5JNSA

Crystal structure of human low molecular weight protein tyrosine phosphatase (lmptp) type a complexed with phosphate
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
152
structure length
152
Chain Sequence
b'TKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
molecule tags Hydrolase
source organism Homo sapiens
publication title Diabetes reversal by inhibition of the low-molecular-weight tyrosine phosphatase.
pubmed doi rcsb
total genus 64
structure length 152
sequence length 152
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5jnsA00
2FMKA 1AB6A 1RZRD 2B4AA 1QP7A 1JLKA 1SRRA 1ZN2A 2LBPA 1K66A 3D8UA 1NY5A 2HJ9A 1CHNA 4UHKA 4RKQA 4PICA 4EGSA 4KREA 4N76A 3CRNA 3BRSA 5FWYA 2CHFA 2OENG 2MYNA 4MPTA 2PUBA 4H60A 4Z99A 2YHBA 1RPJA 4M88A 3OQOA 3MF4A 5ABPA 3QLTA 1XWWA 2GX6A 3A3KA 4MQEA 4TN5A 3BREA 2KYRA 4KVFA 5B3JC 4YR7A 2IPNA 5EWJB 3RVPA 5IX8A 1Z25A 1ISSA 2AYXA 5BRJA 1P6QA 4MRMA 3ILYA 5HM6A 1RXEA 2MYPA 1EWKA 3OLYA 5KWSA 3LUFA 1QP0A 5HKOA 2QV0A 2B1JA 4RK5A 3RVNA 1W25A 4MR8A 4JB0A 1D1PA 4O5AA 4JB2A 4YWHA 3EGCA 3KYJB 4PE5B 1F4VA 2GWRA 3LUCA 1EWVA 4EVRA 6ABPA 1CYEA 3HXMA 1ZGZA 5TPZD 1ZAYA 4PEVA 1XHEA 2WRZA 4ETMA 1TLFA 3T8YA 5EWMB 2JVJA 3CS3A 5TQ2A 5FWXB 1L5ZA 3OLZA 2HQBA 3NNNA 1YVUA 3JY6A 4NCAA 3ROFA 3TO5A 3O2QB 4MR9A 1QP4A 1HEYA 1P2FA 4RY0A 5TQ2B 3OMWA 1MIHA 3TD9A 4F11A 1M5TA 2FVYA 5JNVA 4MR9B 2PKXA 4ZMRA 3D02A 2PUEA 1Z12A 4XARA 3KLNA 2RGYA 3CNBA 2WJWA 3ILHA 4YLEA 4Z4FA 4Z4EA 4GPAA 1ABEA 5CNMA 1Z15A 5DTEA 2NUBA 2E4XA 3RVMA 2IOYA 4Z4GA 5C5CA 5KC8A 4S05A 4NQRA 2N9UA 3Q41A 1YK0A 1LBIA 4RY8A 3H6GA 5D2CA 3K9CA 1DCKA 1TVMA 2X7XA 4MR7A 4Q6WA 1JFTA 3CLKA 1M5UA 1JBEA 3GV0A 5HQJA 2FQXA 1ZITA 1W9HA 4MLDA 1OXKB 2GI4A 3F6CA 2NT4A 4KK4A 4P1ZA 4EVQA 7ABPA 1PEAA 1QQBA 1VPWA 2GKGA 3HVRA 1DC8A 1YMUA 3CZ5A 3H75A 1YIOA 2FXIA 1Z26A 5JNSA 1D1QA 2LIVA 1ZH4A 2FQWA 4OLAA 3IPCA 1DCMA 1USKA 1NXWA 2IDMA 3N53A 4G0PA 1NXSA 3OLXA 3RQIA 3HM9A 2RDMA 1JWLA 3URMA 4KK3A 3EJWA 4TLMB 2QZJA 3A0UA 4G86A 4EYGA 1BDJA 2F8SA 3SM9A 3QX8A 2IPLA 2PJUA 4N0QA 4Y9TA 5F64A 3NNDA 4DADA 3GYBA 5E3JA 2V0NA 3GBPA 3GRCA 3O1HB 1USIA 4Z0NA 3CG4A 2JVKA 3FGZA 1K68A 4RXTA 1U8TA 3JTEA 5IUKC 3NHMA 3JS5A 3C3KA 3MQ4A 4IGAA 3O1JC 1J56A 3H6HA 1E6LA 3KKEA 3R0JA 1YS7A 2NZVG 2L17A 3N8IA 3FDFA 3GWGA 4JASB 4FE4A 4S04A 2DRIA 4W5TA 3JPYA 3MMNA 3KS9A 4KQ9A 2F8TA 1L5YA 3N6VA 1E6MA 1WETA 5FWYB 5CHYA 2HPHA 3LUKA 4JA2A 3O2SB 2H0AA 5IC5A 2IKSA 3FFWA 3FFTA 3HUTA 3F73A 3OM0A 2WMYA 4WXMA 4KFCA 4EYOA 5BR1A 1A04A 1JHZA 4OATA 2ZAYA 3LOPA 5FBKA 4EY3A 2FQYA 3K4HA 1NXOA 3H5WA 4P98A 3GL9A 3SG0A 4CBVA 1DC7A 1Z2DA 2PUGA 1LJUA 2LPMA 1PEYA 3CHYA 3HK2A 5C5EA 2E4WA 4TLLB 1FSPA 4OG2A 2A9RA 2PMCA 1BDIA 1URPA 3HS3A 2FEKA 3S99A 4FE7A 1EAYA 3CG0A 5TE9A 3T95A 4EYKA 4OBBA 1KMIY 4G0XA 4MS3A 3HDGA 4XXHA 1PNRA 4RY9A 3MYYA 4H3HB 4MS1B 3DZDA 4RK1A 4RXMA 3G1WA 5KQLA 3H1GA 3OQMA 2P9HA 4F12A 1Z2EA 2A9OA 3QK7A 1ABFA 5BRAA 5JS2A 1MB3A 4G0QA 5CNKA 5EWLA 1GLGA 1BVHA 2QR3A 4TMYA 2WY2D 3H5OA 3RVOA 3UUGA 4LE0A 1KRXA 3OO1A 2FMIA 5DLEA 1QO0A 3H5TA 4F3TA 2WB4A 3OLWA 1USGA 2A9PA 1ZY2A 1DBQA 1JFVA 3FMVA 3QLUC 4W5RA 1R8JA 2J48A 3QELB 1S8NA 3EULA 3DGFC 3HCWA 3KJXA 5TPZA 2IPAB 1QNLA 1JF8A 2W42A 1NXPA 3RVQA 2JVIA 3W9SA 1CEYA 3LFTA 1QPZA 4MR7B 4RU1A 3I45A 1QO0D 4RV5A 4YP9A 5FBHA 3DLHA 4YCSA 2Q5CA 3Q7SA 3ROTA 1ZVVA 3DBIA 4E7OA 2QVCA 3T6KA 4RSMA 2A9QA 5TPWA 4ZPJA 2FN8A 1EWTA 2O20A 1ZDMA 1DRKA 1MB0A 3IDOA 3UK0A 2FSPA 2E4YA 2E4UA 4G0MA 5HSGA 5TPWB 3QLUA 4L4UA 4EUKA 1QQAA 4MS4B 3RVJA 3HUUA 4Z4HA 4ZMSA 5KQPA 2E4VA 3F7NA 3M9XA 1IIBA 1JDNA 2FN9A 1GCGA 5DCLA 4EVSA 3N0XA 3VNAA 1VLZA 1P6UA 5I4CA 4OTZA 3QLVC 3Q7TA 2FLWA 1FFSA 1DCFA 4G0YA 4RXUA 1DJMA 2FKAA 3IP7A 1JH9A 2BGGA 1SXGA 4WWHA 3I09A 2MYUA 3IP9A 3G85A 4YO7A 3M9WA 1MVOA 2JCGA 3HZHA 4IF4A 1F51E 3Q15C 5IULC 2L19A 1XHFA 2QXYA 1D2AA 3N0RA 4FB4A 4B09A 5JS1A 4MYRA 3A0RB 3E61A 1SD5A 2VYCA 3EODA 3LUGA 4MAAA 3LMKA 4ML3A 4PYRA 3MIZA 3RVLA 4MRMB 4WXEA 3CTPA 1DG9A 5JNWA 4O1IA 2P4UA 1EFAA 3O2JA 4IMJB 5GQSA 1C4WA 1APBA 4IILA 1SXHA 2MSWA 1A0OA 1U2PA 1U2QA 4HNSA 4NV3A 5EWJA 1NXTA 2R48A 3UKJA 1TJYA 3IPAA 3QEMB 2I6FA 1FFWA 4KNYA 2IYNA 3C97A 2L2QA 2PLNA 1LJLA 5TQ0A 4QICA 1EHCA 3JPWA 1OXBB 1SXIA 1H9CA 5CNIA 5IUJC 2MYTA 5KI6A 3A10A 4MS3B 5TQ0B 1JFSA 3KG2A 4G97A 3NNSA 4Z9AA 4N47A 4MS1A 3GT7A 3OO0A 3T38A 2VUIB 4EYQA 5TQJA 2R25B 4UHJA 3TB6A 1GUDA 1VKRA 1M2EA 1PUXA 1KGSA 4RDCA 3Q9SA 4N03A 3KSMA 1VRVA 2RJOA 4RK7A 1ISRA 2HQRA 3OMXA 4KRFA 1B00A 5JNUA 3JVDA 3MA0A 3SY8A 4KQCA 4HYEA 3HV2A 4XASA 1TM2A 2PAFA 3OM1A 3HSYA 1NXXA 4H3KB 1BDHA 1BA2A 1JYFA 5DKFA 2PUCA 4DN6A 3LKVA 1M2FA 1DRJA 3O75A 5JNRA 3LUAA 5IBQA 1RNLA 4E7PA 3LUDA 3CFYA 2CWDA 2PL9A 3CZCA 3EQ2A 2VK2A 3KHTA 1ZHHA 9ABPA 2PUFA 1ZH2A 4LE2A 2MSKA 3M6MD 4KV7A 1PHRA 1DBPA 4L85A 5JNTA 5KQMA 2FMFA 3NBMA 4G0OA 1QMPA 1D5WA 4O1HA 3SQNA 1Z16A 2R47A 1YTUA 2HQOA 4MS4A 3FFXA 5IUNC 4LX8A 3H1FA 1DZ3A 4KPYA 4YGXB 4Z9BA 3TX6A 4LZLA 3QEKA 5GOTA 1NATA 2HSGA 1QKKA 4IRXA 1JYEA 3F6PA 1ZESA 1Z17A 3GA5A 4MGEA 4RK0A 3RVRA 4JOQA 3C3WA 1Z18A 4XAQA 3H5IA 1RXIA 4YS6A 2JBAB 4MQFA 3C6QA 2PUDA 3CKMA 5T7BA 2QVGA 