5JNYB

Crystal structure of 10e8 fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGSASGNRASLTISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 10E8 Heavy Chain
publication title Developmental Pathway of the MPER-Directed HIV-1-Neutralizing Antibody 10E8.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 212
sequence length 212
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jnyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jnyB01
4WWKD 2NPLX 3QQ3A 5HYJE 2D03L 3STLA 3PHOB 5C0JA 4LMQE 2VKWA 5JMRA 5I16B 1IGCH 3S96A 2LAAA 3LKSB 4M61B 1NFDF 4OAWB 1WZLA 2NZIA 2VSDA 5T33H 1OTUD 2DTMH 4OZFH 4YDLC 3BH9A 4XBEL 1JI1A 4XNUL 1T83A 5C09A 1SVZA 5IG7A 1FSKB 5ADOH 1PFCA 1TXKA 2R0LL 3U0TB 4H1LA 3P77A 4D0BA 1JRHL 3HPLA 5D96C 3QWRA 2FX7L 5I73C 3RGVC 1YN7A 4QY8B 5D7IB 1WSST 3H7LA 1RUPL 3U7WH 4AT6A 2DQGL 1LO5A 2NY2B 2ZUYA 1HQ4B 1UM4H 1KEMH 2BSTA 3VE0A 3N1QC 4NKOA 5ITBL 1AGFA 4HKBB 3B5GA 4JRXB 2VWEE 1DQDH 3FQXB 4PRHE 1CL7H 4QRQB 1KNOB 2DICA 2GY5A 5T3XL 1F58H 3IRZA 1NFDE 2EZ0D 4PY7A 4RBPK 1HXYA 3BQUC 3VXOB 3G5VB 4QHUB 3EO9L 4JZJB 5C0GB 5DD5H 4RMSA 4CVWA 3BIAX 4I3RH 2OI9C 2F19H 3RWDB 5EUOA 5DK2B 1TJHL 1FJ1A 3T3MF 1FZJB 5I76A 2JCCB 3QYCA 2X1PA 2AKRB 4X7SL 1F6AB 1N6QH 3EZ8A 1G7HA 4LPYA 3WLWD 4JHAL 5FOBB 2Z92A 3KPSE 4LLDA 3FN0H 2P5EA 3NFSH 3TWCL 3RTQA 4CDHA 1N4XH 4OGXH 3DO7B 3D3VD 5FKPA 2BVUA 3EOAB 4KRLB 4ZG1A 4F15C 4OLWH 4LSSL 3MBEA 4IM8A 4D0DB 1AE6H 4P5MB 1MCWM 5CMAB 2DLEA 2GTZA 3NA4A 1KYOJ 1SEQL 3DMMB 3AVEA 3CSGA 4P48A 1N7MH 2I07B 1MFBL 4I9WE 4K07A 1RUAH 2EEBA 4Y2DA 4OUUA 4O5LL 4NNPL 3BKCH 3ARVA 3ZKXB 3GSNH 4JKPL 3VD9A 3GO1L 3T3ME 1JGUL 3H9SB 1A21A 2E6PA 3E2HC 4OI7A 4APQA 5EO0B 1MUJA 1JPSL 1YPZF 2J12B 4P46A 3QI9A 3VA6A 4OFVA 3N9GL 5EO1A 1ZLVH 4XCNA 4LGRB 3TC9A 5B8CB 4MSWB 5E94B 2O93L 4QRRA 1TZHA 2M8XA 4HS8L 3MRMB 3RWFB 2LVEA 4XTRC 3S37H 3D0VB 5ID1B 5K9JL 1D9KB 3AY4A 5F7KC 1P9MA 5F93C 2XZCH 4NQXA 3TH4T 1R3JA 2H8PA 4K8RC 5HHOE 3VGHA 3OKEA 4XVUD 5F3HB 4C55A 1UACL 5CD5C 2BC4A 1J0HA 2D7MA 1CICD 1D5ZB 1EFXB 4FFVC 4JAMB 3OJ2C 4LKCA 1TQBB 3BP7A 2FD6H 4LHJB 3HE7C 4LLQB 1UEMA 1E4WH 4UT7H 4FHBD 3FONA 4XCEA 5TDPB 1U6AH 1YPZE 5FM4A 3UTTB 2IBGA 3QRGL 5BV7L 3S8WA 3QUZC 4OD1L 4YXLH 1YYLH 5E5MA 3NACL 4KKAD 3LN5B 2QKIA 3VXMD 3KJ4C 4DKFL 4QXGH 4OF3A 4S0TD 1E4KC 4I18B 5HY9B 4WWKC 4EXKA 1NCWH 2Q3AA 3BO8A 3MCKB 4HS3A 3TV3H 1JF1A 4CUCA 1WEJL 2AEQL 1KN4L 7FABH 2ICEA 1A7NH 2R56L 5I6XB 1I1YB 4FTVE 1Z3GL 5ISZA 2G2RB 1OTUC 2Q8AH 1MJJA 5DFWH 4NCDA 5HDQL 3GZKA 1J8HA 4J4PA 4NN5B 1KJ3L 5ADPH 1Z9LA 3DNKA 4LF3B 5HHNB 3JV6A 1ZVSB 4U2YA 4O2FA 5HI5D 1JYVA 2FB4L 2EE6A 3Q1SH 2EDDA 2VXVL 5EBWB 1FRGL 1J7VR 1NDMB 1C1EL 4LK4A 4V1DD 1NGZA 3LQMA 4C4KO 1F4YH 3REWB 1CGXA 4GBXB 3QUKB 5IT2H 1ZA6B 2CIIA 3S4SA 5CEYB 2J8UF 1Q9WB 3SQOH 2JIXB 5HYJB 4LLUB 4FXGA 3IFNH 3MREB 3IJSA 1OTTD 3IDXH 3VMNA 1ND0B 4QRUB 5L88L 1JMXA 4OSUL 4QHKJ 2ITDB 1KLUA 3BPOB 4X5WA 2EZ0C 2W9DH 4MAUL 4KROB 2BHZA 4LKXA 4RSVA 4JO1L 4G8GA 4YNYA 4I3SH 4GSDL 2EDOA 4QXTA 5CKGA 2AK4D 2Z35A 1UJ3A 4CW1B 3TJHD 4JJ5A 5J0BA 5MEPA 3TPUA 4HIHA 1RJLB 2GSGB 2Y6SD 5FYJH 1NC4A 1A6AA 5CCKL 3O81A 5CLTA 2R8SL 5ICXA 1MEXH 43C9B 4NJAL 2Q8BH 1HH9A 1YECH 2J8UE 3HRZB 1A7RH 4PJAF 5TDOB 1FNFA 1XGYL 4YX2H 5JPMA 4RRPA 4ZPTA 1OSPH 3T0EA 1LVEA 2EDEA 4PRHB 3JTSA 3S88H 5GGSA 1ZLUK 1I8KA 4HIJA 2H2SD 4OIAA 3VXUA 3FO2A 3FQUB 1FFQA 2VDOH 2GCYA 1IL1B 3OHXA 4EZMA 5FYKE 2VLJA 1UGNA 1AGDA 5CIPH 2JB6A 5AAMA 3S7GA 2DBLL 4ONGH 5JIHA 4HSQA 2QQLH 3OXSB 5HBBA 5D1QB 1KTLA 4ODUA 4QRTA 1OWRM 5E9DD 1OAXL 5HGHB 5C7XH 3O9WD 3NCJH 3G08B 4M61A 3WCYA 5C0RL 4PJAE 3FB5A 1B4JH 3V5HA 3PE9A 3ZHKA 4F3FB 2LTQC 3NZ8A 2DKSA 5E8OB 4BZ1H 5GGRY 4HKZA 2J88L 3GMMA 4BQBA 3HE6B 3L6FA 4JREB 4PJHB 1U3HB 5IK3B 5I19H 1U93B 3P4MA 3CLFL 2XKNB 1CD9B 1I75A 3S5LA 3GHEL 4GQ9L 4XVUC 4MQ7A 5B4MD 3BX7C 2B1HL 5T1LB 3QDAA 1C16A 3W0WA 4C4KT 2CKBL 2VDQH 4NQSB 1CICC 4OD2B 1NGWB 4X5XB 3ET9F 1X5FA 3H3BC 5CIPA 4XNZC 2BP3A 4PJ5E 5E2WH 3LIZL 5FUZH 4KKAC 3RGHA 3TNMB 4OV6F 3HUJB 4WI2A 4E42B 3CSYA 5F9OL 1UA6L 4UDTA 4R2GD 4PJIA 3WNNA 2IANE 1HHGA 4OLXH 2ZP0T 4HX1A 3RWHB 4AH2B 3U9UB 2QTEA 1MCJA 3QJFB 4YHKH 4YHNA 1E4XI 3AGVA 5ILTH 4JFFE 3GJEB 2CKNA 5EB9A 2B8OT 4F37K 3I6GA 1QBAA 3VDBA 4JG0H 2YD7A 2GITA 3L7FB 5DK2A 3AUVA 4PJ8A 1KBGH 3STZB 5EOCH 1NMBL 1D5XB 3FRUA 3DYMA 1DUZB 3I6LD 4R96A 2D7QA 3BGAA 1AIFB 3QZWG 5HI5C 1YMME 2GFBB 1MAML 3DO7A 3Q0HA 4Z7OF 5F6IB 5CEXB 2HFGL 3W81A 1VHPA 3VRIB 3WNMA 3SDDB 3EDDA 2X7LA 4BQ6A 3DMMA 1KENL 4PRIE 5J11C 3QCUL 1IEBA 1BQHG 4MA7H 4AZ8A 3MBXH 1BVZA 5IB4A 2B4CL 5CINH 1OTTC 4UT9H 5C0AE 4G6JL 4QKXB 4XNYH 3H9SA 4FP8L 2EE2A 3H2WA 4FTVB 5BVPL 4X4YA 3MLVH 5C86A 3O41B 4Q2ZA 5GIRA 4NZTH 5IESH 1T04A 1LK3L 1T0NB 2ILLA 3WO3B 3CX5K 3K7UA 4ONHA 1NQBA 2OMBA 3PDGA 3TJHC 4Z7OE 1D7FA 1MRFH 5F1NB 4WWID 5TE4H 4DKDC 4M43H 5CZXD 2Y6SC 4LCCC 5GGUB 5C07E 4XP1L 5L8JB 4KTEH 3BD4A 3LSOB 2E6JA 3FQWA 3QNYA 1S9WA 1PYWA 3WLBA 3BKMH 5T1MB 1IBGH 1J0JA 2CIKB 3LRSB 1T1WA 4XBGA 4RAUA 5D6DA 1FNSL 3GI8L 3S3PA 3W2DH 2PR4L 4NIKB 3GNMH 5DFVD 1MRCL 2VZOA 3BIKB 4U6XA 5I0ZA 2H2SC 3TZVA 1TJIH 4ZO8A 4WW1B 1QA9B 