5JOFA

Crystal structure of vrc03 ghvglv antigen-binding fragment.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
220
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARRGSCDYCGDFPWQYWGQGTVVVVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Somatic Hypermutation-Induced Changes in the Structure and Dynamics of HIV-1 Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VRC03 gHV heavy chain
total genus 33
structure length 220
sequence length 224
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jofA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jofA01
5C0DA 1DUYA 4KTDL 4JR9L 4OLUL 4NC2B 5CS7A 3VFSB 3OKOA 3EUUA 3RA7L 3IT8D 3S88H 1AGDB 1G7JB 1KC5H 2AJXH 3PABA 3X3GL 1S5IL 4M5ZH 4PRHD 2ORBL 4Z7QF 1X9QA 2QADB 2NNAA 5C0IB 2EDFA 3QO1A 3W0WA 5BS0A 4FABH 3S9DB 3HE6D 3MLTB 4UMGA 3V6OC 5FGRA 1MFCL 1UKQA 3EYUL 4Y88A 5DYOA 1KT2A 3CDYA 1GOHA 5TQ2H 5D7SH 5FYLE 5HHVH 5DUML 1MFNA 5C7XH 4NQSA 3ALWA 1NUNB 1UJTA 3V4PH 1P7QD 1XR9B 4IJ3C 4U1SA 1R3KA 4ZXBD 5KVDL 2Z93A 1BECA 3U48A 1SHMA 4XVUC 3BW9B 4Y5XA 1BX2B 1ORQB 2IPTL 1RUQL 1SJVA 1I3GL 4OLWL 35C8H 3MRCB 4HS8L 3HAEG 3INUH 1FVCB 3EFFA 3WDJA 1RJZA 5DA0B 5E5MA 3P4MA 3MRQB 5HHQB 4MNGA 4UV4L 2EXWD 3I02A 4GQ9H 3B83A 1OGTA 4X5XA 1NBYA 2IMMA 3NGBB 4KROB 4BQ8A 2PYEE 5FYJD 4F7TA 4ZO9A 4KQ4L 1Z9MA 4F7MA 4FFZL 2ZUQC 5FM8A 4OT1L 3QDJD 3CFJA 4HIEB 3RVUC 1XR8B 3L7EB 1MPAL 5FO7A 2I9TA 4XTRD 2ESVB 1MUJA 4QXUL 4YDKL 2VDPH 4N0CC 3EOBA 5CLTA 3DYOA 3FB7B 2MQ0A 1QLFB 2ZCKH 5EULV 4Q2ZA 3STLB 1JVKA 5FECA 2NX5A 3VD5A 3LOWA 5F1SA 5DGRA 1NCUA 2FYYB 1A3LL 1VFBA 4O51B 3ARZA 4RZCB 4QXUH 4CMHB 3IFOA 1NSNL 3ZE1F 2IQ9L 3KDMA 5BO1L 4QT5A 1A6WL 4PJ9D 2V9QA 1T2QL 4OCWH 2ZG1A 4OSUL 1EVTC 1H3TA 2UWEA 2XN9A 15C8L 4HLJA 4LPYA 5DHVH 1T2QH 4WHTB 4TRPH 4BSVB 3UTSE 2WBJD 4POYA 4LSRL 2WLZA 3GIVA 3EOTL 2BNRA 4CKVX 4JKKA 4XGZA 2BP3A 5A2FA 2C4FU 1CIUA 3GMRA 3MXWL 3NH7H 4FQ1H 4L5FL 5TH2A 1ROWA 1T0NA 3ARED 5E00B 3O3AB 2Z31D 4KVNH 4MA1C 3QXUA 3PP4L 2HG5A 3RP1A 3UPCA 1VDGA 3NZ8A 4JO2L 3GMOA 5A1AA 1RZKC 4YNYB 3FO2A 1RUKL 1MCHA 3MXWH 3NH7L 3V52L 2DLIA 1K6QH 2FO4B 4OFDA 4GG6B 1G7MB 1OAKH 2VDML 4ZFGL 4P3DA 4BYHA 4FN0A 4DVBB 2WLYA 1GGYA 1BFSA 1H3VA 3UJJL 6FABH 3IJYB 3KJ6H 4Y2DA 4XNYL 4X6CB 3GMMB 3KPLA 2R1XA 1PX4A 1BFOA 3UTTA 5CJXA 1DLFL 1HXYA 3SKUD 1JPGA 1LO0L 4NQTA 3T0EE 3PHOA 3J8F7 3DRTA 4MNQE 2C4XA 1K8DA 5IJVB 1I3GH 4MXWL 4ZXBC 5DC0A 5HHNB 5F9JA 2MNUA 2QQQA 4JDVA 4XHJC 4FQXD 3MNZB 4PV9B 3AAZB 3UYPA 4YHYC 1DQLH 2ICES 3IJSB 3L5XH 1L4IA 2KQNA 3FT3B 5I1KH 4NRZA 4JPIB 4UV7L 2IALB 1OGAE 2DQJH 5FM5O 5ICZB 3O3DA 5ISZA 4WFHD 3WO4B 3STZA 1EEYB 4PRPB 3PV7A 3OF6A 2HA1A 3CCHA 2GUOA 2WAHA 4X7DC 2PXYB 1BREA 4Q97A 3O11B 2I9LB 4Z7NE 1NDMB 5GS0H 4NO2A 3RVUD 4S1SL 5EWIL 5TDOB 2XNAB 2W0PA 5JXAL 1HYSC 2ZSWA 4XNXL 2EIZB 4XC3H 3L3HA 3PGCB 5EORH 1JGLH 3FONB 4OQTL 4WFFD 2X05A 4XMKL 4OZHF 2PO6B 1D6VH 4MJIA 1WZ1L 3BGMB 4X0KA 5HD8C 3CPLB 3FQXB 2ZCLL 3BXNB 4WHDA 2E27L 2YC1A 2VZ1A 4TPRH 1U58A 2QKIB 3P4OA 1VGKA 1ZEAL 1QR1A 1PD6A 3REWA 3MLZH 1I7TA 3LPFA 4UTBH 1FN4B 1X4ZA 5IESL 1K3ZA 3MA9H 4LPWA 5E8PA 3W0WB 5C07E 4JFEB 1I8IA 3D69B 3P9WB 4NQDE 2VDQL 5ADOH 1FYHB 3I6LE 5BJTB 1RPQA 4M7LH 2EECA 3FO0L 4OD3L 5D7JC 3QFJD 2VC2L 4LLMB 5ADOL 5ESQB 2OP4H 3TBTB 5JOPE 4Z76B 4YEEA 1JL8A 1EFXB 1VEMA 3PG2A 3GJEB 3VXQA 4ZPTB 4BA8A 4JRXA 1MHEB 3VI4F 3AREC 1EDQA 3OJVC 1HSAB 2J6EA 4XWGH 4AH2B 2P8LB 3DOSA 4YR6B 1FAIL 3FZUD 3VJ6B 2V5SA 2VR9A 4Q9CA 2RB8A 4FFWC 4JFQB 4KJPD 4LIQL 4N9OB 4Z7UB 3NFPB 5B3NA 4EDXB 3H9SD 4OM0L 1I9IL 4KXZI 1KTLB 3WLWD 4OZFB 4GAYA 3DUSB 1F2QA 1A14H 4M1GH 3ZYIA 1E0OB 4JFDD 5HGHA 2PTTA 1NLDL 2BMKA 4ZUUA 3IDGB 2MHAA 3S7GA 4HMDA 1Q0XH 5LGHL 3GDBA 1WWWX 4R2GB 4IRZH 3ESUF 3D18B 2Q8BL 3V6FA 4JDZA 5H94A 4XPFL 1GOGA 3HI1B 4F57H 1J12A 1YEFH 4ZPVB 2EYSB 3BAEH 1ACYH 4P2RB 1QYGH 3QUZD 1YC7A 2W0KA 4R0LC 4ODTH 1QHOA 3VCLB 1P1ZB 2GJ6D 3KG5A 1P4IL 5K9QI 5C0AE 3U2SA 1TTFA 4HUVB 5FCSH 2CK2A 3HRZA 1FAKT 1A6VH 3MJGX 3KJ6L 3L5XL 5AWNL 3WNNA 1U8NB 1N6VA 3MRHA 1HE7A 2WP3T 5D71H 3VFOA 4XNUL 3TPUB 4NWUH 5KZCD 1A9BA 3SY0B 1ZHNA 3MV9D 3DUUA 2NY5L 4FNLL 4HPYL 5F7FA 1BJMA 1YUHA 4PY7B 2FD6L 4Y2DC 3VFGL 4OGAD 5F3HA 4KV5E 1E27A 3O3BB 5FYKL 2W1NA 3ZYJA 2DWDA 2FH6A 4O02H 43C9A 1NGYB 3HI6H 5H35B 2VLRB 2FHCA 5IB2B 3S36L 3B9KA 3MZGB 1WZ1H 4JDTL 1DQMH 4RAUB 5DDHB 4U1IA 4LSQL 5IK3A 1MVFA 1WIOA 2M1KA 4NRXA 4RMQA 1NH6A 1REIA 4ZS6C 2H41A 1PAMA 2NLJA 4Z7VA 1KTRL 1WVZA 4L8SB 3VXRD 4YAQB 3NIGE 3RX5A 3LEVH 5GGTA 4FXGA 3OKKA 2ILLA 2H2SD 4PP1C 3TT3L 2BHUA 2GFBA 1YEHH 2AW2A 4Y1AB 4MDJB 1VKXB 1WFUA 2V2TA 1LMKA 4LBEA 5IKCB 3SCMB 2V17H 1KELL 2R1XB 1YEHL 3UTTB 4JRXD 3V6ZB 2HJLB 3TCXA 3DIFA 5A16B 1OPGL 3QI9C 4HULB 5D7JD 1DN2A 3B43A 5DRZA 1RK0A 2B5IB 1XF1A 1LK2B 5EOCL 3SN6N 3WSQH 4P0DA 5HHNA 3PIQB 1X5KA 3S34H 4NSKB 1NGXA 3ARGA 3CH8A 3MGTB 4PGDA 2EC9U 2IPUG 5TDPB 2BXYA 4Y7MA 3ARYA 3SDCD 2DTSA 4FFWD 1PEZA 4S1RH 5D5ME 4K23H 5I71B 3TJEL 1D5XB 4WO4D 2V9RA 2FX9L 4PJIB 3BN9D 1LO5B 4LSTH 2NY3C 3GSNH 1TJGL 5CJOH 5FGSA 1W0WA 2UWEE 1OAKL 2R69H 4HIJB 4R4BB 1IZJA 1E6OH 1FC1A 2RHEA 4ZFZB 4XBEL 3JSSA 1QFHA 4P2QE 4NZTL 4HJ0C 3M1BA 