5JOEA

Crystal structure of i81 from titin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
92
Chain Sequence
MGPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Titin
publication title CARP interacts with titin at a unique helical N2A sequence and at the domain Ig81 to form a structured complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 24
structure length 92
sequence length 92
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5joeA00
1MI5B 2ZOKA 4RA0C 4QRTA 4PJ7F 3TJHD 3ZDYE 1QFWL 4ZTOH 3G5YA 3OF6A 3IT8D 5J1TC 3EJZC 3REVB 4OF7A 3GK8L 1A3LL 2CGRH 4L3CB 4F7MB 3P9LB 4LLMB 4ODVH 1IEHA 1UGNA 5DEFA 2VLLA 3F7PC 5J89A 4KJPD 4YXLH 3U0PA 5C0JA 3W9DA 3MREA 4M7LT 5JXEC 1JNNL 3ZMRA 3LEVH 3GMNB 4NT6A 1YC7A 4PJIF 4GRWH 1XGQA 5F7HA 3X3FL 1RUPL 4ISVB 4UV4H 1XF4B 4X4ME 2ADIA 4JM2F 1PEWA 3TBVB 1DBMH 1EHLH 5C07D 1G9NC 3CAFA 3HZVB 4NM4H 3UTSD 5IHBA 1N8ZB 5CP7A 1BM3L 3T1FA 5EOQH 4LLAA 1NBZA 4JY6B 1I4FA 4PJGF 4QXUH 1SM3H 4M8VA 2YKLH 4JDZB 4H1LA 1R3JA 1CU4H 1U92A 5EZOH 3QCVH 2IBGA 2XY1A 4GT7A 4I0PA 1UZ8B 5I71B 3LEXB 1UC6A 3RHWF 4S1SH 4OIIH 4M7ZB 5E99L 1D6VH 4JO4H 4MAYC 4YDKH 4HV8B 2HKFH 2VC2L 1H8SA 5IK3B 1KN2L 1YN7B 1KPVA 3IKKA 5CKGA 4LPCA 3ZDZE 1R3LB 2EZ0D 4ODTL 1XCQA 5E6ZA 3IRZA 5IJKC 4P57B 3WFDH 3LN5A 1IFHL 4PJEB 1YPZB 2X44D 2CQVA 4R7NB 5IEHA 3BZEA 5LGHL 4Z7WF 5DQ9A 4XAWL 1Q9OA 1GOHA 4F15C 5C9JA 5F6IC 5J4MA 3QWOB 4B7IA 4I0CC 3WNLA 3O81A 3GIZL 3H7LA 1YNTA 4XPGL 4F9LC 3DOSA 2YD4A 1T2QL 3UAJC 1E4JA 5CEYB 1G84A 4PB9L 3CUPA 3IRPX 5CD5C 4QHNB 2NY5H 5C08A 1ADQL 1JNLH 4APQB 2PO6C 3O3BB 4LLDB 5EZLA 5CZXC 1MCSA 4AY0A 3HPLB 3OZ9H 3U4BH 2FLBT 5L2JB 5T1LB 3U9PL 4ZSOA 4UOW1 3FHAA 3HZKA 1JRHL 4XWGH 1LVEA 3GBML 5FOBA 1GRWA 4NBXB 1P4BH 1W72H 5BMFL 1WUNT 5H94B 1CBVL 4QY8B 4J2XA 3IVKA 2VLRD 4Z5RA 2Z0BA 3HNSH 3MA7B 5CZKA 3NPZB 3GJEB 5LGKA 3FO9A 4FFWC 4FQ2L 5AZEH 5IBTH 4YIQA 4FTVE 3LPWA 4XTRD 4CJ0A 1FL5A 3OKDA 4TSCL 2J4WL 2HAZA 3O8XC 1OT2A 1T5WA 4AEIH 4NO2B 3FQNA 3JV5A 3FQTB 5I17A 1KEMH 2NPLX 3V79C 5CILH 5INCA 3VGAB 3VXRE 2DQFA 1YQ2A 4JHAH 3BO8A 2BVPB 2PW2A 2VDPH 5EC2A 4OZHF 1U8IA 3NH7L 4MAUH 3OKOB 4F3FB 1CDYA 3OAUL 4K8RD 1AD9B 1S5IL 5T1KA 2C9AA 1PSKL 3IDJB 4LRIA 1HKLH 2FZ3A 5IMKB 1NSNL 1VA9A 3EOBA 5ICXA 4R0LB 4ZYKA 4AL8H 2JK5A 3N1PC 4M6OH 4S1QH 1UA6H 2HLAB 1S7TB 1CIUA 1FNEA 1F11A 1QSVA 2CRYA 4HKXA 5L2KE 3ARZA 2VL5B 3WSQH 1T80A 1ND0B 2GUOA 1S7XB 5J9PB 4PLJD 4XI5D 5FOJA 5CHNB 5JZ7C 5B8CC 1HHGB 2X4OB 4OZ4A 3CDFA 2FD6H 1CFSB 4UIMA 3TV3H 1XIWC 2CKBB 5F70A 3O9WC 5I15L 1U3ZA 3MMEB 4DFIA 2Z35B 5C0BA 5CCKL 5JO5A 1HXYB 4P2OB 5IEKA 1OPGL 3RGVC 2EIZA 3D69A 1A4JB 1G7QB 1J05A 2YA0A 2YD6A 3PABA 1T7WA 4OZFH 4LRNL 3CVIL 3PDOB 3UROR 4UBDC 4UILL 4TVSa 1NFKA 4FZ8L 1RJYA 2C1PB 3EYUL 4OM1L 4DGIH 3CH1A 3UYOD 4EUPG 1C8PA 3KAAA 3L3KA 3FO0H 5EO9B 4IRJD 1KLFA 1LK2B 2ICCA 1K8IA 3FT2B 1YNKH 5F7FA 2X4TB 1JHKL 1DLHA 4RAUA 4Y89A 2XOTA 4M62L 1FNGA 3IDGA 2EYSB 5DHYA 2APTA 3STZA 5I1JL 1I1AA 4KTDL 1NBYA 4Y16D 1R3IH 3BWAB 5EA0H 3NACH 3AXLB 3QRGH 1YEDA 4UU9B 3LY6A 2DL2A 5FHAL 3TIDB 5EBMB 1O5DT 3BP5B 4CMMB 3HAEB 3KYMA 4LLVB 2V2WB 5KTEH 5DZLA 3TO2A 2FIKB 3PP3H 4L3ED 3ZL4H 1MREH 2GCYB 2CIIA 3IFLH 1P69B 1I3VA 5E8NA 1A8JH 1ZLVH 1H5BA 2RFXB 3LEYH 5IM7B 1R5WB 4BZYA 3EYSL 4MX7A 3PJSA 1I8IA 1N2RA 4WUUB 4OZGE 4NQXB 5C8JA 3HHRB 4F7PA 3ET9F 3RUGA 1F00I 3CFEB 3RX5A 2VITB 1T89C 1WBYA 2DI9A 4U1SA 4ZS7L 4CVUA 4W4OC 3CU7A 4X4YB 4LHUB 4XVTH 3LD8B 4PJBA 3UC0H 5D1QD 3W2DL 1G7JA 5ESVA 5F3BA 4FQCL 5CBEA 2I60H 4RGNB 2NW3B 3DGGA 4HC1L 2IG2H 4MWFA 5F1KC 3QJHA 2B1HL 4L29B 1OGAE 1RUQL 2VRAA 1XH3B 5FYKH 3KPRE 1LD9A 2FGWL 2Y36H 2X9XA 2CD0A 1VFAA 1UEYA 2RR3A 4PRDA 3T4YA 1NBVH 3WCYA 3RL1A 4X9GA 1EBAA 1PZ5A 1QLFB 2DKUA 3V4PL 4NYLB 3F7YB 5K9KB 3C5ZA 2MHAB 2CLZB 1A1NA 5D5ME 1HXMA 2VL4A 2VDNH 3REWA 2NY1C 2DBLH 4XGZB 4DEPC 3SKUD 1BIIB 3PNWA 5EOCH 4GS7B 1MRDH 1U6AH 1YY9C 1EEUA 3N50A 4R97C 4HXAL 2DIJA 4OLZL 3AROA 5BOZG 1UCBH 1CICA 4FN0A 4F8QA 3GMOB 3HNTL 3MUGA 4JJHA 3T0EE 4Z77A 1G7IB 4IOSD 3HE6C 2PCPB 4UINH 3U7AA 2JIXD 2O5YL 1M4KA 1NFDF 1QACA 4LBEA 4Z7VE 1VKXB 3ZHDA 1L9MA 4NFBA 3WD5H 1EBPA 4S2SA 1ZT1B 4XPBL 1VADB 43CAB 1D5IL 1YEEL 2NCMA 2RGSA 3B2VH 1RZ8B 4IRSC 5F72S 4AQOA 3TH2T 1A7PH 3HMXH 2V17L 2EDXA 4D9LL 3RPKA 2F53D 3V9FA 4M00A 1P7QD 1XGRB 3PWNB 1DFBH 3T1WA 4XWOD 2CUHA 2UVFA 3IJSA 1KTRL 5C86A 4PRHB 1WZ1H 3DO7B 2X6MA 3OG4B 3VJ6A 5LGJB 1LDSA 1FNSL 3UMTA 1JI2A 4JG0L 5C07A 1AR2A 3UTSA 2A0LD 3DVIA 5F96H 3K1DA 2CDEB 4K23H 4PJEF 1YPZF 4GRLB 4PJ5B 4R4NC 3C5JA 3SKMB 4HKJA 1HH9A 2D0HA 1A21A 4Y1AE 4QXGL 2HTKD 3DUUA 1GC1L 3GRWL 2H8PA 3TJEH 4X6CA 3FB7B 3MRRA 4JFDD 1U8OB 4DUWA 4KKLC 2K9UA 5I16B 2V5MA 1MWAA 4NQCE 3L3GB 4M5ZL 3WIFB 3HUJA 4PJXA 3CVHB 3QUYB 5EWIL 3VXUD 3IAGC 3BKYH 4R96B 1ITCA 5B4MD 4HK3N 2J8HA 1CFQA 4OIBA 4X98B 3HE7C 2VLKE 4LMQE 5DRWB 4G7VL 3L95A 2HWZL 3SDCD 3T4AA 5IFHH 4LQFH 3P2TA 4WY7H 3RVXC 2QSCH 1QRNE 3MRFB 1FAIL 4NQSB 2GK2A 3KR3H 3SOBH 3WDIA 3PHSA 3H42L 3IFOB 1JK8B 2OJEB 3FQXB 1A14H 1I8LC 4OT1H 4OKVB 2WMPA 4U1JA 4LLUB 4M7ZC 1OT1A 1TZGH 5CJBA 2E9JA 8FABB 5B39B 4MJ6A 2XWBB 1S9YA 1OB1A 3RVVC 4G8IA 4J4PC 