2QU7A 4KZKA 4RKRA 1A2OA 3OQNA 1JX6A 2JBAA 4MQFB 4ETNA 1PNTA 3KYIB 3GBVA 4LE1A 3P9YA 2E4ZA 5T3YA 3DLBA 2YHAA 3KLOA 3O74A 4HNRA 4WT7A 3EAFA 4G0ZA 4Z4CA 1T34A 1E2BA 4RS3A 2PE5A 1YS6A 4YRZA 3N0WA 3Q7RA 2R4QA 4RK6A 4WUTA 3E3MA 4D74A 3I42A 4MQEB 1Z13A 3RVKA 1FFGA 4QPJC 2H3HA 3QLVA 4JAVC 4MR8B 2VUHB 1D4ZA 1BAPA 2M1ZA 4JP1A 3KTOA 3LUJA 5IEBA 3SAJA 2FLKA 5CNJA 2FEPA 3L6UA 4Q7EA 2PL1A 1LK0A 4XFKA 3I5AA 2JB9A 3QEMA 2OQRA 4RZSA 3OLVA 3MM4A 3H5LA 4F8JA 1AB5A 4QYWA 1I3CA 2JRLA 2QW1A 2JK1A 3HDVA 4W5QA 4D6YA 2XDYA 3NHZA 3IP6A 3HJFA 2NT3A 2NZUG 5EWMA 4NICA 4DQDA 3H5VA 1TMYA 3SNKA 1ZGGA 4Q6BA 3TMYA 6CHYA 5FWXA 2GBPA 5KQGA 1P8AA 5EWLB 3LUHA 5ED4A 3IP5A 4Z4IA 4ZYLA 3HEBA 4W5NA 2PUAA 3LKBA 1E6KA 4PZ0A 3O21A 1JL3A 2RJNA 1UDRA 4W5OA 3O1IC 4N0PA 1YMVA 3RVSA 3HO1A 2LP4Y 3QELA 1U0SY 3QX9A 4LDZA 4GNRA 4IMIB 4RWEA 5DGCA 2CD7A 3RH0A 2ID9A 2QSJA 2FMHA 1KRWA 1JDPA 4F06A 2WJAA 4XLTA 4RK4A 3B2NA 3EDCA 1LBHA 2AYZA 3H1EA 2MSLA 3CU5A 4OLBA 3JVIA 8ABPA 3EQZA 1Y1LA 4MLCA 2FW0A 2FTKE 3N75A 2ID7A 4KMRA 4QYMA 4D6XA 5IEJA 2WWVD 3L49A 1NTRA 4HNQA 2CHEA 3KCNA 3VNBA 4N41A 1NXVA 3C3MA 4YV7A 5PNTA 1RZRA 2LUOA 4ZJPA 3DGEC 1DP4A 4LDAA 2L18A 2TMYA 4ETIA 5BQ3A 2ZWMA 1GCAA 3BBLA 3BILA 5B3JA 1DBWA 3BRQA 1MAVA 3LTEA 5KC9A 1U04A 4NCBA 1YK1A 2IPMA 4WZZA 1GUBA 2FEWB 1FQWA 2M98A 4LRQA 1C0EA
chains in the Genus database with same CATH superfamily
1JLKA 2W2LD 4MXDA 1S3SA 5K8VA 2HQSA 1PEKE 2DCUA 4DIFA 3NGMA 4UHKA 3WLSA 4CM8B 5HCNA 2HR1A 3CRNA 1IQ0A 1F9EA 3THWA 5ALXA 3BXFA 1MQAA 4GOOD 3PKJA 4ZIRA 1SUIA 3KTAA 2GMWA 4BUJA 4FNAA 1MD9A 1CUIA 2W2PA 4LQLA 4LTMA 4I08A 2BR5A 1DE0A 1NULA 2WM3A 2ARKA 3VHLB 4TSRA 1L5WA 3D0RA 1P39A 4DKJA 1LKZA 4FEGA 5JJBA 4KLAA 5FPPA 5CFLA 2C3PA 4OBWA 3I01A 3PQ8A 2DLNA 3ILYA 4RHTA 1WD5A 2QRKA 2YJ3A 4NDAA 3EIUA 1Z28A 3OSZA 5BV0A 1JQKA 3W9BA 2C77A 3NQ41 4OO3A 4NIMA 1RVDA 3R3JA 1YWGO 3HBLA 1IY2A 2GWRA 4LJ5A 1CYEA 4OHXA 3GXOA 5LXTF 4QFCA 1X92A 1N1GA 3KALA 3S6JA 2ISSD 5KCMA 3LY5A 1EK6A 5IVHA 1KQPA 2VRNA 4B0OA 1JG4A 1YRQA 4GDFA 4BRWA 1GAWA 4NBSA 5EYPA 1M1NB 1G8GA 1L5ZA 1RC1A 2P6UA 3IUEA 4LUCA 4NCAA 4YJ2F 521PA 1QP4A 4LF8B 4L75A 4BVHA 5TQ2B 2HRQA 1AS0A 1ADYA 3C3DA 4FYVA 5L9AA 2WWGA 2PKXA 4UCQA 3H9QA 3A9CA 2P69A 3H3XA 4PS0A 1SVOA 2EJUA 4IFIA 2H4YA 3H3JA 2EX4A 2HWYA 3KLBA 3GD5A 5TV2A 3RYHA 1O6GA 2GEBA 5JSZA 3EZLA 3QMMA 3SX2A 4CHTA 1HEIA 4S1WA 3TZBA 4DEVA 1A5SB 1E4YA 3GK3A 5JRZA 1ZU4A 1ACJA 4MP3A 2ORED 4A5SA 1G16A 1BCRA 1G3RA 1PK7A 5BNWA 5JY6A 3VAYA 3R40A 4MKGA 5TJHA 3B7WA 1FRZA 1NVVQ 4UOQA 1RQNA 3AV0B 1RYNA 4Z51A 1IXZA 2D4HA 3DDUA 3EC2A 4FYYA 3GJXC 2QN9A 3SJCA 3UHOA 4FUTA 4GQIA 5IZCC 1ZITA 2QUKA 4GHWA 2VNAA 4I6EA 4EJ6A 5IDWA 2CDCA 3HXPA 3LXUX 1GJRA 4M1SA 3TSAA 3B1JA 1I0LA 1IK4A 3HTXA 5E8JA 4N3GA 1SY7A 1TCCA 1MIOB 1XUOA 2IV2X 3L1JA 2YWGA 5F9HA 1QQ7A 1YMUA 1F0KA 3H75A 3I04A 4TQ9A 3PNYA 2EV9A 1MP0A 2BHTA 2GF2A 1HDYA 3WLTA 5B6PA 4PF1A 2LIVA 2FQWA 2AN5A 2O3QA 1LD3A 3ONFA 4JD5A 4MVWA 3LQKA 5I9BA 1UXJA 3HU1A 4Z49A 5LXTB 3USCS 2CXQA 2IDMA 3EUEA 2AXQA 2XNKA 1NZJA 2OGZA 1UH5A 1FVHA 3GFQA 4O2BF 4PVDA 5E2AA 1W4AA 1MO3A 3E8MA 3LG2A 4J6EA 4RHFA 4EYGA 1YDMA 2X6RA 4RZIA 1LBSA 1ZGHA 5C1PA 3S44A 4XE5A 4DADA 1QBKC 3DDHA 1QDEA 2R4UA 4I4NA 2JLQA 2G88A 1USIA 4PO3X 1C7QA 3WNQA 2JVKA 1ZS9A 2HA4A 5IK2D 1MEOA 5IJ0B 1LW6E 2AG5A 3IAHA 5CBPA 1CY8A 4UHEA 1NDQA 3FTFA 2BVNA 4M7WA 3S99A 1RAAA 1N7HA 1SXJC 1EA5A 2JBHA 3LA8A 5AK3A 4C05A 1B23P 2AQKA 4CTOA 1J24A 3HDYA 2H63A 2XSZD 2P2NA 5H3HA 2C5GA 3Q6MA 5I9IA 5AI9A 1WXGA 1UOQA 1Z3IX 1N2IA 2H2AA 4DM7A 3ETEA 2HF2A 1QYDA 1RXCA 2AB0A 4I3FA 5CHYA 4OAOA 5ED0A 3VBCA 1H8ED 2RHHA 2XYHA 2YN0A 3MJEA 1T9HA 4CT5A 1SBQA 3FFWA 4M53A 4URUR 3CF4G 2NVUA 3L6DA 3OMLA 4OJQA 4EYOA 3B7PA 4Y7CA 1I6LA 3ZXSA 2JZOA 2HXYA 1SUPA 1P62B 1KZ7B 2IH2A 4HQ6A 1I2DA 2OT3B 3ZY6A 4C2BA 2J07A 5AW5A 1BRTA 3WGMA 1IL0A 3CHYA 1C2YA 4DCUA 3GJ0A 3MT7A 1T5OA 4V2IA 1FU7A 4W7SA 3GA7A 2QL6A 4JKYA 1O96B 3VGJA 5FQOA 3I04M 1KMIY 2JJQA 2GEVA 4LZZA 4AKSA 1UZUA 5JAQA 3MCWA 5JANA 4OCZA 4A4DA 1CW2B 1SZDA 2RJ3A 3SFZA 3ZU5A 4FZ5A 4QJ4A 1Y8RB 3UPDA 1YL5A 2P6MA 1GGFA 1II8B 1PIWA 4A8JA 4LV8B 5E1MA 1J2TA 5IFKA 1Q0TA 4NBVA 2A94A 3ABIA 2W6IA 3PBKA 4Z7OB 3AUUA 3QBEA 4W5WA 3RC3A 4KNWA 4M0CA 4I8IA 2VAWA 1GZVA 1O89A 1W94A 2W37A 4FWIB 4WPGA 2PKCA 4GX2A 1UKAA 3E2PA 3BRWA 3ZDXB 5B12A 3DB2A 4MX8A 4HUTA 4PU0A 2EARA 1M1XB 1Q3TA 2A9PA 2W11A 4R5HA 1OROA 4ZQEA 3V46A 3UEOA 3WYFA 3WGVA 4EJ0A 3TDNA 1SKBA 3TBFA 1IN8A 2OBLA 3WGHA 1XVTA 4WX2B 4DABA 1J0CA 3FZYA 1J9GA 3HCWA 5TPZA 3W6OA 1KEUA 3HE3A 2X1MA 4NNJA 2FZKA 2OCXA 2XKBA 4IDPA 4RE6A 2ZDHA 4ENSA 5L7YA 2IC5A 4LDRA 2ONJA 3IQGX 3ROQA 3U3DA 2C99A 4UXJA 1HDGO 3VNRA 1KGDA 4EW2A 4YJGA 3RANA 2UYQA 2M6RA 3KWLA 2AZ4A 2OORA 4RY2A 2J0UA 2PBLA 2GNPA 1UADA 3GUCA 2VAMA 5CFQA 4K88A 3WMFA 3IVGA 3ZHZA 2ON6A 1ZGAA 1GNPA 2GF9A 3ESBA 1N9GA 4PCUA 3SMQA 2D7DA 3WBFA 1S2OA 3TLKA 5JQGB 3VYSB 1J00A 1O5IA 2E18A 2I99A 4ZI7A 2PYZA 1JLRA 2XTZA 4DR4B 3F1KA 4EATA 3UHFA 1ZI6A 3FLAA 1RCUA 3B78A 4UDXX 3AUSA 3P9XA 3C24A 1Z5PA 3FYTA 2VK1A 4FEEA 3K2IA 4RVNA 5AM4A 1G60A 3ZYZA 4LQ4A 1Y63A 3OHMA 4JOCA 4PLWA 1S3FA 3VNAA 3MJCA 1P6UA 4PZLA 