3ZTNH 2ZSWB 3UTZA 2D4FA 4NQEB 1I9JH 1LE9B 5ALCL 2JCCA 4CDGC 1T21A 4QHNA 2EKSB 4Z5RA 3K7UA 3PWUA 3IFPA 3U7WH 2P48B 4U3CA 2WWMC 3JWDH 5MENE 4BFEA 2DQTH 4UT7L 3WHE0 4EEEA 4FZEL 2CDGA 4PLOB 2Q86B 4XX1G 2YC1B 1RUML 5J1SC 1U58B 2QKIA 1JF1A 1I4FA 4QCIA 4TTGA 3RNQB 3BHBA 3DJ9A 2D7MA 3VD4A 5MEOA 3U46B 3NAAH 2EE3A 1KCKA 2K1MA 3QH3A 4ONGL 4JQIH 5EUKB 1I7RB 4I18A 1T3FB 3FQTA 2X4TB 3SBWA 1IC5H 2PYEA 4K3JH 3SGJC 3QIBA 5IB3A 5IFHL 2GK0B 2DDQH 4Q9RL 1HQRA 2P7TB 1CLZL 1N4XL 1JWMA 3BD3A 3RHWF 2B1HH 5J6GB 2Z8RA 3DX9A 3RWHA 3EW3B 1EFXA 4OLWH 1UWGL 1CR9H 1NFDB 1GRWA 1HSAA 3KLDA 4GKSB 1JZ4A 1C16B 3LIZH 2H9GA 4XP6H 1WFNA 2XQYG 3TZVB 1P5VA 3VFGH 4I2XA 4K7FA 3CU1A 3T0BA 4H1LH 5IG7B 3ZKMD 3A0OA 1X5IA 3MYJA 3MX0A 4M43H 2NY0C 4JO4H 1HH9A 1AGEA 5HTSA 4ZUUB 3B5GA 4NIKB 1TCMA 1ZHKB 2H2SC 4PP1D 4FFVD 1YEKH 4KK9C 4HWBA 3W39B 1I7UB 4JM4L 1A4KB 2GEEA 4LLUB 2NTFB 1F90L 3HHRB 1S8DA 5FKPB 3GKWL 4DKEH 4ELKA 3BPNC 4YLQT 2XKNA 3ET9F 4M7LL 1KYOJ 4J3WA 3BOVA 1JHKL 2DIBA 3OX8B 4BKLB 2J7LA 2DQCL 2I24N 5JW3L 4G9DA 3HS0B 2X70B 2VLJB 4WU7A 3TT1H 1JHKH 2CKBA 5EUOE 5B3JE 4FQIH 3RA7H 3T0EB 5BV7B 3O6LL 1MIEH 4LDOB 4S0TD 3FFDB 2E6JA 5C2BH 2C1OA 3L5IA 1FGVL 3TA3B 4JAMA 2E9WA 3JV6B 4JHAL 1JNLH 1BLNB 2NPLX 1KJ2B 4QEGA 1R5WB 2APWA 1MCNA 2X9XA 1FE8L 3HUJA 2X4RA 3U6RA 2DQIH 4ZMAT 1TZGH 4P9ML 5DT1H 3KYAA 3HZYB 3QUKA 2XZZA 5L6YL 1E4KA 3S88L 5DJ0B 1IRAY 5GRXG 4I8DA 5GSVB 4LARL 3I3EA 1I9EA 2N7AA 2DIAA 4XAWL 1M6OA 3TP4A 3O8XD 1KPRA 5EIQA 2E7MA 4ZUWA 2ZUSA 3DX8A 1JV5A 2EC8A 5HY9A 2FR4B 3C09C 3HPLB 4NO0A 1QEWB 1BF8A 5K9OB 1CDJA 4YX2L 2Z91A 4UNUA 3GUTB 3OG6B 1K9TA 4D9QD 4X6CE 2KZWA 1T5WA 5KTEL 1HHGB 4ZXBA 2IFFL 3JZ7A 1HH6B 1U2CA 4UBDC 3B6SA 3OKEA 5HDQH 5BRZA 1F6AA 1HWHB 5HYJE 1C1EH 5DMGD 1DDHB 4MX7A 5HYJD 2DL2A 4MCZB 3QXTA 3VWKA 1JFQL 2VTFA 3MOAL 4PJDA 1Y18A 3B3IB 5E08L 1ES0A 4J4PA 4WEBH 4WV1B 1L0YA 1WT5C 2ZG2A 5IW6A 5D9SA 5IM7B 4HCRL 5HYSB 5C3TA 4XCNB 3K8LA 2NY3B 5MENB 3GMQB 1TZHA 4O02L 4PV8A 3ETBF 3PDGA 5E8EA 4J2XA 2VDOL 1N2RB 3TIEA 3MTRA 4G8GE 5IROA 3U7YH 3G6DH 3WFDL 1CDUA 2Y07H 4DWHA 2LVEA 4TVSa 4M43L 5C0BD 3ZKMC 2NY2C 1PGRB 3GGWB 4IMKC 4X7TB 1EJOH 3MRGB 3M17A 3JWOC 3LCYA 4QRSA 5JOPD 3LAFA 1C08A 1BQHG 1YEEL 5F6HJ 3QUMB 4M03A 4NKIL 4P4KA 3BVNA 4OZIB 2Y5TB 1NUGA 3TEUA 1OSZA 2Y72A 2D0GA 2IPKB 1L0QA 3GSUB 5L9DH 1U3ZA 4K7PX 4J3SA 1YNLH 1OP3H 3U4BL 2EDRA 3LS4H 3PQYE 4XXCC 3D6GA 4GRMA 4N0YH 1MIML 2P5WD 5F7DB 5D1ZD 4F3FB 2ZSVB 3VXPB 3HI5L 5KW9L 3QQ4B 3UROR 3RWDA 1FFRA 4QHNB 1T1ZB 5EU7E 1MIMH 4NQCD 5KSVB 1AR2A 5C86A 4JN1L 5GJTL 4LCUB 4GAGH 1H9VA 5ANMA 5H2BB 2FSEA 2R2BB 1HINH 4LRIA 3D39D 4Y4FA 2E9IA 5TJWK 3SPVB 3V4VL 3D1MC 5MEOB 1G7HB 4Y16B 5IHUH 3QUYB 4PJHE 4CN6A 3CX2A 5FYLH 4WTWA 2IADB 5E8OA 2XZQL 4JHWH 4UDTA 4RGOL 2CRYA 1FZOB 1JUFB 1NAMA 2PW2A 4G6AC 3QIBB 4L1HA 5IB3B 1JMXA 4KK5D 4RBPH 4Z6AT 1DL7L 2GW5A 4JRXE 1JWSB 3WFBH 2ICWA 3DVIA 3OKDB 1UC6A 1VFMA 4X83A 4XRCA 1H8OA 1NL0L 5EU3A 1EV2E 3ZE2F 3QEUB 1YYML 4JZOA 4R90L 3CFKA 1JNLL 3C60A 4ALAL 3D0VA 3TZVA 4DZBA 1EGJL 3CD4A 3HE7C 4XPAL 2GI7A 5J1AA 3TN0A 1FSKB 1A02N 3OBAA 1PY4A 1ZHBA 4QWWC 5JA9A 2YKLH 3FFCD 4OBRA 3SDXE 2MPAH 3O3EB 3VDBA 3C6LC 4GAJL 4HEPG 2BJMH 5D93C 5ADPH 4HUKB 3CMOH 4ODTL 4X6DF 4OIAA 4WJ5A 4KKBD 4GG6F 5TQ2L 4YHLH 3FB7A 5E7BA 4QF1A 1QTYT 2V5TA 4PD4J 4O2EA 4DW2L 4F2MA 1RMFH 4OFKA 2Z9TA 1GIGL 3V7MA 1ZKAA 1ZLSH 1KXVC 3QHTC 2YD6A 3I3DA 5KS9E 3TH2T 1T7VA 2C26A 1MFBL 3CFCL 2XKNB 5E9DD 1J8HB 1IT9H 4F58L 1SY6A 4HH8A 1NKOA 1FCGA 1ZV5A 3MRQA 1U8MB 5E2UL 4M93C 4QHLA 5FDYA 1AXIB 2NY5H 4L4VA 2DTMH 5F9AC 4D0BB 1JZ6A 3THML 1JWUA 1FZJA 1U3HB 2NY1D 4QGYA 2XN9B 2VIRB 5HPMB 5TGBB 3MV8A 3S36X 1GZQB 4P4KD 1N5YL 4LSUL 4ZNEE 4JE4B 2VAAB 4JFYB 1SYSA 4NQVB 3F7YA 5EIIB 2ED9A 4BZ1L 1D5BA 4HCRH 2WUBH 3S5LA 3S4SB 5C0CD 1DZBA 1O7SA 4XCYA 4NYLB 4RSVA 2P5WA 4NJAH 3L9RB 5E00A 1KCRH 1RUAH 4S1QL 3FB5A 2KPNA 1R6VA 1UWGH 1J1XH 2H32H 2VZTA 1EGJA 3PWLB 5GGSB 1UXWA 5L8JB 1S9WA 4PG2C 2R0KL 5T3ZE 1ZLVH 1XGTB 2QQKL 3QIWC 5F89A 2NXYB 4LCWD 2L7JA 3HE6B 3R8BB 3T08A 4K71B 3RNKB 2A6DB 4LLYB 4UI2A 5D2NC 3VWJD 2FR4A 3ARBD 4G9FE 1QEWA 3HB3D 4GMTL 3EIFA 2IBZX 3AMKA 1U3JA 2QQLL 1FPTH 4MD4B 1FZKB 1HHGA 4ZXBB 2QQLH 1HXYB 4PJXB 4PRIA 2DYPA 1F90H 2R2HB 3BD4A 1MVUB 4WFHE 1TTUA 1WV7T 2EE6A 3FOLA 1KACB 3GMRB 4MX7B 4UTBL 2ATPA 4M00A 1JRHL 1Y18B 3U9PL 4G6AD 4LCCA 5E4EC 1FE8H 3HTLX 5EZJA 3CUPA 4JFHE 3P0YH 3MFFB 4UAOB 1YQ2A 2UY7A 4CDHA 4XBEH 2ERJC 1NCBL 4JPVL 1A1OA 1MHCB 3KPPA 3SQBA 1IGMH 3FO2B 3TIEB 1I9RH 2FO4A 4XMPH 1P84K 3UC0H 3MRNB 4X8JB 3B8SA 4HPOL 2HLFD 5FA4B 5CEZD 1R24B 3QWQB 3GSXA 4U6XB 1AGCB 5I0ZA 2JE8A 2PO6C 2GJ6A 4QRSB 3ZT6A 1HQ4A 1F3JB 3ARFB 2QHRH 1JPGB 1CQKA 4KMLB 5J13B 3FONA 5HHVL 5I1HL 5DEFA 2DQFA 4FQLL 4JQIL 4U1HB 2YBRA 1IM3B 1FNFA 1WFOA 1MCKA 1SJXA 3OHXB 1TETL 2IAND 2BVOA 4P2YA 5I8KH 2XA8H 5I17B 1VERA 4TOYL 1JYWA 3LZFL 5IMLB 3VXUB 3FOMA 3IJSA 4U1JA 1B4JH 4H5SB 3L3OB 4ISVA 5T33H 1GL4B 3THMH 4DTGH 4YDKH 4WEMB 4UOW1 5GRJH 4HV8A 4MCYA 3O0RH 5E8PB 3D3VD 2GSGB 4YHNA 4LNRA 3C6SA 5FGCB 2AXGA 3QUXD 3S35L 5BZWB 4CVXA 1R3LB 4X9BA 5DXWA 3CCHB 2HVKA 4Z0BH 5L88L 4NO2B 5F7NC 5HGAB 4AL8L 4Z76A 2W60B 