1YUHB 4OZIB 1ZSDB 1AP2B 2F54E 5K9JL 2NXZD 3D85B 2HJKA 3QFJD 3GSQA 3SCMD 3LKOA 2AV7A 4OBRA 4C4KT 5TGBB 5GRUL 4HCRA 3RWEB 3VGHA 2DLHA 1PLGL 4KGLA 3CMGA 3HFML 4UT6H 4EVNA 2D4DA 3R06A 4HIHA 3R4DA 2J1KA 3TZVD 3TCLA 4PY8I 4U6YB 4YHOH 5HI3C 4E5XA 3QEUB 1KTKE 4XVUD 3S88L 4XMLL 4Y4FC 1OWRM 1P6AB 2VLRA 5CKAA 3OPZL 5F7UA 2A83B 3CDGA 1G9MH 3QI9D 2NY3D 5ISZB 4M7KL 1P84J 4Q9CA 3T65A 3D0LA 2XG5A 2G5RA 5IKCA 1J0YA 3BSZL 4OV6F 5TDOB 3O2WL 5I1KL 1DANU 1ETZA 1IGTA 4YWGL 1B4JH 1IGCL 4JN2A 3TP4A 5JOPD 4C56D 2R29H 4X5XA 1OTTD 2Y23A 2DQIH 4OD1H 3MFFB 1F90H 2BC4B 3HR5A 1MPAL 5FGCE 4WHCA 3BDYH 3MACH 1I7UB 1MQ8A 1HINL 1UH3A 1F2XK 2VLMD 5H2BB 4OD3H 2HT4D 4YHPB 4DOHE 1ZE3C 4GQ9H 1Q0YH 4M02A 4XNUL 4X8JB 5I1IH 4X9BA 3MRCA 4ZQKB 3BQUD 3HNVH 1HYSC 2NW2B 4EEEA 1T7ZA 1T6VN 1AJ7H 5FO9A 5KJRH 3HA0A 5C0DB 1F42A 1FFNA 3Q48A 1A5FH 1DL7L 4DW2L 3WIHA 1WBZB 1I7ZB 1I8MA 1RZIB 1EAJA 2YMXL 3DX8A 3ZYIA 4IMLB 1AY1H 1U41A 2XQYG 5MEND 3GBNL 1ZGLA 4E9LA 4KDVA 1FN4A 2DB8A 1AHWC 1NJ9B 1S5HB 5JW4R 3MROA 4WV1A 4M7LH 3P11L 2ARWA 2BY2A 4TSBH 2PYED 3VFNA 1XGYH 5EU3A 3E8UH 5DLMH 2FL5A 1KJ2H 1PKQA 3RY6A 3RPIB 4GRMB 2OL3H 2LU7A 2ZOKB 4QRTB 4KQ3L 2I25N 4D9RE 3KNBB 3G5YB 1T04A 1KOAA 4X83A 2JCCF 2VJXA 4IRJA 2APFA 2BK8A 3P4OA 3E2HC 4WEBH 5DEFB 1E4KA 3ZDXE 2UYLA 2VLLB 3QO1B 3T3ME 1SEQL 1ZGLP 5HY9A 3MYJA 2NY4B 3P73B 4LCWD 3U0PB 2DF3A 2DDQL 3W9DB 5C0JB 2VDQL 1VGEL 2Q6WA 5TE6L 4Y16A 4NT6B 4KRPB 1WCQA 5I1LA 4NQEE 1K8DA 1HQ4A 4GAJH 5DC4B 1XGQB 5GJSL 2OM5A 5M7QA 2FX7H 1L0QA 4YHML 2ADIB 3ARFD 1AQDB 5I73C 1QSFE 5E24E 5CP7B 3T1FB 1G0XA 3LKQA 5ELIA 3P0VL 3GMPA 3K1KC 5GHWL 1NBZB 1E4XI 5E00B 5C0CD 1FNFA 4OI9A 5FHBH 1I7RB 1MFBL 4H1LB 4L3EA 1SYVA 2FEEL 4ZFFA 1R3JB 1I1CA 2ADFL 1GC1C 1OHQA 1U92B 1JPSL 4IOFC 5GPRA 1YYML 4WFFD 4KI5D 1M7XA 2J6EH 1I85A 4Z76A 4L4TD 3ZHKA 5HVFB 2R69L 4NPYA 2M1KA 1CDGA 3TVMA 5I1HL 2VB5A 3VRLF 4ELME 2OR9H 5E95B 2I07A 5D1QA 1XCQB 4YAQA 4UT9H 2CXKA 3LN5B 2NZIA 4M3JA 1BVKA 5IEHB 4AT6B 3B8SA 5DQ9B 1Q9OB 4O58L 1NGZA 2WQRA 2WWMC 2EXYC 3TT3L 2A1WL 3KXFE 4GSDH 5C9JB 2IPUK 1EUUA 3QUZD 3N85L 4N8VG 1ZLSL 5HDBE 4ZD3H 4HF5L 5HGBA 1NGQH 1UB6A 1NGWA 1YNTB 3VFOA 1CI5A 2R2CA 4GLRI 3VH8G 2KQNA 4WGWB 1Y6MR 2R2EA 5F97E 3G6DL 3CUPB 4Y4KD 4KK8C 1D5MA 2C3XA 3F12B 5C08B 1XF2A 4G6KH 3LD8C 4K7PY 1F4YH 2P5WD 4LIQL 3T0VA 1A02N 1TZHA 4E41B 4H25A 4WNQA 4YXHH 3BKCH 4ZSOB 3B4NA 1UJTA 3KJ4C 5E9DE 2AEQH 2FWOA 1N0XL 1RI8A 1IAIH 4K3DH 3HZKB 1KENL 5F6HJ 3VXPA 5FOBB 3K46A 1NLBH 3V0AC 1BJ1H 2JIXA 3QDGD 5FYKD 4JZOA 1H15A 3IVKB 2QADD 2R0WL 3AREB 2HT3D 1NAMH 5C0ND 3FO9B 3HG1E 5F9JA 4YIQB 3SQOH 1GGTA 3WHE1 1FL5B 2F53A 1LK3H 1P7QA 3ELAT 4GS7C 4ZOBA 1MLCA 1BZQK 4HS6A 4AQ1B 1T5WB 5L8JB 3K81A 5FUCC 5I17B 1H9VA 1F3JA 1ZOXA 1IM3B 2LAAA 5INCB 4YQXH 1TFHA 3DVGB 2DQFB 1UG9A 3LIZL 1C7SA 3BO8B 4JY4A 2PW2B 4WDIA 5DZNA 4HUWA 5ADOL 1C5CL 4LP5A 2PTVA 4PJHE 4PRAB 4Q6YA 3M1BA 4ZXBA 5IF0A 3MXWL 1IKFH 5ALBH 1JPFA 5E2UL 1MFDH 1RZKC 3K2UH 4JKKA 5T1KB 4NOBA 4U1GC 4FA8A 2FZ3B 4JFDA 5IB4A 4ALAL 1CDHA 3EOBB 5ICXB 4ZYKB 2FNBA 3Q6FA 2JK5B 4F7CA 2DQJL 2X9YA 4K3JL 1FNEB 1F11B 2VQ1A 4IMKA 4ODXA 4UT7L 3FKUS 3UBXG 2DQGH 2GUOB 5DMKB 2K7QA 5D96B 4OZIF 3VXUA 2UZIH 3O4LE 4HGWA 3C60D 3RWGA 4Z7QE 4LDEB 2F8XC 1T3FA 3DO3A 1TNMA 4FG6C 1WZLA 1D9KD 3VI3E 3ALWA 2X1PA 1DTUA 3RKPA 1N6UA 2J88L 3I9GH 2OR8A 5C2UB 3T8XA 3DMMC 1KPUA 1UXWA 1YMHA 5ACLA 1NGPH 5JDSA 1OCWH 3D69B 4URTB 1F6AA 4CMHB 1FORL 1J05B 3B9KD 7FABL 2IFFH 2H32B 5T5FL 2YEZA 4CUCA 4HPOL 3PABB 1C08A 5GGVH 4HKBA 5E4IA 1WT5A 4EDWH 3QUYC 4N0UA 4XBGB 1MFCH 2ICWI 1R0AH 4WI8A 1RJYB 2W92A 3MV11 2FJFA 3L3KB 3VCLB 3MR9A 2Z92A 4FQIL 2XZQH 3MODH 1K8IB 1SVZA 3QFJA 4EDXA 4GG6E 3SCMA 2B5IB 2R0LL 1P5UA 3VWJD 1P4LA 5KSBE 1DLHB 4O9HH 3TYGH 4RAUB 4NZUH 4DCQA 3UJTH 1FNGB 5C0AE 3IDGB 5E8DL 1QOKA 5DHYB 3FQUA 2LABA 4EXKA 4Z7UA 4IOIA 1NBYB 1WWBX 3QEGH 3WS6C 4F7EA 1DN2A 1XF5A 3O3AA 1YEHL 4FTVD 5DTFA 3TZVA 1AQKL 3BHBB 1YEDB 5IFAH 2NTFA 1E27B 2MMXA 5HYJE 4GKOA 4G6AD 4BQCA 5H8DA 2YN5A 3WIIH 5SX5K 1XGTB 3KYMB 5FO8A 2Y25A 5E2TL 1OP5K 1IC4H 3VXRD 2VZTA 2NY7L 2RHEA 3MXVH 3QI9A 2ESVE 3QNYA 4QRRD 4IJ3B 3TO2B 4BK4A 1JN6A 4OLVH 3MJ7A 1RVFL 2J3SA 4L8BB 2ITCA 5MERA 2CIIB 1AD0A 3ZE1F 5E8NB 1H5BB 4R8WL 1NPUA 1KCUH 4M7JH 2YPVH 4M1GL 4MX7B 3PJSB 3DRQA 4WI2A 1I8IB 1NUDA 5D2NA 2DTML 2VR4A 4WVRA 1LNUB 5C8JB 1F4WL 4F7PB 3RUGB 2UVEA 2R9HD 1N6QH 5DJ6B 3RWDB 1WBYB 5BRZB 2Q76A 5L2KD 1MFAH 2E6PA 3F5WB 5ESQA 4U7KA 4NM8H 4UIKH 1HOCB 5BOPA 4PJBB 1KB5H 4N0YH 1W72A 1G7JB 1BBDH 4MA8H 5F3BB 1UM5L 2W07A 3D0VA 5CBEB 3FB6A 3UO1L 3DGGB 4X6DB 1MJ7H 1PYWA 3BQUA 4MWFB 2DI8A 4XP5H 3QJHB 4NNPH 3OGOE 1MI5E 4YDIH 4OLWL 1VFAB 4KDWA 5TE4H 3UJJH 4PRDB 5SX5H 1OAYH 1PAMA 3T4YB 3CMOL 3RL1B 1QQDA 2EC9U 4X99A 1PZ5B 4KK9D 4YE4H 6FABL 4PGBA 4DZBA 3WLWC 3PHQA 4OLXL 3O41B 3H8NA 5MENA 1A1NB 2Z91A 3TIEA 1HXMB 5A3ID 5HI4C 3REWB 1KULA 5DJZA 3PNWB 2ZG1A 3I6LE 2YK1L 2PYEA 1X6NA 3V2AR 5F89A 3MUZ1 3STLA 1CICB 3LS4L 4PJ9C 1I3RA 2P24B 3LV3A 3MUGB 1T0PB 4RMRA 3SGJA 2HJLB 5DEGA 2D7TL 3DV6A 1U93A 2AABL 4LBEB 4OCYH 2UY7A 4S2SB 4BQ8A 1BWMA 1RD6A 5IGXH 5JHLH 1C16A 5D6CA 3PDDA 3I50H 1B88A 