5JO2A

Crystal structure of abscisic acid-bound abscisic acid receptor pyl3 in complex with type 2c protein phosphatase hab1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
182
structure length
182
Chain Sequence
GLTKDEFSTLDSIIRTHHTFPRSPNTCTSLIAHRVDAPAHAIWRFVRDFANPNKYKHFIKSCTIRVNGNGIKEIKVGTIREVSVVSGLPASTSVEILEVLDEEKRILSFRVLGGEHRLNNYRSVTSVNEFVVLEKDKKKRVYSVVLESYIVDIPQGNTEEDTRMFVDTVVKSNLQNLAVIST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL3
publication title Co-evolution of Hormone Metabolism and Signaling Networks Expands Plant Adaptive Plasticity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein/hydrolase
total genus 43
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2016-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 5jo2A00
1FM4A 3UIDA 3IJTA 4R7KA 2E3SA 4IHRA 2QPVA 4IGWA 2LCGA 1E09A 3KAZA 3C0VA 3OJIA 2LEQA 2L65A 4JHIA 3QSZA 4MNSA 3RT0C 3RT2A 3UQHA 3H3SA 4REHA 3TL1A 1ZXFA 2E3NA 1LN1A 1IFVA 3E85A 1EM2A 2E3QA 4MAPA 3WG8A 3FO5A 4JHHA 2IL5A 4MA6A 1TW0A 4LG5A 3RD6A 1X53A 4BK6A 1Z94A 2N4BA 3P51A 2PSOA 5E4MA 1B6FA 4JHGA 5AMWA 3KDJA 4IGXA 3K90A 3W9RA 4A81A 3JRSA 3TVQA 4C9CA 4M9BA 3KL1A 2NN5A 2LE1A 2E3RA 4N0GC 2LAKA 4BK7A 3Q6AA 4RYVA 2REZA 4GY9A 1H2OA 3OTLA 2Z9YA 2KTEA 2LUZA 5E4BA 5I8FA 2KCZA 1T27A 4PSBA 3CNWA 4LGAA 2KF2A 3NMNA 3QN1A 1XFSA 3KDHA 2WQLA 4Y31A 2FFSA 3IE5A 3NI8A 3OH8A 2LDKA 4M9WA 1ICXA 1LN3A 5E4DA 5I9JA 2E3MA 3ZVUA 4A85A 2LGHA 4DS8A 4LGBA 2EJXA 1XUVA 2NS9A 3TFZA 1QMRA 1LN2A 2LF2A 4FPWA 5BRLA 4A8VA 4A80A 3NS2A 3Q63A 1KCMA 1JSSA 2RERA 2A1LA 4REIA 4C94A 4DSBA 2E3PA 3TVRA 5JO1A 3PU2A 4BKCA 4IH0A 3P0LA 3KB0A 1BTVA 1FSKA 2K5GA 4XRWA 3KB3A 5C9YA 3H3RA 2Z9ZA 4DSCA 4OICA 4Q0KA 2FLHA 5JO2A 2LIOA 1LLTA 3NJ0A 4REJA 2M47A 1XN5A 3NMHA 3Q64A 3PUTA 5E46A 3KDIA 2N4AA 3K3KA 4WVOA 4N3EA 4IGVA 2BK0A 2L8OA 4A8GA 3H3TA 3ELIA 3KAYA 1VJHA 3W9KA 2GKDA 2R55A 3NR4A 3KLXA 4A83A 2L9PA 2I9YA 2MOUA 2VQ5A 3NJ1A 2KEWA 4A88A 1T17A 3NMVA 4JDLA 3OQUA 2M89A 3GGNA 4BTZA 4A86A 2VNEA 2Q3QA 4C9IA 4Z3LA 1TXCA 3H3QA 3NEFA 3NMTA 4BKDA 2RESA 4JDAA 4B9RA 2K7HA 3NEGA 3NJOA 3P9VA 5JNNA 2PCSA 4IH2A 4XRTA 2LPXA 4A8UA 3R6PA 4IGYA 4LA7A 3NMPA 3UJLA 1UW5A 2E3OA 4QIPA 1XN6A 4A87A 2D4RA 2QIMA 1XDFA 3JRQB 1BV1A 3F08A 4A84A
