5JOFA

Crystal structure of vrc03 ghvglv antigen-binding fragment.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
220
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARRGSCDYCGDFPWQYWGQGTVVVVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VRC03 gHV heavy chain
publication title Somatic Hypermutation-Induced Changes in the Structure and Dynamics of HIV-1 Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 220
sequence length 224
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jofA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jofA01
4BQCA 4Y7MA 5IR1B 4G9DB 3EAKA 3UC0L 1FLRL 2W9DH 5IG7A 1GIGL 1MPAH 3QCTH 4L3CA 1XZ0B 3O3BA 2FLRT 4XMLL 3WSQH 1C08A 4X4MA 1QLRB 2WM0A 2X4UB 3QDGE 4CN4A 3NTCL 2H26A 3GIZH 3CVHL 2EXYC 4DW2H 2JTDA 5JMRA 5DRWA 5F93C 1N6QL 5BVPL 2WK2A 4HH9B 3MV9B 3P4LA 4Z7UF 1UACL 4WWKA 4AEIH 5HDQL 1RY7B 4HUVB 4O2EB 2C7UA 2ZP0T 1M71B 1AR1C 5ICZA 1PSKL 2AI0H 4JDZA 4JFYA 2Y25A 1WCQA 2VDRL 1JF6A 1S7UB 4Y5YB 5D2NA 1H8NA 3AU1B 4F9PC 4HKXB 4JFHD 1NGWB 4J4PD 4MB5A 5D7KD 5E70A 2G5RA 4Y4KB 5DVLA 4HUXB 1N3NB 5I76A 1AXIB 3FB8B 4RCAA 4Z77B 4RISH 3KJ6H 4UU9B 3TFKC 2AEQH 2F58H 4G6FB 5EC2B 4KH2A 3TCLA 4JLRB 1F45A 3PHOA 3QYCA 4PG9B 4AEHH 1QVOA 1DBJH 5BZDA 3WFEH 3CXDH 2VC2H 5TE7L 2MQ0A 2VDLL 2VLRD 5IT2H 4DK6A 3TGXA 1S9XA 3P9LA 2E6QA 2CLZA 5KZCB 4Z18A 3VE0B 3MLZL 3TIEB 4RWYL 3IJSB 4H20H 4PLNC 5C0RL 1Z9OA 3VXNB 2X5PA 1RD6A 4ZFGH 3UXFA 5TQ0H 3WFCL 1YEFL 4KK5D 1PVHA 4PJBE 2WBJA 3TIDB 4JO4L 4M48L 1D5ZA 3O6ML 2JE8A 2ZUWA 3WBDA 1FBIH 2PW2B 1OSZB 4LSPH 1KGCE 1N0XH 2YRPA 4I5BA 2ENSA 4GMTH 5DRNB 2FGWL 2PETA 2NY6D 4PGZA 2A9NL 4XX1G 3ABZA 4FS0A 2V5YA 2PN5A 5GRUH 3NBNA 1S5IH 3VGHA 1UC6A 1I7ZB 5MEPB 3RIFF 1OARL 3HUJF 3MXWL 2EZ0C 1XGTA 3WKML 4LCCC 3UTSB 3BSZH 3BH9B 4NQDA 5T3XE 1NBVH 3IKCA 3KPPB 5T3ZD 2Y06H 4U1HA 3WHE1 5E2WL 5CUSH 2HJFA 4NRXA 5IVXF 5HGHB 3WLWC 4PJCA 5KJRL 4WW1A 1KTRL 3S36X 2BRRH 2OTPA 4HLZG 4H5SA 1JUFA 3MV11 3QCVH 4MNGA 3RWJA 4R4NC 3GMRB 3TM6A 5ESQA 4Z7VA 1A6AA 2NX5D 4ENEC 1GC1L 1UXWA 3BGFB 5D9SA 1K3IA 3SDCB 2B1HL 1T7VA 1EO8H 4NFBA 5E95B 4ETYA 3NAAH 2IMNA 4GT7A 4Z7NE 2PF6A 3LKNA 3VG9B 5HYIA 4JB9L 1YPZA 2Q76B 4J3SA 5KSAB 4MD5B 2UWEF 1AI1H 1LP9B 4ONHB 1DEEB 5CP3H 2IFFH 2ZOLA 4MCYB 2XXMB 2C1OA 3BE1L 2YD4A 5DA4A 1J0KA 1F2XK 3MNWB 3HI1A 2I07B 3ZHKA 2IWGA 1B0RA 4FFWC 3HZYA 4KK9C 4NHCH 1FP5A 3GSNB 3HNSL 1ZHLB 2MPAL 3BP5B 5H37G 4D0BA 3PWPE 1GAFL 3E1F1 4EKXA 1AH1A 1G9EA 5I18H 4JFEB 4GKZB 1MCQA 4NZTL 1IZKA 5FV1L 3KPNB 4CVZB 2B39A 3V6ZA 3D39E 1MI5E 4LLVB 5B3JE 2J6EL 2A1WH 4G80B 2XQBL 3RPIA 3PL6C 1JF1B 2BHZA 5KW9H 5I17A 3ULSB 1MFEL 5EU7C 2VITB 2J6EA 4WNQA 3G5ZA 4ZD3H 1YEGL 1MREH 1X4XA 4AIZB 4ZO7A 5D2NE 2IAMC 4NKMB 5JZ7C 3CFKB 4E5XB 3FRUB 4AIOA 5A16A 3VRJB 4L9DA 3VFMB 3QIBC 3KNBA 5L8KB 3C6SA 5CEXB 4MXVF 4CUCA 4PLKC 3MYJA 3D0LB 4U1SB 4QOKA 5JHDA 3KS0H 3GK8L 4PUBL 4EUPG 3QXVA 3O45B 1VKXA 4HKBA 3PDDA 4ODVL 1PG7H 3EJYD 5FDYA 1KPUA 2YUZA 1WBZB 2K7QA 3ECBA 4X7EC 3O2VH 5TE6L 5C2BL 5DJDA 4MS8D 3ZTJH 3OGOE 4TSAL 4F33B 1I8LA 5KN5B 1OLZA 1QBLL 3G5YB 3V6OC 2EC9T 3BZFB 3VXSD 5D5ME 5EG6C 4JFFE 3MJ8A 2BDNH 4XNQA 1S3KH 3QZWB 5D1ZD 1B2WL 1CZ8L 3TVMB 2XRAL 3UJTH 1EUUA 5D2LB 2KQNA 2X1WL 2AW2A 3BPOC 1INEH 3HN3A 2FYYA 4HPYH 1A1NA 4TULL 2CUIA 4PBVC 5C70A 5MHSE 1KCVH 2YKLL 3B5HA 3UP1A 4FNLL 3NFPA 1GH7A 5EA0L 3ES6B 3JUZA 3BKCL 5CIPA 4G6JH 43CAA 1N2RA 5FHAH 3QUZD 1J10A 4OIIL 3GMLA 2DWDB 3MRQA 3BZ4B 1D5XB 4DGIL 1BBDH 1L0QA 4GG6E 1CDJA 1G7QA 2X7LA 4HJJH 3O6LL 1CD1B 1OP5K 4RFNB 5C2UB 4M1DL 5IK3B 2V2XA 2CDGA 4YHPA 1HINH 2JK5A 2YD7A 4HXBH 2WBKA 3B2VL 1F90H 5F9AC 5E2TH 4P48A 3OXSB 4PJCE 1HKFA 3PUCA 3MUHL 2CKNA 2DJ4A 3LSOB 5IEKB 2V2TA 2XPGB 5KVMC 1NMBH 1T1YB 4MNGE 1S5HA 2G2RB 1OGAA 3IFOA 1T22A 5HHOE 3RWCB 4FQQA 3WJLA 4U1LB 2FH6A 1T3FB 4KI5F 1JRHL 1RFDH 3IDGB 2JIXB 3GB7B 1AJ7L 5HJ3A 2EYSA 3VDCA 3RX7A 1IC4L 1NC4A 2X4OB 1YPZE 3DUUB 4LNRA 5TE4L 4ONGL 5ID1B 1NDGA 2YN5A 3VA2C 4B7IA 3FT4B 4ODUB 1EBPA 3FT2B 4NJ9L 5J3HD 4GS7B 3TWCH 5EFIB 4LVHB 3EYSH 5A2JH 5LXGH 4OZGB 5DURD 5T1LA 5D1XC 2FO4B 3DYPA 4X6CA 1JRHI 5A3IC 3WNLA 2E9IA 3QDMB 2Z8RA 1R6VA 2YHGA 5LGJA 4NN5B 1ES0B 3MO1A 1VADA 3WJJA 4BH7B 3MR9B 4G8GA 2G75A 3PDOB 2ZSVB 1A21A 3ZSSA 1QSVA 1FNFA 2FX7L 3IFLH 2Z8VC 1AD0B 4M7KH 2RFXB 5HYQB 5FB8A 1G7HA 4XRCA 3WNNA 3CIQA 3R1GH 3KLAA 3J8F7 4H26A 4Q9QH 2OP4L 5GQBA 4P5TC 1L7IH 4GKSA 3TT3L 1A4JA 3MREB 1T6VN 1EEYB 1BD2A 1OB1B 3MXVL 4ORGB 3MBEC 1F4YH 5T5NF 4QNPE 4PRBA 3ZE2F 1KN4H 2BVQB 1HHJB 3KXFD 4LQ1A 4LPVA 1GYAA 3DURA 5DC0A 3VFUA 2WIIA 3ARVA 2A77L 3T0EC 5IW6B 4S11A 4C56B 1IGFL 3O11B 4X4XB 3SKOB 3LPFA 4I48A 1DN2A 1ZT4B 5ILTH 5JHDE 2ATPA 2JJSA 1N26A 3VWKB 4FFZH 1XF3A 3ARBD 3SDAC 4Z95H 1MWAL 5FYJH 2VDQL 5IHZB 5DHVB 3HZVA 1UJ3C 2V7NA 1F6LL 4PJGA 3S8WA 1RIHH 3QFJA 4YBQC 1MWAA 3D85B 6FABL 4L4TA 1TLKA 4QRSA 3L3HA 3S88H 4BFBD 4OD1L 2Z35A 2IH3A 2HT2C 5FO7B 5TDPA 4X7SH 3CJJA 1CI5A 4OZHE 2AAVA 2DWEA 1IGIL 3ARGD 3RU8L 3QIUB 2OR9L 1A6UL 4XI5D 4WVRA 1KEGH 1RZ8B 2R15A 2MCPH 3C2SA 1ZTXL 3FQTA 5SV3A 4NWTL 3I3BA 5IVNA 3CDGB 4WW2A 4QRUB 2F9BT 3BKYL 1NFDA 5C08A 5CJXC 2CIKA 2AK4E 3LH2L 3P3YA 