1FLRH 1KCRL 2BCKB 2X40A 4PJCA 1OAQL 4UDUB 1NAMH 3VXQB 2BOCB 3INUL 4MNQD 1D7FA 4YIQB 1PG7H 4X6DA 5MHSE 4LEOA 2AEQL 2WWKO 4HK0A 3HKFA 2KBGA 2YK1L 4DJMA 3G5XB 5CEYA 2GCYA 3WJJC 4NKDA 1FNGA 1N5YH 5ICYA 5CJ8A 4LRIC 4XRCB 4RFOL 1N6QH 1CVSC 1KF9B 1KFAH 3CFKB 4PJ5D 4MQ7B 4ZS6D 3BISA 3ZTJG 1QPXA 5LAXB 3PGFL 1DFBH 1RHHB 4LOUC 3VRJB 1I8KA 4GBXB 1KB5A 4NJ9L 2V6HA 4L4JA 1V7MH 5J1AB 4MZ2A 1DN0A 4PYHA 5GS0D 3HI1A 3WN5A 3JVGC 3RAJH 4JFXA 4YFDB 4FQQB 4YDJA 2DQHH 3PNWB 2C7UB 1S7TA 25C8L 5AAMA 4MJ5A 3HA0A 4IS6A 2Z31A 3CFEA 3QI9D 5T1KB 3O81A 5CIPA 1DBAL 5I74C 1K85A 1J0HA 2A2QT 1Q9WB 3OAYK 2WIIB 3CX5K 5DRXB 3ZZ1A 5D7LA 2UWEF 5T3XH 3BP7A 3UTSD 4FHBD 3QCVH 4JY4A 2F53B 1RVFH 2ZOLA 4OZIF 5AZEH 3WLBA 1TQCC 2ENYA 4FQ1L 4M8VA 4DCQA 4XWOC 1MI5B 1WICA 3PL6C 1YYMH 5IV2B 2PTTB 1XH3B 1YUHB 4WO4C 3FCTB 3MUGB 3O6FB 3CXHJ 2GJJA 5HVHC 5D7IE 4CW1B 3P4NA 4JO2H 5IFAL 2XRAH 1CIDA 2BVQB 5ITFB 2PO6D 4RISH 3V4PL 5TE6L 4OKVA 1SBBA 2D7PA 4WDIB 3TNMA 4HS3A 4QYOB 2VABB 4OLEA 5D8JL 1UADC 3E2HC 3MJ9A 2Z92A 4Q58C 5F44A 3VWKD 2ZNXA 2EO1A 2QJDA 3AMLA 4K3EH 1OP9A 5D1XC 1Z6JT 3BP4B 5IEHB 5FUZH 4POUB 3D39E 2FECI 4NKQB 1FVEB 4R0LB 1D3CA 3QUXA 5AWNH 4DFHA 1BVKB 1B6DA 4QTIL 5DFWH 1CXHA 4LHUB 4JANA 3DX7B 5CEZE 1WZKA 3D48R 32C2B 2GFBB 1LO3L 2A9ML 2RBLA 3GEWB 4NM4H 2R39A 4YDLB 1KOAA 5L8LB 1XCQB 4DN3H 2OBGA 4ZYKB 3SCMA 3RDTD 4FOMA 1KUMA 4LHQB 1KCSL 4PJ8C 3T4AB 4Q6IC 2HJLA 1CFVL 2EXYC 1RULH 3I84A 43C9B 3B9KC 1HDMB 2EYTA 2XQYK 1FFNA 3K2MC 4LRNL 1VCAA 4NM4L 4RAUA 1TTGA 3OXRA 3MGTA 3HPJA 4KZEL 5DDHA 4LCWE 3Q6GL 1OCWH 3WS3B 1INQA 2IPTH 3QEQA 4OD1H 4ODXA 3Q48A 3RU8L 1IE5A 1OP3K 1NCWL 4B53A 3R4DA 1T5XA 3GRWH 2GY7B 3NN8A 4TULL 4WGVB 2LAGB 2VDOH 2MQCA 4Z8FL 5MERA 1P69B 1OF2B 1AGFA 3T1WA 2AABH 4NBXB 5E5UB 4JPKL 4KTEL 3WKMH 5DD0L 3H3KA 1J9CT 2MJWA 1U2HA 1BQHA 4P3CH 4NPYA 1A6AB 2HRLA 2OSLA 4TTDC 2O5ZL 4X8XA 1ZEAH 1UCTA 4F15C 4LVNB 5K9KA 1SJEA 1RK0B 3U1SL 2ZCLH 3MA9L 3PWUB 1KIRA 4LCCC 4C59B 4FMFA 4ETQB 2AEPL 2CLVA 4MZ3A 3W9DA 4H20L 4HUXA 4F7PB 4PGDB 3SE3A 5EOQH 4OIBA 1W2KT 3GBNL 5AZEL 2CIIA 3H9SA 4EBQL 1UM6L 1VA9A 2OTWA 4RBPK 1I8MA 3U46A 1D5XA 3AB0C 5IBTL 3RGVB 3WDHA 5AAWA 5C0JB 2N56A 1V05A 1MREL 5DC4B 1I7RA 4CN4A 4ODHH 1U8QA 3VGAB 2WUCL 2VN4A 4R4BA 2J8UB 1QLEH 3H0TA 1JWMB 3CFBA 1WEJL 3VFPB 4MD0B 5DEZA 3TZVC 4I3GA 4XP1L 3UTZB 5I15H 1MREH 1LE9A 5J11B 1LVEA 4HK0B 5GGUB 4H88H 3QWRD 2P8MA 3QDJA 1E4WH 3TV3H 2FJFB 2DQDH 1GPOL 2YD5A 3EJYC 2F5AL 4S0SD 1FSKC 1W72L 3N1QC 3P2TA 5HGBA 3KJ4B 3E8UL 3UJTH 1HI6B 3W2DL 5FHBL 1ZHKA 3QH3B 3U83A 1AJ7L 4OJFH 2XZAL 3JVGA 3QP3A 1DN0B 4JM2B 5DVLA 2FRGP 1R3KB 3PJSB 5B4MD 4X7SH 1KLGB 3GHBH 4PRDA 1G1CA 3REVB 4WY7L 3KPMA 5T1DL 2X89A 1T2XA 1BF2A 1JGVL 1XGQA 4LQ1A 3T4YB 4UTAH 1ZHLA 4Y4HA 2UY6A 4E42B 1FVCA 2DQGH 3AREB 4N9GB 2HT2C 3SDXB 4PLJD 5I0DA 3O9WA 3CLFL 1G7LA 3T77A 2YPVL 1NGZA 1CE6A 1P53A 4DN3L 2WIIA 4WGWB 1MF2H 2DTML 3KPTA 2F53A 4P46A 4OZGB 3NZHH 2D9QB 1QBML 5D96B 2N4IA 5T5NG 3JV6A 1LGVA 3QULB 1XH3A 5GIRA 2YUXA 1BLNA 2HMID 3SE9L 1R5VB 4E41B 5JNYA 2VZUA 5JW5A 1XR9A 2QTEA 4L8BB 3HZYA 3QUKB 5SX5K 3TO2B 3K4DA 1S8DB 4D0CB 5CUSL 5F8QC 1MH5A 4N8VA 2K9UA 2W59A 1C5CH 2WWMD 4ODSL 4GLRH 3OPZL 1DVFC 1A3LH 4QO1A 1TQBC 3KPOB 5GJTH 4MAUL 1MY5A 3QZWA 1DQQA 4LCIH 4XT1C 3HZMB 3DX8B 4G8GA 4HBCH 4WU7B 4QRPA 1OGTB 4G5ZL 4AMKH 5C0RL 4DUVA 4IHOB 4GRWH 4PLKD 4ZFFA 3QUXC 4NC0B 5IEHA 3GJFH 4ZUVB 1JYVA 5J3HD 1T5WB 1BJ8A 3BT2H 2YD4A 4MA3B 5A2KH 2APVA 5HYQB 2H2PD 3B6SB 3KYNB 3O9WC 3NTCL 4K94L 3DX7A 4DUWA 1XR8A 3L7EA 5GS2H 1OQXA 3UYRL 4XPTL 4HDIA 2VDNL 4HJGA 5DWUL 3D0LB 2XPGB 4M5ZL 1OPGH 5KBNC 4YJZL 4R6UA 3BPOC 4OD2A 3GKZA 1I3UA 1NC2D 3U6RB 2I07A 4L4TB 1KELH 1H5BA 5BXFB 3MRIB 1HILA 5FECB 2VXUL 3Q3GB 5D9SB 4LKXA 3CSYA 4JR9H 5F1KC 3TZVD 3FO0H 1MJ8L 2M8XA 3GSQA 2EDTA 4OD3H 2VN7A 4AZ8A 3RY6A 3KPSB 2ARJQ 2VNCA 3KR3L 1A7NL 4OLVL 2G60H 2NY0D 4KHXL 3MC0A 1F11A 2YRLA 4Z7VF 3ZL4H 2BVYA 1Y6KR 5I9QC 4DVBA 4DOHE 5DD1H 1CGVA 4PBVC 5C1MB 3WXVH 4BQ9A 4I0PD 5SX4H 1BEYH 5EU4B 4D94A 3C09B 5L2JA 1G6VK 5KVGL 4XVUD 4QWWD 3FQNA 1N0XH 1SMOA 3BP5B 5F7YC 3KR3H 4HAFA 4MQTB 3H7BB 3QB7C 5HPOA 1QG3A 1WWCA 1X6NA 5B4MC 3TV3L 4I3SH 4GRMB 4QHMA 4RFEB 2GJZB 4KXZH 4Z18A 3GIZH 3QQ4A 3S36H 2B4CL 1A6TB 2VXQL 3GSRB 4UQ3A 1T7ZA 1FYTE 4XCNA 4MNHB 4CL7A 3GMOB 2R56H 1KEGL 1QYGL 4PRBB 1N2RA 2BY1A 2CQVA 1AKJB 3DARA 4N8CH 2JCCE 3DTXB 4P99A 2HJFB 5GGSY 5AD0A 2VXSL 1G6RA 3SEPA 1JPTL 1NCCL 3GGWA 5FO9B 4N1CA 1CDHA 2I9LA 2D7QA 2ZUVA 1S5HA 2AJZA 1DBKH 5JLZB 4YXKH 1FZOA 5CHNA 4X99B 1QFWH 2C1PA 1KENL 2WQRA 4MVBD 4YHOL 3AY4A 2FWOA 1K8DB 1WTLA 4MJIB 1N7MH 3BEWA 4MD0A 1JWSA 3O8XC 2VB5A 2ZSVA 3VXPA 5GZND 1N7ML 3BP6A 1Q0YH 3OAZK 2Q3ZA 1FJ1A 1ZAGA 4TPRL 5KSVA 5A43C 3N85L 4GW4A 1HHJB 5LQBH 3IDYB 1PDKA 1I1FB 1S7UB 1NCDL 3RWCB 1BQLL 3B2UC 2HKHL 4H0IA 4NKIH 3ZE0E 3EO9H 1AGBB 2HRPH 3GBML 4U0RB 4PP2B 5ACZA 3OKLB 4YWGH 2GUOB 2V5RA 1G7HA 2BOBA 4Y16A 5D2NE 1HCVA 1MRCH 2J3SA 1I85C 5E8OB 1HEZB 1J5OL 1VFUA 3AC0A 4KTDH 2YN5A 1OLLA 3L95A 4NNXB 4ZPTA 2X4PB 4OIIL 5D7IB 1IGIH 5E6IA 4RWYL 4YR6A 2APXA 3F6IA 3MYZA 4M5YH 1UA6H 5EZLA 4Y4HB 4PB0H 3NFPA 3W9EB 4UIKL 3EOTH 4N9GA 1I9RL 1RIUL 