1DUYA 3GMRB 5C70A 1UKTA 4LCWA 3C6SA 2BX5A 3IJSB 4JQVA 2NQCA 4CVXA 4WTWA 2VYRE 4WJ5A 3KYNA 1I1YA 3SBWA 2ENSA 3VJ6B 2VXVH 2V2TA 4ORZC 3QNZA 1O7SA 3ARFA 5C07B 3UTSB 1TIUA 1DBJL 1GH7A 2AW2A 4ZUTB 4Z78A 4KQ4L 1RFDH 1KIQA 1ZA6A 3C5JB 4HKJB 1HH9B 4OZFA 3P0YL 2Y7QB 4JGMA 5JNYB 3DUUB 4V1DE 2H8PB 4KAQH 3EOAA 3MV8E 4YJZL 3KPQA 4L4JA 4X6CB 2VDKL 4NN7B 1W2KT 4KDTA 2H9GA 1FV1A 3RJQB 3VD7A 4HT1H 3UJIL 3S37L 4ONGL 5I8CA 4LOUC 4KRPC 4L4TA 3NZ8A 3MBEC 1LP9A 2FECL 3ME0A 3THML 4PJXB 4UI2A 2YRZA 1OGAD 1WVZA 4TRPH 2AGJL 3KPRD 1LO4H 3IDNB 3SE8L 2IANE 3LQAL 5E2VL 3QIWC 2H3NA 3V0VA 1HH6A 1T03H 3L95B 4DN3L 3T4AB 2X2YA 3B9AA 5MI0B 5LAXA 1J1XH 1X6LA 1YJDL 3MRDA 5F7EH 3PL6D 3MRJA 4I0PC 4F9PC 3QUZA 3RWCA 1W0YT 1KYOK 1TVHB 1Y0LB 4U1JB 3MLPA 1CCZA 3AS2A 4R26L 3RTQB 5HDLA 1AE6H 1S9YB 1X5AA 2P8MA 1OB1B 2OTPA 2VUOA 4G8IB 4Y4KA 4PRPB 5K93A 1M05A 1X5ZA 2DMBA 5FYJE 4M4RA 2C26A 2QSVA 3HB3C 4UQ2A 2HJKB 2Y07H 4LSRH 2P5WA 3GSQB 3MLRH 3LKOB 2AV7B 4ZPTA 5HHNA 1T21B 2CK2A 5DYOA 4P49A 4P4KD 4N5UA 3RBSA 1NANI 1U3JA 2EDOA 3VXSA 1DVFD 1SQ2N 2HLFD 4EVNB 1MIMH 5DUBA 3CLEL 2DLIA 2EKJA 3R06B 4HIHB 3I84A 4EBQL 5IW6A 1QFHA 1HNFA 3TCLB 3G6JA 1U8QB 2OCFD 3V4UH 3QDGA 2GSGA 4HGKC 1OAQL 4FQJH 4KHTL 3V52H 4U0QB 2VLRB 3FTGB 4QHMA 4RGOL 1JCKA 4X4MA 3EDKA 1R6VA 4XNYL 3NCJH 2VXQH 1IEAA 3CDGB 8CGTA 3DHJA 1NMCC 2MFNA 5T33H 3MRPB 3D0LB 2DQCL 1SBSH 4K3EH 4Y1AD 4R3SA 1ETZB 1T66C 1FYTE 2IMNA 4LSTH 2VXSH 4JN2B 4LF3A 4X5XB 1UH2A 1CT8A 3C8KA 1A1OA 3DX7A 1JGLH 4X5WA 5DEZA 1ZS8A 2YUZA 2XT1B 3HR5B 2EXWD 3L5JA 3MTRA 3NABL 5I1DA 5HGAA 4NOFA 4NQCD 5GRWA 3VXOA 4OGXH 4HUXA 1V7MH 3KLDA 2GIYA 3L3HA 3OHXA 1YNLH 4MCYA 3CFCH 4KV5E 4B50A 1JRHI 1RIVH 5IW1A 3QJFA 5L6YL 3FMGH 5LCVL 3MRCB 1T7YA 2VLKD 5DD1H 4AEHH 5EC1B 3T2NL 1BAFH 3HMXA 4M5YH 4TNWK 5FO9B 1DQJA 1FFNB 3SKOA 1QRND 1KJ3L 4R2GD 3S4SA 3MPCA 3CK0L 3C60A 1I8MB 4HMDA 4ODHL 4R7DA 3BJLA 4GKNA 1D9KA 2EE2A 5HGHA 1A7QH 2DLEA 2OJZL 5HI5D 1ZGLB 4Y0GA 1KCLA 1FN4B 4GAGL 3I3BA 5C0IA 3MROB 4JJ5A 4AMKL 4WV1B 4GKZA 3FT4A 4LRIC 3EYFA 3VFNB 1WITA 5EU3B 5F7NC 3B9KA 1N64L 2FL5B 5F1OB 4MNGA 1PKQB 3OKMA 3VFPB 1MOEA 3GGWA 3L9RA 3FONB 1S9KC 4RZCA 5DA4A 5FYLE 1A4KA 4H26A 1CK0L 1DLFH 2JELL 4XPFL 1M6OA 3TFKD 5BVJA 5L9DH 1ODAA 1T04B 3B6SA 1LO3H 3P4OB 4OLUH 4TQEH 3MCLL 1RSFA 3VWJA 3U7WL 4YHLH 5HY9B 3MYJB 5J56B 2P43B 3WFBH 1CLOH 4XP1L 3WS3B 1FZOA 1K4DA 2EIEA 2Q6WB 3AMKA 4Y16B 4FTVA 1JGEA 2FJGA 3ZE0E 5TH2A 3ESVF 5I1LB 2YXMA 1K8DB 1HQ4B 5CEZE 3VU2A 1DQTA 3LQZA 5C7XH 3NVQA 1NCCH 3GMPB 4MJ5A 4ZAKC 4RGNE 4MLIA 5D71H 3VXRA 1D5XA 5DVMA 1FG9C 4JO3L 4QRRA 1MHPH 5T1DL 3RAJH 2AJXH 4L3EB 4ZFFB 4ODSH 4LEXL 3K0WA 4GFTB 4CN6A 1I1AC 1MFNA 1TJGH 3L3OA 1A0QH 5DJYA 2XPGA 1V7NH 4FNLH 4FFYH 1XAUA 3O6FC 5K9OA 4NPYB 4NCDA 5GS1B 4KK6D 3VXNA 2R4RH 4I13B 3MLXH 1AI1H 5E08L 4MD0A 1AH1A 4HUKB 3TVMB 2HT2C 3OAZK 4EN3D 5L2KA 2OK0H 2EEBA 2I07B 4S1RH 5D1QB 2DQHL 1U8LB 3LQAC 3U0TA 1ES0A 1BVKB 4D3CL 4UDTA 4GXVH 3SE3A 1I9JH 1NGZB 2YHGA 3GMMB 3RU8L 2MWCA 1H5BC 2XZCH 4CRPA 1F3DJ 1LDPL 3S34H 3CU1A 5HGBB 1UB6B 1NGWB 2VOTA 1KT2A 3VFOB 4J3XA 1SY6H 5C6TH 2R2EB 2VWEE 3Q5YA 4YEFA 1MRFL 1QBLL 1INQA 2ZCHH 1D5MB 3SDDB 5LWYH 1XF2B 1L9NA 5T3ZH 4LLYA 3TF7C 4D9RD 4U6XA 1HIML 2APWA 4PRHE 1TZHB 3GO1L 5A2IH 4WNQB 3K8KA 3WFEL 4YFEA 1JNJA 5A1AA 1CGVA 4OJFL 4UQ3A 4KKNA 5JDJA 3U4AA 2H2SC 3DYPA 4C58B 3RY5A 4HMCA 1RU9H 3OAZH 1HSBA 3VXPB 1U8PB 3QIUD 2XRAH 5HJ3A 5HHMD 2B7DT 4YGVA 3BN9D 1MJUL 1XR9A 3GMQB 4LFHD 1V3KA 4JZOB 1DQDH 5DO2D 1FLRL 1H15B 3ISWA 4NQED 4XHJD 3CJJA 2HMIC 3C5ZC 2VQTA 4X6CF 4DK6A 5CAYB 4XP6L 4JPVH 1EHXA 1JGVL 4X6EA 1KN4H 1MCDA 1CLYL 1QSFD 2OZ4L 4Y8AA 1QBML 2P44B 5I6XB 1QYGL 2F53B 3EJYC 2DJUA 1P7QB 4JFQA 3BP6A 5EBWA 1MLCB 4HS6B 5HDQL 3HUJF 5F8RC 1FO0L 4RFOH 4HUNB 5H37G 2W60A 4G7YH 5HXMA 1CICC 4WENB 3BDXA 4NN6B 1F3JB 3VW3L 3S5LG 4NDMA 4CDHA 4JY4B 3V7AE 4HUWB 1JBJA 3TJHC 3WHXA 1KJ2A 2R2HB 2J7LA 1IAKB 2OL3A 4OZGA 5FYJH 3M1BB 1EX0A 1KNOA 2NX5A 4ZXBB 5IF0B 2HKHH 1JPFB 4NZRH 3WJJA 5E5UB 2DM3A 4M1DH 1EUTA 3RL2B 4JFDB 4KJPC 5IB4B 1G7LA 3Q6FB 1DZBA 1G6RL 2CPCA 1ZV5A 3GZKA 4F7CB 4KY1H 4O5LL 1FGNH 2VQ1B 3SPVA 3V4VH 3GI9H 3RDTD 4PB0H 4NHUB 1CGTA 1YDPA 3B8YA 4AH2B 2Z9TA 4YFLF 5KSVA 1JWUB 3KXFD 1DN0B 3VXUB 4AIZB 1OGAA 4HGWB 2AJYH 3NN8A 1T3FB 4FQ1H 4GW4A 3KPRA 4FHBD 4GRWB 5L7XL 2WLYA 4LSPL 3T8XB 1KPUB 2RCSH 4BZ2L 4HWZA 4FP8H 3TO4D 1A7BA 5JDSB 4R90H 3EFFB 5FM5O 3PL6A 1ACYL 5BXFA 1F6AB 1Q38A 3SQBA 1PJ9A 1IGIH 1TJHH 3QG7L 3TPUA 1WV7T 2YEZB 4ZO6A 3C9NA 4JN1H 1ZANH 1T4KA 4HKBB 4YR6A 2D7MA 4N0UB 4U05A 4P23D 2J6EA 2CKBH 5E9DD 2ADGA 3KPLA 4HFUL 5I30L 5ISZE 2E7BA 1NCAL 4CBPA 2FJFB 1RAMA 2P1YA 4P5TD 1L6ZA 1TETL 3MR9B 2Z92B 4GMSH 2EZ0C 5JIIA 1NBQA 4YUEL 5B38B 3U6RA 4NSKA 3U2SA 3VMPA 4Z7VA 3SGEI 4P4KA 1U8NA 4YHKL 3WV0A 3FQUB 2FO1A 4FQXB 4Z7UB 4X0KA 4IOIB 3HG1D 3EYVA 3LZFH 4U6VH 3FZUD 4F7EB 2Q1EA 1DVFA 3O3AB 3BMWA 4BELD 2GJJA 1X5FA 1UYWL 3TZVB 2IPTL 2IAMD 1BQLL 1TVDA 1X9QA 4KTEL 3VG9C 3OKYA 4N0FA 1U58A 2NTFB 5DMJB 3BIKB 5FB8B 1T2XA 4TUJA 1EH9A 4ODBD 2JJWA 5SWZE 4XVJL 3FO2A 3CLFL 3MOAH 4ETYA 2O5ZL 4WTZA 5FO8B 2NY2B 1NFIA 2W9EH 3QI9B 4L8DA 2NY3B 1JN6B 