2CJUH 4WUKL 5BZWB 5DJAA 4HUVB 3CDYA 3TEUA 4DGVH 4QHLA 2EIEA 3LN5A 5EWIH 3GBNL 4QOKD 2XN9B 3GM0A 2AJUL 4BH7B 4L3EE 2OJEB 3B9KD 1AXSA 3RL1B 4AL8L 3F7RA 1Y0LB 2VRAA 4NQDA 3BDYL 1P84K 3O9WC 4QCIB 1MCKA 3CVIL 3T0VA 2J8UB 1B0RA 1MI5E 3WE6B 3LRHA 3VJ6B 4UT6H 1A6TA 4UILH 4M48L 1RZKH 3ZYOA 4MAYB 4PTUA 2Y7QB 4TUKL 4H8WC 3MROB 5JQ6L 5B4MC 3MUZ1 1QLRA 4BH8B 3NH7H 1BIHA 5FK9A 1AO7A 1H15A 4AIOA 2XQBL 5IEHA 3CIQA 1JWSB 3PWVB 1CE1L 6FABL 3CD4A 2VH5H 4MCYA 4Q97A 3U4BL 1ZA6A 4M7KH 3QQ4B 2UZIL 1BAFH 5DC9B 1YEHL 3RX7A 2G60H 3JVGA 4NWTL 5C08A 4ZUVA 3SKJH 4LLAA 1UB6A 2JJWA 4OF0A 5CKAA 1R24A 1MPAL 4EQ2A 4NUGL 2NY3B 2FWOB 3VFNA 4PJAB 4R2GC 2QQKH 1UWXH 3QHTC 4MA3B 2VR9A 3NABH 3WFCH 5J13B 2BVPB 2OSLB 4XVSL 4ZNCD 2ESVA 3RVXD 1YY8B 4L8SB 3ESUF 1FE8L 2MMXA 5BXFB 4ODXB 2R9HD 2VLLB 3VFPA 4U1KA 4RMTA 5I1IL 4RAVB 3P11L 3WJJA 32C2B 1A6ZB 2LAGB 4S2SA 4HHAA 5EC1A 1RIHH 1ZVHA 3QNXA 3V6FB 5CD3A 3T3PF 4N0YL 4O4YL 3QUYA 5HGBA 1TDQA 1P69B 3TLRA 2VDRH 3MRRB 5T1DH 4NO5A 2P8PB 4ZXBD 1QEWB 2Z93B 2B1AH 3TBVB 4PJ5B 4OGAD 4K7FB 1C5BL 1Q0YH 5E8DL 2BY3A 1NL0L 1T20B 2UY7A 1A4JB 5L9DH 5K33A 3O2VL 2IANB 2R0KL 2HJLA 1M71A 4DQOH 2J6EH 4NSKB 1N5AB 2B2XL 4ZTOL 1TCRB 1QD0A 1OAQH 4OIIL 1Z9SA 1PLGH 3FRPG 3VFWA 2FO1A 4JM4H 3SE8L 5DUMH 3IFOB 3UBXG 4H88H 2DYPD 2HVJA 4JN1H 1G9EA 2YS4A 4BQCA 4S10A 1K4CA 1N5YH 3K2MC 5EU5A 2AJVL 3QFJD 4WEBH 4O00A 3T3PE 1T66D 3KPPA 2YA1A 1YMMB 3NN8A 1ITBB 3K8LA 2D7TH 2HN7A 1K5NB 3LKRB 3H9HA 5CZXC 3V4PH 3VGEA 3L3JA 4J3UA 3B9EA 3ARZA 5B3JF 3GIZH 4PJHA 5ESVA 1Q1JL 1ORSA 1UYWH 5IBUB 1BGXH 1E0OB 3OV6A 3CPLB 5F9DC 3L9RB 1EAJA 3IU3A 2MCG1 5C92A 3ZHDA 1YEKH 4YFDB 3DSFL 2IG2H 4M6OH 1INQA 1B6UA 1RHFA 1URLA 2J6EA 5DFVC 3SJVA 4Z7WA 5C0AB 1AD0B 3RIFK 1NGWA 1JGVL 1ZT4B 3WNLA 1GL4B 1YDPB 4FFZH 4G8IB 2EC9U 2P8LB 1EEQA 5F1SA 1VESA 5C0FA 2HTLD 4PB9H 5JPNA 4M9PA 3SN6N 1D5IL 1AQKL 1SBBA 5E2TL 4Y4HB 4RWHA 1NCUA 3LMJH 4EBQH 5FGRA 5C0CA 3B9KC 4XC3H 1UZ8A 3LB6D 5C07B 4G6FD 4WI3A 5HJ3B 4X5LA 4L4VE 4JG1H 3LEYL 1XGPB 5B3JE 5EZJB 4I77H 1F90H 2VL5B 2D0GA 3ARBA 5IW1A 1PKQE 1CFVL 3GMQB 5MENE 2GW5A 1U36A 1RK0B 2OTWB 3WFDL 4JO3H 4JHWL 1PVHA 4YIQB 4NN6B 1LDPL 4R0LC 1QFUH 1EEYB 3VG9B 4J8RA 4HUKB 1KELH 4J2XA 1R5VB 4U1SB 5JUEH 1FP5A 2DQEL 4GAGH 3RNQB 1TETL 3BZ4A 3ZDXF 4JFOB 4M6AA 3MNWA 3UTQA 5A43C 1VADA 4GAJH 5DZLA 1Z5LA 3KPMA 3QPXH 4KY1L 4XNXH 2ZZUT 1NFIA 4G8EA 1YZZA 1WWWX 3F12A 1VB9A 2D3VA 2QADD 1P7KB 1MHHB 4L3EB 1BBDH 4YHOL 1IAOA 4U1LB 5D6CB 4ZYKA 5IOPB 1G1CA 3UO1L 3VA2C 3QG6B 4LP5A 4JFPA 4FQJH 1MI5B 3O0RL 2WBJD 2BDNL 1IEAA 4OCSH 5I0DA 3SGEI 4X4XB 4G6KL 4YPJA 5JXEA 3GSQA 1S7RB 4Y1AA 1IC7L 3QJHA 3RVXC 5SWQB 1YEEL 5MEQB 3Q48A 4HLZH 2R9HC 3CFEA 3HG1A 3KPTA 5EOTA 2W0KA 5MEOB 5H8DA 1ADQA 5F1NA 3OKLA 3E3QE 5D8JH 1RZGB 3ZDXE 4HFWB 4P23A 1FVEA 3DGGA 2X09A 3VXPA 4K3JL 2CRYA 5BMFH 2FR4B 3PNWA 3QP3A 4K7PY 1RZIB 1IM3B 4NOFA 2A6IA 3LQZB 4ZXBC 4RAHA 3HCVB 1JZ7A 3DROA 1PG7X 4NZRL 3WO4C 1ZT7B 5DLMH 1UM6H 4JFYB 1YEFL 3EYUL 3ROOB 4WW2F 1CXLA 3MUJA 2BXYA 3JWOC 4K7PL 1S9VB 4CN6A 3S35X 1CFQA 2VIRA 1GIGL 1H3UA 3D1MC 3ARFD 1SEBB 1JHTA 3AROA 5E1AA 5ETUA 2HP4A 1X44A 5HGGS 4PFEA 5DJ0B 5KVFL 2XN9A 4XRCA 4OD3L 1OARH 2ATKB 3TO2B 4WTWA 3CFDA 1AI1H 2DIJA 3A6CH 4O2EA 2AXJA 5EULV 1S5HB 1JZ3A 1T66C 4GW4B 2FJGB 5I15H 2AQ3A 3D85B 3M17B 3V4UH 2W9EL 4EUPG 1IC4L 1UXWB 3QUXD 4YAQB 4JB9L 1D6EA 1NDGB 5JO5A 4FQ1L 5T3ZH 1W0VA 3BUYB 4KFZC 4HH8A 1HOCB 1XEDA 4IRSA 5KW9L 2NNAB 2BVOA 2YKLH 5F88A 3VD3A 4DUXA 1MCSA 1H0DB 1EZVY 3WUWB 4JANB 4KK5D 1J0YA 1CFTB 1XGTA 4HJJL 3UP1A 1XIWB 1NEZG 1HHKA 2GTWA 1KPUA 1Y18A 2EO1A 1CQKA 1VKXA 3OR7B 4B53A 3N85L 1Y6NR 1CF8L 5GRXG 1YNTB 2VLME 4FQ2L 3D2UD 2PXYA 4YDKH 3OGOE 3N06B 3P0GB 3UBXI 1S8DB 2HTLC 3O8XA 3VH8G 4B41A 4JGJA 3MRLA 2GT9B 2PCPA 1IKFL 3ULUH 1R3IL 5DUPH 3UYPA 1CVRA 2X5PA 1JGLL 3IKKA 4JFFD 1OL0A 3LQAL 2J8HA 4DGYL 1LEKB 3LB6C 1RZ8B 3ZDYF 5CP7A 3GI9L 2ADIB 4NC1E 1KIQA 4EEEA 1VSCA 5T5FH 3ECBA 3GSWA 1MJ7L 1BLNB 2JB5L 1QBBA 4FQQA 3MLUL 4IHOA 1S9XB 4OV5A 2VZSA 2EDQA 4XBPA 3FB8B 4XNUH 1N6UA 3PL6D 5BRZD 1KIPB 2R0LH 2ZWLT 4HWEL 5D1ZA 5FO8A 3SDAD 1DQQB 5FGBA 5CSGA 5DEZA 4Z9KB 5EUKB 5DJ8A 2CRIA 1JRHH 2V2TB 4Y19D 3R8QA 2FX7H 1MCHA 2IWGA 4HULB 4PGBB 2DMBA 4PJCF 3H7BA 4JFEA 4PRID 4B7IA 2FHFA 5L2KA 4KWUA 2ICES 2D31A 4Z0XB 4PJEA 5IB1B 2QADC 3SDCB 3L5XL 2ZG3A 2IMMA 4KI5D 1IQDB 3VXSE 4U0RB 3ZDYE 1S7QB 3HNTH 2EECA 3H3KA 4L4TD 3FFCE 4K71C 4L4VB 2PTTA 5T3XH 3IXAA 3WHE0 1PKQB 4JDVA 1U0QA 4XPTL 3MRHA 2DQHL 5SWZA 4PGJA 5MENB 2PO6D 2RCSL 4MNQE 2E9JA 3EO9H 2DL2A 5GJSL 5AZEL 1VDGA 4I0CC 2CD0A 5F7DB 4MWFA 3RZCA 1XFPA 3L7EA 3QEQE 1RSFA 3KPRA 5D7JC 3O6LL 1OP5K 1DVFD 3UTSA 1W8NA 3MGTB 1ZGLM 1OP9A 2AV7B 2Z4QA 4PJCE 4M7LT 5DD3L 4LPTA 3TO4D 1DEDA 2XTJD 3EIFA 1FVDA 1T7VA 3KYMB 5GZND 2QBWA 2CKBB 3ULVL 3ARDA 3M1BB 4IMKC 4JY6A 4N9GA 1NC2B 3F5WA 3L9RA 5CHNA 3WNPA 3EO0A 1CDJA 1NMCC 3NPZB 3T4YA 3KWWB 1AP2B 2R1XA 1SEQH 3T1FB 1KJMA 2W07A 5CJBA 1MFBH 1UKSA 5BJTB 2XG5A 5I8CB 4PREB 2I5YH 2XZQH 1ZS8A 3ARGA 3ARFC 1FO0B 4G8IA 2O61A 4TNWK 1G0XA 1BFOB 2BFVL 4L5FL 5DUBB 5IBTL 5SWSE 4JKPH 3GO1H 4B0MM 4LLWB 5FO7B 2VL4A 4HF5H 3IFLL 4DKAA 