2A0LD 5A3IC 4I4WA 4L4VB 1EUUA 4GG6E 1ZGLA 3MV9A 3GSNL 2JJSA 4Y4KB 2DLEA 4NP4L 4O5LL 3HNSL 1QR1B 1FZJB 3ULSB 5EN2A 5BOZG 3QPQD 4OCRH 1QR4A 1EZVY 2V7NA 1IGIL 1S7XB 4UUJB 4QRRB 2MHAB 2NW3A 3TN0B 4JFEA 4JFYA 3ARDB 4KKLC 4OF8A 3VXRB 2XFXB 4E0RA 1ZLWK 2JB5H 3VFWB 3S4SA 2X4SA 4HWZA 1YDPB 5E6ZA 5I1GH 4LLMA 1AR1D 1H3UA 4E41A 5D1ZC 5JW5B 3F6LA 3PWLA 5GGSA 1TVHA 2CGRH 5D2NB 4P9HC 2PNDA 5EU5B 5TQ0H 1QHPA 1CICA 4JB9H 4WUUD 3OB0K 5DZNA 5IFAH 4JFZL 3LEXA 3SBWC 4CBPA 3D39B 3OR7A 2VXVL 4L9LA 3TPUA 2A77H 3V6BR 3QG6B 2R29H 4BH8A 3H3PH 4LGPB 2WBWB 4ACPA 4GAYB 4EI5C 1TQCB 3WE6B 2NTSP 2ZCHL 4YGVB 3WL9A 2FZ3A 3IF1A 5LWYH 3C6LA 2F58H 2P5EE 5T3ZL 1CFVH 1DBMH 5FM4A 3UJJH 3UTQB 3G9VA 3PV6A 3C5SB 3DMMB 3O6FC 3QO0A 2XXCB 4JFPA 5F97E 3D18A 4JY5L 2RAMA 1XFPA 2I25N 1NAML 1D5BB 1ULVA 4WW1A 3GJFK 4GQPH 4NOFA 4Y4FD 5E08H 1WISA 2OJZL 3S5LB 4NZRH 3D0LA 3CFCH 4ZPVA 2WUBL 4XCYB 4YC2B 2CD0A 2VITA 3LIZL 3B2VL 2X41A 3HI6L 4MYWB 3B9KB 2CDEA 2D0FA 1C1EL 1FFPB 2I07B 3BN3B 3JBG7 1IKNC 3VXOB 1ACZA 3CUPB 3QNXB 1MWAA 4LLQB 3NABH 1OY3B 3QUML 1S7SB 4WVRA 3VFRB 1A2YA 4DEPB 1R3JA 5C71A 3HE6A 2ICWJ 1DFBL 2VOTA 3FFCB 2I60H 3QDMD 1GGIH 5D5MB 4YAQA 2NZIA 5GRVL 4HG4K 3JUYA 3OKKB 4J3TA 4LPCA 5FA4A 2B1AL 1MAJA 4YEFA 1RURH 4KKBC 1I1YB 5IVXA 1KEML 2V2TB 1FZKA 3JV5A 2WMPA 5DK2B 1A7OH 1OL0A 1FNSH 5DVKA 4BH7A 2XY2A 2QBWA 5CUSH 2IQ9H 5GS0C 1UWEL 1PKQB 5JDSB 2J4WL 4LVNC 3LKSA 5E94B 5GQBA 1A6ZA 4ENEC 4U1HA 1XCTB 1RIHH 1P9MC 2MKWA 1QACA 4MHHI 4RISL 1CFBA 2BVOB 4LCCB 5F7EL 5DVMA 3MRPB 4PJIE 4X4YB 5HDBF 4U1IB 2JJWA 5CJXC 4G6JL 5DMKB 1IGFH 4O2CB 3T3MF 1GGUA 3FO9B 1MJUL 4RMWA 4LAQL 4MNHA 5HHPA 1NGQH 1IM9B 3R1GH 5GHWL 4P4KC 1NL0H 5E9DA 4GRWB 2HMIC 1MLCA 5F1IA 2VDLL 1HNFA 2LU7A 3LS5H 1R24A 3MLUL 2NYYD 3M45A 2ZPKH 1C5BL 2WINA 4LIQH 2HVKB 4NOBA 4KRNA 5CIPH 5T3XE 4TSCL 1TPXB 4LSDA 1BOYA 5EC1B 4P57A 2AJZB 3DROB 4PPTA 4RGMB 1PLGL 4HIXL 5D2LA 4Y8DC 4AK1A 4HFUH 1J0KA 4U31A 2DM7A 3IU3A 2P45B 3G5ZB 3CK0H 4JB9L 4OCXL 4GUPA 5HVGB 1BGXL 4NQXA 3VWJB 4NKDB 5IB4A 1G7IB 2CDGB 4XH2B 3C08H 4BFIA 4AQOA 3SO3C 1CD8A 3VWKC 2LAAA 4HZLA 3RNQA 4OAWA 4KPHH 2AERT 3VXUA 5KSAB 1CD9B 5D1XD 3LH2H 3MLRH 1F02I 4JZJC 5TPWH 4YXHH 4HV8B 4OLUH 5HDLA 5J06A 4PJ9C 3VRJA 2KH2B 3RWCA 1LE5B 3C6SB 4XVJH 2R8SL 5C9KA 4XNZB 5T5NF 1R3LA 2ADFH 1MNUH 2MOVA 3A6BL 2FBJH 2J6EL 3RWJB 5CSBA 2BHZA 1LHZA 3DVFA 1CLZH 1N4XH 5M7QA 4X5LA 3MJ7A 3MRBA 4WI6A 5FYKH 4OQTH 1C12A 3QQ9C 4MJ5B 5DFTA 1TMCB 1RAMA 3QDME 2XICA 1YMMB 1OD9A 3PABB 5ANME 4NRYB 4HPYH 1FP5A 4QXTA 1SVCP 1M1SA 3P3YA 2O26U 5I8CB 3BZDA 2ZUQB 3IFPB 4PJ5E 5CEYB 5CFHA 3IETB 4NWUL 2YPVH 3K46A 4KUCF 3IKCB 4XCCL 1KCLA 4X9FA 3VXNB 1OVZA 3ZDXF 3DURA 1UACH 3UDWA 2R1WB 3U36A 3ARFD 1DP0A 3FCTA 1H0DB 5I19L 4JG0H 1Q38A 4PRNA 5D93B 3RY5A 4CW1A 4MDIA 2CIKA 3TCLB 1V3MA 3DVGA 5TE7H 3WNOA 1BX2A 3T2NL 1JF5A 2W9LA 2XN9E 4ELKB 1DEEA 3NCEB 2UYLB 2VLLA 4JO3H 5IUSA 2WIMA 1CDBA 4ZO8A 3UTPD 4QOKA 5J6GA 2C7UA 1JHTA 2YSSA 4NNYB 4EI5B 2VQ1B 3FAXA 4XPGH 3P4MB 2G5RA 4IS6B 3WNPA 1DQML 1UEMA 5M95B 4AENB 2R0KH 4J8RB 1OAUL 1U8IA 4RWYH 3HZKA 4F7TB 3QUXB 3L7FB 2NY3D 2R4SH 1E6JL 3DSFH 1NJ9B 3OF6D 3QNZA 1M7XA 4K8RH 3SE8L 1J1OH 1T22B 1RIUH 4K07A 4M6ML 1ZTXH 4BZ2H 1ZA3B 2AXFB 4FQ2L 1A7BA 1IBGH 1XCQA 1PZUB 1QLEL 1WAAF 1KJ2A 5E99H 4H1LA 4L3CB 3T65B 3PV6B 1F4WL 3W39A 2IJ0C 1UXSB 4K3DH 3STLA 3SKOB 1S78D 3RBSA 4UOW0 4TUOB 2VITB 5LCVL 1PG7W 3WIIH 3O41B 4R7NA 5ISZD 3N50A 2NZ9D 3P0VH 1A6VL 3W0WE 3GO1H 1JGVH 4UTAL 5ID1B 1OARH 4CADB 3KDMB 4MAYA 5CP3A 1NMCB 4NO0B 1IC5L 1NBZB 4KFZC 5H37H 4ODUB 2YKLL 3G5VB 2D4DA 2G60L 5CBEA 1WBYB 5FDWB 3KYKH 1A9EB 2C3VB 1OAXH 1T5XB 6FABL 1IQDA 2DJ4A 3SDYL 3E3QE 1QVOA 4UU9B 4PJIF 1EBPA 1OWWA 3MBEA 5KANG 3D85D 5CMAA 4R90H 2YPLE 3RPIA 4GKOA 3KYMB 3O2VH 3UC0L 4EIGB 4HKJB 4G7VH 1EMTH 3WFHB 3LDBB 2EDHA 5CILL 1EH9A 1MCOH 4XPAH 1T83C 1ZOXA 2RGSA 3CAFA 5DO2D 3ARUA 1N3NB 4O4YL 1TVDA 1RUAL 4HGWA 4R4NC 3BFOA 1ETZA 5MENA 1KIRB 5E4EB 2YA1A 1MQKL 3U0PA 1LO4H 2AJ3B 4DGYH 3TH4T 4HUXB 5ESVA 2XOTA 1VHPA 3TLRA 4X4YA 3P4LA 5GGRA 1KG0A 3GJFA 3PL6D 1IGCL 3GSOA 1MFBH 3RGVA 3NA9H 4PJBF 3RTQA 5C0NC 3DXAE 5DD5H 5C0EA 3WD5L 3WIHH 2H1PH 2NY5C 5D1QB 3CXDH 4GRLD 4X5WB 5FUOH 4XP5H 3QDGD 1AXTL 4WI7A 1OSZB 3LPGA 3CFBB 4FG6D 4GKNA 4HG4J 5JIKA 2CMRH 4NPYB 4RFOH 3VWKB 3CC5B 3U30C 4GFTB 5DD3H 1IZKA 3MNZA 5KSBB 1T1XB 4FQPA 3NCYS 2IWGA 5CBAB 2XA3A 2GTZB 3B9AA 5EO0B 5F71A 5E8EB 5IQ7L 3W9DB 3KLHC 3IDXH 2VXTH 1NPUA 3O3DB 1YPZF 1ONQA 5BCAA 4HW6A 1F4YH 1IL1B 1RURL 1I8MB 5DC9B 2NY4B 1JZ8A 1NDMA 1UQSB 4PJ8D 3MR9B 4F9LC 4KVNL 1V8HA 3HG1E 4UDTB 5LGKA 4BSWB 1JUFA 1BQUA 4OZIA 4AEIL 4PGBA 3OWEA 5K93A 4N0UE 1CZ8H 2C9AA 3EDEA 4ZG1A 5BVPL 4HS6A 3DSFL 4WU5B 2IAMB 3QIUB 2F5BL 1CU4L 3ROOA 4XXCA 2E9JA 3L3DB 1J0JA 4LHJB 1FNEA 3QEUA 3GMNB 5I1AB 3BKMH 5ITBH 4X98A 4QHUA 5D96C 5JOFB 4R9HA 1NC4A 5TF1H 4I77L 1I7TB 4R2GC 3KS0H 4M9PA 4JVPA 2B7DT 1HK6A 4FQIL 2OQJB 1INEH 4I3RL 2ED8A 1R5IB 2P24A 4U6VH 5MP6L 5B39B 3PE9A 4LP5A 1YECH 3LQZB 2X4OB 5HGBB 4XNYH 2R1WA 1WIPA 4NP4H 4O5LH 2CGRL 3QCTH 3KXFD 4PS4H 2R29L 1S9XB 4ENED 5F96H 2BNQA 4RAVA 3TO2A 5I1GL 4M8QA 5IVZB 3D3VE 2VSDA 1NAMB 2PW2B 5DJZA 