFNA 5FTJA 1Y8CA 2BSAA 4IO1A 5AXCA 2WSYB 4KNWA 3ZDEA 3HDGA 3TMYA 2F8LA 4TYNA 4ZC1A 5A6SB 4D2IA 4YO8A 1ULTA 3GJQA 1PFYA 1E2KA 3BRQA 4F97A 1N92A 4HQOA 4YP7A 2DSNA 2ERYA 3MIZA 2YQ5A 1X70A 1YQQA 2VVTA 4LRUA 3MWDB 5DW0A 2H85A 2PVCA 1WZUA 1QHHB 1Y8RB 1KGSA 2DTEA 2HU8A 1ATIA 2PH3A 2R1TA 4YLEA 3IP6A 3EIFA 5AK6A 3TEMA 5FDFA 2A0XA 3BK1A 3H9CA 5JSQA 1QAOA 1TYEB 1WSAA 3GCXA 1WPRA 1BCRB 5AVRA 1LS6A 1DJOA 1NU6A 1WXQA 3MGGA 3TRFA 2R84A 3BG5A 1YTUA 5MDHA 5SICE 3BL6A 4JL5A 2GRUA 5F51A 2W0MA 4E11A 3HR4A 2H52A 1A8SA 3U7JA 3WDSA 4PPGA 3UQZA 1C9KA 4K9SA 2JGLA 4KAAA 1UC9A 3ORYA 1UCFA 1ZGGA 3C6QA 2PUFA 3OIYA 4N01A 2D6FA 1O97D 4IVPA 3RFUA 1YJAA 5DNVA 3IQHX 1XA0A 3LL4A 4KYTA 3N2ZB 3S99A 5IHXA 1DXHA 2CMDA 3MWGA 2I76A 5IAJA 2C54A 3WLJA 1XB2A 3R09A 5K2OA 2ZDGA 3OKCA 1ORDA 2NO9A 3ZDFA 5KQGA 4DCTA 4CQMD 4AMUA 2VTDA 3GC6A 3GD5A 1EB8A 2CUKA 4R6XA 4KMOA 2O2IA 4AULA 1UOQA 2QDXA 4LI3X 1WCIB 4N18A 5JVDB 1OLSB 4IV8A 4P08A 1ZITA 3VXKA 1LK0A 4RIGA 4GSKA 3GG9A 4NECA 1CDZA 4HLDA 1X94A 4XJSA 3RSLA 2IHBA 4KXYA 1XMVA 3O8DA 5IUKC 4KR6A 5H02A 3H9UA 1NY5A 1SU4A 3AHHA 2DP4E 4M22A 3UK0A 3V5NA 4AY6A 2XAAA 4V0SA 4PYOA 5TDHA 3WLOA 3UVEA 5F5LA 1Y5LA 3MELA 4BEJA 2ZWPA 1JI0A 3F4LA 2PZEA 2IZ5A 3L40A 2VHEA 3OOSA 3ONEA 2JGDA 3ANXA 5CURA 1IN8A 2QN3A 2ANCA 4MYUA 2YC4C 1OR8A 4CHTA 1COZA 1X7WB 4N39A 1LX6A 1JYSA 2IP2A 2GZ3A 4KZKA 2JGIA 2B4KA 3C7DB 5GJVC 5GZ6A 5FULA 4LECA 5FBQB 3MWKA 3ZBTA 4CN9A 2R0QC 4G6ZA 5F4ZA 2OGZA 1KOLA 1CUSA 2DWCA 1UWCA 1XAHA 4JYCA 4UJ5A 3CRMA 1E1NA 4IMIB 2D0OB 4LJ4A 3ZV4A 3HVUA 3B5EA 2G09A 2ISQA 3PVZA 4YREA 3TQSA 3M1LA 1JG7A 1E0DA 2VNKA 5C18A 3RWBA 1AQJA 3QHQA 3W6OA 1HA3A 1NW8A 2J6IA 2WF8A 2G67A 3WV5A 1NPTO 5AM5A 4BMSA 2CNLA 3VPAA 4QDZA 5CBPB 5KHLB 3ABIA 4CLEA 1KZGB 1N2EA 2R6DA 1QKIA 3BKXA 2R5WA 3CUTA 5TC4A 1E2UA 1XD2A 2RBGA 3BTOA 3GW8A 5BW6B 4RGBA 5E4JA 3IAM1 1O03A 4YPFA 4O6VA 1XMXA 2W2LA 1ZWKA 3G23A 4MV5A 2XNSA 1YVDA 4OHCA 4Z7NB 1N3IA 3EHDA 1R1DA 1HYGA 2R8PA 3KAQA 5A7GA 3OFND 3RRXA 2AN1A 3LPLA 4FYIA 4HOYA 1E9DA 4QYMA 4N7RA 2F43B 4MVCA 2Z0MA 3SEZA 4L85A 4ZALA 4IEIA 4DE5A 2CJXA 2AKYA 2EW8A 3DV2A 5E8RA 3RK0A 3BEDA 1CUDA 2PWZA 3K1TA 4NHEA 4OXNA 3FDIA 3RQIA 2VWGA 2YVQA 4C87A 4NOJA 1N33B 2DFLA 4CR6A 4GWLA 4H7EA 4ZAYA 3RVSA 3NO4A 3HYCA 1QJCA 1S7GA 4M1YA 4KUHA 3WMWA 2MMCA 4KJZA 1KK3A 2A0UA 2C3PA 3DKKA 1GFWA 3UANA 3ZW8A 5CVUA 5FPKA 1FFEA 3MJSA 3UO8B 1PFWA 5CW1A 3ZHYA 2D2VA 1RM0A 2Q1SA 3A2LA 5GWXA 2CSXA 4H4EA 1LDYA 1B4DA 1DWOA 4PG6A 3PKJA 1EQUA 1U80A 2CXQA 3KYJB 2JJMA 4LE1A 4RKFA 1QYRA 5CPBA 1SCNE 4DKXA 1P0MA 2ZRKA 2AG0A 2HGSA 5JMTA 3CG0A 4Q3BA 5H8WA 1G5FA 4L57A 1F51E 5HIAA 3DVAA 1GPH1 1DARA 2J9FA 5HOQA 2JLBA 4WN9A 5EWLA 4B4WA 5D3MA 3L6OO 3NBZC 3ROFA 2XBLA 2VQFB 3ELUA 2G5TA 2X7HA 