2Y07L 2AGJH 4BFGA 3TJHC 4HWEL 4KQ4H 4L9LC 5FYKH 1JPST 4XC1H 4CADB 1R3JB 4LSQH 4HIIA 1F11A 1WICA 2C3VB 1S9KC 3MNZA 4QHUB 1UVQB 1VESA 3OJDA 4JRXB 1PZ5A 2P5ED 3HI6H 3F8UB 3LN5A 3MRMA 2X10A 4APQD 4RMUA 1JYVA 2AXFB 2Y23A 4OD3L 4Z7WF 3WXWL 1LDPH 2QQLH 2A83A 4YDJB 4KI5C 1U8PA 4PJXF 1WLHA 1BECA 3S36H 5JO5B 4WY7L 2XT1B 3NZHL 4IMKA 4EN3A 2FB4H 1SMOA 1IARB 1ZV5A 1CDCA 2NY1B 3LEVH 4NWUH 2BSTB 4R3SA 2EKSA 4ZNCD 4NGHL 2ERJB 1ERNA 4KROB 4P46D 4U1JA 3DVNB 1OGAE 3H3BC 4JPIA 1DBBL 3C2AH 4X99B 3M1BB 1SYSB 4EXKA 5SWZA 4JG0H 1RZGB 1IC5H 2XWTB 4OLXL 2WV3A 2CLVA 2EE2A 3FTGB 5A43C 3UMTA 2R29H 3RIFK 4GAFB 4Q6IA 1A6ZA 1N7MH 3FQRA 1QA9A 5FIEA 4OTXL 3W11D 3EOBA 3DROA 1T21A 5ANMB 2ED8A 1CBVL 4KK8D 4PJAB 2DJSA 1TQBC 4X4ZA 1ORQA 3ARQA 3QIWA 4Y5VB 3RTQB 2HMIC 2MHAB 4YQXH 1U8KB 2FCBA 3BRGC 1MFDH 4I3SL 3EFFA 2V7HA 4NQEA 4JG1L 1HQRA 5IROC 1ROWA 4TTDC 1DFBH 4KRNA 1XCTA 1EHLL 3BMWA 2R8SL 4O2FB 1YQVH 3MLXL 1A5FL 4ODBD 5AWNL 1ZHNA 4G8GE 3H42H 2D03H 5I73C 5IHBA 1RMFL 1FNHA 2R0ZH 4Y4FD 1GPOH 3PWJB 5D96B 3SDXF 4B0MM 1TVHB 2AABL 3O6FA 3NIFF 1CICB 4FXLA 5CEZD 5CFHA 3C5ZC 1NCDL 4UI2A 3G6DH 4LLWA 4P57A 1LD9A 4OBSA 1C8PA 5E9DD 5INCA 2VZUA 3OHXA 1NGYA 4XNYL 4EI6B 3T3MF 2DLHA 1W0VA 5DRZA 4FQXA 5KSBE 4S1SH 4K8RL 3OR7A 2HFEB 4JPVH 3FONA 2VWEC 4MX7B 3TNNB 1NFKA 4ELMA 3VD3A 5IWLA 4TUOB 2YA2A 3F7VA 3V0WL 5IFHH 1GOGA 2AJSH 1JPFA 1RIUH 3WHXB 3KPOA 5EB9A 1KBGH 2VE6A 3UTPD 5FUCE 4YWGH 4JRWA 4YGAB 1VCAA 1NEZB 2CQVA 4TSCH 3QDAA 5CBAB 3B6SB 3ULUH 3S6CA 1KIPA 4N68A 4JFDA 1QQDB 4PJGE 2VABB 3VFOB 1R5WA 3EJJX 3HCVA 3F65A 4OJFH 3BEVB 2IBZY 4GAGH 4LAQL 4XMPL 4HIEB 4KRMB 3P0YL 1MCIA 4DN3L 3IFPB 3U0PA 1A64A 3JWDC 3ROOA 2OMNA 3QUYC 1AFVH 1U8MA 1XF2B 4LPXA 4YPJA 3MV7B 3NMEA 2DQFA 1MHEA 1CWVA 3HC4L 2YC1A 1AIFA 5F9DC 1KCSH 5MEQA 5GRJL 1IFHL 3ZKXB 2FJHB 1WITA 4PJFF 4I77H 4X7TA 4WU7B 1FCGA 2X4NA 4OCSH 1CFQB 2DQUH 3MRFA 4EI5A 4IS6A 2NR6D 4ALAH 2VDKL 2P5WD 4L8DA 3I2CL 4Y4HC 2WANA 1T1WB 5EO9A 1KTDA 3RY5A 2GJZB 3WD5L 3BIKB 2ICCA 4ZG1A 5DUPL 4HUUA 4JRYD 5EPMA 2BNUB 3VCLA 4LASL 4XNXH 1QUNA 3D3VA 1IAIL 3GJFH 3LRSA 2APXA 4UBDD 4G9DA 3U7AA 3NCBB 3P40A 3LDBC 4QRRE 1U3YA 3X11B 3CMOL 1SEQH 1XZ0A 5BW7A 3QUKA 4WRLA 5LBSH 4FZEH 1QLRA 3L7FB 4MJID 1Q0XL 3TYGL 2X4UA 3UPRB 4G6ML 4DUXA 1F8TH 2VQUA 2YRLA 2Z91B 3ZDZF 5C92A 2IC2A 4D9LH 4C4KT 4WTWA 1P53A 4YXKL 4HH9A 1N64H 3MV9A 1IAII 4J23A 4HLJA 1O7SA 3R06B 4HUVA 4O2EA 5MEOB 5E08L 3CAFA 1PKQB 4LVEA 1AGBB 1AGCA 5ISZB 2CK2A 4Y5YA 1U2HA 1TPXC 3AU1A 1JN6A 2ADJA 4HKXA 1NGWA 4XXDB 3HC3L 5EIVA 1UJTA 1YYLH 3EFDL 3DVIA 4LCIH 4M3KB 4Y4KA 2BNRB 4HUXA 1N3NA 5BCAA 1I9RL 3FB8A 4LKXB 1IBGH 3WYRA 4Z77A 2W59A 1WZ1H 4UU9A 1OAUL 2VLJB 4G8EB 1NGQL 5C0AE 1EEUA 1V7MH 1G6RL 4I0PC 5EC2A 4NQEE 1H5BB 5GZOC 5B21A 3HR5B 4JLRA 1RZJL 1MJ8L 3O9WD 2VH5L 3ZDYF 5TJWK 4JE4B 4QRQB 4PG9A 2WUCH 1JI2A 3RVUC 1TVBB 4H8WH 4PB9H 5GPRA 4RZCB 2XXCB 3HE7C 3VE0A 3TIEA 3C5JB 3MJ9L 3IJSA 3OR6A 1FNLA 1QFWM 4NM8H 3GMQB 2I5YL 3T3PF 3RVXC 1U42A 3MJ9A 5ECJE 1Q1JH 2ICEB 5DXWA 5IFJB 3VXQA 4PJ8D 4MAYB 2X2YA 4O00A 25C8H 2PW2A 1OSZA 4PY8I 3FO1B 3RNQB 4NUJB 4DKDC 2DI8A 2YWZA 5TF1L 1BJ1J 3BD5A 4ELME 5IMMB 2WNGA 4XTRD 3FN0H 5T1KD 2C5DC 5DRNA 5KG9B 4GRLD 2HA1A 4HIXL 3GHBL 3MRDB 2CLRB 2VIRB 3GSWB 1I7ZA 3HE6D 5D72L 2OTWB 1GHFH 1FGVL 1PYWB 1A47A 2EDLA 4K2UH 4EJ1C 3UTSA 3BH9A 3OB0K 3ZKSD 4UOW0 3OGCB 4TUJB 4X6FB 3O2WL 3KPPA 1U2CA 4TVPD 4WHDA 5DJCA 5HGHA 3L3DB 2EDBA 5L88L 4UB0L 4UT6L 2R4RL 1IKNA 4NYLB 4WGWB 3GMRA 1IT9H 4C4KO 4JM2D 3H0TB 4ETQB 1YECH 3I02B 4Y19D 3SDCA 1K6QH 3AS3A 3MROB 1U3HD 5CSBA 4K07A 5IQ7L 1YUHB 2Q76A 4ZSOE 3RBSA 2JKXA 2A6KB 5KSAA 2N4IA 3JWOH 4OCYL 4YXLH 4F2MA 4MD5A 5DUBB 3U4BL 3T0DA 2NY0B 2CRIA 1JE6A 4LCCB 1LP9A 4ONHA 1DEEA 2Y7QB 1PFCA 4FQLH 2E5EA 2H32B 4MCYA 5I1JL 4LDEB 5LAXA 1JNLH 3HNTH 4OGZA 4PJIA 4YUEL 3GSNL 3MNWA 4YO0A 2I07A 5D70H 3MLPA 4RGND 5GS0H 3VW3L 12E8H 3GSNA 5E8NB 3C6LD 1ZHLA 3LN4B 2FECL 3BP5A 4L1HA 3HS0B 5DD0H 1A3LL 1MCNA 1JF5A 1NAMB 1D5MB 4JFEA 4KTDH 5FF6B 2RB8A 4GKZA 4RMRA 3VXMB 4DJMA 5MEND 1Z9MA 1MELA 3KPNA 1LO2H 4CVZA 3V5KB 1XIWC 1MJUH 5FHBL 3QG7L 3I50H 4BZ2H 3PGFL 4LLVA 2MSPA 4GBXA 5GIRA 1RULL 4G80A 1JF1A 2XZAL 2VQ1B 3ULSA 3IU3A 4P4KC 2VITA 3BJLA 4JPWH 2VB5A 5I75C 4NQSB 1GJIA 3U7YL 4AIZA 2FECI 3U9PH 4P23C 1LILA 1HDMB 3CFKA 4E5XA 3FRUA 3VRJA 4PRPD 3VFMA 2CR3A 5CEXA 4F8TA 4S10A 3D0LA 3RA7H 1RUQH 3A6BH 4U1SA 4UIMB 4U1NB 4M8QA 4Z7UB 4YBLC 1J8HE 1FYTE 1MLBB 4PGDB 3RY4A 5L2KB 1WAAA 1WBZA 1WF5A 3GO1H 4ZOAA 4A2MA 2HYMA 1Z2KA 3CCHA 2HTLC 5T33H 4F33A 4K7PL 1XGYL 1P7QB 3SGJA 3RDTC 3G5YA 2O26U 2X4QB 4XVSL 3PL6B 4U1GC 2HT4D 3FN3A 3BZFA 4WCYL 4AEFA 1U9KA 1ZOXA 4LVOC 2OJEB 4UT9L 5C0NC 4X4YB 2NXYD 3QZWA 3K7UA 1O0VA 3MNVA 1JZ4A 3TVMA 3MLYL 5E8PB 3IRPX 5DT1H 5B39B 5D2LA 3I6KB 1WEJH 1U6AH 2IAMB 4KC3B 2HTKC 3QIBB 3FT3B 5I15H 5DTFB 5DO2C 2PYED 3I6LE 3ES6A 3VFWB 4FQIH 1BP3B 2DWDA 4S1RL 2JB5L 2E7LC 1IAMA 3NCCB 3BZ4A 1D5XA 1U8QB 3C87A 1UB5B 4LIQH 4ONOA 1EUTA 4IRSA 2LU3A 3HZMA 4I18A 1CD1A 4YXHL 5K33A 2DTML 2IH1B 2GY7B 3L1OL 3T2QA 5TH2B 5C0CB 3KDMB 4L4VD 1KNOB 1WZLA 4KJYA 2Y6SC 1QBBA 2F8VA 5I1HH 3NIGE 2VYRE 4N5EC 3LN9A 5C6TL 2V2WB 