4G8EA 3O6KH 4AH2A 2M26A 2VLLB 4FMKA 4G8FA 4PUBL 4JFQA 4QOKB 5I6XB 2CUMA 4EI5A 4O2FB 1G7QA 3IFLH 2RR3A 1KPUA 3O9WB 5DUPL 3RGVD 3T77B 5C70A 4AENA 4HSQA 4NQCA 4JPWH 4ZUVA 1FLTX 3WN5C 3D2UA 2R0LL 3WFDH 2P5WE 3VG9C 2VKWA 3GHBL 5DTFB 3LZFH 5TFSH 1V3JA 3T09A 1IGTA 1NGPL 2VZSA 7CGTA 3EHBC 1MNUL 1E28B 2VZVA 3SE4C 3GFUA 1DQJB 5I1JH 3B8YA 1Z5LB 2AI0L 4BQBA 1K8IB 3ARGD 5E8DH 1Z2KA 1GC1C 3IJHB 1NBVH 3L5JA 1UXWB 4MD5B 1Q94A 5E8DL 2OTUA 4FFYL 4PG2A 1JMZA 3QWOA 4TUOA 2YWYA 4GW1B 3RI5K 2VL5A 1ZT1B 4OLXL 4JKLA 1U8NA 3BYYA 2VC2H 1YMHB 1NMBL 3DNKA 4NDMA 3MRLB 2VKXA 3LQAH 4TSAH 1LP9B 5ETUA 5C0FB 4Q74A 3VGBA 3EJYD 3MODH 4PB9L 3CVIH 1A9BB 4GXUN 3P30L 4ODUA 1JYXA 3ES6A 1OCWL 3B9DA 5F1OB 3CVIL 1T4KB 4TUKH 3BSZL 3NFSL 4OZ4B 3QDHA 5F3HB 2VAAA 3F7YB 1J1OL 4QXGL 4M1DH 1S7WA 3B9EA 4KDVA 4HJGB 3JV0A 1FAIH 5DLMH 2VERN 1CD0A 1TJHH 4NYLA 4ZS7L 3T2OA 1QP1A 1RZ8A 5IB2A 2CK0L 3L3IA 5I73C 4QHMB 3MCLH 4YE4L 3L3GA 4LPVA 1HILB 1XIWB 4X7EC 5IK3B 1PG7X 3SGDI 1RI8A 1XF4A 4J3VA 1ETZB 3HNTL 4J6RH 3BDBA 4ELME 1FPTL 2NLJB 3U0PB 4PRBA 1GH7A 5D1QC 5DA4A 4D9LH 1RIHL 4H8WL 1EO5A 4HWEL 2DIJA 5FO9A 3GI9H 4E41D 4WTXA 4APQA 1RHFA 2FIRT 4Z7WA 5AYUL 2ICCA 1F3JA 1M71A 1A7QL 2W65A 5IHZA 4KKLD 1RZIB 2C1PB 4ELMB 1RK1A 5ALCH 1MJ8H 4HKXB 4FFVC 1YY8B 4GMSL 4Z7WF 4K3EL 1DBBL 5C09B 2EZ0C 2QEJA 4PFEA 2FX8L 1INDL 2UZXB 4NSKA 3IB4A 5HDBE 5IMLA 3K1DA 4WI2A 2JB5L 4I0CC 2R69L 4JJ5A 4TQEL 5DUPH 4UOJA 3ZHLA 2OR9L 1T89A 1A6UL 4IBLT 5KSAC 3ULVC 4IOFD 2H2PC 4Q7DA 4KVCL 2BNRD 2ADFL 1OSPH 2GSGA 2OXGA 4PJ7F 2R23B 5GGVY 4YHNB 5KS9F 1AGBA 3FQRA 4G80B 5TFSL 1JGUL 1QSFA 1QFWI 1ZWIA 3G04B 1NMAL 3SKJL 1XGUB 4U1LB 4JHBA 4LEXL 1JZ7A 3LH2L 3ARFA 1K4DB 3QI9A 4ZNCD 3O6FD 1P5UA 5E2TL 4HT1H 4OI7A 4QRRE 5T1LB 4LEOB 3NAAL 4Q9BA 3UBXA 2YBRB 3V4UL 5KW9H 3PHSA 2DMKA 3QDMA 2IG2H 4ZOEA 2ADGB 3TH3T 2HLAB 2LTQC 2HFGH 4HMCA 4LP4A 4EOWL 3ZKQD 3P9MB 3QYCA 3HB3C 1JF1B 1MY7A 4QHUB 1AP2A 1UWXK 4B7LA 4RRPA 5EN2B 3F8UB 4GKZA 2OM5A 3PWNB 4TN9A 3SDAD 2NQCA 5E2JA 3Q5OA 1YEDA 4M02A 5LQBL 4M7ZB 4OSUH 2AXGB 4PY8I 1R5IA 1MRFH 2Y25A 3VFWA 5B39G 4KGJA 1WZMA 5EDXA 4V1DB 3CVHH 5SX4I 4HBCL 2F54D 1BIIA 2E5EA 4XPTH 4G6KH 2AV1A 3K2UL 3P77A 4Z9KB 3L1OH 3C8DA 3VRLE 4X6DB 3MXVH 5EZLB 3IXTB 4G8FB 4NGHL 1BZ7B 1G9EA 5DHXB 4DGVL 3LPWA 3OR7B 1MCLA 5K33A 1TZIB 5BW7A 2EDXA 1A14L 4L9LB 4M1GL 1ZT4B 2VXUH 4NGHH 5FO8A 1TJGH 5BRZD 3KPSE 4RX4D 4XBGB 1S3KL 1MI5A 2FX9H 3U0WH 1AD0A 3DV4A 5LAXA 3HAEH 2V7NB 3T0WA 1U95A 1G9MH 2G2RB 2F5AH 4EN3A 4UILL 5CAYB 1X5LA 4L4TE 4QKXB 2APBA 3HMXA 1V7NH 1S7RA 2ADIA 4M61B 3I9GL 2B0SH 1P4LA 1MFCH 2R15A 2X4SB 4HWZB 3G5YB 3LB6C 1H8SA 3FTGB 3IDNA 4GMSH 5D1ZA 4DEPC 4HS3B 4QYOA 1IGJB 1PKOA 1H8NA 3EBAA 2RFXB 3TJHC 3BQUC 2Z92B 4YHZH 1X44A 1SJHA 4N5ED 2AK4E 5EU5A 3SJVD 4M6OH 3HCVB 3KYKL 1C5BH 3DUHA 5CIPB 1ND0B 5HHMD 2Q8BH 4LGSB 3LEXB 2Z8VC 3KPQA 1J86A 4DN4H 1TITA 5JDJA 1UB5A 3BH8A 4P9MH 1QSFD 1MLBA 4OJFL 5CKGA 5GXBB 1D9KA 4IOFC 4RNRB 3VXTA 3NFNA 3IF1B 1G0YR 1UKSA 4NQDD 1T4KA 4DKFH 5LWYL 5F6IB 3O6FA 4J1UA 3VGHA 3EZJB 3BX7C 5FK9A 5KVEH 4ZUTA 1SEQL 5EO9A 4FXLA 4RDQF 3QEQE 4OKVB 2D03H 3BESR 3LN4B 1YEGL 2CDEB 4K2UH 5F9OL 5ID0B 1P6FA 4NC1E 2I26N 4M93B 3MBEC 2A0LC 3OXRB 5A3ID 1F58L 3ULVF 1KCUL 4QRQA 5CWSA 2HN7A 3WS3A 1PW3A 3O0RL 2XQBL 5TDNB 4ODXB 1IM9A 3VXSB 3BH9A 4Z7UE 4YGAB 3T1FB 2DRUA 4JFFA 5HI4D 1HH6A 3NN8B 1UJ3B 4HWUA 3MLZL 3UEZA 4ONOA 2LV4A 3CFIC 1FL6B 3KPRD 4X80H 2D31B 1RY7B 3HE7D 3G6JF 3BKCH 3WUWG 4JFDB 4G8IA 3B3IA 2BX5A 4UINH 1BBDL 2DLFL 4BH7B 2GITA 3LHPH 3OAZH 2GTWA 2QADD 1HSBB 1HDMA 2QQNL 3U1SH 4HCRA 2FLRT 4ETQA 1FFNB 1KENH 2YWZA 4I48B 4YHOH 1G9NH 3I2CH 4LDLB 4BFIB 2IC2A 1UKTA 1WAAE 2NY6C 3V8CA 4JJHA 5EUOF 3FRPG 3L6FA 5EUOA 3BWAB 4JJ5B 5F93C 4LMQI 3CZFB 3FO9A 4XMKH 1I1AC 3QR2A 3LHPL 4EN3D 1UH4A 1N59B 5I71C 5GRUL 1P7QB 2BERA 1LP9F 1W0YT 1NEZA 4MWFB 5DJ8B 3PP4H 2EIBA 5EFIA 1RJCA 1XGRB 1BQLH 1JPST 3WUWA 2DD8H 4NN6B 1Q1JH 2LTQB 3GSUA 4D8PA 3MJ7B 3MRBB 1AI1H 3LQMA 5E2VL 5D2LB 3KXFA 1MCOL 2RCSH 4HIXH 2DI8A 3ARXA 1KIPA 2C4FT 4KROD 1PJ9A 2FH8A 3IAQA 1VFAA 3QDMB 2GAZA 3V5HA 3VWJA 2R0ZH 4N5EC 4LCUA 5CJQH 1TDQA 1S7VA 4H8WH 5H2BA 1U91A 4NZTH 2ESVD 1YPZB 2CIIB 2VDKL 2OTWB 4UBDD 3IDYC 4PJCE 4GAJH 4U1NA 1G1YA 5IW1B 1T04A 4GW5A 2BSSB 5KSBF 3MNVA 1R0AL 2ZUYA 2UZIL 3QEHB 3DVGB 5GRVK 4CN1A 3RWJA 12E8H 3OJ2C 2J8OA 4V1DA 2R0LH 4ZAKC 3VFPA 3VD7A 2A6JB 5BVJA 5CD3B 2VQ1A 1YEJH 3EYVA 3UTTD 1JK8B 2DWEA 3WV0A 3IKKA 1CFSB 5DVNA 1IM9D 4K9EH 1M05B 1CE6B 3VFMA 5D7JB 5I76A 2V5MA 4QTIH 1BZQK 3VDCA 3QQNA 3IETA 3MO1B 4XAKE 2V2XA 3L7FA 4NCC1 1PKQE 2DYPD 3X12A 2HT3C 4XPHH 2FO1A 2B4CH 1CFQB 3DBXA 1GOFA 2AJVH 3DURB 2J4WH 4NWTH 3GMLB 4P2QA 3QFJE 3F12A 3KWWB 3PDDA 5T1MA 2ZZUT 5L8KB 1JZ5A 3PWVB 4D0CA 3EYFA 1KEMH 5HXMA 3G5YA 5J7CC 2AEIT 1XGQB 4GSDH 4JRWA 1JPFA 3JXAA 2K7PA 5JXEC 1DBKL 2BDNH 2QLVB 4X9GA 5FIEA 4CADA 5KSAD 3ULVD 5D5MF 2X1OA 2JCCF 4HXAL 4BZYA 3WIFA 5DQJA 3K81A 3OZ9H 5L9DL 3IS1X 1LNUA 5BMFL 1R3IL 5A40E 3QJFA 5DR5H 4PJ8A 1U8IB 4I0PA 4N90D 5F7EH 1U8KA 2B1AH 2JIXB 4QNPE 1NJ9A 3HRPA 4N90E 1T22A 1TQBB 1CK0H 3TWCL 5CMAB 5I8EB 4RMSA 4DQOH 1ZTXL 4BZ2L 3QULA 1V5JA 3TA3C 2WQ8A 1FQ9C 