3HNRA 2IEGA 3KJIA 3WXMA 1FFSA 4ZTZB 1NI4A 3U37A 3WLNA 1MXFA 2C58A 3DL2A 2G71A 2DMRA 1N9KA 3A2NA 3B1VA 4TS9A 3GPIA 1KMQA 2V7PA 5KMGB 1SBIA 2XCUA 4K86A 1UKEA 3DNMA 2QUJA 4B6JA 4IF4A 1QFZA 2GILA 2BLLA 3PDUA 4DB4A 4M1WA 4Y1EA 4JOBA 4ER7A 1GRRA 2QKYA 1AKYA 3B6KA 3UH1A 3H2SA 4UHHA 4B09A 4TLBA 1QRDA 1FLVA 2OD9A 3ETJA 2FP4B 2RBKA 4LWPA 3KQNA 2YW2A 2E5LB 2VPTA 2B99A 1CUUA 3BWXA 1CVIA 2AN1A 4J0FA 4PYRA 2JFGA 2VYND 5F21A 1J8DA 3VR0A 4WBNA 2I2AA 1HA3A 1KARA 3UWDA 3SR4A 3WLOA 4YPOA 3T3MB 1X8KA 4ENPA 4G2TA 3O2JA 5CA0B 5KSZA 3NUGA 1H4VB 4IYRA 3CLVA 1HQKA 1A0OA 3ZE6A 3DE4X 2OCLA 4EKIA 5HYVA 3I83A 4IXNA 2P9ZA 1KO5A 4Z1OA 2GETA 2F43B 3T9EA 2C1EA 1JG3A 1ZOPA 2LR0A 2QG4A 1BKYA 1HF3A 2BHSA 2EYUA 3C97A 3FRHA 2BIFA 3K30A 4TTIA 4WZAA 4M0MA 5E6UB 5FTKA 2AFIB 4CM4B 3GLUA 1EZZA 1WWKA 3HCBA 1E0JA 1K88A 3HRHA 4W4TA 1ODLA 1Z56C 5CNIA 3ZE7A 4A5OA 3QEOA 5AW0A 3ZKAA 4YASA 1NVXQ 2OFPA 2I3DA 2W00A 3WGLA 2JLYA 3SHTA 4QRIA 3FBWA 4GECA 2VUIB 4KX3A 3VZPA 1MXHA 1ZN7A 1GZUA 2Z95A 4HDOB 3B8HA 1M3SA 1HE5A 1LNZA 1VKRA 2NNLD 2RAFA 2J9GA 2PVPA 5HF6A 1R37A 3WE7A 4EQ6B 5C8YB 3FKJA 2PXCA 2PX6A 1GQRA 3V4PB 2ZBDA 4CCSA 4DIEA 2JL1A 5TMBA 3VSCA 3W5IA 4PVCA 1XA3A 2O48X 4BTEA 1HRKA 5I7EA 1JKIA 5GV8A 1E6UA 2Z1DA 2ZI5A 2ZXUA 4UU1A 3E4DA 3INGA 1NT4A 3N2GA 3OM1A 4R81A 1UFVA 1ZD5A 1ZIOA 1BHO1 1INLA 1YVDA 1ZSVA 2AZMA 2DWOA 2PFSA 3AL3A 4GQAA 2I67A 3IQFA 5BN5B 3TZ6A 1R66A 4WY2A 4LSGA 3T7TA 4AWBA 4CV0A 4LJRA 2GPWA 5IBQA 1M2KA 1NYTA 3H04A 4MTCA 4KODA 1WP4A 1MABA 1QC5A 1UAGA 3DEKA 4PZPA 4BATA 5AO9A 1C5KA 1YC5A 4LAFA 3LZ6A 4XW2A 2PBFA 3P0FA 5SY6A 5CA0F 3WK9A 2IYXA 2WVJA 2ZE7A 1L5KA 4HXYA 2YL2A 1ZK0A 4D4LA 5TS2A 4W8GA 3M6LA 4WJKB 1IBRA 2ORIA 4PBTA 4DCJA 3EQ8A 1NOKA 1PWXA 3BHMA 3HYLA 4LSZA 4ZAVA 3RJTA 4FDVA 1GAXA 2VP5A 4NY1A 3DKRA 3GUZA 3I6ZA 2AK2A 2ECKA 3TEMA 5IUNC 2HC9A 3T5CA 1SZJG 2MSDB 4ZQBA 4GOMD 3GLIB 4QQFA 3HMKA 4QJ5A 1QCYA 5K8LA 5F7ZA 1OVMA 1GLVA 4F9FA 3QE9Y 4R8KA 2AOTA 2HSGA 2X2FA 1BS9A 5CK4A 1OBFO 5KINB 3BF7A 2PAAA 2VJLA 3GFGA 4P86A 1GPYA 5IM5A 3A1CA 3MGGA 4HDCA 3VNSA 1TEHA 2OKGA 4K28A 5JFOA 3LK6A 5JDCC 2AGVA 3H9CA 3C6QA 4TTQA 4ZCRA 5K09A 3NEJA 4L2IB 3ZW7A 4AY5A 3B2QA 5FNVF 2RGRA 1XROA 4WOJA 1NJFA 1TJ3A 1VLMA 2AI3A 2GSWA 2W2KB 3GLHB 4RHYA 4B3GA 4RH3A 2PANA 4PG4A 1GGVA 1ZONA 2Y1DA 1EFPB 5LOVF 1B26A 4H2DA 3FNRA 3ORRA 2IBSA 2B0JA 3BJEA 1DTWB 3IQIX 4ZXFA 3KLOA 4HNRA 2BKXA 2GTHA 2ZWIA 3NYWA 1S5PA 4N0EA 4YCMA 4CTJA 3FPGA 3U4CA 3ZJTA 2Y4NA 1R0RE 4OB7A 1RP7A 3ZE1B 5AVWA 3U0VA 1DWUA 4GBED 1MTOA 3KOMA 5DNEA 5FFFA 4GWLA 1A72A 4Q3LA 4J2TA 3QLVA 3ZI0A 2WUGA 1F8FA 5IT5A 2I7XA 2VUHB 3WAGA 2ZCVA 3VH4A 3DZKA 2C0PA 1OD6A 2FSGA 2ZSBA 3C85A 4HNAB 2GRAA 3TFOA 1R6BX 2OLJA 1R8YA 5LP1A 1D6JA 3T9AA 3VUEA 1AN9A 4LJ7A 4TWBA 2C4VA 3O95A 3QJ5A 5FADA 1U9ZA 3FTPA 3IP6A 4OH7A 5ERGB 1FS6A 2JNWA 2ZYSA 4NICA 2F4NA 2JHFA 5K8UA 5AKYA 2PZGA 1IM5A 1D8TA 1IH8A 5KNCA 2R8YA 1Z0FA 2BAGA 5ILQA 2HWKA 3EY4A 2BMDA 1I7SB 1G8KA 1KMNA 2VNSA 4OH1A 3HL0A 1EUDA 4J1QA 3A11A 1XEWX 2C2HA 5EHQA 3ML1A 3HZOA 2BGTA 4F5YA 1MT3A 5AI8A 4GOJA 4P08A 5BPFA 2ZJ1A 3QX9A 3AEKB 4J7UA 3WB9A 1I2BA 4F92B 4MPDA 2OCBA 4MLZA 3ZWQA 3VSDA 3E5HA 2QSJA 1O0SA 4KBFA 3ZWPA 5AVQA 1G6KA 1WCYA 4BNTA 4P0QB 1TKRA 1JN0A 4PR0A 1AUOA 1FJHA 9MHTA 2EKZA 4XLTA 3EOZA 4UTOA 5IANA 3B2NA 4ZO8A 5F5LA 2JI8A 3P9QA 4FFBA 2Q46A 3GUVA 1E6CA 4E08A 4ODIA 5EVCA 3M89A 3TL3A 6Q21A 4OLBA 3DBRB 2AH5A 3LVBA 2I0FA 3WRWA 1G38A 1W5FA 2WIJA 3D7SA 2ZR7A 3D5EA 1D07A 1JHDA 1FDSA 3L0PA 1VKZA 4QYMA 5EJAA 2JCYA 3E18A 4CL8A 3QVUA 3FA2A 5FUQA 5MHTA 1V25A 1FY2A 3FR8A 3HUEA 3LCVB 3T3EA 4EQZA 1Y4DE 5H80A 1UEIA 3OETA 4YMWA 2BSAA 2H48A 2JJYA 3BJRA 2D00A 1XE3A 3U61B 1I1HA 2WYVA 3JQPA 2O3SA 2QLBA 1L4GA 4RD0A 3FJ1A 2JD0A 1CVRA 1K89A 3FOWA 3GEEA 1R5NA 2NO1A 1MAVA 4KO2S 2XLBA 3FHTA 3WLQA 2X3FA 5EKSA 1IPFA 1FFHA 1T0BA 2PTHA 3L1VA 2CNKA 1QDUA 1CZOA 1K9SA 2PNFA 3EGXA 3HYSA 3OWXA 4H7JA 5EI5A 1E7SA 3QW4B 2ZTVA 5DHPA 2A5JA 3IEXA 1T5TA 4IG4A 3L43A 4PSKA 2A5GA 4KN9S 5FA8A 3EIQA 3KQHA 2H1FA 1CHNA 4IXWA 2HLDA 2JZCA 3WV4A 5DI3A 2HIMA 1Z0JA 4KREA 1PAUA 1GG8A 2DWUA 3IUYA 1B7GO 2NSHA 1YSCA 3FYUC 2AFHE 3AZPA 3K3PA 4AJ4A 4Z3OA 2VWGA 3DLPX 4U6SA 1ZCZA 1JFFB 1YR2A 3PL1A 4TN5A 3RS2A 2PD3A 3T0GA 3U7RA 2A5FA 2JGJA 2W71A 4ZYYA 1YF3A 4DV6B 5FNVA 2NV0A 4DA7A 1C41A 1QV7A 3ZIUA 4NBWA 1HYBA 1P2TA 3E7DA 5HE9A 3EWIA 1MHTA 2AEMA 4I1RA 4EKGA 4WGGA 1YZKA 1RIIA 1UOOA 1QJ4A 4JB2A 2Q5LA 3NWPA 1G66A 3FMIA 4XRGA 2LCFA 5JXHA 5KJCA 5IU6A 1IULA 5LFAA 1H5NA 3W5DA 1LTHR 3FZGA 1ZAYA 3J81A 2RH4A 3WP1B 2VPZA 1IJFA 3NT2A 1TLFA 2P79A 3REGA 4CLHA 1JXAA 3WDLA 4E1VA 4H4DA 3JAWB 4O3MA 2DAPA 3NFYA 3OTIA 4WKBA 1BXRB 3FCYA 1W36B 1TLTA 1P45A 4FW9A 5FWXB 2HQBA 3BK2A 1UZMA 1Q91A 4QARA 2D1SA 1PNOA 3IELA 5CXSA 5EMHA 1M7GA 3I62A 4QNNA 5K0SA 3KEMA 1RHJA 2IP1A 2VL7A 3G2NA 4R1TA 5G40A 5JPIA 3S1AA 3S2FA 3TKLA 5JI3E 3QE0A 3VR1A 3ACCA 1XNJA 1J21A 4AF8A 5FPTA 1W85B 1M74A 3HXQA 1Z5ZA 3F47A 2GD0A 3WMWA 1RLUA 1Z07A 1P2BA 3PDWA 2IWRA 4CQNA 3HJGA 3O83A 4AYXA 5KYGA 1PJAA 1T9ZA 3AKEA 4IDAA 4HWOA 3RVMA 2H1RA 3CF2A 4L0CA 3H2GA 3MWDB 3A6DA 3K6SA 1KDPA 1A4UA 2QLTA 3TPFA 2JH9A 2F17A 3UMFA 2Q29A 