3KPMB 3OXSA 3UCRA 4XBEH 1I4FB 3LMJL 3S96A 1OM3H 4MJ2A 4U1IB 3BPOB 1MHCA 3CLFL 3LZFH 3JXAA 3LSOA 4IRJC 2ZCHL 1MY5A 5IEKA 3VXRB 2XPGA 3R8BB 4JAMB 2G2RA 1B3JA 4OZFH 1CFSB 1JHLL 3RWCA 4WO4D 5ADOH 4P4RB 4QHLB 4U1LA 3AB0C 1T3FA 4RGMC 2FWOB 3IDGA 2JIXA 3G6JE 3GB7A 2P24B 4ZUUB 3BXNB 2VDOL 3QUML 1IGMH 3E8UL 5IVXB 1J7VR 4Q9CA 1LEKB 2X4OA 3DUUA 3G04A 4IIQC 3NABH 5EUKB 3IJHA 4LSSH 1VPOL 1DR9A 3FT4A 5IEHB 2RIKA 1LP9E 4NC1E 4ODUA 3ZL4L 4G43B 4ZAKC 4GRMA 3FT2A 1A7RL 4XP9H 3SJVE 4HFWB 5F7DB 5GGRY 4HKZB 4OUUB 5EFIA 4PJIE 1J11A 2X4SB 2UY7A 1DQML 3V4VL 5DMGC 2FO4A 3P0VL 3MZTA 3QDMA 5F72S 4JGMA 3BP4B 1X6NA 2WMPA 4TVPH 1LWRA 4J3XA 4AJ0A 2ORBL 1AQKH 1ES0A 4G8FB 3ZZ1A 4WHTB 1FFRA 1P2CB 5IV2A 3O4LD 4BH7A 3MR9A 4OCRL 1B9ZA 5C1MB 2EYTB 4UV7L 2ZSVA 4OFYA 1UM5L 3U2SB 2XWJB 1KELL 4OBRA 5HGAA 1SQ2N 1JPTL 4QWWC 1AD0A 4NUGL 1L0YA 1E27B 4UV4L 3STZB 5HYQA 5HGBB 5IFAH 3STBA 2X70B 4HIJB 3JV4B 1YMMB 5DEZA 2VUOA 3KWWB 1HWHB 2VDML 4XAWL 5EZIH 3TN0D 2ZJSH 1F5WA 1T03L 2CXGA 4XNMA 1KPVB 2X4PB 3MREA 2W38A 1EEYA 1UM6H 3QPQC 1OB1A 5BRZB 3CVIH 3BT2H 4F7MB 4LPWA 4JO1L 2BVQA 1HHJA 4DVRL 3I9GH 1FYHB 1T83C 1UM4H 3O41B 43C9B 2EH8H 5IW6A 4C56A 3O11A 5D1XB 3V7MA 1MRCL 4X4XA 3SKOA 1A1MB 3CSYB 3FQXB 4JPKL 1ZT4A 1C5CL 1XGRB 2ZSWB 2OI9C 3P30H 2EXWC 3VWKA 5EUOF 3I84A 1QTYT 4ZUTB 4WWKD 2P8MA 5IHZA 4O4YH 1WAAE 3H7BB 1NKOA 5FYLH 3D85A 2YUXA 1VGEH 2E7HA 3KYOB 4YHYC 1MCPL 1FZKB 5SX4I 4M4PA 2C26A 1X5LA 4WHYH 2D0FA 5FO7A 4OLUH 1CU4H 2DBJA 4P5TB 3SKUD 3E0GA 1UH3A 4OCWH 3CFDB 3B8YA 2AJ3B 3MBEB 4MQXD 1CFNB 2WBWB 3QIUA 1J88A 2R69H 1RZ8A 4NOFA 2X1XR 1XF1A 4HG4K 2X6MA 3A6OA 2G9HA 3CDGA 4QRUA 4JQVC 3T0EB 2Q86B 1ORSB 5BO1L 1L6XA 2R0KL 3NZ8B 3FO2A 1GGBH 2A9MH 3RWHB 4PJHF 3SDAB 5A2LH 4Y1AB 1G9NL 4G9FE 1FPTH 4NN7C 3EZ8A 3KLSA 4CADA 2H1PH 1R3JA 2EH7L 1A9EB 5IUSA 1UJ3B 1H9VA 3QZWG 5D7LB 2C3VA 1YC7A 1J87A 4BSVB 1MCOL 1I7TB 1UQSB 1UVQA 4XPHL 1CE1L 4ZUVB 2WBJD 3PGCB 5KVGH 1TJHL 2DQCL 4N0YH 2IEPA 3WUWB 1IEBB 3QEQB 2AXFA 5D7JC 1EVTC 4BQ6A 3ZYJA 4YDJA 5JO5A 4AEEA 3EHBD 2DBLL 5JNYA 4BKLA 4HF5L 3WN5A 3OKMB 4BZ1L 5F96H 2BSTA 5E2UL 4N1EA 1RU9L 2VUYA 4P59H 1KCUH 4GAYB 1Q9KB 2GTZB 4X99A 1NC2B 2J7LA 3M1BA 1SYSA 4OM1H 5C0DB 5JPNB 2VDPL 4KZEH 4L9LB 2XWTA 4NQDD 3PJSA 5I6XC 3FTGA 1UYWH 4OV5B 3VFGH 3TT1H 1V7NH 3G9VA 4LBEA 5GJSH 3BI9X 4J6RH 5FEBA 1QEWB 5TQ2H 4KY1L 2DQJH 3KYNB 5ANMA 1KPRB 2CMRL 4PRIB 5DJ8B 5TPWH 5FUZL 5I8KH 4OLWL 4GOSA 4Y5VA 4R9HA 3FO0L 3RTQA 4F9LC 4JHWH 2Q8AH 2MHAA 1U8KA 5L9DL 2ZPKH 1G7PB 1NAKH 4PV9B 2ZCKL 1YN7B 2CSPA 2F54B 2DQGL 4D3CL 4ZS7H 2YPKB 3QDME 2OTUB 2B0SH 5JIPA 4GO6B 3NCEB 4O2FA 2P7TB 5DQJB 1T66C 1ZGLM 1NQBA 1RZ7H 3FMGH 3UDWA 3RY6C 2W65B 2ZKHL 1Q9WB 1K8DB 4X5LA 3BGAA 1TVHA 4HT1L 2ITCB 4DUWA 3I75B 1CICA 3TBSB 1ZAGA 3MCLL 1MHPL 5LCVH 1BREA 2HT3C 2EYRA 4PJ7B 1ZS8B 1JYXA 1CXEA 1RZIB 2CR6A 2XZZA 3UJIL 1V5JA 2J12B 4PS4H 3BJ91 5T3XH 4EI6A 4HK3N 1JV5B 1SY6H 4JVUA 5FCSH 5E7FA 2Z9TA 5MERB 3R0NA 1WV7T 4FQHA 3MRHB 3P4OB 2QHLA 2R4SH 1TQBB 3TCXA 2VXSH 4C55A 2OSLB 4MX7A 4N90E 3TNNA 4ERSH 4TUOA 1I8MB 2MMXA 2YSSB 1VHPA 4TRPL 3WHXA 1VEMA 1RUAL 4NKDB 4RBPH 5J1AB 1OT1A 2NY4C 3D48R 2QADD 4YX2H 1NEZA 4WUUE 2Y5EA 1FDLH 3B6SA 5EBLB 3DX6B 5I73B 4U6YB 1QQDA 4YDLC 2VABA 5F7MC 3VFOA 5IB5B 5FGBC 4E41B 3BEVA 1LO3L 3WEXB 1ZVYA 1M1SA 2O5ZL 5K9OB 4JDVA 2JJWA 2XKSA 3C5ZB 5KVDH 1UA6L 4HIEA 4LSRL 3DUSB 5JXEA 5LWYL 1QBMH 4K3EL 4PRHB 3IFPA 5JOPD 5CZKA 3H9ZA 3Q3GA 5SWSB 3WE6B 1RZKL 4WI8A 1XF2A 4GSDH 5KVEL 1ZEAH 3MRJB 3MV7A 4Y2DC 4QOKD 5JHDD 2GYSA 5I66B 3VFTB 4X83A 1FVCA 4OF7A 3PP3H 2FJHA 2B4CL 4JN1H 4WU7A 1CFQA 4Y5XC 2ICWJ 2XI9A 1OAYH 1NLBL 1ND0B 1XR9A 3OAUL 3NOIA 1T1WA 1E4JA 2JJTA 2DIBA 3BIKA 2CK0L 3O8XC 3CVHH 4R2GD 4V1DB 1MCCA 3V6FB 2VAJA 3IJYB 1X6LA 4GQPH 5JW4R 1SM3H 1MCWM 4XHQA 1G0DA 1N4XH 4OFVA 3HG1E 4XMKH 3ULVL 3QUYB 3X11A 2NY7L 2A73B 4GJTB 1UCBL 4ODXB 4U3CA 5I71C 1OD7A 3IVKB 3LKSB 5HYSG 3L7FA 1PSKH 1XF5B 2N1KA 3MOBL 5IJKC 3AM8A 2VDRH 3V4UL 3UPRA 3B9DA 2VXTH 3RUGB 4XVTL 4G7VH 1CF8L 4OZIA 3LS4H 5IBLC 4KVCH 1HHKA 1OTTC 4CL7A 2QQNL 3JSSA 4Y4HB 5C07B 1WFNA 1WIPA 1NBZA 1UGNA 1Y6MR 1PKQA 2P49B 5D1ZC 1QYGL 1AGBA 4KTEH 5M7QA 3I3EA 2ADIA 2XN9B 1KT2A 4F7CB 4XXDA 3MLSH 2VDLH 4F58H 3OKOB 4CW1A 5HPMA 1BJ8A 3L5WB 2EE6A 4LKXA 2EEAA 1KLGB 3LDBB 4RWYH 5C0BE 3O6KH 1OGAD 1DQLH 1T7ZA 4NCDA 4DZ8A 2VLJA 3O0RL 4G8EA 4CVXB 5C0RH 1JTTA 1DQDL 3HR5A 1CQKA 3B9KA 4MHHG 2HKHL 4PJ5E 4JO4H 4QRQA 5HY9B 2CJUH 4W4OC 3Q1SH 4XP1L 1NC4D 1S78C 1TVBA 3DECA 3K80A 3T8XB 3HFML 4RZCA 3P9WB 4LP4A 1EXUB 2E7CA 4B41A 3F7PC 3C5JA 4HBCH 5GZNC 2MTPA 4HQQH 3GMQA 4Z5RB 2QL1A 2Q8BH 3ALWA 2A9NH 1D6EB 3SDYH 3IFNH 2L7UA 2R23B 5CS7A 1SMAA 1TPXB 2ICEA 5T1LD 4F9PA 5HVWA 3IYLW 1ADQH 4MVBD 1JFQH 3QFDB 1AE6L 1DEDA 1QHOA 4G3YH 4KHTL 4XGZB 2YA0A 4A6YB 2W92A 3M17B 3FO1A 4NUJA 4PP2B 5DD5H 2E8ZA 1MJJA 5GISH 4ZPVB 5E1HB 4CJ0A 4HUWA 4G8GD 5IMMA 2OZ4H 5KG9A 5E2WH 4I0PB 5F7KC 1ZVHA 1NANI 1HWGB 4WV1C 3LEYH 5KJRH 3MRDA 2CLRA 2VIRA 1I9JL 2VXVL 4KKBC 1FL6B 1RVFL 3F62A 2VZ1A 1KXQE 2HJLB 4EXPX 4B53A 1PYWA 3WFHA 4J3WA 3BWAB 1A4KB 4JFOB 5C9JA 3HE7B 1KJ3H 5GHWH 2ESVB 3KGRA 1BD2D 4TUJA 4X6FA 5JOFB 1QRNB 