3DDWA 4H1UA 5CLHA 4K87A 3U3RA 3UPDA 5AUOB 3E5NA 1HFKA 4LUCA 3T5PA 5GIPE 2ODWA 4EG3A 1M6WA 2PV7A 1NYQA 5HGXA 1UZLA 4KYUA 3IIIA 3R5KA 4IIUA 3D02A 3X44A 1CEEA 1QYXA 2J4DA 1WL8A 5F2KA 2VHUA 2QENA 4LE0A 4NABA 4MPDA 1JZSA 2R25B 3LK6A 2BBOA 2W93A 5FNVA 3QU4A 3G2NA 4FIDA 4RANA 3TGWA 5JH7B 1RTKA 1X87A 3MW8A 4LF5B 4W4TA 5EXSA 5J2TB 2WTUA 5JAQA 1BWRA 2EZ4A 2PL9A 1VOTA 1T5BA 2ZTVA 4MS1A 3GPCA 1W44A 3Q40A 4OH7A 4YJGB 5JCOC 3RADC 3KG2A 5IH7A 1MPTA 4N7MA 3AO0B 2AZ4A 1A9SA 4NQRA 2J3KA 2MSNA 4OQNA 3MXOA 1P3DA 4GZ3A 4JGIA 4X6YA 5A9RA 1RFGE 3A3PA 4J7CA 3VVLA 2XMZA 3IMFA 4C1BA 2I3AA 2FR8A 3GRVA 2AOTA 1PR5A 4MW0A 2QGNA 3LWZA 4XH9B 1HDRA 2C04A 3B8EA 3GMSA 1R0CA 3OAAD 2JCBA 2P4EA 3PNMA 2XRZA 3IP8A 5JH7F 3LZDA 3CQ9A 1ZNWA 3L7OA 4B17A 2EDCA 3AVPA 1TM2A 4CBVA 5J2TF 2JFNA 3TLYA 1RI3A 3VZQA 2IH4A 4RQAA 4JSYA 1SC4A 3QU2A 4LNHA 1JDNA 4C4PA 4CQNA 1U4SA 4Y1RB 4RTRA 1KVQA 4QARA 3BD6A 1JKMA 1B42A 2JAQA 4PG7A 5CFNA 3T7CA 1CF2O 4BLPA 4OHFA 2CYAA 1MB3A 2BM9A 2G70A 1TD1A 4PC1A 3OZEA 4X8HA 3C3PA 1T0PA 1VE6A 1PZMA 3JD3A 3MJDA 1YSCA 2XVYA 5AM4A 4NC9A 5FPHA 5BN5A 3QKRA 1XE3A 2IYXA 2WILA 1T5HX 2HK9A 1YV9A 2WUWE 2ODPA 4YRZA 2AEEA 2G07A 3JSXA 1KNXA 2AI3A 2GF0A 3FZNA 4Q6BA 3WQSB 4NJMB 3P2IA 3RYIB 2XV1A 2GPWA 3PYMA 3O4JA 4QQKA 1UANA 2G0TA 3K2IA 4QYXA 2ABWA 1LCIA 3DM9B 3E5MA 3VISA 5IMSA 3N7TA 3P9IA 3Q9NA 3GNSA 1BQEA 2I78A 3ONFA 2RGEA 3V9AA 4BO2A 1D2MA 4RCVA 2HXGA 3H1PA 3Q3GE 4V2UA 1DG3A 4E5SA 3FKQA 3KZVA 1VJTA 1YA8A 3TNYA 5B3AA 1U9CA 1ZH8A 4PHCA 5ALXA 1L5KA 1VP3A 4OO3A 2Q3BA 4PC7A 5EXPA 3G5LA 3OURA 2DFVA 2P91A 5EA2A 5C8VA 2H5JA 3O7MA 1QTNA 5E4TA 2H48A 3O8QA 5EKUA 3T34A 3SZ3A 3H1BA 3O8NA 1K7FB 2YYZA 3I3SR 1K3FA 1MD9A 1EDBA 3G0OA 3MG9A 1OZAA 4EW6A 3H17A 4QGBA 4EYQA 1T2UA 4IIVA 3VR6H 4P6VF 4B44A 2FLWA 2ZZNA 1C9DB 2VBCA 3BZUA 4LXXA 1BD4A 1E3JA 3BBLA 1D1TA 4BEVA 2P9EA 1RRVA 1DPGA 3R7BA 4WSOA 4F3NA 3MCUA 4ZVPA 3E03A 1ACLA 3FYUB 3NEYA 4FUQA 4DG5A 1PR2A 1L5GB 2H7YA 4FCCA 3KTOA 2HY7A 1VLJA 3HY3A 1CFZA 2YNMC 2ZRPA 1VG0B 2QPAA 3BCSA 3ER8A 1AF4A 5DT2A 1IN4A 2GM5A 3WKBA 4XIYA 1H1LA 2QY9A 2FZEA 3QVSA 5FWYA 1YS9A 5IX8A 1ZP6A 3WP0A 2B21A 3NM5A 3D7MA 4UBJA 4EENA 3NONA 4G4SP 2P6OA 1V71A 2VDLB 3QF4B 5K4GA 5CCXA 1P0CA 1R16A 2W6ZA 1E4VA 4N7JA 1TI7A 2VIIA 3Q7PA 6AT1A 3UA3A 5FO0A 4YAUA 4BLWA 1G5HA 1ST2A 4OHUA 1RE0A 1Y1PA 1BIFA 5HFAA 1E2PA 4ESOA 2CL0X 2FJ0A 3ROQA 3D4NA 1TA9A 5JXWA 3PE3A 4Z9YA 2C7QA 4IF4A 4R2LA 1B1CA 1DRVA 1R8JA 1UOOA 4PBSA 4W5RA 4XM0A 4K8OA 4NCAA 3BC1A 4BGVA 1IG0A 2Y77A 5CD9A 4LRTB 5DM1A 1QV7A 4YJHB 2BGGA 4Q1EA 2PO7A 4LBWA 4MLZA 1G63A 1A7JA 5EYPA 2I4TA 4B2PA 2SCUB 2V3WA 3K8QA 5J40A 1OLUA 3OHPA 2BR4A 4M1MA 5L4NA 4L5JA 4AJJA 4C05A 1ZONA 4HXFB 3S2GA 2HN9A 2ZT6A 3DTNA 1HE4A 2D5IA 1HG1A 1KSFX 