3H6GA 3SBOA 2O3UA 4FOSA 1PV2A 1ZCFA 1DCKA 3DZFA 3I5UA 4LBZA 3I9MA 3IDFA 4RV9A 3T3DA 2NQ8A 1ECGA 3KPYA 3HA7A 2RC5A 1M5UA 5IDVA 2HSEA 1WPRA 2YZNA 3DBHB 3QKTA 4Q4HB 3VOBA 5L3QA 1ADJA 2YJTD 4MLDA 2XCRB 4D0GA 3QE4A 1ISFA 1K27A 1NJ6A 1SU4A 3D0OA 2D0OB 1QAQA 3VUFA 3L06A 3EX7C 1AQUA 2P9CA 3OQPA 5G4KB 4JYBA 3UK6A 2YJ6A 1E32A 3A4VA 2Q7DA 3COVA 4M8KA 3OCUA 4V0ME 3F96A 4XVRA 2CHVA 3R5TA 3HKEA 4CKCA 4BUCA 3ILVA 3WKDA 4MV0A 3REQA 2HRDA 4TMXA 4EYSA 1R1DA 4TL8A 2V3VA 4H31A 3IKVA 2RHOA 5I48A 2ZAGA 2WWHA 5KDLA 1ZXLA 2X1VA 3MTIA 3CVVA 4HB3A 5K8IA 4DIOA 3AIKA 1JP7A 3BIXA 5TDHA 2R2GA 1OR8A 4LRTB 4ZAXA 3LY7A 4RA6B 3HYCA 2WAXA 4NKRA 1OFTA 3Q7IA 3SEAA 4UFPA 3WBJA 2QGZA 4ZOLF 2C97A 4Z0NA 1V3TA 1W88A 3IERA 4X90A 4YBZA 1KJQA 3BXHA 1VJ5A 1UM9A 3SF8B 4FFLA 4NZ9A 3MOGA 2BL4A 4TLEA 2H8GA 2PMEA 1VGQA 3FI0A 3OZUA 1MJGA 2GZMA 4LSWA 2NZVG 1JEDA 1FVFA 4GXQA 4QG3A 1FFBA 2X5JO 3EVZA 4FHGA 1L9KA 3C8MA 2CKMA 4TGLA 4FSXA 1PJZA 3V2UA 1PZHA 1QPGA 1WQ4A 2V6IA 2P3QA 4CZ2A 1NW3A 4KMMA 4GX5A 3LUKA 1XELA 2XDWA 4RENA 5EZSA 5IC5A 2C78A 3DXZA 1ENZA 4WVLA 3LDUA 4P36A 4IVNA 1UQUA 4KUEA 1OBVA 1ZM2A 2R1TA 1A04A 3ZGYA 1T1GA 4OATA 3RAFC 3UJ8A 3R4CA 4JHLA 4F8EA 5JECA 2BJVA 1YAHA 2IPOA 4J7CA 1Q92A 4A9AA 2VHJA 3EZ6A 4KH1A 1DELA 1K0UA 3OA2A 5ICSA 1JW9B 5AHKA 3F3YA 4J1SA 3W2EA 1P7WA 1G4AE 2CW5A 3TZEA 3M6FA 1QTIA 1SOAA 2CD9A 3KDPA 1SIUA 4LRWA 2FZ5A 4KRXA 4RCYA 1W8DA 3LM8A 1T0UA 1YO6A 3ZVMA 2XJ4A 4GI5A 4F5ZA 2C84A 3L07A 1U28A 3W3ZB 4YRIA 1WZ2A 4MS1B 1AU9A 3FTDA 2CYBA 2CE7A 1JAHA 2I1WA 3EZ7A 3H9JA 3W05A 5ITVA 3IBTA 4H08A 3DOEA 2QL9A 3CLTC 3GJ7A 1TQHA 2BI4A 1UBJS 4EH1A 1M1UA 2GRJA 4B81A 5BN3A 4PLCA 4BJ1A 5GTDA 2WJZB 5DULA 1WBDA 2ZBEA 3DUFB 3QPCA 2QD5A 2CJWA 1J0DA 3MYRA 2BEWA 2L69A 1TEXA 4WCFB 3L8CA 3FMVA 5JARA 3ZGZA 4F5DA 1O2DA 3OPQA 4IHKA 1T5SA 3T1OA 3LS2A 1YDHA 1EX7A 4X20A 3MK31 2XVMA 3NT5A 3OIYA 1E9DA 1MO5A 5LQCA 1DKQA 3CO0S 5DNDA 5E9JA 4M0PA 1WR8A 3RW9A 4ZOCA 3LCRA 3PICA 1KDZA 4D79A 2R6CA 4QBGB 5HRUA 4DV4B 2PGAA 2CXPA 3A9VA 3L0OA 3CF0A 3PXCX 3RAPR 3MTGA 4EO9A 3EZXA 1PX2A 1LFDB 2BC9A 2Z0MA 5ESDA 3ROTA 1BKDR 3WMGA 1GQ2A 1D04A 5H5JA 1X80A 2FPSA 4IIVA 4KIFA 5LYJB 1H23A 3VKUA 4DR7B 1EWTA 2O05A 4MVYA 2Q5OA 3L7LA 4N5HX 4XD2A 5GOZA 4UKDA 2O8VA 5A0VA 1A5AB 2AWOA 4GMXA 3RVJA 1R4ZA 4UUAA 1SOMA 1CSEE 2Y1EA 5TLSA 1ZI8A 2VCHA 3AKYA 1N2GA 4NWIA 5DCYA 5DSZA 4KTTE 1IIBA 1H0HA 1ULSA 3C8DA 4EVSA 5ARBA 2GM5A 3HWX1 5FO1A 3CLRC 2GAJA 4YT2A 2N42A 1UAAA 5I4KA 3E03A 4KQMA 2BGWA 5AOBA 5EJ2A 1QIHA 1I1OA 2FKAA 1DJMA 1QIMA 3OI7A 4WZBB 1WDLA 3V1UA 4YDQA 1D0SA 5JD3A 1LUAA 2J87A 3ZU6A 2FRXA 4CDNA 5CIQA 3ZDRA 2L19A 4WXHA 3VR5D 3R7BA 3IBCA 4F2DA 2DPMA 4Y3UA 3ZC3A 4BJ6A 1Z6GA 3LO8A 5A04A 4W82A 2CHUA 1XDZA 3BSWA 4GFDA 3DO6A 2IYZA 2XV1A 1GRNA 1KH3A 3AEXA 3TVTA 5HPYB 3TR5A 3A6FA 3C5VA 5GWXA 3SEZA 1CDOA 4AN4A 5KQRA 3EQ9A 3GRKA 2G7MC 2P2ZA 1PDWA 1TMKA 2YZMA 3PE4A 2JJ1D 2R48A 2X1HA 2X15A 2JIQA 2PWAA 2R5NA 1T4GA 3HCEA 4PXSA 1YOVA 3SDSA 2O5EA 1SWWA 2UZ4A 3FVTA 4U8GA 4GD3Q 4KL8S 5CMLA 5JSUA 2B4KA 2WNSA 2BDUA 3A1UA 1JUDA 3VPCA 4EYEA 4MS3B 2PQ6A 5TQ0B 2D1QA 2ZDGA 2XCLA 4G97A 4RD3A 2GGSA 4X3PA 1P1RA 3HXLA 2EFEB 2XUQA 3C98A 3PXGA 3K1YA 3TG2A 1VPEA 2RHJA 3Q0TA 2AN4A 5DPMA 1SKYB 2E0IA 3GY0A 1PYGA 4R9NA 5CLGA 1MENA 1R6VA 1W6RA 1CUWA 721PA 2FJPA 3A6PC 1RAHA 3GI1A 4JB8A 1XCOA 4ND7A 1KYZA 4LN1A 2VWQA 3P2IA 5IWCA 4BN5A 1JPJA 2WYHA 1TK9A 4OJNA 2OZLB 1RJFA 3JWPA 4KU4A 2BZ0A 2ZU6A 3KV3O 4NMMA 1F7VA 3ENQA 4R1OA 4YRJA 4A8JB 4JL6A 2G1UA 5I9SA 4B4WA 2IRWA 3JAKA 5DRTA 5BUSA 1U2DC 1YZFA 3KFXA 4IUBS 4UHFA 4LC0A 2FEOA 4BBPA 2ECFA 4B80A 5KNBD 3FTEA 4AYWA 5DHFA 4OYLA 2JFZA 4FFPA 5L45A 5JEDA 1PSZA 2V98A 4MWOA 1JYFA 2CNNA 3INYA 3O75A 4IIBA 4Z2AA 1N2SA 4V39A 3SJAA 1R2QA 1ZMXA 3D7KA 3WWEA 1VDZA 4HZUB 4BX8A 4BEWA 2PU7A 2YFKA 1YDEA 1PFQA 3EQ2A 3DDCA 4P83A 2NSJA 3WTCA 1H2FA 2PUFA 1JVBA 1GGHA 2QLMA 2VKTA 5F35A 3CH7A 2NXWA 3HA5A 4G0OA 1I6KA 5L6LB 3T5PA 1GCOA 1QMPA 4KITB 2GVZC 3RS5A 3U4MA 4H1VA 3IVMA 4DHWA 2BUAA 1S7CA 1BWQA 1P1BA 1JHRA 4XM0A 4IHJA 4MS4A 2I87A 1H69A 1K06A 2NSLA 4JI0B 4BX3A 3E9YA 1C3JA 1UZLA 2P4EA 1Y9EA 4DANA 5HIKA 4ZOLA 3FNQA 4WW0A 1QYIA 3V1MA 1OH6A 4MVJP 3G2IA 3G2KA 3QFTA 4PLYA 2XXAB 2HNKA 3FNEA 1TQ8A 2PPLA 4J16C 1L6IA 4K7JA 1D4FA 2WSLA 4LECA 3F6PA 1L1QA 4CPDA 1D2RA 2VTBB 1MX9A 1TM3E 2EL9A 1OV4A 2AUTA 2H2DA 2ZYIA 3VV3A 2UYYA 3TTYA 4DVJA 1EBBA 1EHIA 1TKBA 5JXGA 2P7IA 2WJVA 3EBOA 3PC2A 3DEJA 4JYPA 5DZSA 2CMGA 4Y8VA 4R2XA 2FG5A 1NI4B 2BMJA 2CLKB 1UBRS 3P8ZA 4R8VA 5SZKB 1BVRA 1FQJA 4PAMA 4CV1A 3PQ7A 5ALYA 2WD7A 4OFWA 4Y2PA 3RKRA 1Z68A 2NN3C 4FE3A 3VR4A 4BU0A 5EAIA 4X6YA 2GVNA 1QUEA 3EAFA 3B6JA 3ENKA 3OPYA 3UT0A 3I6YA 3EH2A 5FHRA 4G2NA 5B4UA 2IF2A 3UN1A 4YRKA 3G89A 1QH8A 1RHKA 4RVHA 1SCKA 1W0JA 3CNOA 2FPLA 3I42A 1JTFA 2BBWA 5FUWA 1FFGA 3PJGA 1SHKA 4X1IB 4DNXA 4C29A 4JX8A 3N2ZB 1K4YA 4AJEA 1PJSA 3SAJA 1SG9A 4TMFA 3Q8KA 1UKYA 5GP1A 4IHJF 3GFBA 1GTRA 2ZPTX 3NHWA 1CV2A 4O4JA 1BEUB 1TPZA 2Q5IA 4BZXA 4F9TA 1O9BA 1U9YA 3K6KA 2VSQA 2AG1A 1LLCA 2XYQA 1GGKA 1TVKB 5E6UA 4N49A 2XCTB 1UJMA 1RBYA 1VE1A 2WHQA 1Z7WA 2XWPA 3K0BA 4PC6A 4AUKA 2RCNA 1SB8A 3DJFA 4OGLA 3DZ8A 4QOIA 