4ONFL 1EHNA 5DFVC 1NFDF 3GMNB 4O58L 1G7JA 2CRZA 3L3DA 1NGZB 2BC4B 3ULUC 4JB9H 5DEFB 3QNZB 1R0AH 7FABL 4KDWA 4ZQKA 3RWDB 1MIEH 4NYLA 3UAJD 1A6TB 4ISVA 1NEZG 4RX4A 4KPHH 4HS8L 4K94H 3H0TA 4ETQA 3I02A 4Y16C 3LPGA 4OF8A 1A14H 2XKNB 3IXAA 1BQLL 3MROA 1EGJH 2VSCA 3QFJD 5I8EB 2CPCA 4L4TD 1Z3GH 1YUHA 3KVQA 1JWUB 3BZEB 1CGVA 2EDNA 4LCWE 1HQ4A 2A6KA 2MPAH 1TZIB 5DUBA 2DLGA 5ALCH 5HYEA 2GY5A 2B2XL 4LCCA 2VZOA 3SGEH 1KTLB 1QKZH 2H32A 4OGYL 4NZTH 1QR4A 4LPTA 4V2BA 2AJYH 3NIDE 4PV8B 1UWEL 3NFSL 4JO3L 1C5BL 2FD6L 2JCCF 4NKQB 4JFXA 5E8NA 2Q3AA 5IHUL 5C08D 3LN4A 2GT9B 3ARBC 1C5DB 3Q2CA 2BJML 3HS0A 3ULVE 4HG4J 1D5MA 5FF6A 1Z5LB 4U4BA 3VXMA 4LDLB 2W9EL 1MIML 4OZIE 3V5KA 1UCTA 5CZVL 1I3UA 3OBAA 1MCFA 4JKPH 4ODWB 3MGTB 4YHKH 3BRFA 1NUFA 4P9MH 3DIFB 5CEYB 2UZIL 4RA0C 1JGLL 3MQIA 1NLDH 4OT1H 1DN0B 4KUCD 1BPVA 4XC3H 4D2NA 1CLYH 4NQSA 2VLKE 4XI5C 4IBLT 3IDYC 5JA8B 5TE6H 1A1OB 2OL3L 4TNVF 3X13B 4WDIA 3SKNB 1QACA 1QP1A 4OLEA 3EDJA 4EN3D 3TNMA 3D18A 2VISB 1RJCA 4M9PA 2OL3A 5EOQH 1J0JA 4MD0B 1QBLH 2I60L 5MP6H 4UIMA 2M1KA 2HRPL 4U1NA 4Z7UA 3SE8L 1HYSC 4YHMH 2VLJE 1LO0H 2L0DA 5E7BA 3RWGA 4QXGL 4WWID 1MLBA 4PGDA 5SWZD 5L8LB 1FJ1B 1ZSDB 3O2DL 5J11C 4XP4H 5HD8D 4OF3A 1XMWA 1HIMH 1R3KB 3ILQC 3VMNA 1FFNB 5D93C 4TULH 4U31A 1XIWB 2YKLH 3O2DA 1ZE3C 1D6VH 1P7QA 4LLUB 3TBVB 3KHQA 2X4QA 4ZMAT 3MA7B 4JO2H 3PL6A 1QFWH 2FIRT 4P4KB 5EU3B 2OJEA 2CUHA 3QIWD 1ACYL 1INDH 4DGIH 5SWQB 5I75B 2V17H 2VQTA 3P4NB 5E8PA 5B39A 3QQ4B 1BOGB 3NCYS 4H8WC 4JKLA 4P23B 2IAMA 2DMKA 1MFCL 3M8OH 4NQED 4N0UB 1KN2L 4GKNB 5HHXH 3QIBA 3FT3A 3QAZB 5DTFA 4IOFD 3CSBA 2KBGA 1IEHA 1HSAA 2D0HA 4YBLB 3ZHLA 5DQ9B 4KKLD 4KJWD 1X5ZA 4S2SB 3VFWA 4K23H 3QQ3A 4KJQD 3GBNL 4KKCC 5GRVK 3STLB 1U8QA 3TO4A 1UB5A 3DBXB 4L8SA 1W0YT 4U7KA 4R0LC 3O6FD 3MUGB 1Y6NR 3W11C 4QHNB 2W1NA 4U1KB 1HH6B 2FX9L 4PP1C 1HKLH 4B7LA 5TH2A 5HGDB 5C0CA 3RDTB 3KDMA 4LCYB 1P1ZA 3C5SB 4U1GB 4FQXD 1V3KA 4MQ7B 4ODSH 1OP3H 4LVOB 2V2WA 1WTGT 4MYWB 1IC4H 4U1IA 3SE9L 2BNQB 1SJHB 3GIVB 3QNYB 2VL4A 4UOW1 2R1YB 3VXRA 4OV6F 4DTGL 3VGEA 1A22B 3OKNA 2BXZA 1CFSA 4H0IA 4P4RA 4QHLA 2FBJL 4M7LT 4PYGA 3UO1L 1EAPB 4JFDD 4BSWB 2NZ9C 2MNUA 3FFCB 4ZUUA 3PQYB 5IVXA 5CKAA 1RK1B 2YUWA 3IF1B 1NSNH 1MRFH 3D2UA 4OKVB 5EUKA 4HMEA 3BMVA 1KENL 3IXTA 5CZXD 5IEHA 2R0WL 1P6AB 4G43A 4QXUH 3DV4A 1IKFL 1FH5L 1WTLA 2FX7H 4UTBH 4HFWA 2ZUUA 4M43H 5F7DA 1IRAY 4HKZA 4OUUA 4YHZL 5LVEA 2X4SA 5K9QG 4R97C 3JWOC 4IMLA 4XPBL 4HWBL 3T65B 3BP4A 3WDJA 4IRJB 5F9OH 4GLRH 2I9TB 1XCQB 5I1IH 4G8FA 1PQZA 4EI5D 4WHTA 3MXVH 1DBKL 1P2CA 4Z7OE 4HWBA 2EYTA 5D7KE 5CLTA 4LKCA 3U2SA 5GS0C 3AB0B 3BP6B 1E27A 3STZA 5HGBA 2A77H 2AJXL 4RGMB 2X70A 4HIJA 3JV4A 1YMMA 1BF8A 2BVOB 3KWWA 1U93B 3D3VD 3IDNB 4NQVA 5GGTH 4MA7L 1KPVA 2X4PA 4IIQB 3VU2A 1ZLSL 4HCRH 1M7IB 4R90L 4F7MA 4M6MH 1TJIL 4QF1B 1OAQL 2VDNH 2VLRE 1MSPA 4ZAKB 5JPMA 3MRRB 2VKXA 3O41A 2F53B 43C9A 4FTVB 4WFGD 5D1XA 3DHMA 4F15C 1A1MA 2XWBB 2L7JA 2CGRL 3FQXA 4Z7UE 3HMWH 4YFDB 1XGRA 2ZSWA 3K81A 2XA8H 3MV9D 2UZXB 4G8IB 3RU8H 5DMIL 3H7BA 4KUZL 2AV1B 4NWTH 5CINL 1F4XL 1FZKA 1U8JB 5ID0B 1HXMB 5CSZA 1WWBX 2J4WL 2N56A 5IP4A 1IQDB 4UBDC 1JVKA 4M6OH 2R2BB 4P5TA 3MJ7B 2YEZB 4PIRF 4CBPA 4Y4KD 5IBTL 1NCWL 2AJ3A 3MBEA 5F3BA 4N8PA 5HDOA 5H2BB 1CFNA 5FCUL 1IGJB 5FM8A 1CVSC 2RCSH 1M7DB 2VRAA 3W9EB 3QNXB 5KOMC 5SX5K 2CRYA 2Q86A 2Y5TB 2R9HC 2XKUA 3NZ8A 3MPCA 2GAZB 2JELL 2OI9B 3WNMA 4ZFOL 3D25A 3RWHA 5J1SC 3SDAA 4Y1AA 3KPRB 1OAXL 5KZCD 3O4OC 3ZKMD 3NZHH 1BAFL 1A9EA 5ICXB 1UJ3A 4ZFOA 5KS9F 3MLUH 4LF3B 1ED3B 4LOUD 5D7LA 4KAQL 4BSVA 1G7LB 1I7TA 4YHYB 1L7TL 2FEDD 1UQSA 2NX5E 2I9LA 4ZUVA 3PGCA 1ITCA 1EMTH 1DBBH 3IDXL 3WUWA 2AEPH 3DRQA 3QEQA 3DX7B 1NCAL 3AUVA 1AC6A 4POUB 2OQJB 4OLXH 1OT2A 4NRZB 2W0FB 3TC9A 3OKMA 2HFGL 2O5YL 2ZG3A 4NP4L 3HUJE 2HFTA 3QJFB 4GAYA 2GTZA 4FQJL 1NC2A 5C0DA 3UYRH 5JPNA 1OLLA 3ZTNL 4HZAA 1CXLA 3RNKA 2R0LH 4L9LA 3MZGB 2LE9A 4LGPB 4NN7B 3UTSD 4LU5H 4I3SH 2F15A 3QDJA 1DSFH 2HLFD 2CKBH 1ACZA 2DB8A 1EHLH 2B1AL 3QPXH 1QEWA 4ODHL 3OZ9L 4RRPA 3DYOA 3KYNA 1KPRA 1F3DH 3GJEB 5I1KL 3LV3A 5DZLA 4KHXL 2COQA 1IEAB 4N0FB 4K7PX 3CFJB 3C60C 4LP5A 5BQ7B 5D7JB 1G7PA 4PV9A 1YN7A 2F54A 5IB3B 1NCDH 2GJ6B 1XGPB 2YPKA 3DO3A 2OTUA 4EIZC 1S7TB 2UVEA 5CAYB 3SDCD 1A7QL 3MLWL 2BSRA 4XNYH 4DKFL 2P7TA 5DQJA 3CGTA 2QV2A 4K8RH 5I1CH 2UWEE 2W65A 1Q9WA 5KSAD 4NC0B 1NCCH 4WI3A 3G5VB 3LIZL 2WUBH 5MI0C 3I75A 5I6XB 3V0WH 3TBSA 1RJYB 5EU6B 1GGIL 1YMME 2X89A 3AY4C 4U6XB 4XWGH 5JQ6L 1ZS8A 1NDMB 1VFOA 1RZIA 1F58H 4WEMB 4ZFZB 4PJBF 1JV5A 4JY4B 1YNKL 4P5MB 3BQUA 5MERA 5JW3H 2NZIA 3MRHA 3P4OA 3ZDXF 1NCBH 5BS0B 2YXFA 2EDTA 4JM2C 1J1XL 3UJJL 2VN4A 3G9AB 1N6VA 1YYML 5J4MA 4U05A 4W6XB 1UWXK 2WWMC 3TJEH 1FVEB 5ENWB 4LAQH 3VXSE 4JFED 1J1OL 2YSSA 4POYA 2BCKA 3ZMRA 4O02L 4DGVL 3L95B 4NKDA 4L3EB 3GMOB 4EDWH 2DI7A 5J1AA 5KVFL 1REIA 5KOVC 2IQ9H 5FO9A 4NBXB 2A6IA 4GBXD 4KK6C 5HDBE 1BZ7B 5EBLA 4AY0A 4U6YA 4WUKL 4UAOC 3HC4H 5IB5A 4E41A 2EIDA 3C08H 3QEUB 3QXUA 1IFHH 3WEXA 4LLQB 5J1TC 4Y2OA 5K9OA 1F3JB 5IESL 3C5ZA 4HWUA 5F1IB 3DUSA 1KCLA 4OLYL 5EIIB 5C6WH 4RGNC 4PRHA 3MUJA 4OFKA 3VRIB 1RQ5A 4J3VA 1AD9A 5SWSA 4NNPL 1FZMB 