3MJ7B 2F19L 2Q8BL 3P77A 1WZKA 2ITCB 5D7IE 5MERB 4XCFH 1UWXK 4Y1AA 5CIPH 2VQUA 5MEOA 3KDMA 1YEGH 2HFTA 3DRQB 2IC2A 5D2NB 5J3HD 4KPHL 1S3KH 1AXTL 1HNGA 5FYLH 1FE8L 5FCUH 1MCKA 1A9EA 1OWWA 5CS7A 3C2AH 2ATKA 4PYHA 4U1MB 3J8F7 3UTTB 3QQ4B 3TH3T 4NQCA 2F58L 5ESQB 2X9WA 2UWEF 5IVXF 3GSRB 4GBXD 1W72B 3O4LD 1LO2L 4I9WE 4OSUL 2WBJD 3D0VB 4XTRC 4Y88A 2X4NA 3FB6B 5TQ2L 1PYWB 2W65A 1MUJA 2BRRL 1NAMA 2VLKA 3BQUB 4KMQA 4WCYH 4RISL 3NCYP 2HJFA 4XPHL 1QRNA 5CEZH 5CSZA 4QTIH 5C0GB 2MNUA 1MQKL 3TBYA 4HWEH 1QQDB 1U8MB 1RHHA 4IRZH 1NCWL 2X4RA 2XA8L 4JRXD 4B41A 3SN6N 5MENB 2Z91B 3V7MA 3MLSH 3X3GL 1UWXH 3DVFA 3MV9E 3TIEB 5MEQB 4KUCF 5DJZB 1T1WA 4ODVL 4I1NB 3KG5A 2R1YA 4F58L 2PYEB 4G80A 5F89B 1XF3A 2OS7A 3STLB 5EG6C 2W9DL 4YGAB 4JZJC 3LV3B 5C0AD 2IALB 4OCRH 4M8QA 2R0KL 4PLJC 5E4EC 1LGVA 4XI5C 3DV6B 3B2UD 1U93B 2DMCA 5KANG 3DUHA 3O4OB 4TULH 5D7LD 5TE7H 3BAEL 5ANME 5T3XL 3MQIA 5D7JD 1C16B 5D6CB 1TPXC 1BECA 2MJWA 1FH5H 1DUYB 4XMPH 5C1MB 1LO0H 2GT9A 4YX2H 3C6SB 1EGJH 4L8SA 4CVXB 1CXHA 2ESVD 4HS8L 1EVTC 1P1ZB 3KYNB 1I1YB 2V9RA 5DFWH 1WAAF 1UB5B 5I1GH 4OB5H 1ED3A 3ARFB 2ZPKH 5CMAB 4OTXH 43C9A 3QYCA 4Z78B 2BFVL 2N1KA 2VZ3A 1KIQB 1EFXD 5AWNH 1ZA6B 4OZFB 3ZKXB 5CD3A 4TUKH 4NRXA 2EDRA 4G3YH 3I02A 2E6JA 2R2BA 3QHZH 4IRJC 1AGFA 3DECA 3EOAB 1E4KC 3KPQB 5JR1L 2VE6B 4G9DA 1FV1B 2IH3A 4CAGA 4P9HL 1JGDA 1Y18A 1Z3GL 1BFVL 1FPTL 5I8CB 4RFEA 5ACZA 3NZ8B 3CFIC 4KZEH 1LP9B 3T77B 4JKPH 1H8NA 5HPOA 2KBGA 1UH4A 5M95B 4EN3A 2H3NB 3V0VB 4E41E 1HH6B 4BH7B 4LVEA 1NCBL 1WEJL 3O3DB 3JTSA 4OCSH 5A16A 4BYHA 2BDNL 3PGFL 5LAXB 1ZHKA 2IMMA 1JYWA 4FQQA 1WFUA 3CVHH 3MRJB 3ZO0A 3QUZB 1NL0H 2QQNH 3RWCB 1S7UB 3PV6A 2G60L 3DGCR 3LHPL 5BV7H 3HC3H 3QULA 3TC9A 4ENED 1XEDA 1U2HA 4ZUUA 1J86A 5GIRA 3I6LD 3K4DA 1UJ3B 2FEEI 3MCG1 4LSDA 2VDMH 4Y4KB 3P0GB 1FNHA 1M05B 5HVWA 2BY1A 3FFDA 1CD1A 5CGYD 3RKDC 1FVCB 5JW4M 4UQ2B 3VD5A 2CH8A 5D1QC 2P5WB 1R3KA 5CBAA 1DSFL 3EO0A 5E2WH 4YHZL 3LMJH 5HHNB 2QKIB 3A67H 5F6HI 3WDJA 5DYOB 3CGTA 3B9DA 4LSVL 1ZEAH 1TTUA 1QKZL 1KB5A 4NQVB 1OM3H 2V9QA 3VXSB 2QHRH 2PNDA 4KVNH 3CSBA 4JM4H 5D2LF 4HUVA 2HFFB 4XP9L 3LN4A 1NAKL 3EOTL 4JREB 3RWIA 4P2YA 5F44A 5IW6B 3RI5F 3BN3B 4NHCH 3G6JB 4BSWB 3QIUA 3JWDL 2EIBA 4UOW0 4WW2A 3QDGB 1HI6A 4OQTH 2QQKL 4Q6IA 3SKNB 4AEEA 3WO4B 4NQEA 2QADB 1IE5A 2O26U 4QHMB 5DK0A 4F57L 5EUOF 1IEAB 3I6KA 1QPXA 4P59L 1QNZL 2Y5TA 4HK3J 5T1MA 1N6VA 3EO9L 5J11B 2X89D 2H26A 5HHPA 5I8KH 5D6DA 1A9BB 1YEFL 4OKDA 2ZJSL 3H3PL 3HAEG 5T3ZD 4V1DD 4NC1E 2RQ8A 4LF3B 5JXAH 3MV8D 4QHLA 4XRCA 1CT8B 3C8KB 1KTLA 4W6WB 1A1OB 2GJ6E 2CO7B 1N4XH 1U91A 3NMEA 4X5WB 1ZS8B 2HRPL 3D18A 4L4VD 3KPMA 4I3SH 4NGHH 5I1DB 5HGAB 1FL6A 3GI8H 4JPWH 3VXOB 4NBZB 3EKCA 4HUXB 4NO5A 5J06A 1GOGA 2PKDA 3VFRB 3NGBB 1MFEH 1BX2A 3L3HB 3OHXB 4APQD 1RZGA 5E7FA 3U7YL 1GAFH 2VXTH 3QJFB 5IW1B 2Q3AA 4ELMA 2IAND 4LHUG 4A2MA 1V8HA 2Z8WC 3IFNL 4XWOC 2HP4A 1Z9LA 1DQJB 5T1LD 3SKOB 3T04D 3U0WL 1PKOA 3RDTA 3S4SB 3LKSA 4NN6C 4LSUL 1Q0XH 1RULH 3FJTA 5E8EA 3C60B 3NTCH 2A0LC 4GLRH 1D9KB 5HGHB 3PE9A 4AG4L 4HS3A 5GJTH 3QUKA 2HTKC 4Z7UF 1KCSL 3MYZA 1CXFA 1BFTA 2F5BL 3EGSA 3NIFF 4GKZB 2MCG1 5D9SA 4EQ2A 3TO4A 4KGJA 5FYJD 3EYFB 1L7TL 3A6CL 4TN9A 1RQ5A 5JHDE 3GUTB 4MNGB 4IMKC 3OKMB 3GGWB 2YD9A 3L9RB 4RZCB 4ONFH 4H26B 3OWEA 1M6OB 3D1MC 2X1OA 5B4MC 5E9DA 5BVJB 5KVEH 5EU6A 4M43H 3B6SB 4TOYL 4P5TA 4P46B 4RMVA 2DJ4A 3SDCC 4YK4B 3OV6A 3NCYS 1IGYA 1JYXA 3DROA 3MRBA 3UCRA 4A6YH 1K4DB 3OXSB 5DJ0A 4WU5A 3HG1A 1FC1A 3RUGE 3HLAA 4Y5XA 1JGEB 2FJGB 2GEEA 3QIBC 5TH2B 2WZPD 3U30B 4AK1A 3LEYL 1MCEA 5BRZE 1N59B 2NXYD 1WWCA 5KVGH 2IAMA 4JVUA 3VDBA 3QO0B 1DUZA 4M4PA 1WT5C 1FYTD 4Z8FL 4J3WA 5I66A 2DLFH 1GYAA 1JNHA 5KG9A 4MJ5B 4R4BA 4K07A 4KJYA 2NXZC 4X6DE 4LARH 3LAFA 3WNOA 2AJVH 4QRRB 3ULUL 5D1XD 3SCMC 4PLOB 3ALPA 1IKNA 3EFDL 2LU4A 4P2OD 3ZTJG 3MRQB 3ULVL 4DK3A 3L3OB 5DJYB 1FG2A 3EDFA 1F2QA 5K9OB 4MCZA 3AAZA 3QXDB 3TZVC 1KCVL 1NDGA 3VXNB 1MRCH 4MD5A 3EOYG 4HEME 3VFSA 3WUWB 1BZ7A 4XVUC 2A77H 3CPLB 4RX4A 5L2KB 2N56A 5AYQA 1ITBB 1FCCA 4NKDB 4JCLA 4NJAH 2X1XR 4GBXA 1R5IB 1AGEA 3O4LA 1P9MA 3U0TB 1ES0B 2NY3C 5DJCA 1G9NH 4I8DA 3H9YA 3M8OH 2XKNB 5A2JH 4UDTB 5ACMA 2NY5C 3QFDB 1WC7A 4Y7MA 3QISA 4QTHA 2B20A 4BFEA 2HFEA 1RIUL 2A73B 1JL8A 3ARRA 2G5BA 5D1ZD 4Z0BL 4JANA 4ERSL 4ZUSB 1OTTC 1ZAGA 5HHVL 4DKAA 1EJOL 5D2NC 1OAKH 1KT2B 3KHQA 3QQ9D 1CFNA 4ONHA 4H8WL 3RY4A 3MLYL 2XIDA 1H0DB 4OAWB 2XZZA 1DE4A 3O2VL 4B7LA 1INQB 5E8OA 3TT1H 4JRXA 4NN5C 2IWGA 5FYLD 3QP3A 1OAUL 5B39G 4LLYB 3OKEA 4C57C 2AV1B 1HZHL 3BQUC 4JHZA 2IEPA 3PWLA 4QOKD 1MCOH 4GG6A 5C07E 5KSBA 1EO5A 4J6RH 3RHWK 1C7TA 1HSBB 3QUML 4M6MH 4OFPA 1E4WL 3I85A 4KJQD 5HJ3B 3QQNA 1X4ZA 2YR3A 1XR9B 4K2UL 3R8QA 1BQUA 4I77L 4BJLA 4JB9H 4IM8A 5EZIL 4Z9KB 2Q3ZA 3TEUA 5CEZD 5D7LA 5GGRY 4LHUD 4X6EB 2BOBA 1M7DB 4QHKI 5D7JA 3OKNA 1ZGLM 4LSSH 4NP4H 3UEZA 1IQWL 4HJ0D 1RZ7L 3BPOB 2QLVB 1F58H 4EOWL 3DRTA 1DDHA 3BP6B 4RGND 3DI3B 1L6XA 4PJXE 5EOCJ 2KPNA 1CIDA 4EIZC 2X4UB 2ESVA 5FUOH 1J5OH 4LKCA 2W60B 5TDPA 3HI6L 4H20H 4AZ8A 2DOCA 4N90E 2FATL 5DR5H 2ZKHL 1RIHH 1MJ8L 5DRXB 1EFXA 1GZQB 5FO7A 4YHYC 4OZGB 4LCCC 2NX5B 