2OESA 3FY4A 4TYMA 3THWA 4KSBA 2GHIA 1M7HA 4JP3A 1BO6A 3CF2A 4RWEA 2IEDA 2R1ZA 5KPJA 4NEHB 1NM5C 4UZFA 1SXPA 3TS1A 3ZY3A 3ESAA 2QRNA 3BXPA 1W6RA 1Q15A 2FWNA 1J9ZA 2GDZA 4EKIA 4FD2A 3EF3A 4M0LA 2QZ9A 4FCVA 4X1YA 1JVBA 1VPTA 4PLZA 3U1TA 1YFZA 1FSSA 2CWWA 3QWAA 1X8JA 2BW0A 4UBOA 1QIGA 3IILA 4RM2A 4BO9A 1IBSA 3LGSA 1ZD4A 4MLDA 3IUJA 1IXRC 1KEPA 2NPOA 4DA9A 2HWWA 2Y4NA 2O4CA 4BUZA 4C30A 1XXLA 3CKLA 1UBTS 1AKNA 4HZUB 3LHSA 5CYFA 2VF4X 5FUBA 4O2AB 1FMFA 4AZ3A 3R5JA 3MJEA 4AT1A 1PWXA 3DL0A 2Q3LA 4E5VA 2JH9A 1R5OA 3CT6A 3ST7A 1EP1B 1SBIA 2J32A 1A3CA 2ZVDA 4C22A 4ZZIA 1TL7C 3U3KA 2FU5C 3UKDA 1SXJA 3P5SA 1U0OC 2BKAA 5KEIA 2X0DA 3ZY4A 1N6OA 1WXFA 5JDIA 1R4NA 3IPXA 5A71A 2PSSA 1DC8A 2DF8A 4BIIA 4YT4A 1YACA 2CNBA 4PRLA 2P2SA 1RI1A 4DMKA 3ITEA 4F1KA 5A7FA 5IABA 1Z12A 3GA5A 4JDUA 4LQ4A 4IFTA 2YZ7A 2ZR9A 3KOOA 3L01A 1U5CA 5CM2Z 2PUEA 4BNUA 2WTBA 4YJDA 4WOCA 3SPXA 3B85A 3I5XA 1XWFA 4O2AF 1R4ZA 4GXTA 4HFRA 2PS1A 4J0GA 5JSUA 2E21A 4BO0A 1ZISA 5KSWB 2PKEA 4QATA 2XJ4A 4EITA 1HYBA 1Z0AA 2VSNA 2XGSA 3OX3A 4EH1A 1NGSA 1Q95A 2OZVA 3FWKA 4JGBA 1ZVVA 3K9BA 1T5DX 2XB2A 2AS0A 1ZC3A 2GAAA 2GRAA 2G1AA 1FUUA 1KO4A 2AG1A 2VR1A 4XD7D 3VR2A 4B2LA 4AYWA 1KYWA 3KR9A 3ZH2A 3AUXA 3DDUA 3HYSA 3P9SA 4YJ2B 2Y71A 5E1BA 1M67A 1WRBA 4S0ZA 3SYKA 1R4MB 3HBMA 3H8JA 1NNSA 2E6KA 1J8YF 3ABQB 5EUBA 2Z6AA 5EMNA 2VF7A 4B32A 1F20A 3EGWA 4OGWA 5A5VA 5DLYA 5J2UA 4LMBA 1JLSA 4OU4A 4RVUA 1J1ZA 3I9V1 1DRKA 3QVMA 4LHWA 4MUEA 2JI4A 4UBMA 3HP1A 3SKVA 3PK0A 4MO2A 4BWGA 1I4TD 1A5BB 1N8SA 4EY5A 2VPXA 5BVGA 1NXXA 3WQBA 4TUYA 4EBBA 5DH9A 4ENWA 1I1NA 2PUJA 3EAGA 1FCJA 3O31A 3B7WA 3E9DA 4JIGA 1K63A 1TOAA 3EQZA 1HEUA 4YJ2F 4W5HA 5KHAA 2WWFA 1CZKA 3QMWA 4RFLA 1EJ6A 1JMVA 1QIIA 3M1YA 4OQLA 5AVVA 3DKIA 3OIGA 1XUOA 5EMHA 4NFHA 5P21A 1QMPA 4AUEA 1K6MA 4MAFA 3S7TA 4LHEA 5BO5A 1FP4A 4G0VA 3NM4A 2Q5LA 3EZ9A 4MUYA 3BMQA 4TYQA 5AFSA 5LP6B 2BT4A 2G25A 3JQAB 1QZZA 3ND6A 3E15A 3DUFB 3KOXA 2HU7A 4YXFA 5LUAA 3FLEA 2I6UA 2A0WA 3TBHA 2VQEB 4WZZA 1MUUA 1Y34E 4GDFA 2ZJ1A 2YWEA 4WOJA 3ZKWA 4MI1A 4EG1A 4DDUA 5EWJB 4YMTA 2V7PA 4Q9JA 2E85A 5JAOA 4EJ0A 1XTSA 4G9EA 4MCIA 1X15A 1TA4A 2IU4A 3H2HA 1K08A 1C3EA 3LA6A 4FZJA 1KE1A 4EFKA 5JFTA 1U0BB 2IYAA 4L73A 3MHTA 3Q2IA 4S1VA 2CMKA 2OGWA 2R65A 1H0HA 3PICA 5KVCA 2A92A 2PVPA 1WD7A 2H07A 3HFSA 3TW4A 3HS3A 3B1JA 4YB8A 1YZFA 4RK4A 1N6NA 5LP6F 5K03A 3JARB 1P5FA 3UK6A 1UDXA 2J85A 1XRRA 4PG4A 2Q7DA 4KRGA 2QRLA 2P3OA 3G8CA 3NRJA 4HH0A 5A6VA 3SHFA 3FVRA 3SFTA 3RS0A 2R2AA 4OBWA 3DEKA 3MD0A 1DEAA 1UK7A 4Q3KA 1KBQA 2OECA 2YMLA 4XVQA 1W581 4PC3A 4CG3A 1B0ZA 1HTWA 2P6PA 2CWDA 3A1NA 2UZ1B 2ZUDA 1WOMA 3O9MA 3IUMA 3UKOA 4DBLC 2BJHA 2IXDA 3IEUA 4B4KA 4YONB 8ADHA 4RULA 3GPLA 4LYFA 3R20A 2VJBA 1IQUA 5K4HA 