4EBQL 3R4DA 1AXTL 1FRGH 3MRJA 3RVVD 5EUOB 3QT2A 4TNVK 1T2QL 4UIKL 5BOPA 1T04B 4AIXA 4GH7B 5F6IC 4MXWH 2DOCA 3SE3A 2AV7B 1CFTB 4YGVB 2IFGA 4FP8L 3TH4T 4TOYH 5IQ9B 3OXRA 4L8CB 1RAMA 2OK0L 5E6IC 3S35L 1CL7L 3SGDH 2NY4B 3DSNA 1OGTB 1B88A 3P11L 1BGXL 4XHJD 2D7TL 5C7XH 1HNGA 3HRZA 1OPGH 1RV6X 4YDLB 1EJ6A 1JI1A 4V1DA 3V6FA 3IJYA 3TVMD 1R3LB 2XQYG 4I8DA 4XPFL 2DQIL 5LGHL 1MFNA 3VD9A 1E6JL 1XAUA 3DGCR 3QEQE 4UINL 3QUYA 2A73A 2O93L 2FIKB 4W4NA 4PJHB 1CL7I 4ZS6D 1Q9LB 3IVKA 4Y2DB 2EDKA 2AJVL 4MXQC 1XF5A 1JZ8A 5GS1C 3EUUA 1DQJB 4FQCL 5DVOA 5CCKH 5FOBB 4OLZH 4XCNB 4Y5XB 4IRSD 1FIGL 4P2QB 4HV8B 2D9QB 4UDTB 3K2UL 1TTUA 2PR4L 4JDTH 2IG2L 3W9DB 4OZGF 4L8BB 3B5TA 4Y4HA 4LRIC 1OAZL 4Z7WA 3JWNC 1G6RH 3QDJE 4E42B 4R26L 2JJVA 3O8XB 2BVTA 4HJ0D 3GI8H 2XN9A 4RDQG 4Q7DA 5HHPB 4F7CA 1OAKH 4ZYKB 3LRGA 4UUJB 5E99L 4HGWB 3OKOA 3L5WA 1SJEB 4JR9L 1H3UA 4HDIA 4NSKB 4H25B 4Q0XL 2ARJQ 5KTEL 4I4WB 1KLGA 3ARFC 3D9AH 2C3WA 1QLEL 3EOAB 4CVXA 1WVZA 5H35A 5I71B 1CXIA 1Z9SA 3SCMC 4QKXB 3W82A 1P7HL 4RQQA 1NL0L 1S7XB 3KXFE 2FX8H 2JIXD 1A6VL 3EYVB 4PJ9C 3EGSB 4RMTA 2XNAB 1CK0L 3SPVA 3T8XA 3AXLB 1FZJB 1EXUA 1T6WA 5AUMB 4X80L 3QUXA 1KIRA 2GKIA 4FQ1L 4NPYB 4Z5RA 3F7QA 3FJTA 3CX2A 2HH0L 5D1ZB 1U36A 3NFNA 5D5MF 4A6YL 1D6EA 4HIXH 5DZNA 3EIFA 2R23A 5CKGA 5D72H 4R8WH 3F5WB 2J8UE 4JQIL 3QFDA 4A6YA 2E3VA 5BV7H 3QDMD 4XGZA 3QRGH 3M17A 4XWOD 1D9KA 3RX8A 4ZPVA 3LKPB 5B8CC 3DGGB 2KQMA 4Q9BA 4OFYD 1QZ1A 4I0PA 5DWUH 1LO4H 2HLAB 4MAUL 2NTSP 4O5LL 5E0QA 4UT6H 3WS6C 4GG6F 4JHBA 2HJLA 2HG5B 1A4KA 4GG8B 2G60L 1VACB 5IGXL 1JGUL 1A6WH 3MRGB 4J12A 5JOFA 2H9GB 5FECB 1QRNA 4WEBH 3GMNA 1Z6JT 4EOWL 2EIZB 3MLVH 4Y0GA 2AVGA 1NGZA 1U8LA 3IU4L 4PRHE 2BC4A 4TN9A 1BEYH 5DEFA 3QNZA 2IPUG 5SWSE 4NZJA 4C56D 3RWDA 1S7WB 4P2OC 2EEBA 1A6TA 4OCYH 3U4BH 4KMTL 1QSFB 1MLCB 5F21B 3GNML 1IAOB 2P5EE 4LAJH 3VWKD 3T0BA 3DYMA 2X40A 4R96B 4PB0L 4OSUH 1AO7A 3QB7C 1WFUA 1NCUA 4XPAL 5INDB 2FO1A 1WFOA 3QHZL 3BUYB 5I8EA 4WV1B 3D85D 4BSJA 1LK2B 3LCYA 4ZPTB 3TN0C 1JWUA 5D8JH 1GGTA 1PDKA 3QEGH 3EOTL 4X9BA 5EZOH 1K2DB 4M9OA 1A3LH 1KTLA 1JWMB 2D4DA 2VJXA 3QIUD 5ETUB 1VSCA 4PJFA 5DURB 1KB5H 5FHBH 3QG7H 3U1SH 3TZVA 4F7EB 5LKNA 1OY3B 1RULH 1W0WB 3BO8A 1VENA 3PABB 1MJ7L 2GT9A 1U8NB 1C5DA 1U0QA 2BHUA 5FA3B 1M05B 4H1LH 3MFFB 4MB3A 3N85L 1I9IL 1YNLL 3U7YH 4F7PB 1Z5LA 1CS6A 4Y16B 3CK0L 1OCWL 1F42A 4HK0B 4RAVB 5CGMA 4PJAF 1W72H 2VZVA 4DQOL 5D2NC 4ODWA 3MGTA 3L3GB 2GSIA 4AMKL 2HFFB 3DIFA 1CQYA 1CGXA 5CEYA 4FG6D 4Z7WE 3VGAC 1KUMA 4PJXE 4YC2C 3KYKL 2ZNXA 3WIIH 5ERWB 1QOKA 4YR6B 5I1DB 4KJPD 5F8RC 4NQTA 4QNPF 5K9JL 1A1OA 3SQBA 3X13A 3SKNA 5IHLB 2KZWA 2VISA 2VTFA 2NY1D 2VLMD 5HDLA 5CEZE 4MD0A 5A2KH 1E6OL 4KROD 3BKJH 5E9DE 4QCIB 1T5XB 3ARBB 3I6GB 4OI9A 2W9DL 3EYFA 3GJFB 3N50A 3MLYH 2LFGA 1FJ1A 1MPAL 1ZSDA 3QCTL 1KFAH 4D0CB 3WSQL 1OTSD 1R3KA 1FFNA 2P8PB 4AG4H 2DS4A 1XIWA 1JPSH 1U58B 4DW2L 3WIHH 4WTZA 5GGSB 4LLUA 3TBVA 8FABB 1I8IB 2LTQC 1N59B 3PHSA 3UTPE 4P4KA 3X3GH 4S1RH 5EU3A 2JB5H 4OIAA 4HUKB 4ZO6A 3RTQD 4OZHF 4M8VA 3EHBC 5SWQA 4AEIL 4JKKA 1N5YH 4W68A 1BOGA 1T0PB 3IDYB 3FQUB 5E94B 5IMLB 4N0UA 2AI0L 5F1SA 4GKNA 1N6UA 5BOZG 2EDXA 5DUML 5DQDH 3F58H 4JGJA 3U7WH 4IDJH 2BY0A 4QTIH 3MODH 4WIQA 5DQ9A 1TZGH 4MGXA 2VO5A 3SDXE 1T7YA 3K1KC 4HZLB 5KANG 2FATH 5C0FB 3STLA 3DBXA 4RISL 3KJ6L 4JZJC 2HAZA 1KLFA 1TENA 4RA3A 4HH8A 1YEKL 3UTZB 5HYJB 5J11B 1CICD 5D93B 4QHNA 1HH6A 3T3ME 1YDPB 5HGDA 3VXPB 5TFSH 4AEHL 3RDTA 3CXDL 4LCYA 3WFEL 2VC2L 4WTXA 3C5SA 5IT2L 1YY8B 1ZHBB 4MQ7A 5KBNC 5CGYC 2P5WE 4K9EL 3DMMC 3QUMH 5DS8B 4CN6A 3CX5K 2GK0B 3EDFA 3ZT5A 2BNQA 1SJHA 1TETH 3GIVA 4ZFGL 3QNYA 5TQ0L 1FAKT 2R1YA 4JRYE 2MJWA 1JNHB 3BAEH 3ZL4H 3U0WL 2EDFA 1A2YB 3INUL 1AO7E 1NMCC 1Y0LB 2E7LA 2ERJC 3FFCA 1DQMH 2VXUH 3V4VH 4R0LB 1XF4B 1MY7A 4YHOH 4GMTL 1RK1A 3IF1A 2QQQA 4K94C 3MJGX 4NT6B 5JXED 4MD4B 1OWWA 5GRUL 4ZNEE 4NNYA 1S5IL 4RMVA 2DDQL 4HMDA 1UM5H 3W0WA 3V7AE 4RMWA 4NUGH 3MV7D 4YBHA 4UV4H 1VA9A 4PJFE 1NBVL 3RKDD 3GZKA 2IANB 2Y06L 3B4NA 3CUPB 2VDMH 1K8IB 5CUSL 4IRJA 4PGEA 2I9TA 5L7XL 1XCQA 1S7QB 3OAZH 5FGCE 4RBPK 1YJDL 3SQOL 3HC0B 4JO1H 1EERB 3QCVL 4N0CC 5C0EB 4YIQA 4XB7A 1QNZH 3HNVH 3BP6A 2RJMA 4LVNC 4X0KB 4IOIA 2FEEL 4BH8B 3NGBC 5CGTA 2BVOA 4QXTB 3MA9H 1U93A 3IDNA 4RGOH 1EO8L 4LQFH 2JCCB 2YMXH 1UADC 3NAAL 3QO1A 3TV3L 1M7IA 3OKLA 2AJUL 4G7YH 1HN1A 3DXAB 4OGAD 4QF1A 5KSBF 3MRRA 1KC5H 3QXDA 1QSEA 4K3HA 3O3EB 2F53A 1MCPH 3ULVD 1AI1L 5FGSA 2IFFL 4R97B 2YPLB 2XWBA 1KJ2H 2FEEI 5CP3A 4YDIH 3R0MA 5DVNA 1A7PL 1AC0A 3L5XH 1DZBA 5HHVL 3VH8B 1DDHB 4NHCL 4G8IA 5K93A 2HWZH 4LLYB 2ADFH 4W6YB 4XNUH 1I7RB 5GS2D 1CLOL 2AV1A 2DTSA 1U8JA 5ID0A 3OKKB 2JB6B 4B50A 1I3RA 3GM0A 4NQUA 1P5VA 1IQDA 3KLDA 3V95A 2ARJB 2R2BA 2C3HA 2O61B 4HX1B 3M45A 3QSKB 2A1WL 1F3RB 5H2BA 1H3PH 2YZ8A 5KW9L 1IGJA 2EEDA 3OMZA 2NLJB 3B3IB 2VLJD 2R1XB 1T83A 1M7DA 1MEXL 1T20B 1MCOH 2YD1A 3ZDYE 4ZD3L 3W9EA 2ILLA 4Z76B 3B9KD 1MREL 4NM4H 1CE1H 1R3HB 1DE4B 2EXYD 1TJHH 4F15B 2Y5TA 5ITFB 4WTZG 2YD8A 2RQ8A 4KKAD 4AQ1B 3KPRA 3NA4A 2QQKL 1K5NA 2WP3T 5DJYB 5ICXA 4PJEF 4LEXH 4LF3A 1ED3A 3FN9A 4BZ1H 1G7LA 1AR1D 1PG7L 5E2UH 4PRDB 1WWAX 5IB2A 