2QJDA 1NUGA 3PG2A 2SEBB 1A7RL 4MNQD 4Z95L 4DN4L 4OUUB 2GITA 1CTOA 3G6AA 4PV9B 4ZODA 1FDLL 3O45A 1ORSA 3WEXA 3BKJH 1NUNB 1CE1H 1KEGH 4JQVC 4DQOH 4FMKA 3WFCH 2HVKA 1LE9B 1TTFA 3SPVB 4HMEA 2PR4H 4HLZH 3BISA 3SBWC 2VDOH 3QR2A 4PRPE 4HH9B 3MGTA 5CGTA 5KSVB 3ARFC 5E5MA 2BSSA 4G5ZL 1OGAB 3Q6GH 3JWOH 1OF2A 1P2CB 3EZ8A 4GW4B 3KPRB 2JJVA 1FIGL 4EI5D 3ORJA 4TVPL 5CSBA 5EDXA 4FXGA 3ULUF 1MF2L 2YD1A 3P9LA 4Q58C 4LLMA 3KYOA 5D7KE 4KDTC 3W5NA 3ULVF 3U36A 3PL6B 5BXFB 3I75A 1KC5L 4NZTL 3TPUB 4PRHD 1FIEA 3KPSD 3TWCL 3B5HA 1T4KB 3QZWG 5B3NA 2VLRE 2DTSA 4YR6B 4ISVA 5HVHB 2Y5EA 3PWVB 4Q9RH 3C6LC 3EO1A 2ADGB 3KPLB 3P4MA 1N8ZA 2DQDH 3EW3B 5HHOB 4MXWH 3R0MA 5JUEL 1Y6NR 3F7RA 4HBCH 3U6RB 1GGIL 2FECI 4NSKB 2H2PD 1X7QA 2EH8H 3U2SB 1G9ML 4P4KB 4JDZA 2H32H 1U8NB 4XZUB 2FEDC 1A6ZB 4XP4H 5CLWA 1F8TL 3BESR 3QBTB 4X0KB 1YQVH 3EYVB 3GB7B 3S35X 3L5WA 3QUZC 3UDWA 3LEXA 3MLVL 4XVSH 3VFGH 1EMTL 4N0FB 3ZYZA 3GSNL 4HV8A 4TUJB 3HZMA 4NUGL 5AYUL 1ZHBB 4Y4KC 3FO2B 1KGCE 5IK3A 3MACL 1J1PH 4JO2L 3RX8A 2FB4H 3ZDZF 1SY6A 4L8DB 15C8H 3P77B 2X89A 4PGJA 2B4CL 1C5BL 4N68A 5I1CL 3RNKA 2N4IA 5HTSA 4V1DA 3U4EA 3KDMB 5EU5B 3MV8A 5J12B 4DTGL 1QFWH 2GHWB 4H1LG 3BRDA 4E42A 3GK8H 4WO4B 4L4VA 1A3LH 3BOVA 1EV2E 2ATKB 1KLGA 3VXTA 1HDMA 3ZKSD 3WO4C 2QADC 3P4LA 2RJMA 4P2QD 2HT3C 4PJAE 4QHNA 5C0NC 1OAXL 4APQA 1JNNH 3D85D 3O3BA 1NCDL 3RZCC 3DXAA 3PQYB 2IANA 2X4NB 2CJUH 2WUCL 4HXBL 1A6UL 4L1DA 1VDGA 1PKQE 2W65B 1MUJB 1RUPH 1NAMB 3X3FH 3QHFL 2HG5B 4ZO7A 1BM3H 2HJFB 5T1LA 4ZFOA 3BFOA 4OGYL 5A43C 1ZXQA 1II4E 3V5HA 4P5KA 2R56L 4PRNB 3TBYB 5DJDA 5FM5M 1RHHB 1TLKA 5H94A 2O5XL 1MH5A 2CK0L 3PGDA 1FGVL 4K9EL 2XKUA 3MA7A 3NGBC 3H7BA 3VXQA 5ISZD 1T1WB 3HN3A 4M1CD 4M6NL 5DGQA 2I9TA 2R0ZL 2HH0L 3BEWB 5E99H 2ICEA 1XF3B 2IBZY 2NYYD 5AEAA 4GG8B 1L7IL 3MRNA 3WXWL 1KN2H 4IHOA 5KSAB 4IDLA 2R39A 3DETC 4Y4HD 3W39A 4M8QB 4ODTH 5DT1L 2KZ1B 3UTQA 1IFHH 3C60C 5H35A 4PLNC 2GI7A 1EK3A 5LGHH 4XAWH 1QVOA 2MSPA 3QT2A 4FOMA 2Z31A 1JPST 2R1XA 1AD9A 1B0WA 3ROOA 5FFLA 2BVEA 2AK1L 5SWZD 1CE6A 3CC5A 3GIZH 3MZTA 3V0WL 1V05A 1OLZA 4XPGH 4RWYL 2COQA 4GJTB 3S6CA 1T2QH 5IMKA 1ZVYA 1FBIL 4L8SB 4IEFB 1MLBA 4R0LA 1RHFA 3B9KC 5F9AC 2AXFA 4PB9H 5CUSL 5TDNA 1S7TA 1FFOB 3L5IA 3S3JA 1ADQH 4PFEA 1G1YA 1RV6X 1ND0A 1T5XA 5J9PA 1BZ9A 1FYTA 4ZNCD 4Z7OE 1LO5A 3IU3A 5CD3B 5A40E 4NRXB 3I02B 2R2BB 4XPTL 1AGFB 3U9PH 2CKBA 5D1XA 1JHLH 3VWJC 4G9DB 1JRHH 2IH3B 5I18L 3GBMH 1A7OL 4P2OA 1NMBL 1JGDB 5BMFH 4X7TA 4DOHB 4NUJA 4PGZA 4I9WD 1Y18B 1CBVH 1G7QA 4RFEB 3DTXA 1BF8A 2A9ML 3ECBA 1E4XL 2YD5A 2DD8H 2CUMA 1C1EH 4FQ2H 3EIFA 3PDOA 4JHWL 1J1OL 4D9QD 2BVTA 4CVWA 3TN0C 5LG1A 4EN3B 4G6AC 4D8PB 3RP1A 4J3SA 2C1PA 4DKFL 4TSCH 2J4WH 1B2WL 5BVPL 2CXGA 3MLZL 2VLJE 4YH6A 3LOWA 4G6JL 4PLKC 2LAGB 1AC0A 1LK2A 1U95A 2DQUH 2YPKA 3ZYOA 3JTSB 2CKNA 4YXKL 5A16B 4YFLI 1ZHKB 2BHUA 2P45B 4NQUA 4PGCA 5I0DA 5EIVA 3MV9D 5D1ZA 5DI8A 3F58L 2QBWA 4LAQL 5HYFA 3NH7H 4ZUUB 5GIRB 4JAMB 5CIPA 1S9VA 2Q7YA 3OAUH 2R9HC 4BFGA 4O02L 1S5IH 3H0TA 3VG0L 3TIDA 1PSKH 2AP2A 1XT5A 2W9LA 3FFDB 2VXUL 1NSNH 1CD1B 2VIRA 2F53E 4CMMA 1R3KB 4K3HA 3EO0B 5CBAB 4RNRA 5HDOA 3QXVA 1KB5B 3SE3C 5D72L 5FKPA 4QOKA 1LK3L 1G9MC 4HUVB 3LN4B 1R5WA 3K3QA 4JFFB 2B8OT 3QIUB 1RK0A 4KTYA 1IGFL 5HHMB 5ID1B 1MVUA 4WW2B 4OZGF 5I15H 4Q6IB 1HWHB 4KK9C 4NQEB 5CCKH 3GNML 1OPGH 4KVCL 4XCEB 3I6KB 3T09A 2Q7NA 1MCPL 2Y5TB 5A3IC 4AEFA 2H26B 3RQ3A 4LRNH 3CVIH 2ED9A 2AJUL 1FZKA 3IU4L 1Q72L 1NUFA 2E7MA 3NCBB 4UILH 4HW6A 3WHE0 4FZ8H 4QHLB 4XRCB 1DBBL 1KTLB 2E6QA 2X42A 3EYUH 4OM1H 4GRWE 2EYTA 1X5GA 3KPMB 25C8L 4HAGA 2IPKB 1JVKA 2J12B 1FL6B 3MRMA 1JHKH 3C08L 1T0NA 1S7VA 1BJ1J 4M62H 4NO5B 5I1JH 2MHAA 4RMSA 2CLZA 4KTDH 1TDQA 4MNQA 1JP5A 5D5MF 4R6UA 4ELMB 1MCWM 3BPOC 1J8HE 4JO1L 1N7ML 1BIIA 4E41D 2YUXA 4I0KA 5FGRA 1GGYA 4N0UE 5FHAH 4N8PA 3FOMA 4QRUA 4RFNC 2P5EB 2ZOLA 3LKSB 4MA1C 4FQLL 3F6LA 5DHXB 2LTQB 3GMOA 1EGJA 1B6UA 5DS8A 4MB5A 2X4PA 4JM2D 5GGVL 4DGYL 1QSEE 2PO6D 4EDWL 2UZYB 4EI5A 5CZXD 1U8JB 4D0BB 4HS3B 4Z7VF 1VKXA 1VACA 3ARED 4CU6A 3MBXL 5TF1L 4XC1L 4UTBL 4E0RA 43CAA 3EYSH 1M7IA 1RZ8A 3EGSB 2B2XL 3WJJC 2YA2A 4Q74A 2C1OA 1YEIL 3TYGL 1XGRA 4EIGB 3VFWA 1I9IL 1OAZL 3HS0A 2R1WA 4PYGA 4ZS7H 4PRHA 3KPSA 3FN9A 2GKIA 1FFPB 1JUFB 3BD4A 1KXQE 2VUYA 3KLAB 3L5XL 3QWRD 5GGQL 3V6ZA 1MCNA 3W2DH 3OR6B 5LGJA 2QQQA 3UZVB 4L3AA 5EO1A 5E9DB 2FHBA 4FFWD 1BFOB 1TQCB 1W8NA 4FQCH 4P4RA 5EU6B 2CDEA 3VDAA 3BIAX 4P5TB 5JTWA 4QHUA 4HC1H 2R4SL 2B1HH 1RUQH 4JRYE 1NCUA 3DROB 1QFPA 3MRBB 3W0WB 3LB6C 3QA3B 2FGWH 2ILLA 3FQWA 5DJ0B 4WU5B 3PL6C 2IBBA 3ETBF 3HLAB 4AJ0A 1LE5B 3V4PH 1SHMA 3UTTE 4KI1A 2IAMB 5GS2H 3NBNA 3CFJA 4WRLA 3CVHA 1D5BA 3NIGE 5HVHC 5I66B 4R96A 4BQ6A 4M3KB 1JNHB 2GJ6D 3TA3D 3O0RL 4R4BB 4OM0L 1PG7L 2AEIT 4LK4A 4GUPA 3T0EC 2BVQA 5BO1L 4HXAH 2DM4A 2ZSVB 1F45A 5E2JA 4OLZH 1MSPA 5DVLA 3UTOA 3HNTH 5TFSL 4J8RA 2X7LB 4LPUA 1DVFC 2HLFC 2O5YH 1QA9A 4MCZB 3AAZB 4I4WB 2XZAL 2D2OA 3LRGA 4CN4A 4MD5B 1D5IH 1YEEH 3FN0L 4ZO9A 4MHHG 5KOMC 8FABA 1XIWD 3IGAA 2V17H 3MCKA 3O9WD 4D9LH 3VD4A 5DQDL 4P2QA 4GBXB 5K59E 3D85A 3QEQD 3TCXA 2PYEE 4OQTA 5JMOC 5DJCB 1JF5A 1NQBA 3E6HB 