3T94A 1XBTA 4CQLA 4DUZB 2R7MA 3IJPA 3RUAA 3K8ZA 3UCXA 4D6XA 1VLHA 3JQFA 3TZQA 3UPTA 4MP8A 5A06A 1RFLA 2GESA 4OYHA 5DO9A 1V7ZA 2WT4A 1F2VA 4G5HA 1QGOA 4EYKA 1KIFA 5CH5A 4P82A 2FHPA 4NKRA 1VDZA 3UK2A 4EGCB 1TLLA 1VKRA 5EJ6A 3GT0A 2VRNA 3DFMA 4N9WA 2BP7B 5JWHA 2Q4EA 2V6FA 2WHXA 3H9GA 4JJIA 1QRUA 4P0QB 3TOCA 3BDVA 4MKIA 1QLHA 3IVCA 2XXAB 1ESCA 2VHCA 4P0TA 3OFVA 1PWZA 4PSAA 5I9SA 3LO5A 1U4NA 1TVEA 4O0MA 4EELA 4K40A 3U61B 3AUKA 3OT1A 2W4QA 2R8OA 5IM4F 5TQJA 3SJBA 1I51A 1U3FA 4UUOA 1JFFA 4BKUA 4P31A 3ZDCA 4ZU3A 4HS4A 4CEIA 4OHOA 4WLEA 3DBIA 5KOHB 4ENUA 3HR8A 4YDQA 3Q8WA 1IOVA 1E63A 4EGFA 3BAFA 4NYJR 2P9CA 1BMFA 1HFJA 2OFWA 3W5UA 4LMRA 5EFOA 4HPWA 1EK2A 3OT4A 1KFKB 2QLNA 4DREA 5JAIA 1VFPA 1FPQA 1YS2X 2IBMA 1CC1S 3G6KA 1U9IA 5ICEA 1KZHA 4KI7A 3ZWCA 3H2IA 2ZIAA 4NU0A 1E6EA 1HT1E 4MW5A 5BPHA 1I6KA 3FPFA 4NNJA 1AZTA 2NXWA 2AOVA 1AO3A 5GGXA 3SIWA 3VKVA 3ZJ5A 4B74A 5HZGA 2CXPA 2GZMA 1M1YE 5D1NA 3NHSA 4UPEA 4PSCA 1FBTA 2DFPA 3E7WA 4PAGA 3L7KA 4K6CA 1W34A 4J1TA 4M9UA 1EWTA 3K6RA 3UGKA 3EGCA 4PYMA 5L45A 4HF7A 3KQMA 4R40A 2GPJA 3G7UA 3S8MA 5L7WA 3K09A 4D81A 4D57A 1DO8A 1GARA 1OWLA 1P73A 2EFCB 3CPHA 3U4CA 4B7CA 1RQPA 2BH2A 1THTA 4ID3A 3P8ZA 5E8JA 1D09A 1Z25A 4IGFA 1I5RA 5LOVA 1KTIA 4RTOA 3MNFA 1G291 3VQTA 2REBA 2A57A 1B14A 1GR1A 1W87A 3K0CC 4GEGA 4KYIB 4QBHA 4TMYA 3TJZA 1A8QA 2IEIA 4GLFA 1WP4A 2DWOA 2J48A 1BXZA 4KAJA 4E4RA 2POCA 1W5SA 1M83A 1FYXA 1UZUA 4CT4B 4HRXA 3KXIA 4NCNA 4WUTA 5CLLA 3SX4A 4UU8A 2GAFA 4W5TA 4GEKA 1I9CA 2XNDA 3DMTA 3U4QB 4B6PA 2IWHA 1T4GA 2I5PO 4LHSA 3E7XA 3WYGA 2MSWA 1YUMA 4WXEA 2CLCX 1OH8A 1NKVA 2CVQA 1RJ9B 1ZG3A 2D54A 1HDGO 4K6HA 1CBUA 3IKTA 3W9YA 3BH7A 1C0EA 3TG8A 3PUHA 3QUTA 3R5TA 5DJ5A 1N78A 2RHGB 1DFGA 2IEAA 3AETB 4N03A 5DCUA 3W5SA 4CF7A 3LT0A 2ADOA 3RVBA 1N2HA 1LZLA 4HLNA 5FA5A 2VDKB 3TKAA 1JMYA 3M5WA 3SVZA 5JUWA 4N5DA 1DT3A 5IBPA 1KDZA 3TQQA 2EHJA 4E5PA 3QQPA 2F67A 5HR5A 4KLZA 1PV4A 2DRIA 5I9LA 2QAJA 2EW1A 4O8CA 3FYTA 2OOKA 2V03A 3I6YA 3RM3A 3WE7A 4WBNA 5F7ZA 4BQRA 3UMRA 1WCXA 3KT8A 4K2AA 5DHUA 3S28A 2HHHB 1FXWF 4LFAB 1Q1AA 4WERA 1KJJA 1SMKA 3CGGA 3G2PA 4CQMA 1N2XA 1A8IA 2XXAA 3JD4A 4JQCA 4BGIA 2OZKA 1EM8A 1IOZA 1PLKA 1OGYA 2EDAA 3G2LA 4NPAA 3CLHA 2LDBA 3S2IA 3T3DA 2G76A 1UBHS 4RGYA 2VAWA 4AZ0A 1SQ6A 2C9MA 4BE7B 3LHKA 4EVIA 2FUKA 2WFLA 5ENZA 4C43A 1KF0A 4HAIA 4CLHA 4H6XA 4TN5A 3SIRA 2XMGA 3AHJA 3K94A 2BHSA 3SFZA 5IG2A 3RGGA 2FMKA 4PLWA 5JAUA 3EDYA 1C9MA 1Z07A 4F45A 2R00C 3LNCA 3CLRC 1JAZA 2A1UB 2OYCA 3I0NA 4BMPB 5LKAA 1OYWA 2IC5A 1XLUA 4L0MA 1NW6A 3RPEA 1W96A 4LSWA 4X7BA 3ZHRA 5DTRA 3INYA 1U3VA 2DUNA 2OMEA 1MB2A 4TMVA 3UTCA 5EHIA 1MABB 1AA6A 1WPXA 4IIXA 3NANA 1OW3B 1PQUA 2B1JA 3H1FA 3T5DA 4C04A 1OCEA 4FYHA 4NYIR 5KYKA 1J8FA 