4KK5C 3BZFB 5JNYB 1CL7I 2ICWI 4KAQL 4OCNC 4ZUTB 3MUY1 1MJ7L 3NIDE 3WS6C 4Y5YA 2ED7A 2R4RL 2VZOA 1JPSL 5C2BL 4LKXB 3S37H 2VLJE 3STBA 3MREA 1MFDH 3LRHA 4J3OC 4OCMC 4R7NB 4MJ6B 4L3EA 4U2YA 3KPOA 5JPMB 4MJID 1NFDE 8FABB 1FV1B 1F11B 4M4RA 3FB8A 2P5ED 4GLRI 4MA8H 4YFLI 2D3VA 4IDJH 4F57L 5TDNA 4WFGD 3FJTA 4U2ZA 1EERB 1JPSH 4Z77A 5JIPA 1K5NA 4ONHA 4JEGB 1B88A 3VRLF 5HYQA 4DK3A 2MCG1 3BIBX 4OFYD 5I1DB 3RWGA 3MACH 2VZ3A 3MLYL 5D2LF 3S96B 1KC5L 3FOLB 2V5YA 5LCVH 4DZ8B 2EYRB 2ATPB 1T89C 4L8CA 1MF2L 1OSPL 1P84J 2DQUH 3CC5A 4NN7B 1CFTA 2BFVH 3M07A 1KBGH 1I1AB 4GG8B 2X7LA 2NW2A 1YEFL 4HGWB 4M3KB 1A6TA 4UQ3B 4OBSA 3C8HA 4ORZC 1A1OB 1U8PA 3T8XB 2AJ3A 3ZMRA 4OF5A 3LKPB 1LO4L 3IS0X 5IMKA 1T0MB 3HC4L 4LSSH 4WEBL 4G8GD 2VLJD 2MQ3A 4U6XA 5HGGS 1UQSA 4Z0BL 5L88H 1S5HB 1QNZL 4FQCL 4EUPA 1G0XA 3CFDB 3ESVF 1QFUL 1L6ZA 3DI2B 1S78C 4X99A 2FB4L 4KKCD 4Y5VC 3UTTE 4JGUA 4JFOA 1FNSL 4D8PB 3O8XA 4M3JA 1F42A 1C7TA 1MCRA 3A67H 1IC4H 4XPHL 3JWNC 1QA9A 4TSBL 3JWOH 3LV3A 3LQAL 4TSAL 5E1HB 3BZEA 4PJ7B 5JTWA 4F7EA 5I19H 3VWJC 3L3OA 5I16A 3NZHL 1KJVB 2Y23A 1FZMA 4LU5H 1S7UA 1RV6X 2HFEA 3EO0A 3MV01 3M8OL 1Z9OA 5FYJL 1OD7A 4KJYA 1CTOA 4QXGH 4P2RD 1WJ3A 4OLXH 2VWEC 3BO8A 5IMOB 1E6JH 4Y16C 4AJ0A 5HGAA 5HDOA 1Q72L 2Y6SD 2Z4QA 5JLZA 4F15B 2BSSA 4HXBH 2BNQB 4D3CH 4NJAL 4NNXA 4M8QB 5IVZA 2BOCA 2H3NB 5DJZB 2OXHA 3MBED 3P0GB 5DSCA 2CRZA 4WWID 3V8OA 5ICYB 2IMNA 1FVDB 2P5EA 3B9KD 3Q5TA 5JR1H 1AGDA 1G7JA 1F6LL 3MV9B 3MGOA 1U8JB 2B20A 4G7VL 4W4OA 3S6CA 1BD2B 4UUJA 3D2UB 2R0WH 1J0YA 1KTDA 2DQHL 5D1QD 2OZ4L 3ZL4L 1AC0A 3VU2A 3MLTA 3BEVA 3QRGH 1TJIL 3QDGB 5IVXF 3ULUF 1ED3B 3VG0L 3LQZA 3BIAX 3QISA 3P73A 1O7VA 5ACLA 1L7TH 1S9XA 3KWWA 2RCSL 1TVHB 2Z93B 3FRUB 2VR5A 5F96L 2X4PA 3TN0C 3WFCL 3U4AA 1CICB 3GI9L 4ZDHA 5MI0C 3TGXA 2CUHA 1CG9A 4K94C 3BP7B 2EZ0D 2XTJE 5SWZD 4OZHA 4X4MA 1S9VA 3MRLA 4KZDH 3LRSB 5ETUB 2A1WH 1INEL 1ZGLB 4X5XB 4C83A 5CZVH 3WE6A 4PJ8B 3P11L 3MV11 4NQCB 3MJ8A 4AL8H 2NW3B 3EJZC 3P11H 4DN4L 5T3ZH 3QO0B 4JFPB 5F6IC 2X10A 1VACB 5ITFA 4NKMA 4WW1B 1OAYH 1HOCA 1YDPA 2H26A 3CDGB 3V5DB 5L2KB 1H3PH 3EOBB 1ADQA 4PJGA 4JLRB 2VXVH 4FNLH 1VPOH 1A1NA 1AIFB 1D9KC 1UYWL 3I50H 4G6MH 4K3JL 4Q2ZB 3RGHA 3SDCB 3VXOA 3PGDB 4KJWD 3CMGA 5D2NA 2DQJL 3LS4L 4DVRL 2ATKA 3NPZB 3SDAA 5EOTA 3OKMA 3VXSE 4TOYH 2PN5A 4CU8A 1FIEA 1FVEA 4MJ6A 5JPMA 4MS8D 1YMHA 4NDMB 4X80L 2Q6WA 3HE6C 4D9RE 2CLZA 4LHUA 8FABA 3BKJL 4BH8B 4JN1H 4JO4L 2DBLL 1LEIA 4DKAA 3RJQB 4YGVA 3WL9B 1CXLA 3TIDB 5DJDA 3VH8G 4NZUH 3UTQA 1NBVL 4NQED 2XWJB 1I3RB 2GQHA 4XCEB 2H1PL 2D2OA 2BNRE 4KI1A 4XGZB 3LMJL 5IVOA 1WT5A 3Q6FB 4M7KH 1K4CA 5HJ3A 1UFUA 4L8CB 2ZCKL 3NACL 1MCWW 2EKJA 1Q9OA 1YEEH 4MLIA 3HMWL 5J8OA 5D7KD 3RGVC 4LSRH 5I30L 1J11A 2X4NB 5IROC 4HEME 1FIGH 1XF4B 2HT3D 5DURB 3VFRA 5C08E 1B2WH 2WBKA 4M6OL 2PR4L 3VGAC 1KSRA 1G9ML 1G7MA 1B2WL 5C92A 1OF2A 1UWEH 4JG1H 4U1KA 1V7ML 3QFJA 4YO0B 5I30H 3LQAC 3GBMH 3HR5B 1YN7A 5HHME 3ARGC 4NN6C 1IEBA 1U3HD 1JZ2A 3ELAT 1A6AA 2BNQE 4WCYH 4JM2F 1EJ6A 1MCJA 1JE6A 2W65B 4G6JH 5TE6H 4GS7C 1TETH 1PKQA 5JDSA 1RK1B 4Y8AA 2YUVA 4LPXA 4XNMB 3U30B 1B3JA 1GXEA 2IEPA 2FBOJ 3TVMA 1EX0A 4N1HB 3TF7C 1QA9B 3BQUD 1A4JB 1V7NL 1B0WA 1JJUA 4EI5D 4HZLB 5DMKA 4F7EB 4GH7B 4JFFE 3FT3A 3O4LE 3DETC 1JNJA 1EZVX 5F7MC 4JRYE 3BKML 3ZO0A 4LCWB 1DANU 4PRID 2AEWA 4KTYA 5F1NB 1RJYB 1IAKA 3RDTC 4WIQA 3AFLA 3FN0L 3WNMA 2A83A 3G04A 1CDYA 1BM3L 5ENWB 3OJMB 1WK0A 3C8KB 1ZLUH 4P5TA 5L6YH 5TDOA 3PWJB 4JFZH 5C0GB 3L5HA 3BMVA 3G6DL 2ZCHH 2AV1B 3MLSH 2H3NA 2P1YA 5B8CB 1CGYA 4PRPE 3QUYC 3RIAF 1XGYH 4PJ7E 5DSCB 4Q9QL 2PO6A 2A77L 3R0MA 5DD0H 2ZJSH 4GUPB 5HYIA 3HC3L 4JRYA 1IFHL 4UT9L 4WW2C 3V6OE 4PJFF 3AS2A 1ZT4A 5AG8A 2FJFA 4Z8FH 3HUJF 5HYSG 1EO8H 1VGKB 5IQ7H 3BKJH 1W72B 5GRZA 3PWNA 4KK6C 4XB8A 4NO0D 2W9DL 1MOEA 5DF0A 3UYOD 4XNQA 3GB7A 1I8IB 5IESH 5MI0B 3PJSA 3BEVB 1NEZG 1MAKA 1BD2E 4PRDB 1YNKL 2OL3H 1BBDH 2DLFH 4TTDD 1CFNB 5JMRA 4HHAA 4YHKH 3VE0A 3D85B 3G9AB 1NSNH 4M1CC 2QQKH 2UYLA 4MXVE 4XNXH 2E27H 1U42A 4YZFF 1XF3A 3FRUA 1LP9E 1MHHA 1YMMA 3MRKA 4EBQH 4YHPB 2DB8A 5FF6B 4YUEL 1RZFH 1MIEL 3F58L 4N1EA 5I6XC 4RGND 2D7TL 2YA2A 4J8RA 3HZKB 3GK8L 2X2YA 2PW1B 3RL2B 4QXWA 5GRUH 3O45A 1CT8B 2IANB 1AO7A 4Y89A 5J56B 4OZFA 3IKCA 5DLML 1I9IH 4UQ2A 3T2NH 1J10A 4DGIL 1Z9SA 3DV4B 3L3KB 3VXUD 3PL6B 4D9LL 3EZ8A 1R5VA 1T7WA 4KKCC 4M62H 1HHIA 5FK9B 1UM6H 1GSMA 2YUZA 3ORJA 4L8BA 4U7MA 5F9WC 4F9PA 4FZ8L 3PXJA 5KAQF 4GRLB 1OTTD 3NCYP 1A5FL 3E0GA 1P7KA 2AXHA 5ID1A 2DKSA 3U2SB 3RUGB 3VXMA 1F13A 5C0BB 3BZ4A 4LAJH 3RX7A 3SDAB 1NBZA 4UNTA 3U4EA 3BMWA 5CBEB 1KPVB 1LEKB 5DD1L 1LO0H 2FJGA 1RU9L 4HJJH 3G6JB 3QNYB 1E4KC 1UM4L 4UU9A 1FO0B 4HD9A 4JGMA 1I8LA 3ZHKA 1FL6A 4H88L 3RPIB 5IR1A 4V1DD 1JGEB 2HVJB 2XPGA 3OSKA 4PJBA 4OF6A 1MCDA 5D2LE 3T65A 4L4TA 1HHKA 3QBTB 3T04D 2J1KA 1FFQA 4GBXD 3MLRL 1ZLWH 1G9MC 1RZGA 4OB5L 5FKAB 5IF0B 3LKRB 4TNVK 4HC1A 1IT9L 4PJFE 4F58H 2P4AB 4EXPX 1TNNA 2EEDA 3LN4A 4ZAKD 2CO6B 2XWBA 3KPSA 3PP3K 2L0DA 2AK4A 5CWSB 4M9OA 4AM0A 4P2OA 5EUOB 1N0XL 3UAJC 3GJFB 3SHSA 1AH1A 3IDIA 4XVJL 5C0AA 4HAGA 5CGMA 3BJLA 3L5WA 3JWDL 5I1IH 3OTTA 2DDQL 3QAZC 3T1FA 2VH5H 4ZNEA 