4HUUA 2ICES 4S1DC 1FNSH 4QTHB 5F9OL 4ESKA 4JG0H 2G5BB 4JANB 4UBDD 1AGDB 1JF1A 5HD8D 1R3HA 4RAVA 4JFOB 4WHTA 4YFDB 1CFNB 3QDHA 3BJ91 3C09C 4QXGH 4S0SD 4DKEL 3GRWH 1GC1H 1FNAA 1DE4B 5FA3A 2EXWC 4LIQE 5DQJA 5JHDD 4I2XB 4JRXB 4YBLB 1UWEL 2FHCA 3OKEB 3MGOA 2BY3A 4U0RC 1XR8A 3LH2L 4ETQB 2EDNA 2DICA 4M5ZH 1HHIA 5DC9B 5CZVL 4WUKL 1L0YA 3PWLB 5FDWA 4HQQL 2D03L 5ESAB 2E9IA 4LGPB 2XV6B 4PTUA 3ROLA 4R2GC 4KROD 1EERB 1UADC 4Y4HA 1HK6A 1TCRA 4G7VH 1S8DA 2HWZH 4DUXA 1I8KA 5GRJL 5J1SC 1X5LA 3MLWL 3OJDA 3OXRA 3INUL 1U8KB 4QF1B 5BRZD 5FYJU 1I7UA 2WWKO 5D7LB 1FAIH 5HI5C 2BOBB 5D7JB 3OKNB 1ZVSA 1UM6L 3H42H 4JR9L 5DUPL 3BPLB 5GS0L 5DD3L 5EO0A 4KI5E 3NCMA 5SWZA 4RCAA 2HYMA 4X8JA 1DDHB 1LP9E 2X70A 2NW2A 2XTJB 4LQ1A 4LKCB 5TDPB 3MLUL 5D7IA 1CL7L 1NEUA 5GRVK 5AZ2L 4ZS6D 5K9JH 3HZYA 3MRHA 3S9DB 3TFKC 1VFMA 1IT9L 1IMHC 2X10A 5GRUH 1RZIA 5GGRB 1EFXB 1AC6A 5FO7B 5GGTL 3P9MA 4MZ3A 2L0DA 2PXYB 3PHOA 1PLGH 3HFMH 1H3PL 1NEZA 1ZT7A 4WWID 3OB0K 1CN4A 3O45B 2PTTB 3WEXB 4Y5VA 1K6QL 2OP4L 3AB0C 1AXSA 3L3JA 4L8SC 2HVKB 3S88H 4XMLH 4A6YA 2B1AL 3DUSA 4DAGL 1WFNA 1KB9J 3MGTB 3OPZH 5IV2A 5E5MB 4GRMA 1NDMA 4LLWA 1OF2B 4ZFGL 4M7KH 2P5WE 5TQ0L 1RUKL 3KNBA 1DQQB 2FJHA 2NY1D 3BSZH 2EH7L 3B3IA 2DLTA 2XICA 4FXGB 5I1KH 4YWGH 3UTPE 1IGCH 4PJCA 3VXSE 1YY9D 3WMSA 2CRIA 3KYOB 1TMCB 3ZDXF 3QO1A 4XCYA 1KACB 3T3MF 3U36B 3P73A 3G6JE 3I75B 1MPAH 3MV9A 1A6VL 3QDGE 5FYKE 4U6TA 2ERJB 1HINH 4W81A 3I2CL 5SWSE 4KK6C 5GZND 4WI6A 1AQDA 3L6FA 2DJSA 4MD4A 4XNUH 3EO1B 5TF0A 5CJXA 3P4MB 4BSVB 3WFHA 4KHXL 4U1IA 4EN3C 1JYVA 2A6IA 3OB0H 2R8SH 1IC1A 4NRYA 5FDYA 3N0PB 4XBEL 5E00A 2JF1A 1X7QB 5JXEA 4L9DA 4BM7A 1I7RA 4PREA 3VA6A 1DL7H 5ANMA 4DW2H 1MHCA 1YECL 3L5WB 4PY7B 2YMXH 1FRGL 5E6YA 4RMQA 4N9GA 3A6BL 4KKCD 3GBNH 1BEYL 3VI4E 1IL1B 3AFLA 3HZMB 3GHBL 4YEEA 1QLEL 3HKFA 4ELMF 4NZDA 3P11H 2WANA 5GXBB 4N90D 1XZ0A 4HWUA 4KKLD 3FFCB 4QCIA 2ICWA 4DKDC 3LPFA 3RNKB 1RIVL 1S7RA 4AT6A 1DJSA 4NO0D 4V1DB 3U4EB 3HC0B 4KQ3H 3MV8B 1I1FB 3WNMA 4OFDA 3BKML 4QXWA 2OTUA 2AK4E 5HDBF 4E42B 5FEBA 4L4VB 3QIUC 2VTFA 1CGSL 1KCRL 3BN9C 1KLGB 2XNAA 3VXTB 4WI7A 3IXTA 1HDMB 2EIDA 3RTQD 5DO2C 1SEQH 4XHJC 6CGTA 1RUAL 4PRPD 2DDQH 3F12A 4OV5A 2VDQH 5IQ7L 1VGEH 2DQEL 3ZKNC 5TE6H 3FQRA 5JORA 3BZFB 3DXAB 4W6XB 3PGCA 2IANB 3D3VE 4PP2A 5GJSH 1EAPA 4O51A 2IADB 4MNGE 2AQ3A 3EYQD 4KKBD 3FCTA 4NFDA 5D6DC 4WU7A 4E41A 4YHMH 4PJ8D 4LKXB 3JTTB 1LEKA 4ZFOB 3P0VH 5D7KD 3FT3A 4JY5L 4TPRL 3V5HB 5I1EL 4P5KB 3KVQA 5DWUH 5GHWH 4RQQA 3JXAA 5DJDB 4GMTL 4JM2A 3ES6B 5J6HB 2PO6A 1MFBH 3OGCA 5D70L 2ADFH 4KFZC 1BWWA 1MH5B 3PGDB 1JPSH 3AREA 1FAKT 3CZFA 1BPVA 2Q8AL 3H7BB 3VXQB 1YYMH 3QDAA 1LEIA 4OCNC 1QD0A 4PJGA 1GGBL 3O6ML 3LDBB 4X7SL 4PG2A 2C3VA 2R69H 4NQDD 2I9TB 3GJFK 2ICEB 3BI9X 1IC5L 3DSFL 5I1HH 1A64A 3D39E 3MRNB 4IHOB 4QRPE 3EHBD 3QWRA 4RDQF 3F7VA 4Y19B 3RDTC 3W39B 4GW5B 5CEXA 2WP3O 1SYSA 2D0GA 1IM3A 2E7HA 3UTQB 3CSYA 3DVGA 5H35B 2VAAB 4QRRE 4L8CA 5C2BL 2LVCA 5IBUB 3RJDA 4O58H 4LHQB 4PRAA 3TT3H 4NWTH 1QVOB 2A1WH 4PJHF 3IJHA 1SMAA 2Z31B 3N85H 2R1XB 1ZLSH 3ROOB 4HF5H 1CE6B 3CC5B 1EIBA 4MXVE 1KGCD 3TNMB 3ZTNL 3MRIA 4PG9B 4NZJA 3RAJL 3TO4C 4UDUA 1IQDB 5GS0C 1MLBB 1OSPL 1LEGA 2AXFB 3G6DH 4KRLB 4M93B 5TDNB 3QSKB 2NXYB 5F9WB 3ZLQC 3U1SL 1V7NL 1T5XB 1BZ9B 1FYTB 1UVQB 5DMKA 5IB3A 4LIQH 4P23C 1BIHA 4Z7QF 1LO5B 3TA3A 2GJ6A 1PX4A 5JW3L 3PIQA 4U2ZA 3GKWL 5LBSL 3IU3B 3VI3F 4X9FA 4P5TC 3GJFH 4I48B 5D1XB 1N0XH 2ATPA 4MXQD 1KENH 3L7FA 4LVNC 1QFOA 3L3IB 3UYPA 3IFPB 4NO3A 1NLDL 3CSPA 4X7TB 4NUJB 4OCWL 3HMWL 4Y5XC 3DTXB 3SO3C 4ZO8A 3U9UA 3ECBB 3O2DL 1UACL 3I3EA 2H32A 3NZHL 2R0WH 3FRPA 2IAMC 1I9EA 1MCJA 2E27L 4J3TA 1XIWA 4XBGA 5GGTA 3O9WA 2QQLL 5GS2D 3UP1A 2A38A 3O3EA 5JMRA 4FQHA 4JPKL 3VCLA 4HZLA 1U95B 2YPKB 3QEQA 4I3RL 1JTOA 4N0CD 4GG6F 1YMME 4X7DC 1IKNC 3SJVE 4LU5L 5KSBF 3BYYA 4MJIB 1NGYB 4PGCB 5GRXG 3LIZH 5D1ZB 5DI8B 2ZUTA 5ADOH 2VH5L 4CKVX 1WIPA 1D5ZA 2CDGA 1C5CH 1WQVT 2IQAA 3MA9L 5DJ8A 5J3HC 5EBGA 5DRZA 5CIPB 4XX1E 1S9VB 3BYTA 2Q7YB 5B3JE 1QEWA 3BHBA 5BJTB 5KS9B 3MXWH 4XNXL 4HBQA 1E27A 1Q94A 3H0TB 4YPJA 5JHDA 5E2UH 1U0QA 4Q97A 2C3GA 4N8VB 1T20A 2VIRB 3QXWA 4ALAH 5HPMB 4GBXC 1XGTA 4N8CL 3N9GL 4RNRB 1P9MC 4DWHA 1I7TB 2WBJC 4UT7H 4L8BA 2XWTA 3GIVA 1INDL 2AEWA 2HVJA 5FKPB 4QOKB 1UZ6F 5KVDL 2ZCKL 2KDGA 2QL1A 1OVZA 1HCFX 4MZ2A 5F3HA 1W8OA 4GXUN 1RK0B 2J88H 1MVUB 3DBXA 4FXKA 1LNUA 1RK1B 1S9XA 5D7SL 2NX5E 1D6EA 2DQTL 3MNZA 5DJ6A 4GQPH 3HR6A 3RWDA 5BRZA 3TVMD 3F5WA 4B5EA 1HOCA 3WFZA 4HIXL 1FORH 7FABH 5T5FH 5JQ6L 1WTLA 2G75A 4HPOH 3MV7E 4NZRL 1FZKB 4X6DA 3RA7L 3BWUC 2D31B 5IHZB 2OXHA 1X5KA 4M61A 1Z2KA 1KCKA 2EYTB 4W6YB 1YN6A 5I9QB 3C5SA 2YUWA 1QBBA 2VZOA 4IDJL 2VABA 2YS4A 2R0LH 3B2UC 3MRMB 1T0NB 1S7VB 3HC4L 5E8DH 4K7FA 3SDDD 3O41A 1UWGL 2WWMD 4MNQB 2XACC 3ZT7A 1YEHH 3BPLC 3DWTA 2APXA 1WICA 3ARBC 1AQKH 1XMWA 2BOCA 1TITA 1WF5A 2VLJD 3QCUL 3FOMB 4QRUB 4LNVA 3ZT5A 2ZOLB 4JKLA 1YEKL 5HHOE 2P24A 1MNUL 3QG6B 5DS8B 5E2TH 1KBGL 2X4PB 1F13A 2NY7H 2HJLA 2YD7A 3NAAL 4ELKA 4TTGA 4EI5B 1RVFH 3EJJX 1ADQA 1VACB 3GSUB 1RMFL 4R8WH 1WSST 4F33B 1INEL 4M1GH 4E0RB 2DAVA 1M7IB 4ORGA 5KAQF 