4RA3A 1JFQL 3BZDA 2EYTA 3UTPE 3BRGC 4YDJA 2DMCA 1JPSH 3MXVH 4RBPH 1QO3B 2RFXB 4LSPL 3N9GH 5JXAL 3QH3A 1RJCA 2P42B 5H2BB 3WNOA 4NQDE 3AXLB 2OTUA 3MRGA 3RJDA 3QUXC 4F7TB 1T2JA 5KJRH 4FXKA 4I0KA 2FL5A 4KZEL 4M6MH 1V05A 5EU4A 1NBZA 5C09D 5K9JH 1UEYA 3HRPA 1HDMA 3RVTD 2XY2A 2DWDB 3W11D 4F7PB 4GKSA 5LCVH 4WHYH 1OWWA 1R5VA 3D0LA 3NPSB 4KK5C 2EC8A 4Q6YA 3QWRD 5DK0A 4RQQA 1UACH 4HK3N 4QHMB 2BCKA 1P53A 3GB7B 4I8DA 5K9QG 4S1RL 5HI3D 4U6HB 5FIEA 2AQ2A 1OOAA 4HG4J 5J6GB 2J2ZA 4JEGB 3VXRE 3QRGH 5BV7H 1I7TA 4OD1H 25C8L 3VFUB 3AU1B 4GOSA 3NACH 4JVUA 5IOPA 2YPKA 3PJSB 1RIUH 1ZHLB 1ACZA 3MO1A 1FVCA 1LO3L 3V6BR 4G9FA 5DVNA 3RQ3A 4DWHA 4F33B 2C9AA 4WW2B 1D5MB 4AEEA 3MJ6A 1KN4H 1MFDL 3GSXA 5JW3H 1E4XL 3SCMA 2F8VA 3J8F7 1JP5A 1UADC 3MUGA 1Z3GH 1DBKL 1N3NA 4OZ4B 5EBGA 4PRBB 4L8CB 2FX9L 3PL6C 2B5IB 2G5BB 2P5ED 3RTQD 5JOFA 3P73B 3SDAC 4CVZB 4WEUD 4ZUSB 3U7YH 3VD7A 3EYVA 4TUJA 1ZV5A 4PJXF 3D9AL 5J56B 4P3WA 3QDGE 4NQEE 4P4KB 2VXVH 1H8OA 4JPKH 1FRGH 2DM4A 2LE9A 3MNZA 3BAEH 1C1EH 3ROOA 1OAUL 4PRAA 4X8JA 4XWOD 4Y5YB 3CUPB 1A1OB 4U2ZA 5HVHC 1W0WB 4KI5C 3HMWL 1S78D 2ZKHL 3GMLA 3SY0A 4LRNL 2CK0L 1B0GA 4YHIA 5L88H 2YWZA 4OSUH 2W38A 5J9PA 1H3VA 1GGIH 4R97C 5CUSL 1BJ1J 2PO6C 3BEVB 1IAII 2YRLA 3D39A 4GRWF 1ORQB 4MAUH 2R15A 4APQD 4JO1H 4GUPB 3PWLA 3OKOB 3QI9D 4GSDH 2AVGA 4KRNA 4P46D 5C8JB 1A6UL 4POZD 4G9DB 3QEHB 2FJGA 4PJXE 2X4RB 1P4IH 1ZGLB 5D71L 3VWKD 1OQOA 1DVFC 4QRRD 3OKMA 2VNCA 1YEDA 4OM0H 5IM7B 1JPTL 4Q9QL 2EDKA 3TO4C 1G7IA 3MJ7A 2ICWI 2XTJC 1NDGA 3MRKB 2BNUA 5CCKH 3Q6FA 4FMFA 4YGVA 5GZNC 1DBJL 2NW3B 2R8SH 2VR5A 1P5UA 5DZNA 1BVKA 4NJAH 3VFMB 3UXFA 1OM3L 3VXSB 4YQXL 2XOTA 1NJ9A 4LSVL 1XGYH 3K8MA 5FO9B 5LGJB 1JGDA 1KCRL 3FFCB 4N8VG 3TYFB 4PBVC 3U4AA 3PABA 1IC5L 5D7LA 5AUMB 3ZTJH 3SJVE 1JYXA 4GRWE 1SJHB 4BM7A 2KZ1B 4MNQB 4CU8A 4P57B 3KJ6L 3D87B 3ISWA 3HI5L 5IKCB 5C0DA 2NY6B 1FNHA 2VLRE 3BWUC 3QEQB 3C6LA 3QHFL 1G9MC 1HZHL 4NFDA 3ZT6A 1T21B 2DBLH 3SE9L 3FO0H 4PJCB 5KSBF 3LCYA 2ZCLL 2DQDL 1CU4L 4WENB 4X7CC 3MCG1 2H32H 2A83A 4MJIA 3MA7B 3HC3H 4XHJD 5B39G 5JOPD 4Y4KA 1QBLL 5ISZD 3MRIA 1S9XA 3FHQA 5F21B 1T83C 4KRPD 4UNTA 1J8HD 4GMSL 3RVTC 1NUDA 5K59F 2HT3D 5GRVK 3W11C 3LS4L 3CLFH 4DUWA 4IOFD 3GHEH 4NHUB 3HZKA 1FFPB 4LIQL 2X4UA 5D2NA 3LN9A 2B1HH 4POYA 1ZHKA 3L3DB 5SWSB 2CKBH 5HI3C 4R26H 3TBWB 4HKJA 3WFHA 2VDLL 1GOGA 4WU7A 1FV1B 1Q9OB 5GGTL 3V0VB 3DPBA 2ORBL 3O45A 4IBLT 5L6YH 4LSUH 5KSBE 4PJ9B 3QDJE 1ZLUH 1BFVH 3VFGL 1CLOL 3C5SA 3LIZH 1QR1A 4E5XB 3FT4A 2ADJB 4MNHB 1WGOA 2OR9H 5F9OH 1UA6H 3OJDB 4P2RE 2H32A 5E2VL 1KEGH 4DZBA 1A1MA 4BUHA 1EGJH 4G8GD 3I50L 4MXVF 5K59E 1XH3A 3MACL 4PR5B 4HIXH 4S1SL 4CADB 4CBPA 2YSSA 5KVGH 3AAZA 2BSRA 3PWJB 1N8ZA 3RTQC 4PGEB 3PWPB 1IGML 5TQ2L 2OXHA 5GGRA 1MAMH 3NVQA 4PRNA 5C3TA 2J5LB 3M1BA 3DWTA 5DRNB 3VXRB 1U8HA 2K3TA 1GJIA 1X6LA 3T0ED 4MA1C 4Y16B 3N1FC 3NCYP 3EO1A 1KENH 3H42L 4MJ2A 5HYEA 1S78C 5DDHA 5CGTA 5DFTA 2EKSB 3VXUD 2B4CH 3D25A 3ULVF 2QHLA 4MXVE 4Z77A 1R3HA 3H8NA 2YPVL 1L9NA 1EGJA 3KYOA 5C0EA 2VLJD 5LQBH 3CVHA 1CDGA 2CLRA 4APQC 4GFTB 4ZAKB 1MF2L 2AABL 4P46C 3QI9C 4OZIA 4JKWA 4PJ7F 4POZC 5FDWB 3BKJL 4GS7C 3IXTA 4CAGA 4JM2F 5FYJD 2GK0B 2X70B 5FA4B 1AFVH 4TVPL 3QDGB 4NQEB 1I7UB 1U8IA 5J6HB 2PYFA 4DGIL 4XP1H 2R23B 5DJ6A 5KSAB 3AY4C 1P9MC 4PP2A 4F7PA 1KB5B 1V7MH 4PBXA 3GMRB 1QRNE 4PRPA 1RJZA 2EYRB 3BUTA 4XAWL 2C1OB 3ULVE 1OD7A 4YDVA 4QYOA 1AKJB 1ZT1B 1JPGA 5J8OA 3BZFA 4I4WB 3GI8H 3W0WD 1Q9LB 1RI8A 2MJWA 2PR4H 1GZPB 3BP5B 1IEHA 4NNXB 2DD8H 1RAMA 2GJJA 3P4NA 1NLBH 2IC2A 3IDYB 2NY0D 1I8IB 5ANMA 5ERWA 2A6JB 4GAYB 5DURD 4PJ7E 1T2QH 4FG6D 5EIQA 4X83A 3Q5YA 3I75B 1AHWB 2BSSB 3DTXB 1FLTX 1U8QB 5DR5L 3KS0J 1DBBH 2P5WE 5KOMC 2K7QA 4HKXA 3L5WA 4PJEF 4A6YH 3EDEA 5DT1H 2BY1A 1QOKA 3T2QA 4N9OB 4AL8H 4EN3A 1CZ8L 1WWBX 3BW9B 4PV9B 4Z5RA 4LEOA 4JFDA 2QEJA 4XHJC 5JW5B 3CVIH 1FL5B 2XWBB 1M1SA 5EBLB 2ADFH 1K4DA 4HPYL 4KRPC 5BS0A 1G7LA 3OG4B 4M48H 2ATPA 2HT3C 3VXTB 4N0RA 2VZ1A 3QULA 4HGWB 4JRYB 4TUKH 1INEL 3UTZB 4IOFC 4WUUA 4ZD3H 2B0SL 5JLZB 5JQ6H 1ZLWK 2Z8RA 1HH6A 3UC0L 4OB5L 1GYAA 3LEXA 5ICZB 2XQBH 1A47A 4EVNB 3G6JB 2VLRB 1CE1H 3DMMD 5HI4D 1FYTA 3CUPA 3CXHK 3CDGB 4HEME 2GJ6E 1A4KB 1S9KC 4XXCA 1YEHH 3TPKA 4PJEE 4NWTH 4UNUA 4PGDB 1DZBA 3LOWA 3FB7A 4O02L 5IHBA 5DO2D 4A6YA 3BPNB 1K2DB 1VERA 1KPRA 4XMLL 1AQDB 2H3NB 4LASL 4OKDA 3H9SD 4UAOC 3SEPA 1LMKA 1NUFA 1XF4B 3PWNA 3FO9B 3CFKB 1UVQA 4ISVA 1LEIB 4Q9RL 5IB5A 1UJ3C 4OLUL 5SX5H 2ZSVA 4KUCD 5FM8A 4CJ0A 3WIIH 4NBZB 3P11H 3U1SH 4M8VA 1N2RB 1OGAE 4YFEA 3RY4A 3JV0A 1AGEA 4NCC2 2BK8A 1G1YA 2W0FA 4N0YH 1S7XA 3MRQB 4O4YH 4WFHE 5T1KA 2FLBT 3CZFA 3EYFA 5HD8D 2ENYA 4RFEA 5LXGL 5KSBB 3QDJB 2P1YA 1EAPB 3T0EC 4XPHL 1C5BH 3TNNB 1IAKA 4G3YL 5E8DH 3MOAL 4MLIA 3DRQB 5LJYH 1NL0H 4P2RB 2DQIH 4K23L 4Z78B 2X4QB 4P3DA 4RNRB 3O2VH 1M6OA 2WK2A 4G7VL 4QT5A 1D5BB 3TZVD 4U4BA 4JY5L 3WXVL 2B2XH 3MGAA 4ZTOH 1P2CA 5DJDB 4EKXA 3CLEL 2D7OA 4LLYA 5J12B 1BX2A 4JFHD 2XXCB 3GSRB 3DXAE 5ESQB 1ZTXL 3O3BB 4ZFOA 4TNVK 4YHMH 1CD1A 4YJZL 4J1UA 3KLAB 2AJVH 4GMTH 4PJBF 1PJ9A 3ZKND 4DN4L 1BECA 5TQ0L 1N26A 1L7TL 4HJ0D 5IB3B 1MWAH 9CGTA 3RY6A 2ARJA 