2NUAB 1RQXA 4J07A 1IBKB 1YQ9A 1CB0A 2H5IA 4V0OA 1L8OA 1SKYE 4RANA 1SKMA 5EOVA 2CNOA 2FMTA 4PPGA 2NYRA 3QWFA 1I7NA 1V5FA 2HA2A 1BX1A 2IEZA 5LBTA 3RNLA 3HXTA 2AOVA 3U80A 1C1HA 1LTQA 4G5YA 3LUHA 2FI1A 1D6NA 4CMBA 5KYVA 3RODA 1SWVA 4LDQA 1P91A 3A7EA 5SZJA 4PZ0A 3T4PA 4I1SA 3I2HA 1NC3A 1XD2B 3TEJA 4N0PA 1LRKA 1RYYA 1XCGB 1JJIA 2D0PB 2VTDA 2HLPA 4WRRA 1UBOS 1WD7A 3TW4A 2JEZA 4L72A 2V4UA 3QELA 1V9SA 2QTNA 3QNUA 4N82A 1LSSA 3NALA 4BMOB 2DFTA 1Z6PA 3TTUA 3NEPX 5DM4A 1XTIA 1XPRA 3KXIA 4UCWA 3UAGA 7GPBA 1REQA 3PQ4A 4R9VA 2A0XA 2XZLA 1H05A 4TV8F 4ZAZA 3OCXA 1H6AA 5CXXA 2QRUA 1KZYC 2OLKA 3ZY3A 5HKKD 1T0JB 4RK4A 2P90A 1N6IA 3Q8LA 4Q21A 4LPSA 1KS9A 1PL0A 2FPPA 4KLRA 3K8QA 4F2WA 2MSLA 3EVEA 4ZFNA 3G6KA 4G1FA 1Z88A 4P3NA 1NX6A 4IQ0A 4TT3D 5JSQA 3N75A 1Z5OA 3RUAA 1YL6A 1H2AS 1JPNA 1Z4KA 3G0OA 3RKSA 1B4DA 3DTVA 3PC6A 3R3VA 4HNQA 1P4JA 4NMXB 3T06B 4HNUA 5KVCA 1U7TA 1KHTA 4QVIA 1MX5A 3W0LB 3WNDA 3WOVA 4HNHA 3AR7A 4NU6A 4BFSA 4CU5A 3IB3A 4WSOA 2ZJ4A 2FNAA 4C0BA 2R8OA 1L7XA 2OG1A 4CDMA 1XNRB 5MGNA 1NJSA 1M6YA 2GARA 1TKAA 3VI3B 4DSNA 4M22A 3CW8X 1RZVA 4WTOA 2AOTB 2AI2A 2DHRA 4KXUA 3Q72A 3TSWA 2I8AA 4ITRC 2XKJE 3FCCA 4LRQA 3DE5X 4NC9A 2HO5A 1H1TA 2VXYA 4HTAA 5KWEA 1L3CA 1BU8A 2C2WA 4CXMA 4RKFA 1XTVA 4CTKA 3HA3A 2X2EA 2XHEA 3I6QA 1G2PA 1K8XB 4CKWA 2X5OA 1JWAB 1WB6A 3GJYA 3RV4A 2HK9A 3W4KA 3PEWA 5CLLA 2FEMA 4X64B 3HPRA 4X7BA 4BB6A 3BTOA 3H97A 2KMLA 4N76A 5CUQA 1W29A 1PT8A 3LXMA 5GONA 2BR4A 2XMQA 2RD2A 4AJJA 1DMSA 4DCGA 4R0VA 1W9MA 5F77A 5TQVA 5EJ7A 1CVLA 3R8XA 3L6CA 2RGDA 3QXGA 4WFKA 5DYNA 2OK7A 4MQEA 1NBWB 3A3KA 5H70A 4I8DA 2XB4A 1LV8A 1TK3A 1D4AA 4Q9IA 2OXIA 5LR6A 5JNLA 1ORDA 5AW8A 4N6OA 4ZQGA 5JDCA 5KWSA 1RXEA 2MYPA 3PVCA 1MMFB 1LRLA 1CZRA 2B1JA 4WOCA 4CN9A 5COAA 5EXSA 3FKSA 2GPNA 5C1OA 2FRDA 2XGSA 5EHZA 3VO8A 5A5FA 3P0IA 1LQTA 1M2GA 2BMWA 1KPHA 2FWBA 3DMTA 1EP1B 1NI3A 2GBLA 2W6CX 1AZLA 2DQ4A 2WUDA 1UQTA 3DAHA 3JU3A 2WUWE 1R8QA 4HNAA 4TX1A 4UEQA 2OEPA 2RGAA 4EMSA 3ZCTA 2G25A 3CKLA 3O8QA 3TLZA 5AKGA 3VV2A 3JARA 3CS3A 3GPCA 3X1XA 1QVRA 3OLZA 2Y1WA 5KB3A 2VHVA 3C1UA 4A0FA 2DXIA 2XMCA 3TO5A 1F8YA 4NCXA 4KQIA 1MIHA 2I55A 1FXWA 3PI6A 5AVKA 5ECWA 5FO0A 4JITA 2NLOA 2A67A 3H9UA 1Z4JA 5BSEA 5L4SA 3HLYA 5DE3A 1LDBA 2IYAA 2RH5A 2RGYA 2R9VA 4OXRA 4DLLA 5CD1A 2HU7A 4Q18A 1YI8A 3FN4A 3GGOA 4K2AA 3E23A 1BO6A 2NUBA 4G1CA 3MWJA 2Y1LA 3EMBA 2H7VA 4K8OA 2PUTA 3EC1A 2EFJA 3IOMA 4R40A 3QOFA 4X54A 1GA6A 4KEAA 3RS7A 4QGBA 4D9IA 4DJFC 4BQQA 4EGQA 4OA5A 2OCDA 4WKCA 3VU3A 2GYVA 3RADC 3DUWA 4HUQB 4D8VA 4AJHA 1AT1A 3O93A 1WW8A 3O9VA 3PX2A 3F4KA 5LB2A 1E96A 1ZLYA 1EEHA 1P44A 2IHYA 5DK4A 1RLMA 5ECDA 2EFYA 2PXXA 2F6RA 1AOXA 3G59A 2GI4A 1JJVA 3IVRA 2GCIA 1O54A 2XKAA 5AHRA 4DLRA 3LLUA 3IEUA 3HVRA 4XI9A 4LV5B 5ALOA 2B3DA 4MVJH 1YIOA 2CNBA 3KQVA 4E46A 4QPDA 4M1EA 4NCIA 1A7JA 4OGWA 2HJSA 3ACBA 1KQNA 1T4DA 4GICA 3E48A 1NXWA 1A8PA 2QAGB 2UUCB 4KXQA 3I1IA 3OECA 3DV9A 3IP1A 5BMOA 2VBFA 1V45E 4TWAA 3TL6A 3A3NA 5L8VA 2XVXA 5I47A 2PDAA 3HR7A 3NIDB 4KK3A 4LGYA 2Q0XA 3ZEIA 3PUJA 1HNXB 5FUYA 4OJKA 4KC0A 4WASA 5DX8A 1JPVA 1U9CA 4YRTA 3WRXA 2OSBA 3JSXA 4QVKA 4C2TA 3MZ0A 2HNAA 5EP1A 1LQ2A 4OI2A 3ZWYA 1Z36A 2IYWA 2BGIA 4OJMX 4BZPA 2CDAA 2OP1A 2WU4A 2YQ4A 2R7LA 1GNSA 3JTEA 3KEFA 3L41A 4O2BB 5IUKC 3V1KA 3JS5A 4AZ3A 5HKAA 3P20A 3RC8A 1DEXA 1GPJA 2I6XA 2V5UA 2ZRQA 1Y1RA 2OWDA 3Q8MA 1SN7A 3MPUA 2GJ4A 1A9SA 2XI4A 3MMXA 5LYYA 3T35A 2WTUA 1HL3A 4QUEA 3WDKA 4KXLA 4ZCMA 3CLHA 3N5CA 2F8TA 1RM3A 2Q4BA 3C3BA 1E6MA 2GJSA 2XF2A 1FYFA 3F5QA 3I9V6 1X8JA 3NI2A 4LNAA 3OY2A 4UMDA 3LI2A 4P9NA 1AKRA 2ID4A 4MQLA 5DDIP 1P61B 2RH9B 1Z5VA 4PYNA 3QWAA 4R1SA 4A0GA 5K3SA 3KZKA 1C4XA 3KFVA 4I1VA 2VT3A 3K1AA 4GZ5A 4PLTA 2X58A 3EG5A 3WGYA 2AVDA 1EZ1A 1N7IA 4QELA 2Q8QA 4YEDA 4CM6A 6REQB 5I7UA 2ZUEA 4XJTA 3M1AA 2I65A 1XLTC 2GB4A 2O5VA 2PKWA 1F4LA 3KZCA 3C41J 2Z5GA 5JBIA 1M34B 4KDFA 5B2FA 1AHPA 4RGYA 5AKIA 1GTZA 3WOHA 4E31A 1RJ9A 4LOAA 1ZKDA 3B12A 4OXKA 1II0A 3ICOA 1Q7CA 2Y1KA 2W9XA 4Y98A 1WX1A 2XCIA 4GLLA 3A9RA 2FUKA 4AZVA 4L9SA 1G7TA 2AF3C 3B1YA 1Z6TA 1IDOA 4JLBA 4QJIA 4TS4A 4YUAA 4C7OB 1XXHE 3AWIA 3JAWA 4KPUB 3DZDA 1Z83A 5ALNA 1CR1A 1JG6A 3QY0A 1S89A 2FDXA 1A2QA 3HN7A 1FDTA 3WZMA 3R4VA 3A27A 4C0LA 1P0MA 3MLAA 4QU9A 3AF0A 3ZCRA 1SVSA 1X1RA 3MT0A 5JS2A 2FUNB 4DCTA 8GPBA 2WPDA 1X7YB 5FR1A 5BNTA 3KQKA 3PV0A 4ZTBA 4DMRA 1HLGA 4KSYA 2KLHA 4Q1FA 4CV3A 2WY2D 3RVOA 2GVDC 5DB4A 4A36A 3LZDA 2FMIA 1D1SA 4I4TF 4UU8A 1Y33E 4WKGA 4L07A 7REQA 2X4GA 3F67A 4UPDA 1VL6A 4AZTA 2ZSHA 3H99A 1A9XA 2HHLA 3EULA 1N8NA 2KI5A 4MYTA 1I01A 2IPAB 2ZB2A 3FTNA 4HDRB 4R69A 3WSWA 7MHTA 3CBQA 5CT6A 1QU3A 2NP7A 1Z9BA 4NEHB 4QX6A 3K92A 3C1OA 4N5NA 1B6RA 5FTMA 1OGYA 2C20A 2D2VA 1U5AA 1U65A 3NDPA 4GBMA 4IZ6A 3DZHA 5A6SB 2PA0A 2HCTA 2YOGA 3FZEA 4NOJA 1BMQA 1OTHA 1F0PA 2XGMA 4LI3X 1EIZA 5J43A 2OD7A 3U4QB 2R1VB 2IHUA 3AVUA 4U7HA 3R3UA 2O2DA 3VR4H 2OV8A 4IDHA 2ZUDA 5LZ4A 1G2OA 2UDPA 1G2QA 1KH1A 1NU6A 2E4YA 2VT2A 3KR0A 3LPCA 4GGOA 4O4HB 5IK2A 4CKCB 5FLEX 4EUKA 1L4UA 1TW3A 4RPCA 5AXCA 5K2MA 3EUAA 2A0UA 3L5OA 2LCQA 3REQB 3ZGXA 4GKVA 1KAQA 1WCXA 3ET4A 4CL0A 4K1LA 3W5BA 4R54A 2CHGA 