chains in the Genus database with same CATH superfamily
1FM4A 3UIDA 3IJTA 4R7KA 2E3SA 4IHRA 2QPVA 4IGWA 2LCGA 1E09A 3KAZA 3C0VA 3OJIA 2LEQA 4QCKA 2L65A 4JHIA 3QSZA 4MNSA 3RT0C 3RT2A 3UQHA 3H3SA 4JHYA 4REHA 3TL1A 3HXMA 1ZXFA 2E3NA 1LN1A 1IFVA 3E85A 1EM2A 2E3QA 3GB4A 4MAPA 3WG8A 3GTSA 3FO5A 4NCAA 4JHHA 2IL5A 4MA6A 1TW0A 4LG5A 3RD6A 1X53A 4BK6A 1Z94A 2N4BA 3P51A 2PSOA 5E4MA 1B6FA 4JHGA 5AMWA 4E6FA 3KDJA 4IGXA 3K90A 3W9RA 4A81A 3JRSA 3TVQA 4C9CA 4M9BA 3KL1A 2NN5A 4QDFA 2LAFA 2LE1A 2E3RA 4N0GC 2LAKA 4BK7A 3HVRA 3Q6AA 4RYVA 2REZA 4GY9A 1H2OA 3OTLA 2Z9YA 4QDFB 2KTEA 2LUZA 5E4BA 5I8FA 2KCZA 1T27A 3GL2A 4PSBA 3CNWA 4LGAA 4KPYA 2KF2A 3NMNA 3QN1A 1XFSA 3KDHA 2WQLA 4Y31A 2FFSA 3IE5A 3NI8A 3OH8A 2LDKA 2ZYLA 1ICXA 1LN3A 4M9WA 5E4DA 2E3MA 5I9JA 3ZVUA 4A85A 2LGHA 4DS8A 4LGBA 2EJXA 1XUVA 2NS9A 3TFZA 1QMRA 1LN2A 2LF2A 4FPWA 5BRLA 4A8VA 2YH6A 4A80A 3GTEA 3NS2A 3Q63A 3TGOC 1KCMA 1JSSA 2RERA 2A1LA 4REIA 4C94A 4DSBA 2E3PA 3TVRA 5JO1A 3PU2A 4BKCA 4IH0A 3P0LA 3KB0A 1BTVA 1FSKA 2K5GA 4XRWA 3HJFA 3KB3A 5C9YA 3H3RA 2Z9ZA 4DSCA 4OICA 4Q0KA 2FLHA 5JO2A 2LIOA 4NCBA 1LLTA 3NJ0A 4REJA 2M47A 1XN5A 3NMHA 3Q64A 3PUTA 5E46A 3KDIA 2N4AA 3K3KA 4N76A 4WVOA 4N3EA 4IGVA 5EKQC 2BK0A 2L8OA 3F73A 4A8GA 3H3TA 3GKEA 3DLHA 3ELIA 3KAYA 3GL0A 1VJHA 4QDDA 3W9KA 2GKDA 2R55A 3NR4A 3KLXA 4A83A 2L9PA 4N47A 3HM9A 3HO1A 2I9YA 2MOUA 2VQ5A 3NJ1A 2KEWA 4A88A 1T17A 3NMVA 3NQNA 4JDLA 4QDCA 3OQUA 2M89A 3GGNA 4BTZA 4A86A 2VNEA 2Q3QA 4C9IA 4Z3LA 1TXCA 3HK2A 3H3QA 3NEFA 3NMTA 4BKDA 2RESA 4JDAA 4B9RA 2K7HA 3NEGA 4N41A 3NJOA 3P9VA 5JNNA 2PCSA 4IH2A 4XRTA 2LPXA 4A8UA 3R6PA 4IGYA 4LA7A 3NMPA 3UJLA 1UW5A 2E3OA 3GOBA 4QIPA 3DLBA 1XN6A 4A87A 2D4RA 2QIMA 1XDFA 3JRQB 1BV1A 3F08A 4A84A
chains in the Genus database with same CATH topology
1FM4A 3UIDA 3IJTA 4R7KA 2E3SA 4IHRA 2QPVA 4IGWA 2LCGA 1E09A 3KAZA 3C0VA 3OJIA 2LEQA 4QCKA 2L65A 4JHIA 3QSZA 4MNSA 3RT0C 3RT2A 3UQHA 3H3SA 4JHYA 4REHA 3TL1A 3HXMA 1ZXFA 2E3NA 1LN1A 1IFVA 3E85A 1EM2A 2E3QA 3GB4A 4MAPA 3WG8A 3GTSA 3FO5A 4NCAA 4JHHA 2IL5A 4MA6A 1TW0A 4LG5A 3RD6A 1X53A 4BK6A 1Z94A 2N4BA 3P51A 2PSOA 