2DTMH 3GMRA 1ERNA 2W0FB 3WKML 2C1OB 1F4WH 3VFWB 1J0KA 1RZFL 5EU4A 3RVWD 3HS0B 2R1WB 3WLBA 3HE6A 3KPSB 1V3JA 2Z4QA 2F74A 2K7PA 2V9TA 2BRQA 3V6ZB 5DMGD 1EO8L 4C55A 3AU1A 1GHFL 1ZHLB 5EO1B 5ECJE 1UM5H 4P4RB 4ZUTA 5GQBA 4F7TA 3UO1H 4QHUB 2JJSC 4K94L 2Y7QA 3FHQA 1T83A 5JNYA 3NOIA 3GEWB 4I18A 4ZXBD 5CP3H 1BLNB 2VISB 1BP3B 4MA7L 4OLWH 4YDLB 1ZKAA 4PGDA 3FQWB 4HJJL 1E6OL 5I0ZA 3CMOH 1QTYT 5JA8B 1QFUL 4D0CA 6FABH 5HYSA 1QUNA 4OLXH 4ENEC 3CFJB 1D5BB 3MC0A 2NTSP 5BV7B 3EBAA 3IDNA 3PQYE 4FZEL 3CD4A 4GUPB 5CGYC 1DBAL 2YK1H 2BVQB 5DMYA 3RIFK 3DX6A 3LS4H 4CVZA 1EZVX 4WWKB 4OZFG 3SDXB 2AJSL 4NO0A 1LMKA 4MQTB 2KUTA 4J8RB 2D7TH 3MJ9L 1FL3A 1VFOA 1QA9B 2AABH 4XCCL 5I71C 1I9RL 3UDWC 1OD7A 1J8HD 1TVHA 1DBKL 2FCBA 4F37F 1Y0LA 3JWNC 1K5NB 1DEEA 3PP4L 3RRQA 3IGAB 3RTQA 3MCKB 1NFDA 2VR9A 5IHUL 2C4FT 4P2QB 4PRPA 3FB5A 2HFGL 4L5FL 4ZUWB 5ITFA 1QSED 4YDVB 1VFUA 1T21A 4FFZL 4HUUB 1PY9A 4HK0A 2BCKA 1FJ1A 4PJ8A 4FQXD 3W9EA 5CSGA 1DBJH 1MY7A 4HG4K 4KUZH 5F88A 1JF1B 4KQ4H 2KQMA 1R3HB 4X9IA 5DMIL 4RAVB 4WHTB 5GGSY 3P0YH 1WGOA 1CR9L 1S9WB 5FA3B 4GW1A 1OW0A 1U8QA 5DQJB 2V2XA 3DNKA 2J8OA 2VDKH 2ZUSA 3FTGA 2RB8A 2MCPL 3UJIH 2NY2D 4APQC 3S37H 3MGOB 1XR8B 4ONGH 4IIQA 5A2LH 1HHIB 3MRPA 4NQDA 3THMH 4PS4L 4JGUA 5FDWB 2VSDA 3BPCB 4JRYD 5JA9A 1MCRA 4QXTA 2AGJH 5BQ7A 2BNUA 4PTUB 3SE8H 3RIAF 3LQAH 5E2VH 3ROLB 5AD0A 4Y4FA 4Y4HB 1TCRB 2UWEE 3UBXI 1WLHA 1S8DB 4DN3H 4XB7A 1I8KB 5GRVL 1NCNA 4UMGA 3OJDB 5IVZA 2VDRL 3OXRB 3UTTD 1T6WA 1YC8A 5IWLC 1YJDH 1N5YL 2XN9B 3GM8A 5C3TA 1RZKL 1ZVSB 1A6TB 5EO0B 5I19L 4KV5F 5SWZB 3LDBC 3VRIA 1L4IA 2X70B 3ARDD 1CDBA 5SX4I 4HWNA 4OLEA 1BOYA 4R26H 5EC1A 3AC0A 3RVUD 3TBTB 3OKKA 4V2CB 5D7IB 5I8OL 3PWJB 1KJVA 3HZYB 3MRHB 4KZEL 3MO1A 4U3CA 2APBA 3W81A 3VGAC 2G9HB 3WNKA 1NGXB 3ILQD 4PY8J 3P9MB 2D9QB 3PHOB 5DJ2A 3MLTA 1RJZB 1NEZB 1ZT7B 3CLEH 2OBGA 4EBQH 4Y5VB 4HC1A 4LVOB 5IFJA 4PJAA 1AXSB 1PQZB 3L3JB 3X11A 4R0LC 1IGML 1OAQH 4KHTH 4LCIL 4MA3B 1U42A 4M93C 4JLRA 4A6YB 3DUSB 5F1NA 2NXYC 3VFPA 3M45A 3P4NA 4RGOH 5IV2B 4XNYH 3FONA 5JW5A 1NDMB 4LLWB 1O0VA 3GBLA 4C83A 3B43A 4ZDHB 1AHWA 1IVLA 1UFUA 2DQCH 2FJHB 1W0VA 2ZCLL 3S4SG 2OYPA 3B3IB 4PJCB 2AVGA 5D1XC 2MQCA 4HUMB 4XCYB 4JFFE 4P2OC 3WS3A 1ZEAL 3MV9B 5HHME 2C4XA 3SY0B 3NABH 4NWUL 4U1HB 4ODUB 5J6GA 3ZE0F 5ID0A 2YUVA 1HILA 4S11A 3ZYJA 4PJDB 3L6FB 4MD4B 3WFHB 4U1IB 1BFSA 5L6YH 2WIMA 5LCVH 2A6IB 3F62A 1UEMA 5CINL 4NRYB 3E6FA 5AAWA 3T2NH 1P4IL 3MOBH 2BNQD 4Q2ZA 1HKFA 1AO7D 4K94C 5KW9L 3IJYB 1KJ3H 4PREB 5ANMB 1MHCB 3CK0H 4DGVL 5D1ZC 3ARXA 4ODHH 3T08A 3T3PE 4N9GB 3QQ9C 2OJZH 4NKIL 2PYFB 1U2CA 1JZ7A 5C09E 5GS1A 3CXHK 1UT9A 4GAGH 3R1GL 4AMKH 1MAML 3RWHA 2FR4A 1IILE 3GRWA 1UM4L 1X5IA 5DFVD 1XZ0B 1N64H 1T22A 5KVFL 1U8LA 4QCIB 4UV7L 2ICWB 1MCIA 5IQ9A 2VNCA 2P5EE 4X7FC 3A6OA 1S7RB 4H0HB 3KYKL 1CK0H 2EECA 3MBED 2JELH 3GMMA 4HLJA 4XPFH 4UUJA 3LS5L 3CH8A 2OTUB 4X4ZA 4Q9QL 1QP1A 3IS0X 3NFPB 4KJQC 3UXFA 4CN1A 5ABDE 2H41A 5FM4A 2ARJB 2XNAB 3MCLH 3IXTB 3U7WH 3SE9L 5LKNA 4XP1H 3SDDA 4OV5B 2JCCA 5IBLD 3GMLA 3C87A 3FQRB 3RWFA 5JORB 5D2LE 1AFVL 4RBPK 3PGCB 1MEXL 2X40A 4PP2B 3CX5J 5F6IB 1EAPB 4O51B 5HYEA 1BMGA 3OJ2C 3FCTB 4S0TD 4WU7B 4RGNC 4XH2A 2VLJA 1FFRA 3UTPD 3L1OL 3VXSD 1LEKB 1B3JA 3FT3B 4PJIB 5EU6E 5MHSE 2AI0L 4RQQB 1U8PA 4JM2B 5EUOE 1WWWX 4JFZL 3BVNA 3QQ3A 3ARWA 4JO3H 4PV8B 5I9QC 2PO6B 5T1DH 2JKXA 3GMQA 3GHEL 3OGCB 4LEXH 2B0SL 3W0WE 4JFYB 3CZFB 5SWSD 2C7UA 4DVRL 1LEIB 3KPOA 4PJGB 2BHYA 2C3VB 1HEZA 1G0DA 1PDKA 1JPTL 1I1RA 5E08H 4KK5C 1V5JA 1Q9WA 4MQ7A 4QRQB 2H6PB 3F7VB 5CEXB 5T3XE 1SYSB 2DQHH 3KWWA 3CSYB 5CJ5A 5JOEA 4L8CB 2WUBL 4D3CH 4EI5C 3HI1B 4RBPH 1L0XA 3ARTA 5EUKA 2R2HA 3RU8H 4KMTL 4O4YL 3K8MA 4LGRB 1IAKA 4JZNA 3IJHB 1T66D 3O8XB 2VWEC 1LDPH 2GY5A 5IESL 3MRIB 4Z7WB 4UDUB 3RL2A 1LEGB 3QRFM 4P9ML 1MRFH 1QBLH 1HHHA 2VDLL 1T1ZA 5CLTA 3ZE2E 5GSVA 4QNPE 5HYQB 4NHUA 4U1LA 4AH2A 4LP4A 1KJMA 5IB3B 4TNVK 1JWUA 1DN0A 5E8PA 4AIZA 1HIMH 3KS0J 4HAFA 3TA3B 5J57B 2GJ6B 2AK4D 3PIQB 3GO1H 1X3DA 3WFEH 4GRLC 2MPAL 1VENA 3B9VA 2IGFL 4OJFH 2ATPB 2H2PC 3C8DA 5DHVH 5IVNA 3L7FB 3BT2L 3NCFB 4AYFA 4NO3B 3Q5OA 1EA9C 2IJ0C 4Z0XA 3EFFA 1MJUH 4JDTL 1FLRH 4RIRB 4Y2OA 3U9UB 3D3VD 1J8HA 4I2XE 3I3DA 4JRXE 4XP6H 1JGVH 5B8CB 5CGMA 5F7WC 1J9CT 3S97C 1SJHA 1CLYH 4NNXB 1X4XA 2OZ4H 4HDIA 1XIWB 4HJGA 1MAJA 1QBMH 3O9WB 5BV7C 3QDME 1QYGH 3O3EB 4FQHB 5HDQH 2DRUA 4HZLB 3X13A 1FO0H 3QEQB 3WN5A 4P46D 1QSEA 3SDYL 3K2MC 5B38A 4R9HA 3VW3H 3W11D 5L0QB 1IEBA 3VWKD 1A6PA 2HTLD 4FQXA 3CXDL 1J0ZA 4PIRF 4OF0A 1D5ZB 1ZWIA 2CDGB 3OKLB 2IQAB 3ARGD 4QRSA 3E3QE 5DJ8B 4G8GE 5DRZB 5HBBA 3OX8A 3SO5A 3BUYA 5D7LE 2WBWB 4NIKB 1QEWB 5L8KB 4LDOB 2KZWA 1Q94B 5JHDB 4KKAD 2P47B 3D39D 3BIKA 4QRPD 5FK9A 5FB8A 2F8VA 1J87A 1ONQB 1MJJA 1T20B 4GAFB 4G8EA 4OZHB 3T0BA 1K2DB 1G6RH 4Q0XL 1HN1A 1PG7X 1BHGA 4O5LH 2XTJE 3WS6A 1BF2A 3R8BB 3O6LL 2XWTB 3GIVB 5JLZA 1Y6KR 2EDQA 2HVJB 5JPNA 1XF1A 4JRYA 4J12A 2I9LA 2F5AH 5F3HB 4KROB 5L7XH 2L7UA 4ZAKD 1FNLA 3DBXB 1S9XB 4FXKB 4LSPH 1D6EB 3BH8A 3F8UB 3MNZB 2OQJB 1E6JL 4U1MA 3UTTA 4Y2DD 4BZ2H 3QQ4A 3T0DA 3GSRA 5ETUB 2ICWJ 1ACYH 4LGSB 2Y06L 2AEPL 1S7QB 