1ZLSL 2OZ4L 1YA5A 1FCCA 3QEUB 3BWAB 3SGDI 1LE5A 1T1YA 3B2VL 5E4EB 5GS2D 4X6DA 1EEZB 3DUSB 3OPZH 2CSPA 5GS1A 1IFHL 4QRSA 4NDMB 4NWUH 3SDXB 1OLZA 5DEGB 1HEZA 5F8QC 4WHDA 3IDMB 3QUML 5C2BL 2Z31A 1QACA 2YUZA 1AO7D 3HS0B 1RFDL 4XNMB 4X7FC 2MQCA 4LVOB 3MRJB 4FXLA 3TBWA 1CXFA 2NY0C 1BFSA 3IT8D 3O11A 3SKOA 3RDTA 2R2BB 1LO4L 4WI4A 5C08D 4PJBE 1W0YT 4LNVA 4FG6C 5SX4H 4HWBL 4TULL 2JJUA 1IRAY 4XMKH 5E2TH 4NO0B 5TE7L 4MB4A 3CFJA 4OF7A 5A2LH 1FG2B 1MWAA 2X4TA 5F7FA 3OX8A 2ESVD 2BSED 3C9NA 3MLPA 3LEYH 5IQ9A 4PJ8C 3O4LE 4ZDHB 1CFVH 5GRUH 4LPVA 4OBSA 1FC2D 4CVXB 4AM0B 3GMNA 1CYGA 5I71C 1BQSA 3PP4H 3SGJA 1S9YB 1LDPH 1FH5H 3AREA 2FCBA 1C8PA 3QUYD 4X99B 4CVUA 2DQEH 4PB0L 4LDOB 4JZNA 4OZHF 4PJ7B 4NM8L 4D94A 3DMMC 1ZWIA 5HI4C 4HS6A 4KY1H 3T77B 4JM2B 4ERSL 2H45A 1I3RB 5JHDE 2P5WB 1W72L 1PQZA 4WV1A 2E3VA 3X12A 2PW2B 4WTZA 5DO2C 3QR2A 4MD5A 1U58A 2HH0H 1GC1H 3MRFA 2R69H 1A7PL 3BH8B 2I9LB 5ICYB 4OF6A 3G6AB 3VDCA 4IRJB 5ESAB 1IC7H 3RL2A 1I1AA 2IALB 1YEEH 3RNKB 5E1HB 1MCNA 4S11A 4NQUA 2YEZA 2BMKB 3ULSB 1HSBB 5FA4A 8FABB 4HV8B 4U1NA 4OZHE 1F42A 4K3JH 4LVNB 4F2MB 1U3HD 1MCDA 4JCMA 2GJ6B 5FYLH 4WNQB 1RMFH 1N59A 3TVMA 4NZRH 1FQ9C 2F74B 3TM6A 5D6DC 3EYUH 1CGWA 4K7PH 4C58B 4OIBA 2R0WL 3F58L 2I26N 3TZVC 3D69B 1WWAX 4W70A 1QFOA 1A6VL 1PX3A 3FCTB 4CRPA 4RZCB 2BSSA 4FQXA 4BKLB 3WDIA 4P2YA 4OD3H 5E00A 1SYSB 3C6SB 1KXQE 1VGKB 4RIRA 3QHZL 1JZ4A 1KCKA 5C0CD 4LVHC 4K55A 3HPJA 1OGAB 4FZ8H 2OL3A 4IS6B 3ZKNC 1K8DA 1A9EA 4HJ0C 2PYEA 3ZLQC 5F9JB 1A3RL 1NBYA 5I18L 3ARBD 5EBLA 1IC4H 3CJJA 1AGCB 4LHUG 1CT8B 4JB9H 4TVPE 3FB6A 3DUUB 1C5DB 2A6DA 5DXWA 4G43B 1ZOXA 2FEEI 1V3JA 2ZSWA 4OFYA 2MTPA 2ZPKL 3BEWA 4HUNB 1QFWI 5JA8B 4HJJH 5IV2A 4HJGA 2I60L 4EVNA 2EH7L 3RWEB 3T65B 5HHMD 3KDMB 1FL6A 4ZFGL 2XNAB 3DXAB 6CGTA 1L9MA 1YEJH 2DKUA 4R8WL 2R2HB 1P4LB 3PGDA 1CF8H 3JVGC 4ODTL 3DARA 1IKFH 3T4AA 4PJDA 4XCYB 4ODWA 3BVNB 1JGLH 1NANI 3BP6A 3VCLA 1OF2B 4HUXA 4PTTB 3FQNA 4BFIA 5JXED 3GI9H 4GXVL 4Y1AD 5FKAA 5BCAA 1T7YA 4UDUA 2AJXH 4PGCA 4K8RL 5GSVA 2HJFB 1CBVL 3HG1D 5CBEB 4RCAA 1RZKC 1G0YR 4IDLA 3WJJC 3MLUH 3ZT5A 4MYWB 4P23D 4Y5VB 5IBUG 3ALWA 3UPCA 1B9ZA 3ZKSD 1MIEH 2HFFA 15C8L 2W59A 3QUYC 4U1HA 4X6FB 3MV7E 1IGIL 2PN5A 3QIBA 4Z7QF 5DRZA 4P2QA 4HWZA 1EAPA 4PJBB 5CEZH 1QPPA 5ACMA 3TNNA 5I1AA 4YR6B 3EDJA 3M45A 4J3XA 2XRAL 3JTTB 5DMJB 3ES6B 1UXSB 5DD6B 1YN6A 1F4XL 3EGSB 2Q86A 3L5XH 3PIQA 4I48A 2NXZD 4GLRI 1BOYA 3FN9A 1A0QL 4NPYA 2ADGA 3U4EB 3X3FH 2CDEA 3O4LB 4XPTH 2HRLA 2XN9D 2Z91B 1T22A 3F8UB 1XGUA 2RCSH 4Y5XB 1JHLL 4POUB 4UBDD 3O2WH 2QQNL 4I5BB 1MHEA 5GJSH 4QF1A 3KLAA 4ZOCA 1IAIL 3IDUA 4XZUA 1AXTL 4U6VL 4HK0B 1GHFL 5DD0L 1MLBB 1CCZA 4LAQL 1MH5B 1KLFA 2WLYA 3BWAA 2MKWA 5EU3A 4JREC 3MLWL 2EDTA 4U1IA 4NDMA 4C56A 4IRSD 3SDXA 1FGNL 5JHDB 1MCOH 1AR1D 1IT9H 5IJVB 4ZUTB 4WY7L 5IP4A 2MQ0A 4GRMB 4PRPE 1HNGA 2XI9A 3P0YL 4PJFF 4L3CA 3FT3B 2AV1A 3WSQH 2H6PA 3DBXB 2V2WB 4NNYA 1JI2A 3O6FB 2NZ9D 2WMPA 5IQ7L 1R0AL 3WUZA 5FGCB 1ZLVK 2EDHA 3ZYIA 1I9JH 2PXYD 2XA8L 5IGXL 2YC1A 4WDIB 4XH2B 1XGQA 3O8XD 4R9HA 5ANME 3STBA 1KIUA 4ONFL 4KK6D 2JKXA 3IFLH 1QLEL 4NO0A 1EBAA 2ZNXA 5E8PB 5LKNA 3C08L 4MB3A 4ODHL 5IB2A 3MJ9L 4OZHB 5HYSA 4LOUD 3MLYH 3MV9E 3U2SB 3GUTB 3DIFA 4TOYH 2HKHH 4LSPH 4OCXL 1KFAL 4H1LG 4XWGL 5JXAH 4H26B 3ARBC 1FIEA 4GKZB 4ZDHA 5T3ZD 1WICA 5J1TC 3HC0B 2IAMA 3I02B 3FHAA 1SBSH 4FABL 5HPOA 4EOWH 3WDHA 2V2XA 4KZEH 4PJFE 2A6KA 2R2CA 4RISH 3UCRA 5D1ZD 3ILPA 3WL9A 3NMEA 5FGSA 4LLVA 4WUUE 2P24A 3EFDL 3K0WA 4MGXA 2HJKA 1R5WA 3V7MA 4N1CA 4JFED 4FFYL 4F57L 5L2KD 4S1RH 3T2NH 2P47B 1H5BB 1GPOL 2VXSL 2K1MA 3RY5A 3ULUD 2OLDA 3L3HB 3KPQA 1MHPH 1CLYL 4BZ2L 1IM9B 1D6VL 3ZYZA 25C8H 2AJSL 1BBJB 4XP4L 3IF1A 3KXFE 1YMHB 1EDQA 1NCBL 1T4KA 2I9LA 3LKOA 3GHBH 5SWZD 4IRJA 5JXEC 3C5ZB 5TDNB 4PP1D 2R39A 3WFEH 1C08B 4Z0BL 3RZCD 2JTDA 1I1FA 2DWEA 5TH2B 4F7EB 1E4XH 3KPRD 3QZWB 2IMNA 2Z8SA 3R06A 1DBKH 1GOHA 3SPVB 3UTSD 3QXDA 4ZNEA 2HKFH 1TJGL 4P23C 2O5ZL 4FMKA 3LD8C 2KDGA 1MFAL 5I1GL 1TZIB 5EU7E 1B4RA 3S3SA 5EPMA 3D9AH 4E41B 2P8MB 3ARDD 5IMLA 4LARL 3F62A 4G42A 4MJ5A 1HHIA 1HE7A 3EOBB 5EIVA 1BQHB 2JF1A 2X10A 4OJFL 5IVXF 2Y25A 3FQTA 5BOPA 5CSZA 5A1AA 4LLMB 2R1WB 1B88A 3HMWH 2NXZC 4U1MA 5I1KL 1M7IA 3ARGD 3GSVA 1HSAA 3HFML 5DMIL 1K8IA 4OLEA 4UZGA 5T5NF 2X9WA 3TCLB 2ERJB 3EHBD 2VXUL 3QCTL 5CUSH 5A2KH 1U8OB 2EYSB 2F8XC 4UBDC 3RVUD 4LQFL 4NQCA 4P99A 2IGFL 4MHHG 1UJTA 1A6UH 4M7LL 3RFZC 3HR6A 2Y4SA 5JIPA 5C6TL 3MV7B 4ZTPL 3BFOA 4Q6IA 4LPWA 2XA3A 1JPTH 1NBVL 2MCPL 1ZSDA 5IVXE 1SY6A 1DBJH 4IRSC 4D3CL 4N0UE 1WBXB 3HR5B 3OKDB 5GXBB 4PRDB 4CDGC 5JNYB 1AR1C 3IS0X 3X13A 1MLCB 3MR9B 4LSVH 4WFGE 3RPKA 5ID0A 1FNGB 1KOAA 1QP1A 2ZUWA 2P7TB 1KCRH 4DOHE 4P9ML 3BN3B 3ZE1F 5DHYA 3W9EB 4NBYB 3QXVA 4UU9B 5IFHL 1I8MA 3K4AA 4QXUL 1WCBB 3RPIB 1IC5H 5DRWA 5DMKB 2NZ9C 2NLJA 4M3JA 4L1DA 1Y6KR 1AJ7L 1HHHA 2PXYC 2FIKB 3V5DB 3MGOB 4EI5B 5FECA 2ENSA 2XTLA 3HI5H 4NBXB 3O8XC 4I0PA 1J12A 1CVSC 3FOMA 4KQ3L 2UWEA 5EO9A 4KK6C 3QHFH 5DVKA 2AXFB 2HWZL 2RAMA 5FA3B 1MCIA 4JFQB 3PGCA 5SV4A 5E5UB 4F9PA 4LOUC 4G9FD 3SE9H 1IGJB 3L3OA 4ELKA 2ZCLH 2DQDH 1CU4H 5F44A 3G5ZA 1DLHA 