5E4MA 1B6FA 4JHGA 5AMWA 4E6FA 3KDJA 4IGXA 3K90A 3W9RA 4A81A 3JRSA 3TVQA 4C9CA 4M9BA 3KL1A 2NN5A 4QDFA 2LAFA 2LE1A 2E3RA 4N0GC 2LAKA 4BK7A 3HVRA 3Q6AA 4RYVA 2REZA 4GY9A 1H2OA 3OTLA 2Z9YA 4QDFB 2KTEA 2LUZA 5E4BA 5I8FA 2KCZA 1T27A 3GL2A 4PSBA 3CNWA 4LGAA 4KPYA 2KF2A 3NMNA 3QN1A 1XFSA 3KDHA 2WQLA 4Y31A 2FFSA 3IE5A 3NI8A 3OH8A 2LDKA 2ZYLA 1ICXA 1LN3A 4M9WA 5E4DA 2E3MA 5I9JA 3ZVUA 4A85A 2LGHA 4DS8A 4LGBA 2EJXA 1XUVA 2NS9A 3TFZA 1QMRA 1LN2A 2LF2A 4FPWA 5BRLA 4A8VA 2YH6A 4A80A 3GTEA 3NS2A 3Q63A 3TGOC 1KCMA 1JSSA 2RERA 2A1LA 4REIA 4C94A 4DSBA 2E3PA 3TVRA 5JO1A 3PU2A 4BKCA 4IH0A 3P0LA 3KB0A 1BTVA 1FSKA 2K5GA 4XRWA 3HJFA 3KB3A 5C9YA 3H3RA 2Z9ZA 4DSCA 4OICA 4Q0KA 2FLHA 5JO2A 2LIOA 4NCBA 1LLTA 3NJ0A 4REJA 2M47A 1XN5A 3NMHA 3Q64A 3PUTA 5E46A 3KDIA 2N4AA 3K3KA 4N76A 4WVOA 4N3EA 4IGVA 5EKQC 2BK0A 2L8OA 3F73A 4A8GA 3H3TA 3GKEA 3DLHA 3ELIA 3KAYA 3GL0A 1VJHA 4QDDA 3W9KA 2GKDA 2R55A 3NR4A 3KLXA 4A83A 2L9PA 4N47A 3HM9A 3HO1A 2I9YA 2MOUA 2VQ5A 3NJ1A 2KEWA 4A88A 1T17A 3NMVA 3NQNA 4JDLA 4QDCA 3OQUA 2M89A 3GGNA 4BTZA 4A86A 2VNEA 2Q3QA 4C9IA 4Z3LA 1TXCA 3HK2A 3H3QA 3NEFA 3NMTA 4BKDA 2RESA 4JDAA 4B9RA 2K7HA 3NEGA 4N41A 3NJOA 3P9VA 5JNNA 2PCSA 4IH2A 4XRTA 2LPXA 4A8UA 3R6PA 4IGYA 4LA7A 3NMPA 3UJLA 1UW5A 2E3OA 3GOBA 4QIPA 3DLBA 1XN6A 4A87A 2D4RA 2QIMA 1XDFA 3JRQB 1BV1A 3F08A 4A84A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FM4 A;  3UID A;  3IJT A;  4R7K A;  2E3S A;  4IHR A;  2QPV A;  4IGW A;  2LCG A;  1E09 A;  3KAZ A;  3C0V A;  3OJI A;  2LEQ A;  2L65 A;  4JHI A;  3QSZ A;  4MNS A;  3RT0 C;  3RT2 A;  3UQH A;  3H3S A;  4REH A;  3TL1 A;  1ZXF A;  2E3N A;  1LN1 A;  1IFV A;  3E85 A;  1EM2 A;  2E3Q A;  4MAP A;  3WG8 A;  3FO5 A;  4JHH A;  2IL5 A;  4MA6 A;  1TW0 A;  4LG5 A;  3RD6 A;  1X53 A;  4BK6 A;  1Z94 A;  2N4B A;  3P51 A;  2PSO A;  5E4M A;  1B6F A;  4JHG A;  5AMW A;  3KDJ A;  4IGX A;  3K90 A;  3W9R A;  4A81 A;  3JRS A;  3TVQ A;  4C9C A;  4M9B A;  3KL1 A;  2NN5 A;  2LE1 A;  2E3R A;  4N0G C;  2LAK A;  4BK7 A;  3Q6A A;  4RYV A;  2REZ A;  4GY9 A;  1H2O A;  3OTL A;  2Z9Y A;  2KTE A;  2LUZ A;  5E4B A;  5I8F A;  2KCZ A;  1T27 A;  4PSB A;  3CNW A;  4LGA A;  2KF2 A;  3NMN