3QG7H 2G75B 4OF8A 1DEDA 2FRGP 4M1CC 5BZWA 1VCAA 3ARDA 1NMAL 4WTZG 5GZOD 5FUZL 3O6FD 1M71A 3MJ6A 4G6FB 1GXEA 1KFAL 1F6FB 3BE1L 4JFPA 5F93C 2BJML 2NYYC 3DJ9A 4PP1D 5HGDA 1A7NL 2DKSA 4HFUH 5I30H 1JZ6A 4M61B 4YBHA 1NCAH 1FSKB 2E8YA 2HT2D 2WAHA 1TETH 4Y4HC 4F2MA 5C0GA 4YO0A 1YN6B 3C5SB 1CDCA 1AR1D 2VABB 4YUEH 1OP3K 4BQ9A 4PJFE 1OP5H 1U8MA 5CJOL 3SHSA 2EC8A 2UZXB 4YHKH 4K7FB 2L7JA 4R4FL 2EDDA 4WFED 3S5LB 2OSLA 1R24A 4UTAL 5MEQA 1UYWH 4MDJA 2IPTH 1BQLH 4KTEH 3QDJE 2BOCB 2Y72A 2Y6SD 3NFSL 5DD5L 1X5YA 3QNXB 5E03A 1OSZA 1YMMD 4XVJH 3SJVD 4G8FA 3EDEA 3CLFH 1JHTA 2O5ZH 2A74A 2EDWA 1VHPA 2IALA 4ELKB 2YA1A 2F19H 2BSRB 3CZJA 2Q8BH 2NY1B 4DEPB 5EIQA 3KJ6L 5HGGS 2FYYA 1TENA 1CL7I 5JQHC 4ORGB 1K9TA 4NCC1 4TSAL 4KPHH 1AXTH 4Y5VC 1FE8H 4LVOC 3GJFA 5EU4B 3WLBB 3HE6B 2F58H 2Z4QB 1P1ZA 2F74B 3DLQR 2WQ8A 2BERA 1UB5A 3AU1B 5DJXB 1JMXA 1LO2H 1IAMA 5CMAA 1KIRA 4U1NB 4OSUH 4IRSB 1TJIL 3B5GA 3V6FA 1OARL 5CJQL 4F7TB 3TNNA 3FFCE 2GJZA 5TQ2H 2C5DC 2BRRH 2KKQA 4M9OA 1YY8A 3EJYD 4BFBD 5T3ZE 1ZTXL 2BNQA 2NX5D 4I18B 4RISH 2X1QA 4W70A 1AO7A 4XPHH 4PGDB 3I6GA 3JV0A 1JPGA 4JFEB 3S35L 2VE6A 1MQKH 5FECA 2NY4C 4L4VE 4J3VA 5IMMB 1JI1A 1NH6A 1NCWH 5K9QI 4D0CB 1VERA 5HYSB 2XA8H 2LVEA 3MV7D 1MHEB 2X5PA 5EORL 3WE6A 4KZDL 3X3GH 5B21A 5ADPL 4OGAD 2EDYA 3T77A 3ULUE 3NA4A 4FFVC 5AUMB 5CJXC 3DXAE 5TPWL 4F58H 1TNNA 3ULVE 4ZPVA 5L88L 4AM0A 4L9LA 4BH7A 1MCLA 2WINA 4EUPH 3DX6B 4CVZB 3O3DA 2W9DH 3GFUA 2FLRT 5ALCL 3MBEA 4NO0B 2CJUL 4HSQA 2R0KH 3D48R 4WTXA 1FL3B 4I3GA 5C0EA 1S7UA 2YPLE 3BAEH 5T3XH 3QIWA 3N1MC 3HE7B 4WEUD 1DEEB 1UJ3A 1RUMH 1E0OB 1NFDB 1IRAY 5F8QC 1ZT4B 3FB5B 4NRZB 5HHOD 5IROA 3CNKA 3N1QC 5ITFB 1FVCA 4HS8H 4HFWA 4F9PA 2QKIA 1BVZA 2FX8L 4HK0B 1AXIB 2BCKB 4Y19E 2BNRE 1FJ1B 1SMOA 4NQVA 4PJ8B 5FA4A 3W9EB 5F88B 2BFVH 2HFFA 3TYFA 4ZOAA 1GOFA 3DARA 4J3OC 1I3GL 4RMUA 5ENWA 5ILTL 1A6WL 4GW1B 4BSWA 3QXAA 2V2XB 3SKNA 5JR1H 4P9HH 1RPQA 5SWSA 1KELL 2NR6D 1Z3GH 5AG8A 1DQLL 1BFVH 1FPTH 3TH4T 2YBRA 4IIQB 1HSAA 3S8WA 5JIKA 2BVYA 4NQDB 1EXUA 1A9BA 2XQBL 3T0WA 4K3GA 4QXTB 5GGSB 5D8JL 5BQ7B 2BNUB 3VFTA 2EICA 5F7DB 5AD0B 4Y4FB 1OTSC 2EDTA 4WO4D 1FZMB 4JM2C 1NCBH 3OMZA 1WEJH 5IVZB 1C12A 2V7HA 2V5RA 5LQBL 2YRPA 3JV4A 4NQTA 4A2LA 2BDNH 3PGFH 12E8L 1P6FA 5BCAA 3ARVA 4Z7NE 3AREC 3ARYA 3VFRA 4LFHG 3WYRA 2G60H 3LHPH 3VRIB 4PG2C 3PQYD 1JHLL 1QPPA 4QYOA 1Z5LA 4M48L 2CO6B 3OKKB 3K7UA 4RAHA 1B4RA 3H9SB 1KJVB 4LPWA 3S36L 3MO1B 2DD8L 1DSFH 4YHZH 1C1EL 4POYA 1QHPA 2AK4A 4LSVH 1QKZH 2FBOJ 1LILA 5DJ2B 4MJIE 3X14A 3MLTB 3BD5A 3JWOC 4XP9H 1SJXA 1NAKH 3EOTH 2DQUL 5HHXL 5ITBL 5E94B 1VEPA 1EEYA 5IFJB 4PJAB 3JWDH 4MSWA 3X11B 1MWAL 4YZFE 5CP3A 5KS9E 2QQKH 1Q9KA 4JLRB 5F1NB 3D3VA 3GUTA 5KSAD 4TVPE 4BK5A 3P4NB 4F57H 4NC1C 1CZ8L 4P59H 2LU3A 1WZMA 1QNZH 5D96C 5IB1B 5JW5B 5C3LD 3EO9H 3T2OA 1U8HB 1J10A 4C83B 1AHWB 3TA3C 5DUML 2FX9L 3QPQD 5BS0E 1W0VB 1YEFH 1RURL 4CJ1A 2ZJSH 1MVFA 3H3PH 3MRLA 2P7TA 3FB8A 4P46A 3S3PA 3GSVA 4QOKE 1EEQA 4JQIL 1B9ZA 1IM9B 2HRPH 2Q86A 4LSQL 3VWKA 5MP6L 3G5VA 2BSTB 3OXSA 3QXUA 3RUGF 3FOLA 4CMHC 5J6GB 3ARGA 5ID0B 3AUVA 1KXVC 1N59A 1QBAA 1HILB 1C5DA 3QO0A 3QPXL 1LWRA 4POZD 3VFVA 4PJBF 2GK0A 1Z0MA 2CDFA 3U7YH 2FIRT 3D39A 3E2HB 4QRPA 2NNAA 5E1AA 2PETA 3V6OE 3E6FB 3IFNH 3IDXL 1IC7L 4HCRL 4Q2ZB 4ODWA 4X6DF 3PP3K 2DWDA 1UKSA 3U0WH 3VXME 2B5IC 3G5ZA 4RRPA 4WI4A 4LEOA 1TCMA 4LSUH 5L0QC 5IT2L 1JYNA 2OTWA 3MRQA 1ZLVK 4BZ1L 5I73B 1JFQL 5HD8C 2W0LA 1I3UA 4AG4H 5IR1A 3QXDA 2NY0D 3OG6B 4ZAKA 1KCSH 3QCTL 3Q1SL 4MNQE 3IKCB 2F5BH 2H1PL 4HPYL 3WUWA 1H3WM 3RWHB 3CPLA 4Y2DA 4QGYA 1E28A 1VB9A 1H3GA 2R15A 1BQHA 2FR4B 1L7TH 3A6CH 4NKDA 3K4ZA 3PWPE 1R5IA 2PTUA 2QR0A 1T22B 1OTUD 1N26A 3AVEA 1IBGL 4KUCD 4WI9A 3V5KA 1F4XL 4RDQG 4IJ3C 4ZG1A 5IQ9B 3SKJL 2XKNA 3O6FA 3QFDA 1B90A 4OCXL 4FABL 1VPOL 4UUJB 2A73A 5K9QG 1A1MA 4ZUSA 4LASL 4TOYH 1GPOL 2CIKA 4KROC 1CD9B 4F80A 1H0DA 4OAWA 35C8L 4MNHB 1BGXL 1ZK9A 5KANI 1XGPB 4K8RL 5IB5A 2JCCB 4PUBL 3GMLB 3RWFB 2AQ1A 1MIEL 1MCWW 5C71A 4TTDC 3OL2A 3KPSE 5DDHA 2E9BA 1WJ3A 4XH2B 2AV1A 1FHGA 2VLJB 4Z8FH 2XQYK 5GISL 1YMMA 3NA9L 3SJVA 3WIHL 5LXGL 1FSKC 1YEJL 1IARB 5FXCH 4JFFD 4RSVA 3CIQA 4ZS6C 2EE9A 3BVNB 3QQ3B 1RJLA 3ULUH 5E0QA 3RKDD 3ZSSA 3K8LA 3BGMA 1GJIA 2MTPA 3EFDH 5DSCB 5C0RL 4P3CL 3ULVH 2C7UB 4HD9A 3WXVH 3KPOB 1M7DA 4U3XA 2BZDA 1HHKA 2CMRL 3KJ4B 3UZQA 1HEZB 1KCVH 4C59B 2JB5L 2BSED 1CLZL 3CDYA 4PJXF 1HHJA 2X4UA 2WW8A 3TM6A 4MQ7B 1Q9WB 1PW3A 2IH1A 4QLRA 3KWWB 5E1HB 4OLYL 3X17A 1SEBA 2VN7A 3MNWB 1RZJH 3HI5L 3DYMA 1T2JA 5EUKB 4OCLC 2C3WA 4O2CB 5DRXA 1GZQA 3SDXE 5KVMC 1BVLA 4JZNB 5C09D 1RIUH 1G6VK 2A9NL 4Z0BH 4ERSH 5T5NF 3O6KL 2SEBA 3EDDA 3SGDI 4OUUA 5HHVH 1EJOH 2APVA 4XMKL 2ZP0T 4JG1L 2BHZA 2IBZX 4H8WH 4PV9A 3MLYH 2ID5A 1GL4B 3BZ4B 3O2VH 4FXLA 5IIEA 4KXZI 1LE9A 1HHHB 1T1ZB 1UQSA 3MV7A 5GSVB 2P5ED 2ORBL 4PBVC 4U1LB 4P2QE 1KJMB 4HH9A 5GZNC 4EZMA 1OAUH 4CADA 5E8PB 3D87B 5IVOA 1P2CA 4XHQA 3QUXD 1HZHH 3DIFA 4U1GB 5IHLB 4ZTPL 2H45A 1KLUA 1T83C 5DRNA 3O3UN 4HIJA 4I18C 4OFKA 4HWBL 4NJ9L 4BFIA 2X1WL 1CFTA 3QUMH 4NN7C 1E4WH 5LVEA 1CLCA 4Z0XB 4K2UH 4I77H 5EZIH 1J8HB 4J3UA 2MQ0A 4KKCC 1SJHB