3O2VL 1I1YB 5CP7B 1D3CA 1I85A 4MNQB 4F57H 3H3PH 1NEUA 1CXKA 4MWFB 4H0GA 2J5LC 2OQJA 4KDTA 4NRZA 5E5MB 2W0FA 4MJIB 2YRZA 2C3XA 2OX5A 4LHUB 5JW4M 3TFKD 2BY1A 3WIFB 2BDNL 1S3KL 3RZCC 2DYPB 3TH2T 3UJTL 1HHHB 1JMZA 3OAYH 4JQVA 1P5UA 3SBWC 3QJFA 4TNWF 2CMRH 3VFSB 5FUZH 5HTSA 4OLWH 1KCVL 1G7IB 2GITB 2Z93B 3DRTB 5EC1B 2ZCKH 3O4OB 1FFPA 4D3CH 4G6JL 3Q6GH 1IE5A 3QWRA 2HN7B 1RJLB 2J1KA 3T08A 3VMOA 1BBDL 4HS6B 1CD0A 3PDGA 4HJJL 5IF0B 3GJEA 2K7PA 5EBWB 1U91B 2PTTB 3W0WE 3ARDC 1IEAA 4N0FA 4HXBL 5I1LB 4U6HB 5BQ7A 4Y8AA 3EO0B 5D7JA 4RX4D 4JVPA 5IB3A 5LQBH 4HWZA 2GJ6A 3MCLH 3ZYIA 4NKIH 1XGPA 4XCCH 1F90L 1S7TA 5KSVB 5E2TL 3UJIH 1WCBB 2V5TA 2DICA 2DL2A 3RGHA 3QR2A 1H5BC 4PY8J 3Q0HA 4PRPE 2AJZB 1MAKA 4H88H 5CJQH 4ZDHB 1NMBL 4K55A 3G5VA 2EZ0D 4GRWE 2NXZC 5AAWA 1RJYA 1HEZB 1CXHA 5EU6A 4TRPH 5HHMB 3HB3D 4EUPA 1RFDL 4U6XA 5ESVA 4OZFB 1NDMA 4ZFZA 4JY4A 4P5MA 3SDDC 5BS0A 5FUCC 3HPLB 2X42A 2OJZH 4BFEA 4F9LA 2CXKA 1QSEE 3C60B 4R4ND 4KRPC 3D0VB 4MAYC 1FVEA 2O5ZH 5ENWA 4GFTB 1SBSL 3VXMD 4LSRH 5IOPB 3EDDA 5FGRA 2WP3O 2EIBA 3TWCL 3U79A 4ENED 4M1GH 5LXGL 4L3EA 3GMOA 4P2RB 1NMAH 4D9RD 3MRLB 3CSGA 4IRZL 1BHGA 3GGWB 3QEHB 3T1FB 5KVEH 3FQWB 4YDVB 1BZ7A 3RY6A 3Q5YA 3PWLA 2IMMA 5TDOB 2YK1L 3TBWB 3PWUB 5JXAH 1YC8A 3RVWD 3QEUA 2PYEE 1OTUC 2M2DA 4LLQA 5MI0B 1YEDB 2MCG1 3IFLL 5EIIA 4M7KL 5JORB 4KGJA 3V9FA 2BK8A 1XGUB 3VRIA 2A0LC 3SGKC 3R1GL 1QBAA 1FZMA 1M7XA 4R7DB 4XX1E 3WL9B 5KAQG 3UTTB 4FFWD 5EUOA 3IDJB 2PW1B 1L7IL 4JM2B 1T04A 1CR9H 2P1YA 3U82B 1F4YL 2AV7A 3RP1A 1CFTA 4L4VE 4YJZL 4QRPB 5HYFA 1KN4L 2X1QA 1FSKC 2Z31C 1C1EH 1AXSB 5IQ9A 2G5BB 4L8CA 3PP4L 2YBRB 1DANT 3G08B 2R56H 1MVUB 2DKUA 5CD3B 4JQXC 3UZEA 3H2WA 1OGTA 1P7QD 1UCBH 3PL6D 5EU5B 4NQCA 1WSST 4K3GA 4UAOB 4FFZL 3V4UH 3V8OA 4Z95L 4Z0BH 5FYJL 4N1CA 1CF8H 2Q6WB 4IMKC 1R3LA 4LDOB 1A7OL 2NY0C 2X1PA 1RIHL 1OVZA 1SHMA 32C2B 2IAMD 1KCRL 4POZC 1PY9A 4RGNB 5JZ7D 5C3TA 4JHAH 1R24B 4AL8L 2QQNH 3S88L 3QIBD 3EDKA 3NVQA 1BVLA 4PGCB 2DQEH 1EJOH 4PLKD 2FIKA 4PJHA 4X8JB 1Q9LA 4Y2DA 1L6ZA 2DN7A 1K4CB 1TCMA 4X7SL 1ZANH 1GZPB 4UT7H 5F6IB 3ZSTA 5KS9B 5MENB 1LNUB 1CE6B 1DQJA 3TO4D 5FOBA 3B2UD 3PXHA 4XCNA 4ACPA 1BJMA 4Y5XA 1KEGL 4UDTA 4P2QA 4HV8A 4K7PY 3QJHB 3ZKNC 5TGBA 1G9ML 5E6IB 5T5FH 5AYQA 4LPYA 5GXBB 2H2PC 4JN2B 1NFIB 5CJBA 5CJ5A 5EORL 3W9DA 2DLFH 4L8BA 2P45B 5C0CD 1EDQA 4LFHD 3OB8A 1BLNB 5ADPH 1DQDH 4JFQB 4QHKI 2AGJL 3ZTJG 3O4LE 4KQ4L 3O8XA 5FYKL 1JHTB 4P3CL 3TEUA 3NA9H 5HHPA 4XC1L 4LSQL 4ZYKA 1NGPL 4UUJA 3QDGB 4Y8DC 4HGWA 5HGGS 3VGFA 3BIBX 3VXRD 4NSKA 4H25A 4I4WA 3M07A 3D5OF 3VD5A 4FMKA 3HI6L 1OW0C 4TQEH 1DUYB 1Y6KR 5FYKU 1C12B 3RHWF 3MCG1 2XOTA 4ZFFB 3DX8A 3PGDB 1OF2B 5IJKA 1LDPL 1S7XA 3O6FC 2QQLL 2GK2A 5GS1B 4LSDA 3V52H 3EYVA 5FOJA 1OP5H 4UQ3B 3EGSA 3O3UN 2XNAA 3MLRH 4X4ME 1KJVB 3LEVL 2GJJA 2X9WA 3AXLA 4GQ9L 4NWUL 3N06B 3D2UD 4HUNB 1W8NA 4LLAA 5C0IB 3QHFH 5AUMA 1FO0H 3N1FC 1QSZA 2AK1H 2QKIB 1H8OA 4NPYA 3RX5A 5GRVL 3MRNB 1YMHB 4JG0L 4K8RC 1IC5L 4PTTB 4AQOA 3H9SA 3ORJA 4IJ3C 4RFOH 1ZA6B 1N7ML 4KZDH 5IBUG 1T5WA 4CMMA 5ITBH 3CFEA 5DMJB 3WO4C 3X3FL 3ARFB 1FLTX 4ONFH 3SCMB 3LQMA 4YQXL 2HLAA 4PRAB 1BF2A 3IGAB 1MFDL 1PZUB 3S4SB 4UNTA 4PJ9B 7FABH 4W4OA 5ICYA 1YMMD 4M1CD 4PJBB 2HG5A 3QXTA 3SHSA 4Y88A 1VACA 5J8OA 4NFCA 3MRGA 1YQVL 2F19H 3JV6B 1BJ1H 1FNSL 2H9GA 3P4MB 5FECA 3H42L 3LQZB 4K3DL 5I1AB 5CSGA 5T1MB 1PAMA 2J8HA 3WFZA 1GPOL 2ENYA 3NIGF 3JV5A 1MF2H 1TZHB 3SY0B 3VXOB 2V5SA 3QXAB 1S7WA 3OPZH 5D1XD 4U3XA 3ELAT 2VZ3A 5IVZB 1TDQA 5EIQA 2AEWA 1QSFA 1MLCA 2VKWA 3TESA 1MRDH 4GW4A 5B8CB 4R96A 3RIAF 5INDA 4JPVL 3GBML 1QFUH 3BUYA 2FHFA 5BZWA 3TBTA 2O5XH 3BRDA 1LK2A 3G6JF 4XCEB 2QHRH 4ZPTA 5IFHL 1KYOK 4J7RA 3PV6B 2AJSL 4LMQI 1KBGL 2BJMH 4RDQF 1K2DA 5AD0B 4P5TD 4CAGA 1GGUA 4NQCE 4YWGL 3OSKA 4YH6A 1JWMA 4ELKB 1WBYB 3FRPG 3NH7H 3MBED 4TSCL 4XBPB 3OKDB 3ULUL 3PIQB 1CD9B 1CFVL 1LE5A 3MGOB 2YR3A 4Z78A 4NC2B 4C57C 4OJFL 3GSQB 4F7EA 4NQDE 2BSSB 1G0YR 1W0WA 5AYUH 4GAGL 4HAFA 4KFZC 4JKMA 4P2OB 3PABA 4DVBB 1M05A 1VERA 3MFFA 1AFVL 5E6YA 3FZUC 4F7PA 1X5FA 2FL5B 3SDAD 4Y1AD 4HAGA 2XG4A 4Y16A 2OL3H 2AP2A 4HK0A 2VR4A 4RAVA 5D7LD 4P2QE 1KCSL 2Z4QB 4YBQD 3FB6A 4Z7VE 5T1DL 3BVNA 3L3GA 4I77L 4RIRA 4OCSL 2DQUL 3SE8H 3TN0B 1FCCA 1RUMH 3EZJB 2HT2D 4X6DF 4WJ5B 5EBGA 3QP3A 1MCKA 1B4JH 3QEQD 5ERWA 4YR6A 1IC7L 4GXUM 5DSCB 4GW5A 4XCFL 3PWPB 5GGQH 2X4RB 2H26B 5FYKE 1F4WH 5HVFB 4XNXL 2H6PA 4RSVA 5FKAA 1UT9A 3VDAA 3E3QC 3QQNA 2I26N 3D39B 1MI5B 4QCIA 1T5XA 3RPKA 3CVHB 3I6GA 5E00B 1NC2D 3FB5B 4PJ7F 3B9AA 4N8VB 3TJHD 1SEQL 5T3ZH 2A6DB 4TNWK 1BZQK 5LBSL 4FZEL 3QDJD 3RBGA 3QWQB 2P8PA 3FOMA 5AZ2H 5D2NB 1U58A 1CGUA 4MJ4A 3U48A 5GGSA 8FABA 4YFEA 1I8IA 1F8TL 1N59A 2C9AA 4D9LL 3VGAB 3S35X 4HULB 1MH5B 3LHPH 2BSED 4YC2B 3HMXH 1DUZB 1JGDA 3AVEA 3FQUA 4KI5D 4F80A 3KLHC 4XP6L 2BZDA 2F54D 3H9SE 5E94A 5IMLA 1IC1A 2NPLX 1GSMA 3H7LA 5BZDB 2EKJA 3CZFA 4AK1A 5EOTB 5JOPE 1YYLL 2BFVL 2MKLC 3P9LB 5ESAB 4HZLA 5IM7A 2CLZB 5C0FA 5BV7C 1IBGL 5D5MB 4JFFB 4QOKE 5HYJA 1V7ML 2E6JA 3BPLC 2A74B 4DN4H 2X89D 1Q0YH 1YDPA 2WUCL 5D71H 2LTQB 2QSCH 3BQUD 1YY8A 3RI5F 4CJ1A 4H8WL 1LDSA 3TPUB 1H3VA 2NY3C 2Z8SA 