1RCFA 1MDBA 1ODCA 4LDPA 3U7QB 4MRSA 2ZUSA 1VHJA 4EECA 2GZHA 1XXHE 3IHKA 1RS0A 1RBYA 4EY8A 1ONOA 3KHUA 2VLBA 3WK5A 4JC0A 4P7GA 2P9QA 2CKDA 3ZGZA 1KK1A 1FP7A 1WUJS 3PWKA 1CUFA 2O2EA 3T3OA 4Q16A 5TY0A 4LFBB 2JD1A 4K26A 3A4LA 3OFNA 3HR7A 4ZDKA 4TLLB 1E7YA 1IHXA 2G7ZA 2VZLA 4I66A 2Z30A 5TR9A 5KX5A 1ZZGA 3ZHQA 3NEJA 2C2XA 2PYDA 5HJEA 1NBWB 2WQZA 4JROA 5GV8A 5CXUA 5PNTA 2Y93A 3IRUA 3D4PA 2WICA 4IRMA 2X2PA 4ER6A 1HETA 3AM3A 2ZB8A 3ETDA 2ZSDA 2D1TA 1LBTA 1YDMA 3L0IB 1KFEB 2QVZX 4HGQA 3VBCA 3H9QA 3CXRA 3GMDA 3GAMA 4WY8A 4I4TB 2I8AA 3GFRA 4XRGA 2PBLA 5GONF 1RWMA 2INGX 5TQ0B 3OBIA 2XF2A 3OZTA 2ZIGA 1PL7A 1NRIA 2FUNB 5ALMA 5J3JA 2WNSA 4RENA 2JJYA 2CZCA 4Z7OB 5SZIA 3G89A 4I9HA 2WAXA 1SOVA 1LSOA 3KWJA 4MZDA 5BUZA 2FPUA 2BMFA 2YVKA 3RSSA 1PSWA 3LCMA 1RACA 4RVDA 5CDHA 3PQEA 2FW6A 3NKFA 4COOA 1MR3F 1B0PA 2QTHA 1TX4B 2HADA 4QRHA 2EJVA 1A50B 1XC7A 1DPFA 3W5HA 3HB0A 2QT1A 3LM8A 2QD2A 2HT6A 3FYHA 4L16A 1IZZA 1ZX1A 3TR5A 2J3LA 1VYTA 2Q2QA 2HUNA 2M32A 3R1IA 4X5OA 1KHTA 4ZT7A 3PEWA 4HMOA 1ZNZA 1IFXA 3DJFA 4ZQCB 3UV7A 4DDWA 4F0JA 5AK0A 5ARBA 4TTJA 1AZLA 3GLHE 3QG1A 3FGZA 2GK6A 5CVVA 5EIBD 3AEQB 4HFNA 1ESDA 4LV6A 1N5KA 2E4ZA 2NUAB 4FE3A 4L5CA 1QYDA 3LPDA 3NB0A 4MICA 4X64B 3OEHD 5FB3A 1ZIXA 3EPPA 3MGAA 3VSBA 1GA1A 1T8RA 1YR9A 3BH0A 4ITUA 4M4SA 1M1NB 1SQSA 1WTAA 1XMIA 3OKPA 2FFBA 4IHJB 1ABFA 4J49A 3S55A 3VSAA 3DC7A 1V16A 1NLUA 2ZTSA 2VJAA 1J9EA 2Z1DA 3MYYA 3HY6A 5D5HA 3RUEA 1EDOA 3OJEA 1ONBA 5IF9A 3C87A 3OIVA 1I30A 2JD2A 3NHFA 3QENA 5JASA 5D2CA 2I4IA 1U2DA 1JS1X 4OM7A 4OUDA 2PH7A 1T2EA 2CBXA 2I80A 4LHXA 2XWBF 1XIVA 2GHTA 4OQFA 4TXMA 1FP6A 3D4IA 1FTSA 2IITA 3OAAA 2ZJ2A 4CTKA 1M6EX 1YRAA 3IE2A 5BY2A 2QAIA 1NBIA 2R8RA 2XE4A 1QF7A 3Q9LA 4WLNA 3ILHA 1GFSA 2MYPA 2PFGA 3QVUA 2ZE8A 5JPIA 4RD1A 2B36A 3NS7A 4RTJA 2GZRA 2V7WA 1UJNA 3R5XA 3LUAA 1HRDA 4ONEA 5KNCD 4E30A 3K6SB 3E27A 5DM0A 4DLBA 4DDTA 1JVNA 4JLPA 1I3OA 3WMRA 4CJXA 5K8CA 2C7OA 1E8DA 3NHYA 4R8SA 4LPSA 5CVJA 2BFNA 1W4BA 3R3YA 4AKEA 2PUGA 1MO3A 3JRWA 3P0IA 3VKHA 3U80A 2WABA 5ICFA 2F90A 5B37A 1Z37A 4OG2A 5EKXA 2A9QA 3DWFA 3KYDA 5BW8A 1I0LA 4NE7A 1NOKA 3DULA 3D0QA 1IN5A 4RPCA 1G6Q1 1U2GC 1YJQA 4S3MA 1VKNA 3M1IA 4FHZA 4ZOQI 4RNCA 1JJFA 5AXAA 3M6UA 5AKLA 5A4KA 4MV0A 2H1IA 3MMPA 3S7ZA 2C3YA 3GZTB 3TXAA 1ICEA 4I1UA 5JMOA 3FWPA 2FGJA 5FO1A 1CY4A 1KERA 4YDHB 2Y1WA 1R0ZA 5D84A 4TSRA 5DNUA 4DM3A 4ZN6A 4WKNA 5IANA 5CXSA 4G85A 3NGXA 3KSMA 4F04A 4KXVA 1B15A 1R64A 1DO0A 2HWUA 3BICA 5AJWA 4OI0A 5IBQA 4LY3A 2FSSA 3C74A 3DQZA 1DTSA 5G02A 3DLPX 4G4JA 2GR9A 1CK4A 1E2QA 2PQ0A 4KPUA 2AT1A 4L6AA 1O4VA 2EFEB 3OCJA 2AR7A 4F9TA 1AK2A 1TVCA 2QBYA 1Z39A 1U28C 4E14A 4GVPA 2WT9A 3KJQA 2JFPA 2CXNA 2NU6A 3LXMA 2QG6A 5GZ1A 1KZ1A 2AMFA 1G3MA 