4LSRL 5E6IA 5AYQA 3UDWA 1I7ZA 2X89A 3CXDL 3F6IA 2UY6A 5SV3A 4YHYC 1CFBA 4TQEH 2QV2A 1EUTA 4NFBA 2ARWA 3ZE1E 3G6DL 3HZYA 3S4SG 5D1ZC 3IB4A 4NYLA 4Z95L 4O58L 5FGBC 1WC7A 4CNIB 3IU4L 4GG8B 3CH1B 3FOLA 4LIQH 1ETZB 4GKNB 3RWJA 2HVKA 2I9TA 1I8LA 3BOVA 3O3DA 2Y9RT 3C60B 4LSQH 1XZ0A 4JN2B 3BE1L 5GGTH 3ULUC 1F02I 4JVPA 4LDLB 5IROA 1CIDA 4AEIL 5M7QA 4OTXL 3VFGH 1CLOH 2COQA 5F7EL 5DSCB 5ALCL 3CFCL 3ARUA 2V5SA 1MVUA 1VACB 1PDKA 3RRQA 2IFGA 5FHBL 4R4BB 3CMGA 5D1XB 1FZMA 3D39D 1RK1B 5E2VH 1Q38A 4RFNB 5DI8B 3V6OC 4PP1C 1ZHNB 4PJFB 1BWMA 2HAZA 4I5BA 3WDJA 2EKJA 1KPVB 1JF5A 1DCLA 1BJ8A 4UQ3B 3RZCC 4WI5A 3MACH 2I27N 4Y4FB 1MSPA 2V5RA 4CMMA 4WO4B 4GW1A 2R1YB 4D8PB 4AMKH 4RRPG 1X5KA 2X4NB 4CMHB 4ETQA 2FO4B 1MRDH 1U91B 2NW2A 2VAAB 3QUMB 1KLGA 4PLOB 1IGMH 2F54E 4MDJA 5TQ2H 3TA3A 3ARDC 3H0TB 2WANA 1NAMA 5IR1A 4ZUTA 1OD9A 1LK2A 2D7NA 5GGTA 2ZOLB 4D2NA 1QRKA 3NBNA 1F13A 2BNRE 4TUOA 2W0PA 2X2YA 5IW3A 3P3YA 5H37G 5JDSB 2FDBP 3H42H 2FSEA 3KXFB 5F9AC 5D7LD 2KL6A 2V2WA 3B9KA 2XWTA 4X6EB 3ARGC 3NIDF 3UBXB 4IDJL 3MZGB 3RVWD 5JOPE 1HQRA 3EHBC 3RIAF 4EI6A 3DYOA 2NY4D 3DVNB 1QYGL 1WFNA 4P5TA 3W9DA 1BVLA 2G5RA 1UCTA 5L7XL 2BOCB 4H5SB 3RVUC 5IWLA 5AEAA 1RVFL 4ZSOA 3AB0C 2E5EA 5I2IA 1FFNB 1IZKA 2EDXA 2Q76B 3O3AB 4O51B 4EIGB 4ESKA 4JZOA 4MJID 2Z9TA 3S5LG 1J8KA 2A9ML 4P9HC 3I84A 4Y4KD 4L29A 1N6VA 1WVZA 5EU6A 4DGIH 1PY4A 3SO3B 3EJYD 4QWWD 3U36A 1P4BH 4ODVL 5L0QC 4XAWH 4D9LL 4R7NB 4U49A 3NIDE 2XZZA 1DFBL 1J88A 2EH8H 3HI1B 3T8XA 1W72B 1TFHA 4TRPH 1CDBA 3ZKMD 3PWUA 1R3KB 3RHWF 4JFXB 3F7VA 3MRCA 4W6WB 3SDCD 4JDZB 4MD0B 1HN1A 3PQYA 3KLSA 5I1JL 4X98B 4OCRL 5I1EL 1HWHB 4YDLB 4K2UH 1MAKA 4X6BA 4X7TA 1ZANL 1GGYA 4LU5L 4NFCA 5DJZA 4XC1L 3E6HB 5IVZA 3MLZH 4OFKA 4IJ3C 4BQ9A 5JW4Q 2XIDA 1UC6A 5D96B 4YO0B 4Q9CA 5FEBA 4HIIB 5IVXB 3BKYH 5L8KB 3RGVB 4MJ6A 1OTSD 1CZ8H 2CDFB 4N0UB 4X9FA 5IMMA 3OTTA 1EJOL 1Y6MR 3D3VE 5DC4B 5E5RB 1E6JL 3EUUA 4HPYH 3TCXA 5ACZB 5I9QC 1HIML 3QXTA 1XR8B 3RBSA 5E03A 1J87A 3W39B 4UOW0 2VITB 4XP6L 1G9NH 3MCLL 1JWMA 1CXIA 1INEH 3C87A 3FKUS 2B0SH 3HAEA 5K9KA 5IW6A 2HFEA 4ZPVB 5CS7A 5I1DB 4ZUWA 1U8MB 2DB8A 4OZGA 1EMTL 1BQHA 3BQUB 4M93C 1U95A 4PS4H 1L6ZA 3TJEL 2DQTH 2C7UA 5HYIA 4HT1L 3HNSL 4NKMB 4N1EA 5BV7C 3GMPB 2AXGB 2CR6A 2OI9B 4XHQA 1FPTL 3B6SA 4ORGA 3V5KA 2FLRT 3IKCB 1WBYA 3VW3H 4HUUA 2FJFA 1S7UB 1WAAA 2GY7B 3K80A 3BSZL 3FN3A 3KLHD 4LASH 1NGYB 4JQXA 5JTWA 1BIIA 3TF7C 1A1NB 4F15B 4H25B 4OLVL 3T1WA 3DSNA 1A2YA 4ELMF 4WHTA 2FHBA 2QSVA 4I2XE 4OLUH 1EVUA 2VKXA 1PSKL 2E7MA 5DYOA 5M94B 2ED9A 5HGAA 4WRLA 3F7PC 3LEVH 1VEPA 1CE6B 3TBTB 1F6LL 1SJEA 3EYSL 1LNUA 3QXAA 3REVB 2D0HA 1LHZA 3E2HB 3EDFA 3GEWB 3RP1A 4XPHH 5DHVB 1T5XB 4G3YH 2OXGA 3MOAH 3L3KB 4KK8D 4MXWL 1R3LA 2A9NL 5LVEA 5DQ9A 1U2CA 4K23H 5E8EB 3UJJL 4S0SD 1U8JB 4G7VH 3DRTB 1P7HL 1DUYA 4OCWH 3RVWC 1JTPA 2FIKA 3GFUA 3VFOA 3CLEH 5CJ8A 4ELME 3BI9X 2DRUA 2F5BH 3DVGA 4FS0A 1T1XA 4PJGA 3VU2A 3OR6B 3BXNA 2NY4C 4GRLA 5F7UA 3DV6B 1ZTXH 5FFLA 2HRPL 4UIMB 3IDIB 1DLFL 5DVMA 1VFBB 2JLLA 1LO2L 3LKNA 3L3IA 4DN4H 3KPOA 5TQ0H 4EN3D 2F54B 4Z7VF 1L7TH 5BQ7B 4JFDD 3OGCB 2MPAL 2WV3A 2FHCA 4NUJA 1QNZL 3CGTA 4Y4KC 2Y36L 4O2CA 2BNQA 2OZ4H 2APWA 4N90D 3HE7B 1HXMB 5F3BA 4YHPB 1T0MB 5BS0D 2BNRB 3B2VH 3QDMB 3EJYC 4QWWC 4MD4A 3JWOL 3QUZB 1NEZB 1VFAB 1F11B 4PY8I 4U31A 2ID5A 2WIIB 3BPLC 4BSVB 1Q0XL 3GBML 1T1ZA 3CH1A 3QUMH 5D2NC 5C2BH 1LP9F 1O5DT 1BD2A 2JK5A 1DE4A 3VFSA 4KU1A 1JN6A 4WWKB 3ZKMC 1JGEB 1RFDH 4L8BA 5D5MA 3W82A 3MFFA 5I1HL 1FYTD 5GS0H 3VH8B 1RIVL 2WBJA 3AS3A 3H9ZA 3OB0H 2WIMA 1QFWL 4F7CB 1N0XL 3KLDA 2C4FT 2VZTA 2ED8A 1LO4H 3GJFB 3IGAB 4M1DL 2I24N 4HWBH 4Z7VE 1U3YA 5DSCA 4C83A 4FZEH 2DL9A 2AK4E 3MRPB 2IPKB 5TE7H 4HIEA 4HH9B 1JVKA 1OTSC 2OX5A 1KPVA 2GAZB 1K6QH 4F58L 2ITCB 2AJZB 1OAYL 1KJ2L 3HZMA 5JW4N 1L0XA 2O5YL 1LP9E 4JFZL 4ORZC 3VGBA 2PNDA 2ICWB 1EHLH 1M05A 3QUMA 1XGRA 5I17B 1DP0A 3ALXA 5E99H 5J1SC 3HI6L 1Z2KA 1WCQA 5IF0B 5T1KD 4QXWA 3QISA 5F6HI 1NPUA 4CGTA 2AJ3B 5HVFB 5HGDB 3I2CL 4P3CH 3BYYA 3G5YB 4YXKH 5L2JB 4DVBB 1KTKE 2V6HA 4BSJA 4NM8H 1TVHB 2CR3A 3RAJL 5LBSL 4NKIL 2ZUTA 1AY1L 2H1PH 4RA0C 5KG9A 2VJXA 4ERSH 1W72H 1ZGLP 1ONQA 2F53A 5F71A 5IMOB 1AGBB 4QHNB 5EZOH 4HXAH 5CP3H 1MHCB 1XF3A 3U0PB 5CWSA 4G7YL 4N5ED 1L4IA 3KLHC 2VTFA 3WIFA 5E9DE 1DEEB 2NX5A 1ES0B 4OCLC 3U0WL 3HTLX 2C3VA 3B9AA 2GJZA 2V17L 1TITA 3D3VB 4YC2C 4Z8FL 5F1OB 5EDXA 1JWUB 4ETYA 4HCRA 3FAWA 3AM8A 1DR9A 3I6KA 1XF2A 4M62L 4IMLB 4XGZA 1Q9KB 3BJLA 2Y5TA 5E8NA 4NN7C 2E7BA 2OS7A 2I25N 4RMWA 3TT3L 4XPBL 4LCUA 1X7QA 1XF5A 4BK4A 3BN9D 2NQCA 1LD9A 4UIKL 3IDJA 1MCBA 1QPXA 1ZHBA 3QNZB 3NCFB 4W81A 1MFEL 3KNBA 2X4SB 3CMOH 4KK8C 5K9OA 3IETB 5DVLA 3KPNA 5CP3A 1DQJA 3WHXB 4GO6B 1EXUB 1DDHA 4G80B 3F58H 3BHBB 1LE9B 4Y88A 3RDTD 2LTQB 5DQJA 4L8DA 4KHTH 4I2XB 3WHE1 3AMLA 4R4FH 5ENWA 5F9WC 3O6ML 1G6RL 1DN0A 4E0RB 3IDGA 1IKNC 1FBIL 4QRPA 5LGKA 4MDIB 2H41A 3K81A 1DL7H 1I9EA 2W9LA 4EN3C 4NGHL 3I6LE 43CAA 3BD3A 2DF3A 5HHVH 1CICB 3MJ8B 1FYHB 1TENA 1A3RH 1VGEH 2WP3O 5I18H 5KS9A 5C71A 5EBMB 4M7JL 1U8KA 3P30L 4XNZB 2YZ1A 4DFIA 2QHRL 5C0IA 3PWPD 1ZXQA 4ZUUA 4MQSB 3ARED 3VXMB 3GRWL 3UEZA 