4KXZH 4L29B 2CO7B 2R1WB 5F7EH 2HMID 3ZO0A 3BGMB 1BM3H 4NM8L 3UTQB 2CD0A 4AM0A 4UDUB 2FNBA 4GG6B 3LB6D 3ZE0F 1AY1H 1Q1JL 3FAWA 1LK3L 5KSUA 1H15B 1FH5H 1OHQA 3OL2A 4YHZH 4E0RB 3WFDH 5CHNB 1Y0LA 1ONQB 2DQHH 4NC1C 4E41D 5JHLH 2BY2A 4JZJB 4R0LA 1XF4A 3ZLQC 4OAWB 2LVEA 5GGUB 3C5ZD 4NRXB 1FGNH 5HYSB 4PJCB 4PRHD 3GDBA 1ZLVK 5SWSD 1S7SA 3RUGF 4FMFA 5HI4C 1GHFL 3CFIC 5DVKA 4NN6C 4K2UL 5HHOB 4S1DC 3HHRB 3DMMB 2IANA 3CUPA 3O3DB 1X3DA 1K8IA 3U4EB 3UZQA 3H9HB 3S34H 4U2YA 1GGCH 1XFPA 4GBXC 5J0BA 4HBQA 3LKNB 3HC0A 1JGVH 3TP4A 1YPZB 2W60A 1OAQH 5C0EA 3KPSA 3LEXA 2DM4A 4Q2ZB 5C09B 4BFIA 2EDQA 1NMCB 1IT9L 3OJMB 4X0KA 3BKMH 5FV2A 1YECL 4BH8A 1UFUA 1RJZB 1C7SA 4M61B 4V1DD 5J9PB 5DGQA 4GMSL 1H0DB 4FFVD 2JCCA 1FFQA 4XVJL 3HI1B 4P2CG 1EFQA 3W2DH 1LEGA 3RVVC 3HZYB 4KWUA 4YHLH 3DXAA 4MJ5B 3BW9B 2BOBB 3QUYD 4JGUA 3QI9C 5L6YH 3JWOL 1MQKH 5AEAA 4S1QL 4FQLL 2J4WH 2YPLA 1JNLL 3HNTL 5M95B 4PLJC 5D70L 4I0KA 5E5UB 4Z9KB 1JYNA 2FSEA 5GS0L 4P9HH 2X41A 5IBTH 4FABH 3VH8A 1DDHA 2W0PA 4X6CE 12E8L 3ARUA 3GMMB 5DMKB 2PO6A 4LLYA 4Y4HD 3UTOA 1I7RA 2XZCH 3K4ZA 3SKJH 3QWOA 4PTUB 4WNQB 1UZ6F 3G5ZB 4LVNB 1X5KA 5DD0L 4XP5L 1UB6A 4KTDL 5C0GB 2DIAA 2JB6A 3NGBB 1UG9A 2XN9D 1LO2L 2ARJA 3KNBB 1MJUL 2O61A 3I50L 4XAKD 4BZ2L 4GKOA 3MOAH 3NCYP 2MFNA 3RGVC 5JHDB 1S9VB 2NLJA 2R1XA 5GRXG 3KR3H 4JPWL 4X5XB 1BD2E 4Z76A 1YN6B 1NH6A 3ECBB 3U9PL 1NCTA 1Q9OB 1R3HA 1DE4A 4I18C 3GSVA 5ITFA 1U8OB 5EWIH 3RHWK 1DANU 1ZT7B 1P4IL 1NCAH 1DP0A 2DLTA 4RNRA 3RA7L 3VD7A 3HLAB 5DJYA 1A3RL 3KPLB 3QUXD 4OZHB 5B38G 4HJ0C 2EDEA 2HFGH 1URLA 4PRDA 5JQHC 5F1OB 2ARWA 1I1YA 5CP7A 3GO1L 4CRPA 3LKQB 2RR3A 3MUZ1 4MNQA 3QFJE 2B8OT 5T33L 4L4TE 35C8H 1D9KD 2AK4B 4LHUA 1U95B 43CAB 1N2RB 3WIFA 1U8HB 1MHHB 1H3GA 2PXYC 4I0PD 2DYPA 4NRYB 5GZOD 3HI5H 1HHHA 1HXYB 4ODHH 2X7LB 2KZ1B 5FO8B 1J5OH 1U6AL 3VFSA 1AKJA 4LGSB 1VFMA 2H2SC 4NO2B 3BH8A 3DJ9A 3RVUD 2JK5B 1G7IA 5CJOL 2X9YA 2Z93A 3DRTA 4OLVH 5EC1A 1ZA3A 3VXUA 1NFDE 3TA3A 5C08E 4C83A 1RUKH 3A67L 1YEIH 4QT5B 5HI5C 1QRND 4FQIL 1HHIB 5DJAB 3SN6N 2HN7A 1RJLA 3RVXD 1HI6B 3UYPA 3KHOA 3T09A 4FN0A 4LIQL 1TIUA 2DM3A 4HS6A 3ZE1E 2HKFH 5TF0A 2XQYK 5ACZB 5IF0A 2WZPD 4JJHA 5EBWA 2PTTA 1JK8B 4ZOCA 3LIZH 4U6HA 1OGAB 3N1PC 2OLDA 2PCPB 2J5LB 2D0GA 5IR1A 3NCJH 5I1HL 4O9HH 5KSVA 1PKOA 1AO7D 3RZCB 2V6HA 1Q72L 4L3AA 4OB5H 1WCBA 4XBEL 2NYYC 1NC4B 1J1PL 1OM3L 4CGTA 5HHNB 2AJZA 4LNRB 5IMOB 5GGVH 3OB0H 3KPSE 4ZDHA 3B83A 3LKRB 3RIAK 1QR1B 4JANB 1YY9C 1VFAB 4I9WD 5ADOL 5ACMA 1J1OH 1HEZA 3GHEH 2KPNA 3EJZC 1KYOJ 4L5FL 3GRWH 4OZFA 5SWZE 4LARH 2JCCE 4M6NH 5B4MC 1PGRB 1IGML 3P2TA 3TZVD 1M71A 3UROR 3ISWA 1UKTA 4D9QE 3HPLA 4CVUA 3NABL 3ARDB 1S7UA 3EYQC 3GI9H 4LSSL 3C60A 1EFXB 4G8GB 3AREC 3D0VA 3EYUH 3T2NL 1CGYA 2BVYA 2Q7YB 5IOPA 4XP9L 5E2VH 3DVGB 1RHHB 4P2RA 1G7HB 5FB8B 1WFTA 4KQ3H 4NNPH 3GGWA 3LQAH 3QEHA 3VI3F 1AXTH 3FQWA 4YDVA 3PNWB 1IQWH 1T2QH 5E1AB 4I2XB 3TBWA 2JJUA 3PWUA 3S98A 5A2FA 5KSBB 4HUMB 4Z7QF 2IPTH 3WXVL 1YEDA 3T0WA 2NXZB 2WSKA 1G7MB 3AC0A 5JORA 1A7NH 4JZOB 5IFAL 1XGUA 2QBWA 4KVNH 2VR5A 4KMQA 4R7DA 5I74C 3VXNA 3WL9A 1DBMH 3UTTA 1TNNA 3CDCA 3THML 5EZIL 3IDJA 3SDDB 1TITA 2ZJSL 2PW1A 2ATPB 2WQRA 3VH8G 4E9LA 3TIDA 3ARZA 2P44B 1UM6L 3AGVA 3CFCL 4KRPB 4QRPA 4UNUA 2IBGA 5DR5H 3I9GL 4JKWA 1KTKE 4YZFF 4XPFH 2QTEA 5LGHH 1UM4L 2YBRA 3CC5B 3G08A 3MRKB 2EH8L 4Z8FH 1XIWD 5CD3A 4X5WB 1R5IB 1F6AB 2JLLA 2EE3A 5EU5A 2APVA 4KJPC 4P4KD 4HGKC 5I30H 2DWEB 1NGXB 3T2PA 3CLEL 5MEPA 4FQCH 4DOHE 2Q6WA 3V6BR 1HSBB 5I1EH 3RVTC 1ZLWH 3WN5C 5FYLL 4JFDE 32C2A 1F13A 1VGEL 1N8ZB 4NZDA 4Q74A 3E6HB 4D0DB 4YDKH 1IL1B 1A8JH 3QULB 1DJSA 1KJMB 4NKOB 4OCXL 1R24A 2IPUK 3VGDA 4PGCA 1HYRC 1T7XA 2Y1VA 1JBJA 4X8JA 3JV0A 1K4CA 1GZPA 5JR1H 4PJEB 5KS9A 1LNUA 5CEZH 2ADGB 1FSKB 4HIIB 2Z31B 2R69L 5E99H 3QJHA 2NY2C 5E6IA 1EPFA 2HTLD 4RMSA 1NFIA 4LSVH 1WJ3A 3BN9C 3MRMB 1HZHH 3RDTD 2E8YA 1BLNA 3VXUE 2E9WA 4JFQA 5AZEH 1GGBL 2A9ML 2IQAB 4QRRB 3RWIB 1IM9B 3DPBA 5DK3A 1JHTA 4F3FB 4LHUG 5C0ND 4TUKH 2H1PL 2IJ0C 3B9EA 1MFAH 3QDGA 1CGSL 1AQDB 5CILH 1J9CT 2BNQD 3V4PH 2HTKD 3QRFM 4U3HA 4R3SB 2XTJE 5KVGL 4ZXBC 3D3VE 1MUJB 1DUYA 5DO2D 4N0YL 1C12A 4YK4C 4AYFA 5FM4A 3PGDA 1OF2A 4QHMB 3FFCD 3GMPB 4UQ3A 4O51B 4IOSD 1KIQB 3FQRB 4LPCA 4NIKB 5F96L 4WFGE 1MOEA 5L8JB 4P59L 1KCUL 2QKIA 4G42B 1CTOA 4LRIA 4LEOB 4MDIB 1I1RA 3W0WD 1UH2A 3MRNA 1ORQB 1MCDA 3LAFA 4OM1L 1YMHA 2BRQA 2Y6SD 2J88H 3MV9E 5KAQF 3KG5A 4N5ED 4KZEL 5IJVB 5C0AB 4PTTA 3EFFB 1TTFA 5EDXA 3U30C 4NQEB 5E5RB 1HQRB 1UYWL 1JGEB 3QHTC 1ZA6A 3VFGL 1UWGH 3TT1L 1V7NL 1VFBB 1PG7X 5GJSL 4IRJD 4LLMB 1V3JA 4J6RL 1JGUH 2CKBB 3ARFA 4NKMA 3KJ4C 2EDRA 2DQJL 2EDHA 5TPWL 5I8KL 1WK0A 5EO0B 2F5AH 3QAZC 4KGLA 2VXQH 3SCMA 2FH8A 2Q8AL 1Q38A 4PRAA 3IGAA 3O6FB 1NAKL 2ZPKL 3LS5L 3S4SA 4PJ9A 4M7LH 4XT1C 4LLWB 4P57B 4OZFG 4ZS7L 3HZKB 3O45A 3MOQA 4PJBA 3S37L 5INCB 1IM3B 2B0SL 4P99A 5E56A 4ESKA 1E0OB 3K4DA 3JV6A 1RZ7L 3FMGL 3LQZA 5EN2B 5I1AA 3TLRA 3S7GA 4JY6B 5T1MA 2F5BH 5KN5A 2EECA 1QSED 4JREC 4ELMB 1E4XH 15C8H 2F53D 3D69B 3F7VB 1TZHA 4HEPG 4XXCC 3SY0A 3QXAA 1P4BL 5DMGD 4IJ3B 3GKWH 1OSPL 3KPOB 3S5LG 4DGYH 2VE6B 3LOWA 1WWWX 1FVDB 4PS4L 3WO4B 