A;  3QN1 A;  1XFS A;  3KDH A;  2WQL A;  4Y31 A;  2FFS A;  3IE5 A;  3NI8 A;  3OH8 A;  2LDK A;  4M9W A;  1ICX A;  1LN3 A;  5E4D A;  5I9J A;  2E3M A;  3ZVU A;  4A85 A;  2LGH A;  4DS8 A;  4LGB A;  2EJX A;  1XUV A;  2NS9 A;  3TFZ A;  1QMR A;  1LN2 A;  2LF2 A;  4FPW A;  5BRL A;  4A8V A;  4A80 A;  3NS2 A;  3Q63 A;  1KCM A;  1JSS A;  2RER A;  2A1L A;  4REI A;  4C94 A;  4DSB A;  2E3P A;  3TVR A;  5JO1 A;  3PU2 A;  4BKC A;  4IH0 A;  3P0L A;  3KB0 A;  1BTV A;  1FSK A;  2K5G A;  4XRW A;  3KB3 A;  5C9Y A;  3H3R A;  2Z9Z A;  4DSC A;  4OIC A;  4Q0K A;  2FLH A;  5JO2 A;  2LIO A;  1LLT A;  3NJ0 A;  4REJ A;  2M47 A;  1XN5 A;  3NMH A;  3Q64 A;  3PUT A;  5E46 A;  3KDI A;  2N4A A;  3K3K A;  4WVO A;  4N3E A;  4IGV A;  2BK0 A;  2L8O A;  4A8G A;  3H3T A;  3ELI A;  3KAY A;  1VJH A;  3W9K A;  2GKD A;  2R55 A;  3NR4 A;  3KLX A;  4A83 A;  2L9P A;  2I9Y A;  2MOU A;  2VQ5 A;  3NJ1 A;  2KEW A;  4A88 A;  1T17 A;  3NMV A;  4JDL A;  3OQU A;  2M89 A;  3GGN A;  4BTZ A;  4A86 A;  2VNE A;  2Q3Q A;  4C9I A;  4Z3L A;  1TXC A;  3H3Q A;  3NEF A;  3NMT A;  4BKD A;  2RES A;  4JDA A;  4B9R A;  2K7H A;  3NEG A;  3NJO A;  3P9V A;  5JNN A;  2PCS A;  4IH2 A;  4XRT A;  2LPX A;  4A8U A;  3R6P A;  4IGY A;  4LA7 A;  3NMP A;  3UJL A;  1UW5 A;  2E3O A;  4QIP A;  1XN6 A;  4A87 A;  2D4R A;  2QIM A;  1XDF A;  3JRQ B;  1BV1 A;  3F08 A;  4A84 A; 
#chains in the Genus database with same CATH topology
 1FM4 A;  3UID A;  3IJT A;  4R7K A;  2E3S A;  4IHR A;  2QPV A;  4IGW A;  2LCG A;  1E09 A;  3KAZ A;  3C0V A;  3OJI A;  2LEQ A;  4QCK A;  2L65 A;  4JHI A;  3QSZ A;  4MNS A;  3RT0 C;  3RT2 A;  3UQH A;  3H3S A;  4JHY A;  4REH A;  3TL1 A;  3HXM A;  1ZXF A;  2E3N A;  1LN1 A;  1IFV A;  3E85 A;  1EM2 A;  2E3Q A;  3GB4 A;  4MAP A;  3WG8 A;  3GTS A;  3FO5 A;  4NCA A;  4JHH A;  2IL5 A;  4MA6 A;  1TW0 A;  4LG5 A;  3RD6 A;  1X53 A;  4BK6 A;  1Z94 A;  2N4B A;  3P51 A;  2PSO A;  5E4M A;  1B6F A;  4JHG A;  5AMW A;  4E6F A;  3KDJ A;  4IGX A;  3K90 A;  3W9R A;  4A81 A;  3JRS A;  3TVQ A;  4C9C A;  4M9B A;  3KL1 A;  2NN5 A;  4QDF A;  2LAF A;  2LE1 A;  2E3R A;  4N0G C;  2LAK A;  4BK7 A;  3HVR A;  3Q6A A;  4RYV A;  2REZ A;  