5BVJB 3MMEB 1J05A 4ELMB 1LQSR 4YFLI 1JZ8A 3NFPB 1B6DA 2AXGA 3O3EB 1KT2B 2KUTA 4FFWD 4R8WH 4XXCC 1CLZL 1PEWA 2XPGA 4U1GC 2W0LA 5DHVH 1H3XA 4KTDL 2DJ4A 2RHEA 3DX7B 5FYKU 5IHZA 5FM5M 4NKQB 3P4OB 3UPRB 4N1HB 1MIML 4HZLB 1YNKL 1RJYB 4XI5D 1G7QB 4F9LA 4YZFF 2X4PA 2OJZH 4OKVB 1BZ7A 4GXVH 1KSRA 2UVFA 1I1AD 4GXUN 4Z76B 4V1DB 5IEKB 4XCFH 4L9LA 3DV4B 1CBVH 3K1DA 3I3DA 5J11B 4EUPH 1CGVA 4EDXA 3GIVB 5J1AA 2FZ3A 3K4DA 3VFTB 4ZFFA 4EQ3A 4LPXA 1NCCH 5AYUH 3U46B 1X5AA 15C8H 1CR9L 4JR9L 4LNRB 5I8EA 4UQ2B 1A7QL 4NO2B 4MA8L 2XFXB 5I30L 2WBKA 3ME0A 3OKKB 4PV8A 3PDOA 5EG6C 3ZTNH 1IZJA 2OQJA 3KYNB 5JHLL 3SKNA 1V3KA 4Z7VB 2XRAH 3MFGB 2DKMA 1JK8B 4XP9H 1RU9L 1CTNA 2AK4B 2FEDD 1UWGL 3OXRB 1GGBH 4YZFE 5EIIB 5F72S 4QOKE 5BW7A 1BM3H 4P4RB 1MQ8A 4LCCB 1TVBB 2RJMA 4YE4L 2Q6WA 4N5EC 5A3ID 3NA9L 3DV6A 4FQXD 4IIQB 4UTAL 2G75B 4N68A 3GJFH 2AERT 1LP9B 4YUEL 1JHLH 1F3DH 1GAFL 2QQNH 1A14H 4EUPA 3BZEA 3MV8A 4K3DL 3IJHA 4NJ9H 4M5ZH 5JORA 1IAIH 3BJ91 5DVOA 2O5XH 2VC2H 1Z9OA 2PYED 2WP3T 1HI6B 1AXTH 4U6VH 3RY6C 4IRZL 1GHFH 1PZ5B 1U8NA 4JO2L 5DD0H 1AD9A 1I3GH 4X6CA 3F7YA 5FYLD 1RUQL 1QSEA 2ZCKL 3RWCA 2CQVA 4YHPA 3PF2A 5HPMB 4HGMA 1LEGB 3BN9C 1I7RA 4D0CB 5GS1C 3OSKA 1RHHB 4N8VB 4Z7UA 4IOIA 4F7MA 5EC2B 4JRYD 1FGNH 4R7DB 4X80H 3S34H 4U7SA 5DD1L 5HYQB 2E8YA 1M7DA 3G5XB 4OFYD 7CGTA 2Z31C 1ED3B 4U1JA 4WY7H 1WK0A 2P44B 2DN7A 1I4FA 3P0YH 3ROLA 1UCBL 5H94A 5EN2A 2DQJL 2NY5L 4XCCL 2WUBL 5E9DB 3TIDB 3SDYL 4NHCL 3O9WB 5D72L 3UJIL 2CXKA 3RWIB 1R0AH 3OB8A 1S5IL 3WD5H 4DZ8A 3DX9B 3RDTC 4X0KB 3MRDB 4OZFA 4DVRL 2VDPL 2A73A 2BVQB 4H20L 4ONFH 3TBSA 4HAFA 1A7OH 5IIEA 5IHUL 4YK4C 3DVIA 5B39B 1RURL 3T08A 1DANU 3QO0A 3WS3A 1CFSA 4XWGH 1UWEL 4MZ2A 2HLAB 4TYUA 1X5IA 2W60B 3MNVB 4DKEL 4GG6A 3NAAL 2IH1A 5D9SA 3X14B 4FABH 3FT2A 4OF5A 2GUOA 3SGJC 4HFUL 5F7WC 1BWWA 2H9GB 4LBEA 5INDA 3AREC 3ARPA 3QPQD 3KPLB 3QG7H 3S36L 4ALAH 1U8LA 2P46B 4R2GB 2AJ3A 3QIBD 3EYOA 4G5ZL 4GAFB 4L9DA 4WFFD 4AENB 4U3XA 4P2QD 4HMDA 1QHPA 1GZQA 2AXHA 1MQKL 4FFYH 1GGTA 4F57H 1CDCA 3JV5A 5DRXB 1G9ML 2V7NA 3MYJB 4FFWC 2VXSH 1FIGH 4WV1C 4HDIA 4KAQL 4LSTL 1HKLL 5BZDB 4D9QD 4ZS7L 4M1GL 4BZ2H 4JY4A 1D6VH 1Z6JT 1A9BB 3IDNA 1F4AA 2AJSH 3QFJE 1OSZA 5LAXA 3VWKA 5C0BA 3UZQA 2UYLA 1JF6A 4XP4H 4XI5C 3QO1B 1NCBH 2FH6A 2V7HB 3TN0A 4DCQB 3BPCA 2EDWA 1I1AC 1Q72L 5I1LB 1O7VA 4HUWB 3CC5B 3B3IB 1E4JA 4AEHL 4M8QB 2R2EA 5DGQA 2CLZA 3HZVA 5KSVB 4BYHA 2O5ZH 1MFAH 3MSPA 5I1GH 3R8BB 1F3JB 3GSNA 5CEZD 5I66A 4C56D 3LKPA 2EIZA 4LARH 3LKQA 3MOQA 3GSUB 3VFRB 3TVMC 1UM5L 5DTFB 5A16A 2PW1A 3IFPB 2W65B 4OJFH 4WJ5B 3MA9L 5D2LA 5IJKA 4N0FB 1QFWM 4NRYB 2WUCH 5FF6B 5KBNC 1SQ2N 2FEDC 3GKWL 3WEXA 3HC4H 5IHLB 1GC1C 2C3HA 4PG2A 3VWJA 1EXUA 2DJUA 3E6FB 5CBAA 1B0WA 2DTML 2D4DA 4JKMA 4LCIL 4Y2OA 5A3IC 1SMOA 2E9BA 1AHWC 1YEGL 1QVOB 4FQXC 2VXUH 1T3FA 1OQXA 2R4SL 4FQPA 4HMEA 1R5IB 3QCTH 4UV4L 3UX9B 1X6NA 4NO0D 4PG9B 2NTFA 4KJYA 4LQFH 3LPFA 3MRNA 1UB5A 3MPCA 2IGFH 1QSFB 4M7LH 2FX8L 3ARRA 4KPHH 3U7WL 4KVNL 5JOEA 4M9OA 5B38A 1S7VB 2O26U 1OP3H 1UM4L 3QA3A 2IAMD 5FAAA 1D3CA 1NBVH 2MCPH 3C8KA 2BNQE 3UPAA 1XR9A 4NQVB 2NY7L 3DX8A 3VXNB 4ZFZA 2FBJH 3VMOA 4XXDA 5DS8A 4QOKB 5BVJA 2ZG2A 1H9VA 3EFFB 1EO8H 4RGMC 5A40E 4OFPA 1CDYA 2IQ9L 1JV5B 5DD5L 5INCA 4HPOL 4LCWA 4YXHL 4I3RL 1FFOA 5F89B 1U8PA 3HN3A 1BOGA 3L3GB 1YY9D 3TBYB 3THMH 1AJ7H 3U6RA 3OF6A 4L4JA 5FCUH 2IQAB 3FN0L 3P9MB 2CLVB 4OQTL 4R0LB 4BSWA 1GGCL 4DW2L 1S7SB 2HWZH 3LVEA 1I9IL 3WLWC 3WXWL 4JQIL 5GISL 1BQLL 3GMOB 3RUGA 1DBAH 3GGWB 1HILB 4IRJD 4LCYA 3RWGB 2C1PB 4OLWL 1IQWL 2GEEA 1FZOB 3FFDB 4KZDL 4LSRH 3S97C 1NCDL 1QTYT 1K9TA 3NCMA 4UI2A 1N7ML 2DQUL 1G7JB 2YPLA 4JLRB 1RUAL 3MUHL 4NRXB 3HLAA 3DURA 4NKDB 3G6DH 3BKCL 3QPQC 4WVRA 1NFDB 3RX8A 1OB1B 2VLKA 2CDGA 1CFNA 3IU4H 3VFVB 3QIBC 5FHAH 4YPGA 5HHQB 1OGTB 2LFGA 5AWNH 1SHMA 4L3AA 4QHKI 1JPFA 3U30C 3O2DH 2D2OA 4KKLD 2MHAA 4O9HL 1X4XA 4UMGA 5EA0L 4YHLL 2QSQA 2CO6B 3KPSB 2V9TA 3PHOA 2YD3A 4AEIH 4OTXH 4TPRL 2SEBB 1XCQB 3D18B 3CFCH 5JR1L 5I16A 3LKSA 5FHBH 1XCTB 4OAWA 1IGTB 1KTDB 4WI6A 5IFJB 2NX5E 4ZXBB 3WO4B 4NQCD 2DS4A 1IE5A 3U0TA 4AIZB 4M4PA 2DIBA 3ZE0F 2YD1A 1KC5H 1JUFB 2FD6L 3BMWA 4JPIB 4QY8A 5D7IA 2D4FA 2WAHA 3VRJB 3Q3GB 4YBLC 2N7AA 1WBZB 3V6ZB 1WFOA 1NAKL 1HQ4A 4RGND 4YXLL 4QXGL 3O2DA 4HKBA 2DYPB 5IBLD 4JRXA 3BD5A 3JV4B 3FQXA 1JIBA 4QRQA 3QFJB 1KNOA 1JL8A 1MNUL 4X4ME 1FO0L 1I1RA 1PKOA 4F80A 4YWGL 5ITFB 3WMSA 3IAQA 3QBTB 3VXOA 3G5VA 4QHUA 4NRZB 2Q8AL 4IDJH 4KI5F 4JZJA 1CG9B 5C0GA 4I0PD 3RWDA 3P9LB 1FZJA 4KDTA 3ZE0E 5HHOB 2JCCA 2AKRA 1F6AA 5L7XH 2EDBA 1KJ2B 5FOBA 1N64H 3Q1SL 3H9YA 5KSUB 3QWOB 2BRQA 3A6BL 2DJSA 3P9WB 3EOYG 5GGSY 5E6ID 1G7PB 5BRZE 1F4YL 5IT2L 1C12B 2A9MH 3OKNB 3CSPA 1Q94B 3QAZB 3EOAA 2IAMC 2D9QB 4P59L 1YPZB 3ZTJG 1EA9C 1MFCL 4P5MA 2X89D 4Y19E 4D0DA 5KS9E 5CMAA 2N56A 3SQOL 1OCWH 3UJTH 2F8OA 2J4WH 1CQYA 1MCPL 1KULA 1W2KT 1ZVYA 2I07A 3IDXL 3GDBA 4ODVH 2DM2A 3SGDH 1PX4A 4Y0GA 3DHMA 4D9LH 3JWDL 3BGFB 1S3KL 1DFBH 4KI5E 3U79A 1HINL 3OAUH 4G6FB 4KRMB 4I3SL 4L4TE 1QQDB 3OG6B 4PPTA 4U0QB 1KIRB 4M6NL 5EO0A 5C9JB 1BREA 1YY9C 2BRRL 5EFIB 4OCRH 5I1EH 3G04B 4AYFA 4ONOA 