1II8B 1NUUA 2UDPA 3A6DA 1M2OA 4LNUB 4EAAA 1XZFA 1Z6ZA 2ZATA 1D04A 3ROPA 1NXQA 2I6QA 1XGKA 1C5KA 5BOSB 1OI7A 2J9RA 2YJTD 1NE7A 2X5KO 2XECA 1NMYA 1JSRA 4IZHA 3K70D 4AWXA 3W77A 1T0UA 1EX6A 4I3FA 1L5HA 2EIXA 1OVMA 4FYVA 4M99A 5LYJB 4TLDA 3BN3A 3F5MA 4TWZA 1M54A 4BV3A 1P31A 3C6YA 1OTXA 3I2YX 1YJBA 3QXJA 2QMHA 4GD3Q 3N9IA 1ADBA 3RUIA 4AX8A 1TEHA 4Y2VA 4EW1A 5HQJA 4V1CB 1IEQA 3CT4A 2P2ZA 2IXAA 2DFTA 3IMKA 3INRA 3KJIA 1T1IA 4ARBA 3HL4A 5KVVA 3C3EA 3H16A 1SCUB 4YAFA 2ZAMA 5KQLA 2IX3A 3GWZA 1B2LA 1JEYA 1RC0A 5F3RA 4J91A 4UDNA 4BNZA 3O74A 2GA8A 2WKSA 4IUCS 4Y7CA 1XQ6A 4CIBA 2B61A 1JDUA 1ZN9A 3R4VA 2R6ZA 1MPXA 1T4CB 3IQFA 3N07A 4GI7A 2O1XA 4KWTA 5FV4A 4LY6A 5HHTA 1GZSA 1T9ZA 1BE1A 3FTNA 3HSYA 2AD1A 5SZKB 1R6VA 4MW1A 3T1YB 3VMFA 1UIRA 3OTHA 3EX7C 4S24A 3WSWA 4OQQA 2BFAA 1YQWA 1UFKA 3BMOB 3LRPA 4TM7A 5A9TA 2EP7A 3L0CA 2XVZA 3WC4A 5ALKA 2NQTA 1F6BA 4YCAA 3RC7A 5LPNA 3WRWA 4DBVO 5E1DA 5F9MA 2BGKA 4PX3A 4JVLA 4A6PA 3FETA 5IWAB 2VDWB 5CNIA 2GD6A 4BNLA 5C80A 3C1AA 1SWVA 1BVYF 5COQA 2IODA 3GZNB 1NXTA 4U00A 1Z34A 4QDUA 1BAPA 2ZSHA 4D9FA 3DFFA 4UTNA 3RABA 2WG1A 3U16A 3NGLA 2OHOA 3JQGA 3HBNA 3LUKA 5DNDA 4EEKA 3SF0A 2G8NA 4J0FA 5T64A 3W6UA 1M2KA 1HV8A 3PC8C 1LSSA 2PLAA 4G07A 1W85A 5T7BA 1EFHA 1OFHA 3PXBA 3KQKA 4QE3A 3RJZA 2YUTA 3CW2A 3BJRA 3LWBA 3GNLA 1XXHB 3UNXA 4IW3B 3C3MA 3G02A 2PGXA 4ISBA 2C78A 4BEBA 5FTLA 4LBVA 1BX3A 4BLOA 4D9KA 4NMHA 1F6DA 1SNYA 4R3NA 2QTMA 4UHHA 3DF9A 4Y3UA 3OUZA 1AQYA 2P5TB 4HDNA 3T5BA 4DHWA 2IUTA 4NXMB 1F8UA 1E3SA 1JALA 3ORRA 3W6NA 4ZMSA 4Y9TA 1ZAKA 4YA6A 1IRXA 2HW8A 1RM4A 4PM4A 3O9VA 4YAGA 2I2XB 5REQB 1OJ7A 1QOZA 4RQTA 4FSXA 4LYDA 4C4TA 3FFTA 1H1DA 1W8DA 2PS3A 3DEFA 3ZCVA 3RFCA 3GDHA 3FSRA 2D2IA 2V7EA 3UWOA 3WWYA 5CK4A 1INLA 3BWDD 1H1TA 4PZ0A 1NNEA 3SJCA 2P27A 1WOYA 2OORA 4JN6B 4XD7A 2HWXA 3QHAA 1S3FA 3TOZA 1TAUA 4CM8A 4RACA 1R00A 1MT0A 1JBEA 3S3TA 1YO6A 4F5ZA 2L69A 1KOFA 4IJUA 3T1NA 2FWBA 2QTLA 4UVDA 1U3UA 5H1YA 3CWCA 1B6SA 3IQEA 4IOJA 1CRQA 2NOAA 1ZD5A 1S2LA 8AT1A 4R7ZA 5JYDA 1RXEA 4LKOA 3DAYA 3OECA 2B20A 3QJYA 2R4TA 1JHYA 3IYLW 1CUZA 1KXJA 3KR2A 1V8FA 1NMSA 2PX2A 4I3GA 721PA 1U2ZA 1P1RA 1Z5GA 1CUGA 3U7HB 2V65A 1OGIA 4MCHA 4LJ9A 3BIJA 2VXCA 2A5LA 3MLBA 2D1QA 4DV0B 4GOKA 2WPDD 2DJ5A 4V0ME 2J46A 3O3NB 1CWUA 1WB5A 5F2EA 1CUEA 5FF9A 5SY6A 5AKGA 1LRLA 3BXXA 1BWPA 1YQTA 2Z5GA 4PZEA 3EN0A 3L0DA 2OE2A 3EGEA 4Y6RA 4E21A 1YDFA 5HW0A 4NENB 1Z0DA 5JS8A 3ORSA 4G4IA 1FRNA 3FGPA 4D7AA 4UM9B 5HTOA 1II0A 2AMLA 1S8OA 2PLFA 4IKPA 3G82C 3I2KA 5D85A 4L3OA 3VJKA 3W4IA 1H4QA 2OP0A 2JZCA 4Y18A 1P77A 4TV9A 3NR2A 4PE5B 3EF0A 4FKZA 2XKBA 3IQIX 5DFAA 1Z75A 4PRKA 3IPCA 2RJNA 2BFEB 3H9JA 3D8BA 5E2IA 3AHIA 3QVTA 4XARA 4R7TA 1ADCA 2PXCA 1EINA 1T5LA 3E3LA 3G2KA 