2J0QA 2HI0A 1C9EA 4O2AB 1KC1A 1H42A 3IJ5A 1XWIA 2YJNA 3KZMA 1KNXA 1SR8A 3NEYA 4UPEA 4J0GA 4RXUA 3DM5A 5C5IA 2K7FA 4FHEA 4FYIA 2G80A 2CEAA 3E1KA 4ARUA 2I9KA 3GLHE 2XYPA 3KBBA 1DKNA 1SOUA 2B20A 2PBZA 2XWBF 3GW8A 2NUTA 4DGSA 4BPRA 1KOGA 5IULC 4HLUC 2PZAA 1WMEA 3BE4A 3KKMA 4OREX 5EKDA 3W2IA 3CISA 4N0MA 1QF9A 4BNUA 5LMZA 3GG9A 4YRQA 5DM2A 1UBEA 2JGLA 4LDJA 1DOZA 1JE1A 4RBNA 3OOSA 1WXEA 3LUGA 3C43A 4KJXA 2ZAIA 1PVVA 2EP7A 1U1FA 3MIZA 4JBYA 2QTRA 5T41A 3ZTTA 5DWQA 5ADVA 1X42A 2HV8A 5FWNA 1OX4B 2ZE5A 4IO0A 3AR2A 5CYGA 1NAHA 2LRHA 3FMGA 1SULA 3TJRA 4GEKA 3VR5A 2VSXA 1GP2A 2ZIEA 5ISMA 4WH0A 5ARDA 3WLIA 4AZ0B 5AJXA 1K86A 5WRFA 1P2SA 3WQBA 1CP3A 4TV8A 3WWOA 1OFGA 2PUWA 3FSGA 5D84A 2BEVA 1GKKA 2QMYA 3INRA 4Y2VA 1SXIA 1ZJZA 1VSBA 1WXHA 1WZCA 1M72A 3IUSA 4IGKA 1BW9A 4ESEA 1EB9A 2A4MA 2IZ6A 5HJEA 4BP3A 3IO5A 1VP9A 4LY9A 3BB4A 4R8RA 1XP5A 2D0IA 1PLJA 2JCSA 3HFGA 2J5KA 4CL2A 2WF9A 3AVWA 4Y7DA 4M0FA 3UXEA 4BE7B 4FYKA 4Y9SA 4C7MA 3C6ZA 5ALRA 5REQA 4FX2A 5IMBA 5C4GB 3Q9SA 1WW2A 4FTWA 4UM7A 4E30A 2UZIR 1HNZB 1N2CA 2PYDA 3CMMA 2I7CA 3QVLA 4JQSA 5MN5A 1YONA 3MD0A 4JHXA 5KPDA 3GNSA 1W47A 3TM5A 5EHXA 4Q39A 1SCNE 1O6ZA 3GAZA 4GWKA 5CH3A 3SI7A 3VXKA 5KTOA 1RCTE 3F71A 1C50A 1BHQ1 4BO8A 4X66B 3MUEA 1Q0SA 3HFRA 4Q82A 3G2JA 3NC0C 4QDZA 1BMTA 2G7ZA 3A2MA 3F8TA 5JNRA 2R0QC 2P2GA 3F4LA 1LB1B 4BL5A 5IP5A 1XMSA 4F7WA 1E79A 2AJCA 2IUTA 2D7CA 2Z2YA 1L7PA 3BE8A 3H84A 3INTA 3VHXA 1ORHA 1VHWA 1WEHA 3D6NB 2FFAA 2CCJA 4HRVA 3F6EX 1FDIA 3MB5A 2YWJA 3U39A 4ILKA 4LZNA 1JDTA 5EJEA 4LE2A 1KO7A 4BQOA 2X19A 3NHYA 3JQQA 1FP2A 2ATVA 1EZ4A 4JIGA 1JDBB 5D7NA 3SWWA 1XRLA 4HDAA 1VHDA 4QQ8A 4U2KA 1YUMA 2R1UA 1FLAA 2DFLA 5DK6A 2G3YA 2P75A 3JQCA 4JCCA 1TUEA 4HMPA 4BO9A 2G4CA 1I9CA 3KQUA 1IG3A 5LYJA 5BOSB 4I46A 5JADA 2D62A 3UMYA 2UUBB 4XDGA 3TSYA 1AKQA 3PGA1 1V8PA 1Q0HA 1VL5A 3QNMA 3HP7A 1AK9A 2ZVJA 4HATA 4MYHA 2R6AA 3VYTB 1KI3A 3M6WA 3OPXA 2HT1A 5LKAA 1H5UA 5L3ZA 3WFZA 3KOUA 4KR7A 1XZNA 2ZB8A 2DHCA 4U6NA 2P27A 4A6DA 3C8UA 3KTDA 4PGMA 4ZYTA 1TUGA 1EUZA 2BCJQ 5I9LA 4N9WA 1L6RA 3OM9A 4YJ3B 5E3HA 1HLPA 1C30B 1ESMA 2BM0A 1L9XA 3NDRA 4LE1A 4X85A 1ZI9A 3ANYB 3BCHA 1Y0BA 2GDJA 4PG5A 3DWGA 3DR3A 3OZSA 3N07A 3K70C 5DX0A 3OKFA 1UJ2A 4ZEOA 4UOZA 3UWKA 5DWDA 2WZDA 1Y80A 2CEKA 3DA8A 4YC7A 5A5EA 5CFRA 5HMLA 1C1XA 1QCCA 2V55B 3N0WA 1V2HE 1PE0A 2ICAA 2QD4A 4G4IA 3PVSA 1AF7A 3C7CB 4ABTA 2PA3A 2Q1SA 1L4YA 5CDUA 3LUJA 2OQVA 3VR4D 3DWEX 4FKBA 3Q0IA 5DGHA 3D4LA 3AKCA 1ZZEA 2GZAA 3ISVA 3K70B 4EHHA 3IIKA 4MRAA 2Z5LA 1QH1B 3MWLA 2GAAA 4TMWA 1Y3CE 3UWSA 4EWLA 1XAHA 4GXTA 4RTKA 1UUFA 1V6AA 2QZ4A 4PZYA 4UU7A 5LVAA 4UCXA 3NHZA 5B58C 1EX9A 3VM6A 4JLAA 1LDEA 1A2KC 1KVUA 1HDIA 1T8PA 2C2BA 2CDRA 3QM1A 4HQLA 3KPJA 4JBGA 3H5VA 2ZRGA 5GGYA 4BNZA 4UULA 3TMYA 1VFNA 2X8WA 3OX1A 4DZTA 3CVXA 5ED4A 1ZVMA 1L7OA 4MWBA 3PQEA 4GM0A 4Q9LA 3H83A 2J7KA 1ZEJA 2D2IA 1E69A 2GXQA 2RJNA 4LIPD 4N6NA 1XCJA 3Q1KA 1YZQA 5CM9C 4E51A 3ZHSA 5JZVA 3OIWA 5DOZA 4QE3A 4MOWA 1SMKA 4JUFA 4B2IA 3JAKB 1J0BA 4U4AA 1WSAA 2CFOA 2LP4Y 5A5DA 1M0WA 5AXBA 1CULC 5A9SB 2QRMA 3K9NA 5GM2A 1YBVA 4Q3OA 3S2YA 4PM4A 1GA1A 3BD6A 2FMHA 1GD1O 2IHZA 3RIMA 1DUIA 1JDPA 1Q44A 1Y1TA 4JR1A 1G8YA 3IHWA 1L7QA 4L6CA 3ZWKA 1JJ7A 1N2HA 1PT9A 4BOYA 1TQDA 4YJ2A 3C8ZA 3VMFA 4CMJA 2P3OA 3T7DA 3H1EA 3DWFA 1D3AA 1S9HA 1DAPA 5CT4A 5DM60 4AY4A 2HWUA 3L18A 2PN1A 1Y1LA 2CFTA 1G4UR 1WULS 4E5VA 3UIEA 1EGQA 3I34X 5IEJA 3DVLA 4XWYA 2R6R1 5FLYA 3PENA 4PXAA 4L5BA 4XZ3A 4D5EA 3WK5A 2BSXA 2H92A 1XU4A 4CIWA 1XCLA 3E9QA 4V03A 2VO1A 2F3UA 1V4VA 3QYFA 3ZGOA 4AY3A 4NV1A 2QLLA 1XDDA 3V8NA 5JHGB 4RYDA 3OSUA 1RWQA 1DP4A 3AEQB 1L5GB 1VPLA 1PFUA 5HJ5A 3PJEA 2ZOSA 1GCAA 2MMGA 1AQLA 3BRQA 1EFKA 2Z56A 2OUIA 2QR5A 4MITA 1JHOA 1V7ZA 3B13B 4IUYA 3AI2A 3OEEA 3D6VA 4TSKA 3GGGA 1JHQA 1DADA 4FI3F 2BMAA 4RD1A 5B1HA 4MDEA 2A88A 3MTJA 1NRXA 5AW3A 4OKIA 3YASA 4PIPA 4LBVA 1CZLA 4N48A 4OBEA 1ZICA 3SSNA 2RHRA 5H4HA 2I5PO 2ZBUA 4OHUA 4E5UA 1AQ6A 4QIHA 5TRTA 4F6LA 3X2EA 3CR8A 3BRSA 3MILA 4ZZIA 2DYKA 1E9FA 3WDSA 3C15C 2BFDB 4R0NA 2F64A 2Z3ZA 5KOHA 4NU8X 1B15A 4EGAA 1CF9A 4KXXA 3H8JA 1Q0ZA 2IYLD 3NBFA 2NTNA 4KVFA 3RFXA 5B3JC 2QRVB 4WACA 3K70D 2VHWA 2WM9B 5IX8A 1GAJA 2ZP1A 3SDBA 2H85A 5DGIA 3LBIA 2WHXA 3A28A 1BEEA 3MBOA 4ZT6A 1N57A 1TJPB 3E3OA 3FX2A 4EDFA 1UXGA 4XLLA 2CFCA 4BTLA 2C5FA 1GZDA 1A9TA 3RNOA 2F3PA 1I32A 1L7MA 1RM5A 2OBBA 3KYJB 3OAAD 4R3UC 4TYQA 1O0CA 3AI7A 4JJZA 2ORYA 4DQUA 2XEXA 4MVJM 3EVNA 3DPSA 1O5OA 4HLDA 1W1IA 2NVOA 4GI1A 4EHDA 3K35A 4J75A 1ZOSA 2H1WA 1GGMA 4IIFA 4F56A 2Q6TA 3IOCA 4MIEA 4JIMA 4RSHA 4RULA 4I99A 4BFCA 3GRZA 4RZ3A 3I01M 4U00A 4MKRA 4MR9A 5JS8A 4ZRDA 4IY1A 3GP3A 1E3EA 2V1UA 4X41A 1YU9A 3EOBI 3F7OA 1Z4PX 5DYTA 3RIXA 3LH5A 13PKA 2Y8EA 2WKQA 3QENA 3QKSA 1M5RA 5SYAA 4P3KA 5FT9A 3EEQA 4REQA 3KUUA 2H29A 2XQIA 1KYWA 2H1HA 3GLQA 4FMPA 4HR7A 4Q0MA 4ZO4A 1QIDA 5DTEA 1N9ZA 1VCIA 3ZH2A 1YZNA 4CW7A 3S2SA 2W2XA 4QASA 1HT3A 3AFGA 4M49A 4EL0A 2SBTA 1RJGA 2IHTA 4S12A 3TXXA 2X4IA 1I5EA 4ZEMA 1H2XA 1QKIA 3PEVA 1JFRA 2AZXA 3AI3A 2OSVA 3EWSA 2EWVA 5LA6F 4RHEA 1YQTA 3LVQE 3LDHA 3SZLA 4EDHA 1TD9A 4PQFA 4PSAA 4U8HA 5HILA 3IKTA 2FPPB 