4GY9 A;  1H2O A;  3OTL A;  2Z9Y A;  4QDF B;  2KTE A;  2LUZ A;  5E4B A;  5I8F A;  2KCZ A;  1T27 A;  3GL2 A;  4PSB A;  3CNW A;  4LGA A;  4KPY A;  2KF2 A;  3NMN A;  3QN1 A;  1XFS A;  3KDH A;  2WQL A;  4Y31 A;  2FFS A;  3IE5 A;  3NI8 A;  3OH8 A;  2LDK A;  2ZYL A;  1ICX A;  1LN3 A;  4M9W A;  5E4D A;  2E3M A;  5I9J A;  3ZVU A;  4A85 A;  2LGH A;  4DS8 A;  4LGB A;  2EJX A;  1XUV A;  2NS9 A;  3TFZ A;  1QMR A;  1LN2 A;  2LF2 A;  4FPW A;  5BRL A;  4A8V A;  2YH6 A;  4A80 A;  3GTE A;  3NS2 A;  3Q63 A;  3TGO C;  1KCM A;  1JSS A;  2RER A;  2A1L A;  4REI A;  4C94 A;  4DSB A;  2E3P A;  3TVR A;  5JO1 A;  3PU2 A;  4BKC A;  4IH0 A;  3P0L A;  3KB0 A;  1BTV A;  1FSK A;  2K5G A;  4XRW A;  3HJF A;  3KB3 A;  5C9Y A;  3H3R A;  2Z9Z A;  4DSC A;  4OIC A;  4Q0K A;  2FLH A;  5JO2 A;  2LIO A;  4NCB A;  1LLT A;  3NJ0 A;  4REJ A;  2M47 A;  1XN5 A;  3NMH A;  3Q64 A;  3PUT A;  5E46 A;  3KDI A;  2N4A A;  3K3K A;  4N76 A;  4WVO A;  4N3E A;  4IGV A;  5EKQ C;  2BK0 A;  2L8O A;  3F73 A;  4A8G A;  3H3T A;  3GKE A;  3DLH A;  3ELI A;  3KAY A;  3GL0 A;  1VJH A;  4QDD A;  3W9K A;  2GKD A;  2R55 A;  3NR4 A;  3KLX A;  4A83 A;  2L9P A;  4N47 A;  3HM9 A;  3HO1 A;  2I9Y A;  2MOU A;  2VQ5 A;  3NJ1 A;  2KEW A;  4A88 A;  1T17 A;  3NMV A;  3NQN A;  4JDL A;  4QDC A;  3OQU A;  2M89 A;  3GGN A;  4BTZ A;  4A86 A;  2VNE A;  2Q3Q A;  4C9I A;  4Z3L A;  1TXC A;  3HK2 A;  3H3Q A;  3NEF A;  3NMT A;  4BKD A;  2RES A;  4JDA A;  4B9R A;  2K7H A;  3NEG A;  4N41 A;  3NJO A;  3P9V A;  5JNN A;  2PCS A;  4IH2 A;  4XRT A;  2LPX A;  4A8U A;  3R6P A;  4IGY A;  4LA7 A;  3NMP A;  3UJL A;  1UW5 A;  2E3O A;  3GOB A;  4QIP A;  3DLB A;  1XN6 A;  4A87 A;  2D4R A;  2QIM A;  1XDF A;  3JRQ B;  1BV1 A;  3F08 A;  4A84 A; 
#chains in the Genus database with same CATH homology
 1FM4 A;  3UID A;  3IJT A;  4R7K A;  2E3S A;  4IHR A;  2QPV A;  4IGW A;  2LCG A;  1E09 A;  3KAZ A;  3C0V A;  3OJI A;  2LEQ A;  4QCK A;  2L65 A;  4JHI A;  3QSZ A;  4MNS A;  3RT0 C;  3RT2 A;  3UQH A;  3H3S A;  4JHY A;  4REH A;  3TL1 A;  3HXM A;  1ZXF A;  2E3N A;  1LN1 A;  1IFV A;  3E85 A;  1EM2 A;  2E3Q A;  3GB4 A;  4MAP A;  3WG8 A;  3GTS A;  3FO5 A;  4NCA