8CGTA 4Q9RH 4NHUA 1HKLL 1MHPL 3CMOL 3RZCB 3UTSB 1TNMA 3QWRA 1QVOB 3OQ3B 4G43A 5FCUL 5DJ8A 3K2UH 4WHCA 3BP5A 4DW2H 3LSOA 2JK5B 1OTUD 4EUPG 2PETA 1IEBB 3GI8L 4W6WB 4FTVE 3MLWL 4Y19E 5JORA 1EO8L 1N3NA 3KXFB 3VMOA 5HHMB 2I60L 5HVWA 1PY9A 3DO3A 1WCQA 5CBAA 4MA7L 1M4KA 1KFAL 2FCBA 4JFHD 3TVMB 3MROB 4ZQKB 1AO7D 4R3SA 2BSTB 1A4JA 1F4WH 1U91B 1KYOK 1ONQB 3F7RA 3EJZD 1KG0B 3IDJB 3CZFA 1IL1A 1DQTA 3AS0A 3O9WD 3WIHA 1SM3H 1MRFL 4LK4A 5F9DC 1JN6B 3MRRA 4OGAC 1LO5A 3L3JA 3MCKB 3R8QA 4UIMA 4OLVH 4LLWA 3ARBA 1HINL 4K3GA 1D9KD 4UT6L 4NCDA 5ACMA 4WW2B 5F8RC 2FWOB 2ZUUA 4ZFZA 4U33A 3O4OB 1S7QA 4XXDB 3PWJA 3M1BB 3U9UA 2ADJB 2W9EH 2NCMA 4QHKJ 4YHYB 4R7DB 3A6OA 1T1XA 1QBLL 1EEQA 5B8CA 2NY1B 4X98B 5D7JA 5I76B 1A0QH 4GJTB 1BFVH 3O2DL 3X13B 1NAKL 2GTZA 3LRGA 1AHWC 3CSGA 5B22A 1S7VB 3KPRE 1W72H 3X12B 1VEOA 3PHQA 2OQJA 5SWZA 1T20B 5C6TH 5A2LH 1MCPL 2PXYC 3H42L 1OM3L 2W9EL 1HZHL 5IB1A 1H15B 3BIKA 1CGTA 5DO2C 3DPBA 3EGSA 1F58H 2I27N 2X4TA 4IOSD 1IMHC 4XAWH 2MKLC 3U9PH 1H3WM 2BC4A 4P48A 2Z35B 1LD9A 2IH1B 5GRYA 1I7ZB 2H6PA 4PYGA 3ZTNL 3WFCH 3EFFB 2PUQT 2FX7H 4WUKH 5E9DE 4Z0XB 5H8DA 3SKMB 2H45A 1L7TL 5IMMB 4MJIE 5F7WC 2DJUA 1C16A 2P44B 4DKFL 2AQ3A 4F33A 1J0ZA 2EH7H 4CAGA 4ONFL 1U8KB 5CGYD 3RHWK 5AZ2L 5DTFA 5CILH 4JFFD 3MRJA 1F4XL 5AG9A 5IFHH 5JQHC 1E28A 2X4OA 2BZDA 5E24E 3SE4A 1KV3A 1ZS8A 1UZ6F 3WNKA 2O5XL 1KLFA 2CR6A 5C08B 1IAMA 2YPLB 1N8ZA 1VGEH 3OPZH 3ALPA 5FKPA 2ITCB 4Q0XL 2XA8L 1TFHA 3WFZA 4ERSL 3FMGH 2V7HB 1CICC 3ARTA 4DK6A 5LBSH 2DAVA 1HN1A 1EK3A 5B38B 3CXDL 1F3DJ 4KY1L 4NN5B 1QO3B 3DECA 2AK1H 5DRWA 5E5MB 1BWMA 1X5AA 1A3RL 4J3UA 3FB8B 3S8WA 3WD5H 2X6MA 2EDBA 5DK0A 4KGLA 4XAKD 1UENA 4Z77B 3T0EA 1J8HE 3C6LB 1IGCH 4KKNA 3HZVB 3BPNB 4Z95L 3K4AA 1BBJA 3C5SA 4TUKL 2Y1VA 2BNRB 1S7WB 3QXDB 3UPAA 4PJAB 4N0FA 2EYRA 3MXVL 1RZ8B 5C6WH 5K59E 5GISL 5I1EH 2UUDH 4L1DA 2UVFA 5JOEA 4M62L 5DEGA 1Q94B 4Z95H 1OAZL 4JM2D 1HIMH 5T5FL 4HC1L 5IQ9A 5GSVA 2OJEA 3FHAA 4E9LA 3MOBH 3R06B 1R3JB 4YNYA 1QLRA 4Q6IB 2JJTA 4HXBL 5EBLB 5C0FA 3FHQA 4P2OB 3O2WH 1MFAL 5DI8B 4R8WL 1EXUB 5C6TL 4EQ2A 1KLUA 4RGMC 4OFVA 4Y2DB 2DL9A 2Y36H 4Z7WB 4BSVA 4M1CD 1KJMB 1AR1C 3BJ91 3GO1L 1F6AB 4RMVA 1CTNA 4WFED 3S96A 3NBNA 1YY8A 1J87A 3BRFA 3MSPA 5CSZB 1A6ZB 5C09A 5TH2B 4FQHB 4OCSL 4YPGA 4PTTA 5DT1L 2J5LC 4PJDB 3OB8A 4TVPH 4PJFA 1NCTA 3QIWB 4ZOCA 5IBUB 1ES0B 4IRJB 3MRPA 1QRNA 4Y5VA 3LV3B 1WBXA 2R56L 4PJ5B 5JIHA 1KEGH 3BGFC 4XI5C 5FYKD 5IW6B 2MWCA 4GRWF 1NANI 1NDGA 2JIXD 1EUTA 2OJZH 5HHPB 5E2UH 4PV8B 3MROA 4L8SC 1FZMB 4GG6A 4PJAF 3B4NA 4YXHL 3TO4B 5FFLA 1EEYA 4PRPA 5DGQA 5DHYA 4KVCH 5F1IB 4WV1C 3AM8A 3RL1A 5E56A 4MHHG 2PXYA 2WINB 4I0KA 3SCMC 3X17A 5C8JB 2W0FB 1NCWH 3DYPA 4KRPD 3H3PL 2BFVL 1T66C 3BYTA 5GJSL 4K8RD 2OMNA 3N9GH 1YEGH 5F9OH 3C9NA 3ZLQC 3QI9B 1B0GA 3OZ9L 3JV4B 4GS7B 3WKML 1HXMA 4UV7H 4L3EE 2XTJB 4EIZC 2DBJA 4ORGA 4NQXB 4ZOBA 4ZTPL 5FGBC 4Q9QH 3QG7H 3GRWL 3MV7B 4CMMB 3NMEA 1FVDA 2P5EB 4J4PD 1GIGH 1MI5D 4PJ7A 4LGRB 4GOSA 4U1MB 4PTUB 1EJOL 3SJVB 1YYLH 1HKLH 4LNVA 4MS8C 5ICZA 4HH9A 1T1YA 4G5ZH 3EYQD 4OZIE 3PHQB 2OMBA 2R23A 2P8PB 1T20A 3FQRB 4G80A 1QSFB 2HKFL 5DMGC 4U0RC 3EDJA 2FGWH 2YXFA 1RD6A 2RIKA 3BIKB 3O11A 5BJTA 1QKZH 4K94H 5HHXL 3C5JB 3MNWB 4RIRA 1K4DA 5FOBB 1CZ8L 5C2UB 1JP5A 3IFNH 2ZUXA 1BPVA 2AXJA 4PB0L 4HIIA 2W91A 4TRPL 3UBXB 4P49A 3VJ6A 1GJIA 1BZ7A 2J12B 4M6AA 1YC8A 1LDPL 4X0KB 3LEYH 1DL7H 4FS0A 3FQXA 4S1DD 2Y7QB 1IGYB 4K23L 3BUTA 1MWAL 2FATH 4Y5XC 5TE4H 5L7XL 5C09E 3DUSA 5EZOH 4XBGA 4ZTOH 3VXMD 2LE9A 1A7RL 1FNLA 4XCFL 3U36B 1U95B 3IU4L 5IWLC 1H0DA 2X1XR 2EDLA 1YEDB 1DUZB 2J88L 4MSWA 1AKJD 4LAQH 3QDGA 3V6FB 1VACA 3QCTL 2ESVE 4TSCH 4HIHA 3LKQA 3CDGA 3V5DA 3VW3L 5CEZL 5ESQA 2DLHA 4QF1B 4A6YA 1ZS8B 1U3HC 4GRLC 2VDLH 1BIIB 4NNYA 2VLKA 3TM6A 3SDCA 1CF8H 4FG6C 4GRWE 5C08A 3P77B 4JG1L 2HP4A 3RIAK 3J7HA 1FL3B 4KDTA 3KPQB 3E8UH 2EEAA 4S2SA 3UJTL 1T2JA 3E6HA 1T03L 5B38A 4Z7UA 3S37L 1S9VB 2AAVA 1FGNH 4IRSC 4PJGF 1U8MA 1EAJA 1IKNA 4ALAH 3IAGC 3EOYG 5DK0B 4IIQB 2D0HA 5DQ9A 3GSVB 4XP4L 3MJ8B 5C0CE 3IDGA 4EN3B 2Y6SC 5FB8B 3NIFE 4J1UB 4P59L 2YZ1A 3T2PA 2BVUA 1X5GA 4QRTB 2P43B 4MQSB 1A6UH 2HH0L 3QQ9D 2KKQA 4L8DB 1K4CB 3RFZC 3EDKA 4OTXH 4P2RA 2MCPL 5JZ7D 4KK8C 4OB5H 5ID0A 1WLHA 4JVUA 4GQ9L 1GAFL 1CE1H 3O6MH 1XEDA 3BKYL 4V2BA 5T1DH 2DS4A 1UG9A 4OZGF 3KXFE 3O2VL 5E7FA 1ND0A 4CVUA 1BD2D 4N68A 4W4NA 5GGTH 3RPKA 3SDAC 2X89D 3R06A 2WANA 2AGJH 4KMTH 4NT6B 1GGCL 1WBYA 5FDWA 4Z7VB 4MB5A 4J4PC 4NFDA 4L8SA 3CSPA 2A6DA 2CLZB 4LPTA 5EBLA 4ZO7A 4AIXA 4MAUH 1MLBB 5J12C 1QRKA 3SQOL 2K7QA 1LEIB 1KLUB 1CXEA 3V0WL 4Y4KD 1QFUH 1J8KA 2OK0H 1FNHA 4LBEB 4XP5L 1IFHH 4UT9H 1JGDB 3D9AL 4NM8L 4QRRD 4XC1H 1GZPB 1JF6A 1T83A 3PQYA 3N1GC 3Q0HA 3KVQA 4ZS7H 5A16A 4P5MA 1LK2A 4XMLH 5KG9B 1I1RA 4FQHA 2VLRA 1QOKA 1J5OH 1X5FA 1ZA6B 4FZ8H 4XPGL 1QRNB 1NGXB 2OZ4H 5TF0A 1T6WA 1CGSH 3DV6B 4X4XA 3BWAA 4G42A 43CAB 3SJVE 1CK0L 3TWCH 2HRPL 4HUWA 1NFIA 1X6LA 5GZOC 1BWWA 2JJTC 3RTQB 4RGNC 4LCWA 1JRHH 3NTCH 3MBXL 1FGVH 5F70A 4NUGL 5D1QA 4FXGB 1KN2L 4B7IA 2XG5A 4R8WH 5EBGA 5AYUH 2IGFH 4HJJL 2DQEL 2EH8L 4G7YH 2D7TH 1MEXL 2Q20A 4K7PL 2W0FA 5I73B 3IVKA 1B0RA 