3TIEB 5E08L 1ZANH 3B2UD 3SKMB 1NEUA 5B8CA 4MSWA 5E94A 1MEXL 4XC1H 2YUVA 3MRMA 2C5DC 4IRJC 3RWFA 2VE6B 3D0VA 5ID1A 4M1CD 4MNGE 1D9KA 3LZFH 1OSPL 2XTJE 4TN9A 3Q6GH 1SYVB 5GGQH 1FDLH 5F3HA 5GQBA 3S88L 3ARWA 1E6JH 4MCZB 4R3SB 5C9KA 1HHJB 4U6YB 2WLZA 2P49B 1X4ZA 1D5ZA 4XP6H 4K71B 1EFXA 4JAMA 2OTPA 3TA3D 4RMRA 4WCYH 3CH8A 3R1GL 4LLQA 5TDPA 2VDKH 1OAKL 2MKLC 4MQXD 3UTTA 1EMTH 1FNAA 5CAYB 4X6CF 3TJEH 4KKLC 4HT1H 3HNSH 1FAKT 5TGBB 5D7JB 3BGMB 4I18A 4K94C 5HY9A 3O6FD 2OP4H 4D9RD 1B4JL 2AK1L 1G6RB 3MCKA 4LRIC 5SX5K 4BZ1L 1L0QA 2DDQL 2X1XR 5AZ2L 5JMOC 4XAKD 2DIAA 1DBMH 3BSZH 1I1YA 4P5TD 5I19L 2G2RA 1T5WB 4J3VA 1OHQA 5KVEL 4OLVH 1NMCB 1FZKB 1QSFA 1L0YA 3PHQB 1OY3B 4LF3A 5HHNA 5C09E 3MRBB 1ZVSA 3C2AH 2GHWB 2Z8WC 2X4OB 4FQHB 4Q6IC 2HLFD 4NO3B 1MY5A 5EUOF 2RB8A 5EBWA 1I1CA 1NDMA 1WIPA 3ARFB 5EU6D 4X6CE 2OR7A 3REWA 4GBXA 3QUKA 4RGNC 4MMZC 5CEYA 1NSNL 1FCGA 3EYSH 2LABA 4M02A 1Q9WA 2JIXA 2XICA 3NGBC 5IBLC 5HYJA 4LLUA 4QTHB 5F7HA 4KXZH 3MREA 4OLXL 2A74B 3OAYH 1ND0A 4QRUA 5ILTL 2A9NH 2ITDA 1ZA3B 1TZGL 3CCHB 3WBDA 4YH6A 3OZ9H 3PQYD 5DJXB 1U2HA 5EOCL 4EDWH 3QUXB 1VCAA 3J7HA 4I0PC 4OF8A 2HT2D 1U92B 4I13B 4CW1A 3MOBL 1PW3A 1YJDC 5TPWL 4TSCL 1MCWW 2HRPH 5EUOE 4P5KB 1JNHB 5HDLA 1PZUB 1RJLA 4F9PC 1HILA 3QIWB 1QSZA 5C6WH 2G9HB 2GSGA 4LHUB 3DHJA 1LO2H 1MJUH 2WINB 5E6IC 43C9A 3FMGL 2P5EE 1BZ9B 5H35B 3HRZA 5F70A 5TDOA 3UDWC 2BOBB 2EDRA 4URTB 5J57B 5IMKB 3WFBH 4PGZA 4ZQKB 1Z0MA 3CZJA 4KJWD 4ODSL 1QZ1A 3MBXL 3D2UB 3L5JA 2VQUA 4PRHA 5CINL 3V52L 2FJHB 3JWOH 4UT9L 2HG5B 5DQDL 5FXCH 1JMZA 2QSCH 2RBLA 3IVKB 2EDNA 3GBMH 3LV3B 4AG4H 1U42A 3FQUA 4JFFB 3MLVL 1FN4B 2EO9A 1JNLL 2XQYK 4ZS6D 1IL1A 1I8LC 4NZTL 5IESL 5DJYB 3F65A 3N0PB 3GK8H 4H0IA 2VOTA 1QFWH 3CK0H 1N0XH 3OXSA 5D1QA 5IROC 4HD9A 1KF9B 2VABB 1DJSA 3MLTB 2IPUK 3B2UC 5HGHA 4MX7B 5BRZB 4KTEL 3G08A 2VQ1B 3SDAB 4F3FA 4Y19B 5E8OA 4GW5B 5C0BE 4QRRE 4M1CC 1IBGL 2H26B 2QR0B 2WM0A 3HE6A 1KG0B 4PRIB 1NANH 1U3HA 5IK3A 4F58H 1GSMA 1U93A 1OAYH 2XKNA 4WU5B 1FL3B 3LPWA 5KN5B 5HHPB 1J1XH 5HVHB 1L7IL 2DQCL 1QUNA 2IADB 3GSOB 3L95B 5T1LA 3AS1A 2GSIB 5DWUL 4NQSA 4L4TB 2CJUL 4KUZH 4OD2A 1KV3A 4N8CL 1NGXB 1JHKH 2DM7A 3TA3C 4DGVL 4X5XA 5EWIL 4R97B 2PO6B 4MQXC 3C5JB 3I2CH 4PD4K 1S7WB 4FQLL 3TNMA 1YYML 4HQQL 3OL2A 5F7NC 3HUJA 3VGAC 4NKIH 4E42A 1ULVA 4I1NB 4K3GA 5JQHC 1QBMH 3RWHA 2C4XA 4AH2A 3U9UA 2FH8A 3QJFA 1DVFB 4UT6L 3GJEA 4MNGB 2YBRB 2X40A 1KJVB 5F1KC 3TO4B 1AR2A 3BP4B 5FB8B 4U05A 4UILL 2XTJB 3L7FA 4G7YH 4P5TC 4GRLD 3U0WH 1RZKL 2YD8A 3FO1B 3ZZ1A 1IGYB 3STZA 2V17H 1D5XA 5IWLC 4Z8FH 1DUZA 4ZOBA 5ISZE 2DQFB 3O4OC 1EVTC 3JBG7 1AIFA 1J8HE 4DTGL 2GFBA 3I9GH 1C12A 2VH5L 2HLFC 4M7KL 5CEXA 4WI7A 2BNQD 5T5NG 1WT5A 1BAFL 1FNEB 5IVNA 2JJSA 3VRIA 2G60L 1KB5L 3SDDA 3NFNB 4JVWA 4XPBH 2LU7A 1CK0L 4UIKH 3PP3H 3NIFF 3V2AR 4JCLA 2MFNA 1MFEH 3FL7A 3AS2A 2EXYD 4TSBL 1RZ7H 3N50A 1BD2D 4JZNB 3WFCL 1J0ZA 4G8FB 3BIBX 3QQ3B 3STLB 1KN2L 4PLJD 5C0JB 4FTVA 1KCUL 4OI9A 1EBPA 4KDWA 3S96B 3O41A 3JWNC 4DN3L 1HYSD 1T0NA 2HT2C 3BH9B 5I74C 2DI7A 1RIHL 5C09B 4G8GE 5IG7B 5C6PB 5ACLA 3BT2L 3O6MH 4H1LB 1G6RH 3P77B 4AQOA 2M1KA 4WFED 4D0BB 3N1MC 2XKUA 1FBIH 3HPLB 2VDRL 5GGUA 1CGSH 1YN7B 4NGHH 2B1AL 2FGWH 3LSOA 4AT6B 1LO5B 4Y4FD 4J6RH 3NIFE 2BSTB 4M7JH 5T1MA 3VE0B 2CIKA 4KJWC 3LRSA 3SHSA 3P30H 4OGAC 4NKOB 3LPGA 4DQOL 1AGFB 2J6EL 4F8QA 2QHRH 3T0EE 1OAQL 1KYOK 3IRPX 3Q2CA 3BIKA 4MVBD 2DTSA 3GRWH 1QFPA 5DUML 4PY7B 5GS0D 4WW1A 1QA9A 4WTZG 4ZS6C 5FYKH 1HXYB 2NY1D 3M07A 5BZWA 4QTIL 3MLSL 3CX5J 3VXUE 4HUVA 4Y89A 1SJVA 5EUOB 1FJ1B 5I76B 1FGVH 2VLJE 4BH7A 1KACB 2P48B 5LGHL 4R90H 2OJEA 5A2FA 3B9DA 2F53D 4KTDH 3RL1A 1G7HB 3WS6A 2C4FU 1Y0LA 3S98A 2Z92B 5TFSL 1NLDL 4LLDB 2P5EB 4QCIA 3G9VA 3RTQB 2J8UA 4Z6AT 4JQXC 2NX5D 1YNKH 3WE6A 3MXWL 3VJ6A 5E95B 5FYJE 5FKPB 5E6ZA 4PJIF 3RU8L 3MBEB 2IG2L 4M6OL 4NZJA 2GTZB 4MAYA 4MA1B 2Y7QA 1V7NL 3MROA 1G9NC 4LPUA 1UKQA 3HMXH 4KMLB 1CGUA 4BH8A 3UAJD 5E2UL 3ZL4L 1WZMA 4Y2DB 4OUUB 4FFZL 5KZCD 1JWSA 3PWVA 3W0WE 3QQ4A 1CR9H 5FUCC 4PB9L 1WISA 2DM3A 4UOJA 4M03A 1X5ZA 1A7QH 1LO0L 5I30H 4MA8H 1NCTA 4APQB 1MUJB 3E0GA 4XC3L 2C3WA 1JE6A 5JHLH 4HW6A 4P46B 2YHGA 3QI9B 3UROR 1P84J 2FWOA 4JG1L 1RU9H 4PJAA 5EO1B 4XCNB 4I77L 3UZVB 3CCHA 4MA3A 4QRRB 1T89A 1TZHB 4PJIE 2BVPA 2D03H 2OSLA 4KJPD 4JO3L 1YY8A 4L8SA 4LQ1A 5BXFA 2GYSA 4ODXA 4GRLC 2VLLA 1QFUL 2CPCA 1ADQL 1I85A 4NQXB 4NT6B 1KELL 4UTAH 4RAVA 2H8PB 4YUEH 1JNHA 32C2A 1A6ZA 4QRPD 4JGMA 4KDVA 1GAFH 3OKEB 4XBEH 5CILL 2YXFA 3HMXA 3V6FA 2QL1A 3QPXL 5EORL 4XNXL 3MRRA 4IRZH 4LKCB 2P8PA 3BP7B 4KUCF 1QEWA 2Z93A 1BBDL 3MX0A 1RUQH 1RUPH 2ZCKH 3EOTL 3FONB 4K7FA 4PJ5A 4XCEB 3TBVA 1EFQA 2DQGH 4JQVA 4M7ZC 2C26A 2CRMA 3LS5L 4JHZA 1T20A 2FECI 5E5MB 1A4JA 2QKIB 2IANA 2AP2A 2YD4A 5DD1H 5ITBH 2EXYC 4NSKA 1N5AA 1UENA 1TCRA 3T0WA 4YLQT 5F96L 3BO8B 4HS3B 2NY5H 4PLJC 4XCCH 1JF1B 3RJQB 1RZJL 2WBJC 2R4RL 3SDYH 5GRWA 3IFOA 4NHCH 2ICEB 2N4IA 5D72H 5JIKA 3UJIH 3H9SE 4PBWD 3V6OA 1H3WM 5ISZB 1HYSC 1MJJB 4KRPB 1J8HB 2VDPH 1YMMA 3QXWA 1TJHH 3NCBB 3JV6B 4X7SH 4O2FB 1K5NA 3LKRA 1VPOL 4JHAH 2Y23A 3TWCH 4YFLF 1NGZB 3EJZD 5DLML 3KYKL 4Y4FC 