A;  4JHH A;  2IL5 A;  4MA6 A;  1TW0 A;  4LG5 A;  3RD6 A;  1X53 A;  4BK6 A;  1Z94 A;  2N4B A;  3P51 A;  2PSO A;  5E4M A;  1B6F A;  4JHG A;  5AMW A;  4E6F A;  3KDJ A;  4IGX A;  3K90 A;  3W9R A;  4A81 A;  3JRS A;  3TVQ A;  4C9C A;  4M9B A;  3KL1 A;  2NN5 A;  4QDF A;  2LAF A;  2LE1 A;  2E3R A;  4N0G C;  2LAK A;  4BK7 A;  3HVR A;  3Q6A A;  4RYV A;  2REZ A;  4GY9 A;  1H2O A;  3OTL A;  2Z9Y A;  4QDF B;  2KTE A;  2LUZ A;  5E4B A;  5I8F A;  2KCZ A;  1T27 A;  3GL2 A;  4PSB A;  3CNW A;  4LGA A;  4KPY A;  2KF2 A;  3NMN A;  3QN1 A;  1XFS A;  3KDH A;  2WQL A;  4Y31 A;  2FFS A;  3IE5 A;  3NI8 A;  3OH8 A;  2LDK A;  2ZYL A;  1ICX A;  1LN3 A;  4M9W A;  5E4D A;  2E3M A;  5I9J A;  3ZVU A;  4A85 A;  2LGH A;  4DS8 A;  4LGB A;  2EJX A;  1XUV A;  2NS9 A;  3TFZ A;  1QMR A;  1LN2 A;  2LF2 A;  4FPW A;  5BRL A;  4A8V A;  2YH6 A;  4A80 A;  3GTE A;  3NS2 A;  3Q63 A;  3TGO C;  1KCM A;  1JSS A;  2RER A;  2A1L A;  4REI A;  4C94 A;  4DSB A;  2E3P A;  3TVR A;  5JO1 A;  3PU2 A;  4BKC A;  4IH0 A;  3P0L A;  3KB0 A;  1BTV A;  1FSK A;  2K5G A;  4XRW A;  3HJF A;  3KB3 A;  5C9Y A;  3H3R A;  2Z9Z A;  4DSC A;  4OIC A;  4Q0K A;  2FLH A;  5JO2 A;  2LIO A;  4NCB A;  1LLT A;  3NJ0 A;  4REJ A;  2M47 A;  1XN5 A;  3NMH A;  3Q64 A;  3PUT A;  5E46 A;  3KDI A;  2N4A A;  3K3K A;  4N76 A;  4WVO A;  4N3E A;  4IGV A;  5EKQ C;  2BK0 A;  2L8O A;  3F73 A;  4A8G A;  3H3T A;  3GKE A;  3DLH A;  3ELI A;  3KAY A;  3GL0 A;  1VJH A;  4QDD A;  3W9K A;  2GKD A;  2R55 A;  3NR4 A;  3KLX A;  4A83 A;  2L9P A;  4N47 A;  3HM9 A;  3HO1 A;  2I9Y A;  2MOU A;  2VQ5 A;  3NJ1 A;  2KEW A;  4A88 A;  1T17 A;  3NMV A;  3NQN A;  4JDL A;  4QDC A;  3OQU A;  2M89 A;  3GGN A;  4BTZ A;  4A86 A;  2VNE A;  2Q3Q A;  4C9I A;  4Z3L A;  1TXC A;  3HK2 A;  3H3Q A;  3NEF A;  3NMT A;  4BKD A;  2RES A;  4JDA A;  4B9R A;  2K7H A;  3NEG A;  4N41 A;  3NJO A;  3P9V A;  5JNN A;  2PCS A;  4IH2 A;  4XRT A;  2LPX A;  4A8U A;  3R6P A;  4IGY A;  4LA7 A;  3NMP A;  3UJL A;  1UW5 A;  2E3O A;  3GOB A;  4QIP A;  3DLB A;  1XN6 A;  4A87 A;  2D4R A;  2QIM A;  1XDF A;  3JRQ B;  1BV1 A;  3F08 A;  4A84 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...