4YP5A 1P9OA 4H6WA 3NKLA 4IJMA 3L9XA 2NYUA 3H0EA 5HE9A 3ZW9A 3ZJUA 2ANBA 4Q4AB 4UD2A 1BRTA 1Y6JA 4O4IB 4AMVA 2FFHA 4OB8A 5AM0A 4Z9XA 2C7GA 2RDMA 5COAA 3R74A 3N2LA 5KKNB 2MTBA 2CXTA 2GKSA 1Z6XA 2R8EA 4O2BB 5SYMA 2JKYA 4RVHA 1DJPA 4YXWD 3T7JA 3LLSA 1Y63A 2WIGA 3AB8A 1FXUA 5DHQA 5E6SB 3WHLA 4RY9A 4X8LA 4LPKA 2Z58A 2W98A 3MSXA 4CL0A 1J0XO 3TGPA 3L5KA 3IBYA 3IVRA 4MAMA 1NUSA 1U9JA 4J0DA 4MW6A 4OMUA 4RABA 3KSRA 1LK5A 3GUVA 4UPVA 2A84A 4Z86A 3CVWA 4M89A 4D02A 1JEOA 3OJCA 4G86A 1ZI9A 1KP3A 2YQZA 3P5BA 2B1RA 1N1GA 3EVNA 4L0DA 3U26A 2LD4A 3P20A 1N0VC 2VJMB 1F2TB 3BYZA 4FYPA 2CDCA 3I9FA 4F7DA 1ODIA 1JR3E 1NR1A 3X1ZA 4E12A 1MO5A 1EZZA 1T0JB 2E89A 2O0MA 3HJAA 4O4IF 4AY3A 3OO1A 4ILEA 2VJOA 3QQ5A 4RA6B 3V00A 4ILKA 3F74A 4O2BF 1YDGA 1XPJA 2ZYRA 1BEEA 1I32A 1NLZA 3PWSA 3F98A 4M36A 3CUSA 4ODIA 4OGLA 3I4CA 3UXMA 3FYCA 4HUQB 3MYRA 5LZ7A 1F0PA 2ZSUA 3OQNA 4GLLA 4CDNA 4EBFA 4XGNA 5A4FS 3EARA 4WNAA 3GUHA 1XTPA 1QCCA 1OILA 1RHUA 2F8MA 3SEFA 1O58A 4US1R 2BIFA 5I8PA 2WSLA 2HF2A 3RTBA 3R0JA 2H1HA 1C9JA 4DEXA 1CVRA 1XLTA 4PHFA 3KUUA 4R1QA 3CUVA 1L9KA 1X7DA 2AF3C 3QLTA 3BRCA 4JENA 4HR7A 1XEAA 4FNMA 5DYNA 5ED0A 4K3VA 1Z4PX 1OH7A 4GQBA 3WYCA 1DDIA 2AN5A 2PS9A 3MBKA 4Q9LA 3STTA 2PZAA 2W6ID 4OOFA 4URVR 4RDIA 5B4UA 4Z7QB 5EIFA 4XDHA 5DLEA 3T7SA 3N74A 2IELA 2GLUA 4KXQA 2JFOA 3HU1A 4PRYA 1U8EA 2P3LA 4EG8A 3G8YA 1N2GA 4QXMA 2FLVA 2Y0CA 3QYPA 4N1AA 1FRFS 1FEZA 3OY2A 1T1JA 1IY8A 4JEIA 4OXRA 4V2IA 3O2SB 1LX7A 1SHLA 2P9HA 3IAUA 1C50A 2EJTA 4WJKB 5EHGA 1NI4B 4P81A 2W6NA 3FBGA 4ZQGA 2JLVA 1BYUA 1PR3A 1PS9A 2W2KB 5HP4A 3OC6A 4D92A 4HAWA 1QV6A 2I1WA 2JD0A 4WV3A 2RH4A 3VO8A 5FR1A 3VNQA 3H6GA 4XSVA 2H92A 2R1UA 5AJYA 4BPRA 3NGMA 3ZWPA 1ESMA 3USCS 1TUIA 2WTAA 3LY8A 1RAFA 5F9FA 2DM6A 1O95D 2J41A 2BEKA 1QQ6A 1CS4C 2X9VA 3HUTA 2YJ6A 2PKYX 3B6JA 4LRQA 3ZHZA 1SC3A 2R1VB 3RT7A 5CGQB 2IP4A 5JAHA 1X7ZA 4IHKA 1EFPA 4J07A 1CS0A 2ZIFA 4G8JA 4EY4A 3W2EA 4GXNA 2VPQA 4U7WA 1BX1A 4IDDA 1UC8A 4J7UA 4UKDA 1MA0A 5K0NA 1KORA 1I80A 3LVFO 4LVUA 4TXLA 5EWMB 1YI0A 2VK4A 1WLYA 2QTTA 4HNAB 3AFMA 3T1HB 1GQOA 4ZVVA 4HEA6 4WESA 3TSZA 1JH9A 4DARA 2H65A 2ZRJA 1L7BA 1PK9A 5JFOA 2KLBA 2Q9AA 3FPSA 1TGYA 3R7NA 2C9DA 4E3WA 5TJHA 2AX4A 2WJVA 3PHBE 4AG5A 5FTMA 2C8JA 5K8VA 2AE2A 2HJRA 1TEZA 4J0JA 4MGZR 4HDAA 7AT1A 4EKEA 4CM4A 3FDZA 5FOVA 4YWJA 3LV8A 4IOMA 5IT0A 4ZO7A 3WADA 3BGOS 2IZ1A 4CMAA 2B2NA 2I54A 1N5DA 1N4DA 2J4FA 2ZJYA 3PEFA 3WIUA 3F6PA 1SCKA 5FUYA 3I12A 1XRMA 1VM6A 1T3TA 3LDGA 4MQEB 3CY6A 4MUIA 4YDRA 3HFGA 2FP4A 2QTFA 3WRXC 4XVCA 2XMQA 2O1SA 3WGTA 1GYPA 5E9QA 2KHZA 5AVJA 5AI8A 4MQLA 1HUQA 4GICA 4C0AC 5B5SA 5HZHA 4QFCA 4RU1A 4F96A 3UMBA 1I3KA 2O8NA 5FOSA 4LXHA 3HN7A 5KYVA 2YWBA 4O4JA 3B1WA 3WMEA 5JAZA 4E03A 5KB3A 