3TJHD 5HHOA 1FDLH 5DJXA 4X6EB 1JI1A 3O4OC 5J89A 2LU4A 4KU1A 5DZLA 3DMMD 4M4PA 2NZ9C 3IGAB 4P5TC 2GTWB 1T21B 4HWBH 3RI5F 2DQFB 2YUWA 4XZUB 2VWEE 1U8LA 4U6TA 1HXMB 1FBIL 2ZKHH 5E1AA 1NBQA 4OCSH 4JRYB 1I1CA 3MV7A 2MPAL 1ITBB 3ARBC 1WCBB 3QHZH 4G9FB 2Q87A 1FORH 4OUOA 5TDPA 1A21A 3SO3B 3BHBB 2YMXL 4U1JB 3WIIL 1F4AA 1AD9B 1N59A 3T0VA 4HH9B 4OCXH 4I18B 4GW5B 5FEBA 3DHMA 3V52H 3GM0A 1W0WB 1HNGA 3AU1A 1CFNA 2A83B 2VXQH 4AEEA 4NZDA 2APFA 2HTLD 3U7WL 2XQBH 1PEWA 4KPHL 5ENWA 1DUYB 4OZHE 3U7AA 1OOAA 4XBPB 4HS6B 2XY1A 2AK4D 2W60A 1VADB 4N8CL 3VXUE 1ZSDA 1I9JL 5C0GA 3U79A 1FNEB 1A3QA 2PTUA 2VR4A 4FRWA 5E2WH 4R4FL 1KIPB 2FGZA 2X1WL 5FF6A 4HIIB 4Z5RB 2A6KB 3S3JA 3BPCB 4NQCE 5HI4C 3IRPX 2YXMA 2IANA 2FNBA 5BS0B 5DS8A 2HLFC 4UINL 5HI5D 3C5ZA 3ROLA 3QFDA 1CLCA 1KCVL 3LMJH 3E6FB 4U1NB 3N85H 4POZC 5DMYA 4P2QB 4XNQB 4H26A 3F12B 1T04B 4WENB 3D3VA 3HC4H 4LSSL 1JTOA 1ZANH 3SOBL 1IJ9A 1A6PA 4KY1H 1U41A 4JPWL 4BZ1H 4A6YL 3HC3H 5IEKB 4XI5D 1SBSH 4M6NL 4FQQA 4YDJB 3WMSA 2MFNA 3DXAB 1QFWL 4O2FA 2Z31C 2EE2A 5JXEA 4NO3A 1ZK9A 2C3HA 1NGPH 3N0PB 2F54E 3BZ4B 3FT2B 4NN5C 4I5BB 4PJEA 4TYUA 5I1CH 1I1AD 1FL3A 2V17L 2H9GB 3DETD 2PKDA 4MNQA 4V2CB 3ARSA 3QQ3A 1K2DB 5D7LB 5IIEB 4I0PB 1LEKA 4XVSL 4C4KT 2VXSH 4WI3A 5IBUG 4G3YL 3G6JA 2ZOLB 3QNYA 4FQ2H 2OX5A 3BPLB 5D72L 4OFPA 3BQUA 4DCQB 2I9TB 2RQ8A 5IR1B 4K8RC 1DQJA 4FQJH 4UT6H 1Z5LA 4I1NB 4L5FH 1CU4H 2Q7NA 1OAUH 2VQUA 3BZFA 3GNMH 4S1RL 4H20H 1A6WH 1DBAH 4KROC 4AEIH 2OTUB 2VDKH 3TYFB 3SGEI 1SM3L 1FL5B 4HWBL 2KDGA 2VL5B 1F45A 3MREB 1PZ5B 3TNMB 4Z7OE 2XIDA 1UB6A 4JCMA 1P7KB 1BQSA 3IFOB 1PFCA 4P5TD 4B41A 5CEZH 3OX8A 2YD8A 1ZXQA 4ZUWB 1I3VA 4AM0B 5FYJU 1JV5B 3RVXD 3ZSSA 2CKBB 3WXVL 1D5MB 3DVNB 3QJFB 3IDIB 5CP7A 1S9KC 1KPVA 5CZVL 3UTSA 4JKPH 1RUKH 1B6UA 3VGFA 2KUTA 3OB0H 2J2ZA 3BAEL 5I15L 3NCFB 1ODAA 3ALXA 1CFTB 1UT9A 3T4AA 3WJLA 4F7CB 2JTDA 1T6VN 2D03L 2HTLC 2FX8H 1L7IL 3FT4A 4DTGL 4HWEH 3D25B 3V7AG 5HYSA 3MJ6A 5IT2H 2CRIA 2EYTB 2B2XH 5D71L 1IARB 4KQ4H 4RMRA 5B38G 1NUFA 4R3SB 4OCRL 4I9WE 4Z7UF 1R3HB 4WRLA 1DR9A 4E41E 5GGQL 4PY8J 1A3RH 3EHBD 3MRGA 1JN6A 1JFQH 2FEEL 1FYTA 4U4BA 3TYGH 4MB3A 2BVTA 4JQVC 5IHZB 4EZMA 1RZIA 3BVNB 5SV4A 3W82A 4Y4HD 1X5JA 4WW2A 2UZIH 3IVKB 4PJHB 5JXED 5F9JB 5HVFB 5DJXB 1GHFH 2OSLB 2V2WB 4L4VD 4WFEE 1A7PH 1DBJH 5SWSB 2GSIB 4JDVB 4AIZB 3RBGA 3LB6D 2ZJSL 4FFYH 3RWDB 4R97C 5KAQG 3AAZA 4M7ZC 4PGJA 4NRZB 1CICD 3I6LD 2IALA 4KI5F 5T5FH 3U7YL 1JCKA 3WBDA 3ARVA 5ISZB 2H8PA 2DMCA 5SWZB 5E2TH 3TO4C 4JN2A 5C0CA 3WLWC 3K1KC 4OKDA 3GBNH 1OGAD 5I8OL 1MCIA 5B3JF 5LJYH 3IFNL 5MEPA 2B8OT 3MODL 4KQ3L 1YNTB 1G9NL 2GY5A 3I2CL 4UIMB 4WUUB 3RVWC 4LLAA 4OFYA 3FB6B 2Y5TA 5EZIL 4OZFG 3MLXH 4AG4L 3ULUH 3RRQA 1U3YA 2VLME 5CLWA 5L2KD 1ZSDB 1VSCA 5C6PB 3OKDA 1AE6L 4XVTH 4Z0XA 3SKMA 1BZ9A 3K74B 1T1WA 3BZEB 2E3VA 1TJHL 3MACL 2EDYA 3H9HA 3OAUH 2A6KA 1U8JA 2DQCH 2DQIL 1IVLA 4PB9H 1DBBH 1GVIA 1LK3L 4Y4KC 3D5OF 4ZAKA 1YECL 5J9PA 4LCYB 5DS8B 2AS5M 3D87B 4PREB 4KMQA 2DQEH 4L9DA 5KS9A 5D8JH 3VMNA 1OM3H 3S5LG 1ZT7B 3TBWB 5C0AD 3CZJA 4HQQH 3TBTA 4H26B 2Z4QB 4GXUM 2QSCL 4YDVA 2ZPKL 3KYOA 1MHEA 3DI3B 2D9CA 3O2DH 1LD9B 2IH1A 4ZDHB 4XPFH 1WEJH 1AQDA 1I7ZA 4IOIA 1ZHLB 2H32A 3ULVE 2B2XL 3DXAA 1C5DB 5DRWB 4EDXA 5GZOD 5ABDE 3GSNA 3SDDD 5IMMA 2MSPA 4YFLF 3UDWC 3MGOB 3HG1D 1KJ2H 4WHYH 3RWFA 2NY6D 4DZBB 4S1SH 1G84A 2EDEA 2G2RA 5HPMA 4IDJL 1KTDB 2KZ1B 2R8SH 1J18A 1XAUA 2CLRB 5FUZL 4OZGA 4EN3C 4NHCL 2R2EA 4KDTC 3WUZA 2YR3A 4WJ5B 2EYSA 1CE1L 1UACL 3IDNB 2NY4D 3EAKA 4KRPC 4W6XB 1PYWB 4KH2A 4O2EB 4F2MB 1S9WB 1KGCE 5A2JH 4C56D 2YPLA 3CLEL 1SJHB 2J6EH 1NC4D 2A9NL 3HCVA 1MH5B 4N8VB 3H3BC 4PLNC 1FL5A 5F89B 1WTGT 4DVRH 4MA1B 3QHFH 3A67L 1PZ5A 3NGBC 3V95A 3ZKNC 3TYGL 3MRHB 2HFFA 4N0UA 1UB5B 2AABL 3QZWB 1M7DB 1SVZA 4PJGE 1CLOL 4QHLB 5KOMC 5TPWL 1EXUA 4D0BA 2N7BA 4QRUB 1D5MA 2NXZD 1OP5K 3TIDA 4UZGA 3O3UN 4MD4A 3HZVA 5CZKA 5GS1A 1MAML 2AGJL 2HT4D 3PF2A 3KYNA 4KMTL 5DQDH 1QBMH 4IRJC 1E27B 3O3BA 4PRIB 5JPNB 4KQ3H 3QXDA 3F7VB 3MLWH 5CSZA 1A22B 5D6CA 5HJ3B 1DVFA 4F8TA 1DE4A 4PJGB 1KIUA 3OKNB 4U6HA 5DJCB 3WSQL 1QRNE 2OLDA 4G6KL 4IRJA 4PLJC 3BDYL 1MI5E 5HHOD 3Q3GA 3QZWG 5D1XB 3WO3B 3D25A 1CCZA 2X4NA 2ATKB 5EOTB 1NDGB 4QOKE 2VE6A 5F21B 1NFKA 3BH9B 1QLRB 3ZT5A 1WUNT 3RNKA 5ISZE 4YHMH 4JFFB 4S1DC 2LFGA 3BPOB 4QOKD 3WXWL 3K3QA 3MRNA 3UO1H 1WF5A 3BUYA 1D5ZB 3TNNA 4BUGA 1U8OA 4YO0A 3F7QA 3RZCC 4U49A 3UZEA 3WO4C 5C8JA 4HX1B 3KHOA 5C08D 3QHZL 2X42A 2XWJA 5JW4R 4PJDE 4PG9B 2ICEA 2FECL 1BFVL 3QPXL 1BEYL 1BVZA 2R2HA 3FQNB 5JW4N 4PRHA 3X14A 5DRZB 1YPZE 4HKBA 1HSBA 4XNMA 1UZ8A 4YPGB 3FN9A 4IMKA 4LASH 1EHXA 3OAYH 3SDDA 4CVZB 5SWSA 1F00I 3QUZA 5AZ2H 3ARGB 1IAOA 1RZ7H 4XP1H 4PLKC 4PTUA 1E6OL 1EMTL 4NQEE 5J3HC 1MHCA 3KPPB 3PWPA 4OZFH 4X7SL 3I75A 1Q8MA 4RGNB 4WFFE 5CJOL 2H8PB 3ZYOA 3S97C 1IAKB 2B39A 3I50L 2V9TA 1B90A 4JZJB 1LO2L 1KXQE 1KIQB 4C56E 5D70L 4HIJA 3GSXB 3C5ZD 1EAPB 4U3XA 6CGTA 3HR5A 5L0QC 3C5JA 3X3FL 2UVEA 3PDOB 3W5MA 2EDOA 1HQ4B 2C3GA 5HI3D 4KJWC 5CHNB 1B0GB 5I1HH 2VRAA 1CGXA 1YJDC 3BD5A 4KI5C 2JCCB 1RZKH 2ZUWA 3QDJE 5I1LA 2I5YL 1EO7A 5IVNA 4RMTA 4I3SL 5IBLD 3BEWB 4RRPG 4PS4L 4CMMA