4KVCL 1KGCD 5E56A 4LGPB 3CPLA 2CIIB 3S4SB 4LSSH 1A3LL 2NMSA 3VMPA 3NCYS 4Q0XL 4UUJB 1J1PL 4HFUH 4FXGB 3IJSB 5C0AA 1AD0A 2HT4D 1TPXC 4MVBC 2JELL 1ZT4A 3S36H 4TSAL 1KLUB 4X5WB 1YDPA 2IJ0C 5GS0C 4O5LH 4G5ZH 3CDFA 4NNPH 2NY1C 1RZFL 5I1CL 4LKXB 2P8LA 4G8GB 3X3GL 4ENED 3A6CL 4JKLA 4QXTB 1JGUH 4JFHE 4Y4HA 2Z35B 1KXTB 4KK9D 1UJ3B 5I15L 4GJTB 4JJ5B 4KAQH 5MEPB 5C07A 3TPUB 4HIHB 3S9DB 5HJ3A 4M1GH 3ZO0A 1XGPA 5EZJA 1MCRA 1NC4B 1A6AB 5FM5O 2VL5A 3M8OL 5ICXB 3SE4A 3GMQA 4HS8H 2YKLL 1HH9B 1RK0A 2OTWA 2WNGA 3ARXA 5JPMB 3MLXL 4YIQA 1Q72H 2ZNWA 3MV8D 4ZPTB 3T0EB 1EEYA 2Q1EA 4H1LH 3AM8C 4AEHH 5F1IB 3JTSB 4U1SA 3RNQA 3A67L 4JFOA 5GGSB 3WJLA 1I8KB 4HIJB 1QSED 1MCFA 4PD4J 3VXUB 4JRWA 3FO2B 4ZO7A 2F5AL 1AO7E 4YGAB 3SO3C 2D7PA 2GCYB 5KTEL 3OHXB 3ULUL 1P7KA 1MHHA 2VLJB 4L3EA 4OGYL 5DUPL 1AGDB 3NCCB 1H3PL 4U1LA 2JB6B 1UM5H 3IAPA 5D6CA 3VI3F 5I75C 1KTLB 3IJYB 4ODUB 3MA9H 5C08E 4QRTB 4DKFH 1OW0A 3I3EA 5C3LD 5IUSA 3QG6A 1A8JH 3GKWH 3T0DA 1MI5A 5T5FL 1A6PA 4X4XA 3FB5B 5HYSG 4KJPC 1S7RA 3V5HB 3NZ8B 1F00I 2EEAA 5SWQA 5MEQA 4LCIH 4HKZB 1WEJH 2AEQH 2ESVE 3GKZA 3GMMB 1YEGH 1ZE3C 1A6WL 2R56H 3L6FB 2R4SH 5MEOA 3P4MB 4UV4H 1RZGA 3S5LB 3RVVD 5HDQH 4HFWA 4MQ7B 2YXMA 4LGSB 2FR4A 1KJ3H 2IBZX 1RZIA 1C16B 2FX8H 3W0WB 4KVNH 4BA8A 1IM3A 5E7BA 3T0AA 2FB4H 2P43B 3LQZA 4K3HA 3KHOA 3HCVA 2NXYD 3OQ3B 1ZT7A 1TNNA 2NY0B 1MFNA 2FNBA 3EW3B 2B7DT 5FUOL 3VI3E 3TH2T 4JFYA 3HNTL 5CIPB 1J0KA 5DURB 2NY7H 1XAUA 5FOJA 1T6VN 1S9VA 3CSYB 4PJHF 1IVLA 2VR4A 4UDTB 4PJIB 1SEBA 1HHGB 1FORL 4HX1B 5D7SL 2E7LA 4YHNB 2FRGP 3VD4A 2IQ9H 3T0BA 3I6GB 5DJ0A 4HPOH 4YXHH 2B20A 2GITB 4Z7WF 2ATKA 4PJ8B 3TO2A 4DEPC 4FRWA 2ZUQC 4CN4A 5I71B 1S5HA 3FRUB 4R96B 4GW4A 4LEXL 3D85A 3M17A 1E28B 4OQTH 4P9HL 5C0BD 1GGCH 4DW2H 1I9IH 2VERN 3HUJF 3LRGA 4F9LC 3WXWH 1UXWA 4JQIH 8CGTA 5GISH 2BHYA 5TE6L 5D93C 1BQLH 4YAQA 1F2QA 1IQWH 3TN0D 2YD6A 3EJZC 4OCMC 4KZDH 3BUYA 1HOCA 1NCDH 2X7LB 2NNAA 2ZOKB 4L9LC 1CXHA 2VDNL 4K7PX 1H0DA 4PJHE 2DQUH 1YQVL 4JE4B 1CDUA 1T03L 3WUWA 4JANA 2Q7YB 1IEBB 1SMAA 1CFTA 2I5YL 2XZQL 2Y07L 1XIWA 5IB4B 2HT4C 2MNUA 4Z7WE 3OR7A 1MREL 5DZOA 2X1QA 4HF5L 1YNTA 3A6OA 3B4NA 4X4YB 4Q2ZB 5GIRB 1S8DA 1IAMA 1Z0NA 3MXVL 1T04B 1X5HA 3VXQB 2GT9A 4ENEC 4ONHB 4KK9C 3HUJE 5BW7C 4O9HH 3VWJD 4P2OB 5EA0H 4YHLH 4OQTA 1LEKA 1RZ8A 2ADIA 1O0VA 5KJRL 5C0CE 4TPRH 1OAXH 4M6ML 1CGYA 5JR1H 5C0RH 2ZJSL 5AAWA 4NT6A 3FQWB 5LCVL 3QNYB 1BLNA 1S9WB 1PYWB 3WLBB 3DI2B 1TQCC 3WN5B 2J88H 3FB8A 2UV3A 1IGFL 1T1WB 1J9CT 4CL7A 2VB5A 4XBGB 1KIPA 4RAUB 2VSCA 1DQQA 2KQNA 4OCNC 5EUKA 2V2TA 4GQ9H 1EHAA 4U6XB 1EZVX 3TZVB 4PGBA 4YDIL 4UOW1 1MOEA 1NAKH 4Z0XA 4J3SA 5DJAB 5LG1A 5IB1A 4QHLB 3SDCA 5HHME 1IQDA 1RIUL 1B2WL 1S7QA 2KPNA 5JZ7D 4L4VA 2PKDA 4LVHB 1AXSB 1A64A 1JYWA 1MNUH 4NQDB 4W6YB 1FO0H 1PKQA 4LCWD 4YWGH 5JW3L 5MENA 1B0RB 1KXVC 3RBGA 1A6TB 3OF6D 4XPAL 5F7DA 3NZHL 4Y1AE 4RWYL 2VYRE 4PTUB 5HVWA 3U7YL 3MGTA 3HG1E 3RVVC 1NMBH 2AV7A 1OAZL 1QLRB 1T2XA 5EZIL 5FK9B 4JPKL 1AO7B 1H15B 5E70A 3A6BH 3BAEL 3KYMA 5IEHB 1G6VK 3HA0A 2CKBA 2ICCA 4MCYB 3N1GC 1NC2A 2NXYC 3C09C 4P59H 2HFGH 1MFCH 2YPLD 1KTRL 2GQHA 4UUJA 4ZO6A 2XZAL 1AP2A 3KWWA 5C08B 4XWOC 3T1FA 4ZUVB 1MCPH 1X5JA 1UB6B 4FOMA 4CU6A 3U7AA 4K9EL 1R24B 4BFEA 3QCUH 3ALPA 2VLKD 1NMAL 5BJTA 5I8CA 4PREA 4F8TA 1GGIL 3VFNB 3JWDH 1FO0A 1S3KH 4RMQA 1HINH 1BFOA 5DUBA 2DLIA 2ESVB 1XT5A 5H37H 4QGYA 4LLWA 5FO7A 4G6JH 1MCCA 1YC7A 4FP8H 4TVSa 3LDBC 4B5EA 3O6KL 5BVPH 4HUMB 4L1HA 1P4IL 4M6NH 3VFPB 2XN9E 4U1KB 2BRRH 2RR3A 1LK3H 1QO3A 1RPQA 2RFXA 3OAZK 4OM0L 4S2SB 4HHAB 1V3LA 5EC1B 5E08H 3QNXB 5H2BA 3VWKC 5CD3B 3AXLA 2APVA 3QUYB 5HGBB 2PETA 4F7TA 4BZYA 5GJTL 3TN0C 4NO5B 5HTSA 3T04D 2DWDA 4U33A 5F1IA 3UZEA 5JA9A 4QHMA 2HJLB 1M71B 1FNSH 4TTDD 3GB7A 1HWGB 4U6HA 2NY2D 4XVTL 4MLSA 5GS3A 1I3UA 1MRCH 2XV6B 5CJQL 2DI9A 1J10A 3R1GH 5CJXC 3VFWB 5J6GA 2DLFL 1OAKH 4OUOA 2HVJB 4JRXD 4WUKH 3VFUA 3IJYA 3AU1A 3FO0L 4NP4L 5IJKC 1K4CB 1PAMA 5EU5B 3CX2A 4PJXB 3PJSA 3GBNH 1ZHLA 2AJUH 1UFUA 2EE3A 3KPPB 1VENA 4PG2C 3NN8B 3VWJC 4NM4L 3HC3L 4KKCD 1IKNA 4X7DC 1TCMA 3RA7L 2HN7B 1QHOA 2AK1H 4F33A 5JIIA 3ULUF 2HMID 3H9HB 4WW2A 2DDQH 1D5MA 5AZ2H 3BDYH 3L3JB 1YNLL 3SKUD 4BK5A 5ESVB 1ORSB 4OZ4A 5T3ZE 5DJ2B 4PRBA 4L8CA 3IU3B 1H3TA 5KVEH 2G5BA 4UB0L 1C5CL 1INQB 3P73A 1A5FL 4CVZA 4ZUSA 3SJVB 4R26L 4Z7WB 4GRWB 3MC0A 4AY0A 2YD9A 1G84A 4P4KA 3R4DA 4KV5F 3OWEA 5L6YL 2FGZA 4LSUL 6FABH 1BFVL 4HC1L 4Y5YA 3U4BH 4JFEE 5C0FB 1A1OA 2UZIH 1TNMA 1NSNH 5JPNB 5L2KE 2Y5EA 1W0WA 1EO5A 3LH2L 4BFGA 3L1OL 2OR9L 3ZKQD 5JZ7C 1KEGL 3ULUE 5GRJL 5KVMC 5C0CB 1UZ8B 2DLHA 1EGJL 1MPAH 4NUGH 4YBQD 1TZGH 3CVHL 4HIXL 3BEVA 4JO4L 3PGFL 3CAFA 1ORQA 3ARBB 5IW1B 5MI0C 4XVSH 5SWZE 4KKBD 3EKCA 4GUPA 3OKOA 4J7RA 2MWCA 4JPWL 5C8JA 1FE8H 3V6OE 5KVGL 4G9DA 3QEHA 2ZUUA 4U6TA 2X4RA 5E24E 1ZGLA 1E28A 3MOBH 4J8RB 4PLNC 5I1IH 5TPWH 4TSCH 3KPRE 3L5HA 1QR4A 5IM7A 4KV5E 2VN4A 2LU3A 3UTSE 3BZ4B 4HBCL 2VUYA 2KZWA 4OGZA 3MNWB 3MRKA 3UTQB 1D9KD 2NW3A 1VADB 1BZQK 1Z5LB 3FMGH 3KPMB 2ZOKA 2E9WA 3HAEG 1Q8MA 5HHMB 3VFMA 1NFIB 4G8EB 5D70L 3VXSA 3F12B 2Q7YA 5LGJA 5FO9A 1PG7L 1LGVA 4ODSH 1IAOB 3FFCA 1JBJA