2V6BA 1C3VA 1AB5A 4DRXA 4PTYA 4JBLA 2NYVA 4A8JC 3R0VA 3HP7A 1W4RA 1SZCA 3D2LA 4QJBA 2PHZA 4OI2A 4DADA 2A9OA 4HO1X 1OV4A 2GGSA 2O07A 2HZ7A 3TTTA 1UBGA 1IH8A 4X0EA 3NPMA 1A98A 1GTL1 3D4BA 4YROA 5I9BA 3GLIE 3WHPA 4TYYA 4LEIA 1CVIA 3BE4A 1A1VA 4LWQA 3AFOA 3K0AB 4C7OA 2JEZA 4RJJA 2P40A 2VHVA 4YUZA 1DX9A 3FPHA 3V4LA 3AEXA 4E7OA 1C81A 5BMOA 1PEDA 3AR2A 5DI3A 3A05A 4C2UA 1FS6A 2BM8A 1IQPA 2DUMA 1CX9B 4E07A 2YHBA 2ZJ5A 2WUDA 3GNQA 4I4NA 1EPUA 1YB4A 5AVOA 3SZUA 1JHMA 4G1MB 2QMEA 2RGBA 2CNKA 2QRZA 5AW8A 3JYQA 5FI5A 5AW0A 1LDEA 3DHNA 5TB5A 2X0EA 1YQUA 5TARA 5EVJA 2YQ4A 5EOVA 4IINA 2MHCA 3BH6A 5KOIA 4QGGA 5JALA 2JAOA 1N7HA 1NXOA 2VK1A 2WV7A 3RFXA 3EVAA 5HF8A 4NONA 1CQWA 5FFMA 3VV2A 4C4XA 3MCZA 1DXYA 4MR8A 3ICOA 4UD6A 5LFAA 1P9RA 2IYYA 1G6OA 5I7UA 1BW9A 3DXYA 1PJSA 4G36A 4ZO6A 5KI6A 2EBHX 4LC1A 2JZNA 2JVKA 3DMRA 3PFIA 5KVQA 3UCFA 4NBSA 3ZXUB 4DEVA 4LYGA 1S8AA 2DT5A 3TLCA 2OR3A 3I64A 4DIUA 2P9FA 2D4HA 3KKNA 4OVKA 4W8OA 1V7CA 4AECA 1EWYA 3EJ6A 3N75A 4OHKA 5ERXA 1TT5A 4FILA 3E5HA 3UF0A 3O4FA 3UMJA 3HRIA 4KX5A 1U2TA 5EAIA 3ANLA 2PDAA 4HADA 4C08A 4IKOA 5TGTA 4FR0A 1RWWA 1VHWA 4M76B 4ZREA 5AOAA 3E9RA 3H1AA 3QE0A 3IBTA 1B8VA 4S2UA 1DHRA 3GVCA 5IU6A 1DBPA 1MRSA 3UK1A 3WLMA 5K6RA 5H9VA 4NCBA 1AE1A 1PEAA 2HJSA 2YXBA 3A14A 3DXXA 4FNGA 3TZBA 1JFSA 5C35A 1MHPA 2OCYC 3ET5A 2EKBA 3PPIA 2WAMA 4I19A 4KXLA 2NU8A 3N39C 2E4YA 3C0KA 1ZL0A 4RA9B 1J00A 2K4MA 5B6JA 3FDJA 4ZTZB 4GGOA 2H4FA 1K6XA 2DT8A 3E2MA 3J81k 1PZHA 1G21A 3EFEA 1UMBA 2X8AA 4PO1A 2UZ0A 4QO8A 5LB4A 3ZTWA 3WNDA 4G1FA 3COZA 3SYMA 3TW6A 4YAOA 5JROA 1CQXA 2WLTA 4J8PA 2JIZD 1PW7A 3D7SA 4MVJE 3VR5H 2EERA 3ZBPA 3H8WA 1IBLB 4ZCTA 1X9IA 2X4LA 3HSSA 2V97A 4ND4A 4QBGB 4XCVA 1E9FA 3KE8A 3OWXA 4G24A 1JQAA 1GAQA 3FOAA 4G56A 4QEDA 2DPLA 2B3DA 2IF2A 3DJYA 3VU9A 4PW0A 1UL1X 3WGJA 3DM5A 3ZD8A 4JCCA 5INTA 3I30X 1Y3IA 1QAMA 2CMFA 2XW6A 3BMCB 5BSUA 4EG7A 5DISB 1YDEA 3DFKA 1DZ3A 4RY8A 4TKUB 3RDPA 3RFVA 1CU1A 3AZQA 4R1UA 4BATA 3QGMA 1RLOA 3RS4A 2CHFA 1DNPA 3PWZA 1NR7A 1RAGA 3AKYA 2J5RA 1RQ2A 3O0DA 3OEHA 2QA5A 3OIUA 3PJEA 4R2XA 4YV2A 4Z9FA 5I7RA 5U9CA 3WRYC 5JZMA 1Y5IA 3I3OA 4X41A 3THYA 2W83A 2AEFA 3GUCA 3TIFA 1G4AE 1AT1A 3WGNA 1NVWQ 3FCSB 4Z3DA 2WD7A 2ATEA 3TCXB 4AP6A 4HQKA 1T26A 1JXAA 1SUCA 3ACDA 5LP1A 3CV3A 1A95A 5JCZA 3IR7A 1MH9A 4L8VA 3FROA 5FOUA 3R8CA 5LQJA 3PRYA 2BM1A 5FHQA 1DKOA 2RHLA 3ASZA 4ALNA 5C51B 1IHUA 3JQAD 1C7JA 2IIQA 2R66A 1V8OA 2ZBVA 1IY9A 1A1SA 3AQ4A 3D6FA 2PUHA 3N2KA 5ECGC 4DAOA 1NC1A 2V0GA 1GYQA 4YUAA 1NDUA 1JHOA 4GO1A 3GQVA 3ZIAD 2RGNA 3AJDA 1AUOA 4HEHA 3CX8A 4HLQB 4KN5A 1X8KA 3VPBA 3T7DA 1NASA 3NOXA 3PC4A 2QZZA 4MS4A 3T12A 4RPHA 2CFIA 5ETJA 5KNCA 2H11A 3W2IA 4IX1A 3UT0A 1OVGA 1P72A 3L1UA 1ZUIA 1YCDA 2EBWA