4PRZA 1G8PA 4RPLA 3VNQA 2ZITA 4KXYA 2IXBA 3CZ5A 1YJXA 3OZBA 4CE6A 4C2UA 4MGYR 1UP4A 1VA4A 2Q6KA 2W2OA 2WTMA 5B3LA 5LZ9A 1G21A 3V8QA 4UNNA 1KI9A 2BCEA 2EFCB 4FMCB 1KS2A 4P7BA 5C8VA 2FQQA 2JC3A 3HM9A 2F1IA 1NP3A 2FGJA 4LYHA 3WYDA 2G06A 1HK7A 2VUSA 3VR6H 4QVGA 2R8RA 3QI7A 1WHSB 2WLSA 4QRHA 3QX8A 4LXXA 5KYKA 1HQYE 2I29A 1PS0A 3TAHA 3G23A 3CG4A 3FPKA 2AHRA 1NQ5A 4J0DA 5E7JA 3RS8A 1K6JA 4TRJA 4F1KA 2WBLC 3TVYA 4HS4A 3IUMA 5CCBA 2QN8A 4WKOA 5F2NA 4TZ6A 1HRDA 1SGWA 4NP6A 3KTAB 4WJZA 5F33A 2X0JA 1NVUQ 3TJMA 2VQEB 4MULA 4UMEA 3V97A 3ZBUA 2VPYA 3DC2A 3CV3A 1R0XA 3N8HA 1VJGA 3QEJA 1PYDA 4DUGA 5FWYB 3WV5A 1UBNA 4XYBA 3LBFA 2GHTA 2GYUA 1E1QA 4HRXA 3FFTA 3HUTA 3R3YA 4ZAFA 2QXTA 1T8YA 1IVNA 1I0IA 5K45A 1HTWA 2NYUA 3NIWA 3A6HA 4H7EA 3ETNA 5HDQA 4CKYA 3LOPA 4Y2HA 3RCBA 3UHAA 1SK9A 5CA0A 5H82A 4D9CA 4MYCA 4AQYB 4E6EA 1C3LA 3L4EA 4HAUA 4ARSA 5JAIA 3V1TC 3OT5A 1XTTA 1KY5A 3O8OA 4BV8A 1PFWA 1U5BB 2V7XA 3KIPA 4QULA 4EAAA 1WLSA 4LZWA 5KNCD 4KR0A 2O1EA 4V02A 3PYLA 5KBYA 1DZIA 4E2FA 5E8RA 2X5KO 3U7QB 1QZ3A 4BV3A 4MRRA 1T5LA 5IAGA 4WK0B 2BV3A 4KFUA 1Q0QA 1PS8A 3NIBA 4F4IA 2Q1YA 2Q4DA 3KAQA 1QX4A 3K9GA 3MYYA 4NCKA 3ZCUA 1YT5A 1X7XB 4G85A 3ZS9A 3RK0A 3ZN2A 4I1IA 2IZ5A 3VR6D 1W5TA 3K96A 3NDJA 4G5HA 4WUVA 4CMKA 3SZOA 3O5AA 3AHJA 1DXHA 2VJCA 5A4AA 2F3QA 1MB3A 2BKVA 3RPEA 5IM4A 1W36D 3AHFA 1WUYA 3EXFB 1ONPA 5JSZB 1CK4A 2QXUA 2QYTA 3NBYC 3TSZA 3H5OA 3UUGA 4LHWA 2R2AA 1Z47A 2ZCUA 3OT1A 3OUUA 2VKQA 3Q88A 4YT5A 2ZRIA 3BJIC 5KWVA 1U8FO 4KLNA 5CB6A 1W5SA 3L05A 2XX3A 3H3FA 4F3NA 2XADA 2M6KA 3EXHC 1M2HA 1ULUA 3ZHOA 2J48A 1HEUA 2OV4A 2DQZA 3N1UA 1MX3A 3WL8A 3RS4A 3K0EA 2COUA 3IVXA 2H7YA 2J3KA 3NAMA 1MABB 4LJAA 1QC5B 2G0AA 4IS3A 4PWZA 1N0WA 1P1KA 1DFHA 1U2GC 2WSIA 4CQMB 3ZU2A 2XUJA 4HPWA 2ETVA 4IUCS 3DLHA 1O0BA 1B3RA 4N7BA 1CJKC 1QRAA 3GLKA 2QD3A 1Z2PX 1WPGA 2YOHA 4D4JA 1LW7A 1AGXA 2DSTA 4OQQA 1JHPA 1HOTA 3T6KA 1JKJB 2ERCA 4GBJA 4INOA 4MUGA 2VC2B 3BMCB 1IQUA 1ZINA 3W2TA 3NHPA 1F6DA 4DW8A 4EEXA 1V43A 1VYHA 4RA9A 4G24A 1TU0A 3A31A 3EA4A 3GRVA 5K4AA 2QJOA 4XGNA 4NH4A 2BFAA 2NOAA 3FKSD 2YBDA 4MVJI 5DCLA 4E09A 1XT6A 4I14A 2GHRA 2XB8A 4RTNA 1E0AA 5EPOA 3DH0A 2VXOA 1DCFA 2ZIFA 5EERA 3DMDA 3U44A 1I36A 3MWEB 4LXHA 5DMXA 5B1YA 3LECA 3D0QA 3DLAA 1X1QA 4JFAA 3VU1A 1P5RA 1PW7A 2C1XA 3R9KA 3A37A 2Q4OA 3UGKA 4BIIA 1NHGA 1YFJA 2IQIA 1C29B 4RZQA 3Q15C 3QFHA 2XNSA 1TQ4A 1RVV1 4X61A 4EPXA 2WIFA 1D5CA 1OI3A 2DHEA 3N0RA 4OXIA 4CHGA 4Z5XA 4Z4QA 3T1NA 3HGQA 3TFWA 3ZZUA 1KO4A 4IDDA 2C94A 1R7RA 3C16C 4JU8A 4INAA 2P2CA 3P9RA 2GO1A 3WIEA 4DDUA 3N28A 4EA8A 1H5QA 1NKTA 2P9GA 2X8JA 4C20A 2P4UA 4Q34A 2J1LA 1NW6A 1J5XA 4WKNA 4FINA 1ORTA 2ISCA 4HN2A 2IITA 4WEOA 1KP9A 4D43A 4ZANA 3ID6C 4BZZA 4LMPA 2V97A 5ENZA 2HO4A 2ZJYA 2HMSA 3W5HA 3UJ6A 1QTNA 3N2EA 1QR2A 4H27A 1O96A 4JI1B 4ZQCB 4DOMA 4MW7A 3ZHYA 5J2TA 3HCNA 2ZBGA 2OO3A 4NZPA 5A3JA 3SCZA 3EIHA 4MARA 4XWTA 3UMCA 3CX7A 3VU9A 3HKCA 4WJLA 1U7OA 4L74A 1UPXA 1K9VF 3EW7A 3AM1A 3HVHA 1A88A 4M55A 4JEHA 1E2FA 2GN0A 4CQMD 4UUNA 3IV9A 1K3TA 1V9LA 2BISA 2A7QA 2GN8A 1KP3A 2PYIA 1I4EB 5MGBA 4L22A 2W6ZA 1IBCA 2IPXA 1Y48E 4Z9YA 3UG7A 1XNHA 3DKPA 2XVAA 3FCXA 2HWXA 3PXDA 4MIOA 3LRXA 2NPIA 1HURA 2PIDA 3HV2A 4X7MA 1X1BA 3KUDA 4UDNA 4MB6A 2CB9A 4HHEA 5BSMA 4BMCA 1M10A 2JLSA 3OPVA 4WK6A 3C74A 3NFRA 3QE2A 2QGFA 2WKWA 1KQ3A 4YXWD 3EGIA 5LA6A 1FNSA 1KQOA 1U0GA 1J25A 2EZUA 3GA0A 3MLEA 4KR9A 4OJTA 2YR0A 3CX8A 3LCCA 1JAXA 2E5WA 2NUPA 3UWMA 1TYBE 2ILTA 1J2RA 1ZH2A 4YRSA 4Z1MA 2Z6QA 4UAGA 3FVQA 2AOUA 4KV7A 4KKVA 4L85A 4QKQA 2WVGA 3GZNA 1X7ZA 2TMGA 3NBMA 2ZUFA 1G5IA 3KL4A 1N4AA 1CUGA 1Q7GA 2J4FA 2WINI 4E4RA 4XGQA 3K15A 3QA9A 4M86A 4OQLA 3FYUB 4X1KB 1M2VB 4A6EA 4P33A 2R47A 1Y7PA 1YTUA 1B73A 1BWRA 1ULTA 1TCUA 1BYIA 2HF7A 1J9ZA 3FFXA 4MNTA 3RRZA 1UMDA 2R79A 1DZ3A 3ZGLA 2WE7A 4QL3A 4DCMA 1XEFA 3CGWA 4O29A 2C3MA 4D97A 3JD2A 2ZJZA 1ECFA 1DAMA 1L4EA 1RXYA 2FPGA 2A8YA 3B6MA 4UUPA 5GOTA 5E4TA 1NBHA 1M6VB 4TXHA 2OAP1 2CVPA 3DV2A 1USUA 4EIWA 1EFCA 1Z17A 3KXPA 4O4IA 4HO1X 1CQWA 4RK0A 3TWOA 3WNCA 5ITSA 3DBLA 4S2EA 3CB4A 4C04A 1RCFA 2POQX 1U0JA 3C3WA 2IXFA 2R8ZA 5TVGA 3TR0A 2JBAB 1Y82A 4KQKA 4O2AA 4B3SB 4JKOA 2ALJA 4OP3A 2W2VA 3D8RA 2FJ0A 1ZFNA 1E1KA 3N74A 4CNBA 1DDGA 3L1HA 3DMHA 3TOXA 2E4ZA 4D96A 2AHOA 4UNIA 4DREA 4AP6A 1QLHA 4AY2A 2YHAA 1EE9A 1CR4A 2GR9A 3FHOA 4U7DA 4AMUA 2PXHA 1KDOA 2JIRA 1PX0A 3I53A 4FFSA 5FV4A 2GZSA 4Q66C 1GTJ1 3KB1A 4KG7A 1WXIA 3OIUA 3PP8A 1HR0B 3KFLA 4KN8A 1AIPA 4B43A 5KDDA 2P41A 2FETA 3JW8A 1JFFA 4K0KB 1TI7A 3HVUA 3PSHA 3NUZA 2XXJA 3BRCA 3CB2A 2M1ZA 3HXKA 4QBHA 1YE5A 4YBRA 1PNQA 2ETXA 3JALB 1KORA 5CNJA 5FR2A 1W1WA 3EXEA 2P6RA 4IHQA 2IYFA 2FCAA 2F59A 2EWWA 2K2QB 2NYAA 4NHEA 4NYMR 2WU3A 1VKJA 3PR1A 1C3XA 1O95A 1SA0B 1NVAA 3IPYA 3FOAA 2J3EA 3RFFA 3G1UA 4M1KA 3DZIA 4WN9A 3OCWA 4MGIR 3BHIA 2O0MA 4JBHA 2QX9A 2RC6A 4ZYUA 5IM4F 4EQ6A 3ZQKA 3C3YA 2J33A 1R9GA 5EWMA 1KEZA 4ED9A 3E9ZA 1RYDA 1FSZA 3BT7A 2V8OA 5J9FA 2B30A 2BGRA 2GBPA 5JVDA 3BGIA 5MN4A 1M1ZA 3WBKA 2J41A 3MLBA 4F6CA 2WLTA 4ZI2A 3RTEA 4YMLA 1J0EA 3ZVRA 4L08A 1NVDA 2DTDA 4KOEC 1E9RA 1VJ1A 5JLAA 2NU6B 1LXCA 4HH1A 5DEIA 5LNK1 