5T3XL 1SY6L 4FOMA 1BFOB 1FC1A 2PNDA 2SEBB 1YQ2A 5B8CA 2JJTC 2R4SL 4LSUH 4BQ8A 2VXSL 5GJTH 4EQ2A 1SY6A 5DD6B 1R5WB 4M02A 1I1FB 4XCEA 4RFEB 3WS6A 3PV6A 2KDGA 1JTPA 1MJ7H 3MV8B 4DEPC 1D5IH 4EQ3A 2VAAB 1DBAH 1U8MB 1ZK9A 4YX2L 3VI4E 4X9GA 1LGVA 1JHKH 4XBPA 3OKDA 5IK3A 3PIQA 4NO0B 2DQFB 2Z92B 5BXFB 3OG6B 1MHEB 4PFEA 4DQOH 3GSQA 3UTSE 3VWJC 4X7TB 3K74B 5KVDL 3DOSA 4P2OA 1QBML 4DVBA 1I1AC 2BVEA 1B0GB 4CU6A 2UUDK 2EXWD 2YA1A 4ZSOB 2FL5A 4GSDL 3KPRD 1ZEAL 5E8DH 1BVKB 4QY8B 2DQTH 4FFYH 1CDHA 1T1YA 1DL7H 3REVB 3A6CH 1X5JA 5EPMB 4GW1B 2Z4QA 3JTTB 3FQNB 1MNUH 5F6HJ 3LRSB 4OM0H 1OAYL 2YPVH 4K3JH 4WJ5A 2IPKB 2IGFL 5F7WC 1QFOA 1KULA 4YAQB 5L2JB 5DSCA 3QUKB 5ID1A 4WHYG 1KEML 3PWPA 2NY5H 2X4RA 3B9KC 4M7JL 1DVFC 2ZG1A 4ORZC 2FJGB 4NQXB 4XPGH 4XZUB 1SM3L 3D39A 4KKAC 1MI5A 3VA6A 3CVHA 1P4LB 4OZGA 5E00A 1N4XL 5EZJB 3ARWA 3FB5A 4XMKL 1FAIH 4N8VA 1YEEL 1I3GH 3RAJH 2A6DA 2PTUA 4AENB 5D1QC 3MACH 3IS1X 1AGCB 3RWFB 4QO1A 4OCMC 5DUMH 3EW3B 3QWRD 2VXTL 3PDOA 4G7VL 3H9YA 1JN6B 2ADJB 4I3RH 4JFEE 5F44A 3IETB 3EO1B 5I8OL 2RFXA 3LS4L 5J6HB 1EEZB 3IRZA 4QTHB 4KVCL 1WUNT 1UKSA 1MH5A 2CH8A 1FN4B 3QG6B 1CLZH 5JA9A 1KLUB 1DUZA 1TJGH 3TPKA 1J8HB 5D7JD 4ZTOL 1YEKH 3DV6B 1AGEB 1NBYB 1FYTB 2GJ6D 4ORGA 4KTEL 5CD5C 2V5MA 1FFOB 1WT5C 1G6RB 3BD4A 3MLSL 3OAYK 5EOTA 4NJAL 5FUOH 1EHXA 1I3VA 5JUEH 4F58L 5ESAA 4K9EH 2NW3B 4HD9A 2QSTA 3OR6B 3O6KL 5D5MA 1DQLL 4JFFA 4MA8L 3HAEG 4UILH 3W39B 5EU6D 2A74A 3H8NA 1T0NB 4ZOBA 5FKPB 4IHOB 4J8RB 1FL3B 4WEUD 5DHVA 4LSTH 3ZDXE 3VXQB 2CJUL 1B6UA 3Q1SL 3U0WH 3INUH 5BS0D 3TPUA 1ZGLB 4L29A 2R1WA 2GUOB 4HBCL 3BGMA 4HQQL 3UTQA 4OQTH 2Q8BL 5D7SH 5EULV 1H8SA 4UDUA 4JVWA 2CIIB 3S4SG 3IFNL 3SDYL 4GG6A 1BWMA 4L3ED 2DDQH 1H15A 5JLZB 5D2LE 1ADQL 4WGVB 1JFQL 4G3YL 1X5AA 1T66D 1BQHB 3SKMB 4E0RA 2FJFB 1CCZA 5CHNA 1CYGA 1T2JA 1ONQA 5DD5L 1ADQA 3L5HA 5BV7B 5GISL 1IAIM 3MMEB 1NBQA 4JZJA 3HB3C 1MFBH 4L1DA 4Q97A 2OZ4L 4OAWA 4DKEH 2VZTA 5DJCB 5GGUA 2APTA 1JWSB 3BPLB 5HYSA 5L7XH 1PLGH 3LEYL 2HT3D 1YJDH 2OZ4A 3SQOH 4GRWH 5GGVY 1V8HA 4CDHA 4QHUA 2EO1A 4J4PC 1KJ3L 1P7KB 3VRLF 2W0KA 2XFXB 2NY3B 4JRXA 5GHWL 5HHOA 5K59E 5ALBH 3DMMA 2ZCLH 1F97A 1RUPH 2YS4A 3O3DA 2FBOJ 5J12C 3N9GL 3U4EA 2H45A 3G6JB 3H9HA 3T4YB 1X5YA 2DJUA 4KMLB 1DLFL 3DO7B 5EZLB 3TV3H 2AJUH 2GW5A 4HC1L 2NY4D 1R0AL 2DF3A 4TPRH 1MIEL 5C09A 4Q2ZA 1IJ9A 4F2MB 3RVWC 1A02N 4HC1A 3HAEH 4KPHL 4NQCD 3QCUH 4K94L 4OGXH 4QRTB 3DVNA 5EOCH 3BPNC 1RJZA 4M61A 3SJVB 5LAXB 1HH9B 3IT8D 3UEZA 4BK4A 4PJIB 1A14L 5J9PA 1H0DA 4U7MA 4YO0B 4XPTH 1EGJL 1RZGA 3PV7A 1A7PH 3REWB 5FYJD 5HHVH 3RL1B 4KK5C 1Z3GL 4MJ5A 3BW9A 2BOBA 2OM5A 3RWEB 1EGJA 5DLML 1CLOH 4NN6B 4Y2DD 5ALCL 5DK0B 4M5ZH 1QKZL 3VFVB 3P77B 4PJAA 1CXFA 3BDYH 3WFBL 2IALB 2AJYL 4P2QD 5F9JB 1S8DB 4OZGE 4MHHI 3IDIB 4GBXB 5GIRB 3X17A 4X6DB 2NY6C 3DSFH 5CWSB 5D7IF 1KB5B 3GMMA 5DMKA 4ZO8A 3IU3B 4TYUA 5HDBF 1MEXH 5DD3H 3OTTA 4PTUA 5DHYB 3VG0L 3L3IB 1S9YB 1FE8H 5C0GA 4JEGB 1RURL 3O8XD 1C16B 3CU1A 4ODTH 2C4FU 3J7HA 1EH9A 2ZG2A 3SGEI 4H1LB 3PWJA 4HLZH 3CXHK 5C8JB 2LAAA 5FYKD 4JKPL 4YHKL 2QQKH 4M8QB 1RIVL 4P9ML 1S9VA 1W72B 3QI9B 1K9TA 2VZSA 1NLDL 4JM4H 4OT1L 5LG1A 4OZ4B 4N8VG 1CDYA 2OCFD 3TO4C 2GSGB 4X5XA 4XC3L 1CLYL 3B2UC 1YN6A 4L8SC 1Q9OA 4HPOL 3BP7B 2HFEA 4U6TA 1NJ9B 1U8OA 4W70A 4CN1A 3CCHB 4LK4A 1ZT7A 4JCMA 5I1GH 2NMSA 5DJXB 2LV4A 5EOQL 1IGCH 5IBLD 3P0GB 1OTTD 4C56E 5MP6L 3HLAA 4YHML 1UENA 3KPLA 4OZHA 2AQ2A 2HJKB 1LO0L 3EO9H 3BPCB 3MNVB 3BN3B 4U6VH 2DM2A 2EE9A 5CBAA 4FZ8L 5E8EB 3LKQA 5L0QC 4XP4L 1HIML 3H9SD 3ROLB 2BVPB 3ZYOA 1AP2B 2Z0BA 4AH2B 1D6VL 1JNNL 2AK4A 5H37H 4JO2L 1QFWL 3RGVB 1U95A 4HEME 2ZUVA 2YN3A 1U8HA 1VFUA 1MHHA 4G9FB 1QPPA 5A2IH 5BMFH 1MCWW 4NRYA 1RZFH 1INDL 3D1MC 3VGBA 2V17L 1HXYA 2H41A 2JF1A 4IRSB 5FO8A 3HZMB 4I18B 3JVGC 3M8OL 5IMKB 2J8OA 4NO2A 1E4WH 3JZ7A 1S78D 5HHXL 3MCKB 4GXVH 1WZMA 4KJYB 3ULUF 4QT5A 2D7MA 4EIGB 4K23L 3UC0H 1HHIA 1FLRH 5DJAA 5GZND 1GIGH 1HI6A 1QFWI 5C6PB 1IVLA 4XMLH 3S96B 5ACZA 2GJZA 1MHCB 2HP4A 1JK8A 3NTCH 5DFTA 4KV5E 1FNAA 4BYHA 2BNUA 1HKLL 4OD2B 4EUPH 1T2XA 1QSFD 5F7NC 2PCPA 3L5IA 4JRXE 4AZ8A 1N6QH 3E6FB 3WMSA 5BVPH 1J8KA 4ODSL 1UACH 3RZCA 1X7QB 2PXYB 5HDQH 1V3MA 3ZT7A 4M1CC 2KH2B 3SBWA 4UZGA 5HHNA 3EJYC 4KKBD 2KL6A 4PG2C 3G04B 5F9WC 5IMOA 3QUMB 5C09E 3LKRA 1QR1A 3IJHB 1M6OB 2VLME 4JANA 4MS8C 2Z91A 1VFAA 3C8DA 1FZOB 4GRMB 1SBSH 3IAGC 2VL5B 2BX5A 3VFPB 4DAGL 5DK2B 5DFVD 1J0HA 3R06A 4IRZH 5MEOA 4WFFE 2EDYA 3NPSC 3ULUD 2E27L 1NSNL 1MRFL 2J8UF 2AERT 5E4EC 4MJ6B 5ISZA 3ARDA 4PRNB 2YK1H 4PY7B 1EFXA 5IV2B 1YNTB 2BY3A 5TE7H 1A9BB 2Q7YA 4QXUL 5ANME 1BQSA 5HGAB 4Y16D 3RZWA 4PJAE 4UTBL 4M43L 2BNRA 3DVGA 3IDUA 3MLZH 1RHHA 4XNZC 3GBLA 3V79C 2LVCA 3AAZB 3QUZC 3BYTA 1TVDA 4P49A 5EBMB 5B3NA 4PD4K 3PWNB 5CMAB 3CNKA 3WFCH 1UEYA 1H5BA 1YEFH 3O81A 3PNWA 1EIBA 4S0TD 3I85A 4XNMB 5E1AA 5F9OL 2WLYA 5I1IL 4M48H 2RBLA 4I2XA 3O6MH 2WINB 5KSBA 1NUDA 1OWRM 1G7MA 4P9HC 3PP4H 4JZOA 2OMBA 5CJ8A 2FGWH 4HSQA 1MCHA 3SDDA 5GGTL 2Y36L 4HCRL 4LLDB 1P9MC 5IFJA 4WUUB 3AREB 2P8MB 4M6ML 4MAYA 5GGTA 4GLRI 1OARH 3MXWH 2VDNL 3FB7B 1A7OH 3RNQA 3DX9B 4HCRA 1KCRH 3UBXB 3WKMH 3CC5A 1XR8B 3MRKA