4N5DA 4M9RA 4GRDA 2A2ZA 4QSMA 2ACWA 1ZQ9A 2Z1MA 3SS7X 1AHIA 1GQFA 1EYZA 3J7AC 4MUJA 3QTBA 4UUMA 1YIDA 1TM1E 3WKBA 4Y6QA 1EEXB 2EZTA 2IF0A 5SZHB 1WOMA 2JFPA 2W5UA 3JQDA 5K6TA 1ZBQA 2WZBA 4A10A 1FNBA 4AIIA 2WJAA 2CFIA 2NZXA 1DIRA 3B1WA 1X8LA 3BD8A 2QTGA 4TLCA 4HL6A 4J0CA 2OXCA 2B34A 3AONB 2AYZA 2JIPA 2YC2C 4WLVA 3CUWA 1VKHA 1WE2A 1IHOA 1BN7A 4DMCA 3LSYA 2PWYA 1UWKA 4MW1A 3S70A 3TR6A 1X14A 2OBNA 3N9IA 3OP1A 1WUKS 1CJMA 4HX2A 3DVSX 2CVOA 5AUOB 1IWOA 1CY0A 1VECA 1T3ZA 4ES6A 3DXFA 1O7JA 1DO2A 4BFZA 1B8UA 1RBQA 1XDBA 4QTZA 5BOSA 1CNFA 3WGGA 3BCUA 1NQXA 2AF4C 2CUNA 4PCVA 3INNA 3KT3A 3RT1A 1LH0A 3TRKA 5HXAA 3O3CA 2QNBA 4F93B 4J4TA 1GUBA 3JQ7A 1SQFA 4RLQA 2ZT6A 3P19A 4RA6A 4R1LA 4YLGA 1J8QA 4QUKA 4D41A 1M8GA 4IG9A 1BE8A 2K4MA 3SIXA 5DLQC 1FXUA 2NPOA 3SSOA 2C98A 2YJZA 1GNVA 5L7TA 3P52A 4K1XA 1UBMS 3PD1A 1QOQB 1C30A 4HSEA 3K16A 4P4SA 4Q12A 2CJYA 1DIHA 4WBXC 1PGJA 2JFWA 4JSYA 3PCXA 4E2WA 3DO5A 2D6FA 4V1CA 1CZHA 3KWFA 1EDBA 1WKCA 1VBKA 5LQRA 4EAQA 3KD2A 3RM3A 5SZIA 4HRAA 2OR3A 1PJ2A 3NZEA 4DC9A 3LY9A 4TQUS 4J7XA 2E37A 3RDPA 2G1AA 3MAGA 3ZUGA 5A3SA 5IFLA 1AMUA 1ONNA 1P6QA 3I0ZA 4GGPA 1U2GA 1KE2A 3W5JA 3OLYA 4R68A 5B55A 2XUIA 1Z2AA 5ALZA 5FPQA 2WP0A 1VDMA 5DMHA 4DLKA 5JMPA 3V8VA 1PGOA 4X3CA 4BECA 2G9RA 4I50A 5CLHA 5BURA 5JXWA 3F97A 5ALKA 4A0QA 5LM3A 3EFOB 2GEDA 4C1BA 3AKZA 1BJRE 2AUNA 3GMIA 1ZL2A 1EU1A 4PC7A 1XEWY 2CLIB 4B84A 2XNCA 4F4JA 2Y27A 1XRPA 3A1NA 2FQ1A 1RRMA 2HPVA 1PR3A 2WG1A 2YYAA 3AERB 3ICWA 3OIDA 4H1TA 3KP1A 2AYYA 1OHHD 2Q8NA 3R09A 4KZPA 5KU1A 1AA6A 1UWVA 3M70A 4B3BA 4ZD6A 3U7HB 1XYVA 2VUUA 5KYTA 2G6TA 1ZR4A 1RMYA 5L3SB 2Q6IA 1PDVA 1U8ZA 1YBMA 3T41A 1EUDB 4ZMRA 2PV0A 3WAJA 3QUBA 3PUKA 3H11A 3TNJA 3W9YA 1GU7A 5D86A 5EUBA 4S1PA 4PTYA 2DQYA 4GPAA 2P2YA 1LSJA 1W35A 2XVYA 3BL5A 4WDRA 2ZYVX 3X1JA 4US0R 1XCMA 3BIWA 3EIFA 3K8YA 5ELLA 3UA3A 4CF4A 1RAEA 5C5CA 5KC8A 3SHWA 2EFDB 5M7EA 1KY4A 2WHEA 4RY8A 1SVLA 1T2AA 3AX6A 3K9CA 3T7SA 1GFWA 2Q3JA 1QIKA 4LOLA 2YFYA 4FFBB 3HJBA 2CVQA 4PQRA 4ZVUA 3CONA 4U2DA 1J09A 3ZR4B 1W36C 5HQJA 3AJRA 2VDRB 4JP2A 4MA4A 2H00A 4PZ9A 1C8LA 5ETJA 4RGVA 2VPPA 2ZTHA 3TNDA 1U99A 3FDJA 3IKLA 4QBFA 4F96A 4XCQA 3R77A 3VZBA 3RD5A 2F00A 2QL5A 4RM2A 1ZW6A 2GK7A 3OTQA 4YB8A 1KSGA 4B3CA 1NPDA 3L0IB 2G09A 4CCAA 4OMUA 3K31A 3R5FA 3C5WP 1TF7A 4KIGA 5CLIA 3O47A 1VL0A 1CRQA 2GAIA 4MRSA 4LF4B 1L8QA 1ZRSA 4QFMA 5DSXA 4V0NA 1KE1A 1GILA 1LDMA 1R0SA 4PLPA 5AHXA 5K0CA 1IUPA 3EGVA 3IP3A 2A59A 2XGGA 4RL4A 1KDVA 3QUTA 3RLIA 3OLQA 4AXXA 3R24A 2WKPA 2FX2A 2IHJA 2WSMA 3ND7A 4R1NA 3MVEA 5KKAA 3RGWS 1O97D 1E1YA 2F8SA 3EGXB 2YJ4A 2IPLA 3EYWA 3GIDA 4GMDA 4Q4DA 2GZ3A 3OF5A 3R20A 3FMOB 3ZKWA 5DN6A 2O8FB 5CB4F 2ZPAA 3KV1A 4BJ3A 3I9FA 3FPAA 1I4LD 3L4BC 3LT5A 5CT8A 1OXXK 1T3LA 1U8TA 3G02A 1EFHA 3GLRA 3NHMA 5BMVA 4R1QA 3CXRA 2HREA 1NBEA 2FHPA 4KVGA 4S04A 4L5AA 2PU5A 1JSZA 2CN1A 2IU4A 3OUZA 5GVRA 3T4EA 3KS9A 5A5VA 3LY8A 3EZ2A 2C9BA 1JNXX 2AG6A 1X1DA 4KACA 3N6VA 3OUTA 1XAGA 1O4WA 2P9JA 2QMOA 3RSZA 4BNKA 1E58A 2PH5A 1GG2A 4G4JA 4GP7A 4JA2A 4E2YA 4YDHB 5HRCA 1WSWA 1CJUC 5JD5A 3I5YA 3JD1A 4FEYA 1WVGA 4DE5A 4FBMA 3NWOA 1K1EA 3SC3A 1S4MA 5EHGA 3ABZA 1RRCA 2COKA 3SQLA 5MDHA 2O3TA 3CWQA 3RREA 1NXOA 2XODA 1F7UA 2KB0A 3E3LA 4U6QA 3WIUA 3DOIA 4H7IA 5I7VA 4K9OA 4P4GA 9ATCA 3WYGA 4D8TA 2O2XA 3EB9A 5H1YA 1UCFA 3W2GA 4BMPB 4TLLB 2G1PA 1OBOA 3NBUA 3H8WA 1N0UA 2F8MA 2TRSB 3HS3A 5IT9A 2Q3BA 1EAYA 2XQGA 3F6SA 1N2XA 1GTMA 1VSVA 5EZYF 5JC1A 2X7HA 2I9PA 3DFZA 3O4JA 3M4JA 1DPFA 2HBZA 5I7HA 3QITA 5JS7A 1GQQA 1RBZA 3BYZA 3DAYA 4KE6A 3RS0A 4KR3A 2TECE 2JLWA 1JQBA 1Y1PA 3A25A 3QUCA 3RSFA 1F2DA 3DO8A 3UC9A 3NJ8A 2R00A 4MQ6A 1Z2EA 1N6NA 3QBTA 2A9OA 1NKSA 5IVPA 1ABFA 2I8LA 4FHFA 4G0QA 1JIJA 3QLJA 4FYWA 4R7GA 1BCSA 1OCEA 4WADA 3VBEA 1V6SA 4BNXA 4MI3A 3JQ6A 3O90A 4DCCA 1AA9A 1BJTA 4ZQFA 1DKRA 4GMKA 1IM2A 5KVVA 4DQVA 4YQZA 5I45A 2H2IA 2IW3A 3CNNA 3ICCA 1QYXA 2ZJFA 4QLOA 2A57A 4TL9A 4D3DA 5IHPA 1D2HA 5KTRA 2V6GA 4F3TA 4C06A 3R9XA 5CBKA 4Z54A 1C9JA 1J99A 4K9RA 3OEWA 1P0FA 1OU0A 1U0HC 3E53A 4OIMA 4MV5A 4A2PA 4AJ9A 1JEQB 4YJHA 5T4EA 6LDHA 5L4NA 2P2DA 3PDJA 1THGA 3CC8A 1JF8A 4N3CA 4DXDA 1RAFA 4EX6A 4KFRA 1U9IA 3RVQA 3BMXA 1U1EA 3AC0A 3FW1A 3JYNA 1D2EA 1CEYA 2WEKA 2FW9A 1NVFA 3HJUA 5YASA 1EFUA 5CB4A 4DMMA 4OMFG 3RV3A 1MBZA 1KZHA 4ALNA 5E2BA 4EFLA 1KYIA 2IZOA 1MPXA 2AIRA 2YH2A 3M2TA 4DXAA 3G82C 1AY0A 3UPTA 1E4VA 1TIKA 3AETB 3FUTA 3W77A 1U3TA 1HDCA 1ZK1A 2A9QA 4L8LA 1MW8X 4GL2A 5JSFA 2RCYA 1NE2A 2X9LA 1RMQA 3HGTA 2CB0A 3WJ1A 3VA7A 4Y67A 3RRYA 2E4UA 3S55A 1CQZA 4L4UA 1J5PA 4MS4B 5A4IS 4P2GA 1Z4LA 3LT1A 1IXYA 1IEWA 1Y5IA 1GPDG 1PD1A 2J5BA 1TT7A 4CIAA 1YR3A 1E5TA 4NG5A 5DX1A 3STVA 3T7AA 4QREA 4ALLA 3WIOA 3W1VA 1FNCA 3AK4A 5BRNA 4XEUA 3HN6A 1OZGA 4M8IA 1JSXA 1RC0A 1VLZA 3JQ9A 3QVJA 1N5JA 5I4CA 3GJ5A 1TO2E 4ATNA 2YS6A 2WWWA 1E4EB 2REQA 1RE1A 2L42A 3MQFA 4IDGA 3HEAA 4JWKA 4Y9DA 1W5EA 1SELA 1U81A 4QODA 2QUHA 5FLXA 4X91A 1O8CA 1M2WA 1SHJA 3QV2A 2CGEA 2DUMA 2ZI9A 1T9AA 4C4XA 2GCPA 2UZ3A 4M60A 1HH4A 1XNGA 1L7EA 1KBQA 2VBCA 2O57A 4A8JC 3DVAA 5TXGA 5FBVB 4JJ7A 1MFZA 1R16A 4RVUA 5E7QA 4Y2GA 1QFXA 1FNDA 4P3XA 3GP5A