5JOFA

Crystal structure of vrc03 ghvglv antigen-binding fragment.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
220
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARRGSCDYCGDFPWQYWGQGTVVVVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VRC03 gHV heavy chain
publication title Somatic Hypermutation-Induced Changes in the Structure and Dynamics of HIV-1 Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 220
sequence length 224
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2016-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jofA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jofA01
5FDWA 1ZSDB 4D9QD 1P7HL 4NUGL 5FGSA 4PREA 3EO9H 1G7HA 3N1FC 2NY6C 2CSPA 1S8DA 5JW3H 1KEML 2BK8A 3DV4A 3O11B 1ADQL 3F12A 5EIIB 3DUUB 4O9HH 4KUZH 4P2OC 3IU3A 2GK2A 3O6KH 5D7IE 4R2GB 5D1XD 2FGWH 3VA2C 5F96L 2ERJC 1FC2D 1NAKH 3RWIA 2HKFH 2UUDK 3RTQC 2RCSL 3MLVH 4NJ9L 1S9KC 2D2OA 4JZOA 2VABB 3UTQB 4W4OA 2XTJE 1EHLL 3VD4A 1N59B 3X11B 2X4UB 2Q7YB 3NCYS 3CJJA 5FYKU 2VQUA 4PLKC 5T1KB 4EI5C 4NC1E 1Y6NR 4NKMA 2AVGA 5DK0B 4G9FA 1H9VA 5IBLD 4G8EA 2ESVE 3L6FA 2XA8H 3IU4H 4QXUL 1E4WL 1T6WA 2OL3A 3P4OB 3NN8A 4AZ8A 4PD4J 2WUBL 2FLBT 2FLRT 4CAGA 5F9DC 1T0MB 3IRZA 4AT6B 4HMDA 1I1FA 1PYWB 3ES6B 4JDTH 5KSUB 4H8WC 4AIOA 3EGSB 4FZEH 2QQLH 3CXHK 3K46A 3A6OA 3TIEB 1REIA 5I73C 2PO6D 3OL2A 4EQ2A 4NNXA 1GXEA 1AFVL 1QBMH 3Q2CA 1WFNA 2CIKB 1S9VA 4RGND 4XTRD 4XH2A 4GRWE 3D6GA 1A6VL 1BAFH 5E1HB 1IGMH 3O6FD 2Z9TA 3ROOB 3DROB 3RGVC 4DGVH 2EDQA 6FABH 3JWDC 3OB8A 4HH9A 4MQ7A 5F9JB 4TVSa 4FQXD 5KSBE 2ZJSL 5CZKA 1ZVSB 1AH1A 4OD1H 4Y5XB 3VGAC 3EO0B 2DTMH 4TUKL 4Y2DC 4OZIE 4R90H 1CD1B 4KH2A 4KTDL 3CDYA 5E6IC 3EYSH 2Y72A 5FO7B 2AEPH 4F2MB 3U2SA 2YPVH 4RMWA 3IGAB 5E08H 3EYOA 2PYED 4D0CB 3MV8D 1U93B 1SJEA 3VGDA 5B8CB 3UPAA 3DVNA 4ODTH 1XCTB 1UVQA 5AWNL 3EYFA 3EYQC 3MLZH 3QQ9C 1RHFA 15C8L 1BFTA 3TBTA 2NW3A 1NAMH 1U8NB 2D0FA 5IBUG 3HI6H 5L8JB 1G0XA 1TIUA 1F8TL 4OCRL 4AM0A 4YNYA 2E7LC 1O5DT 3MNWB 4PRPE 4BSVA 3MJGX 5KSAD 3FRPA 1HDMB 2XQBL 3MXWH 2HTKD 1AGDB 2F19L 4TULL 3MRMA 2D0HA 3C5ZA 3QRGL 1AE6H 1D5MA 5FA4B 2UY6A 4JY4B 2BZDA 5E6YA 3GKWL 4K9EH 2P48B 3KGRA 2JB5L 4HS6B 3OXRB 4FQ2L 4JRYB 5HY9B 1IRAY 3CFIC 1FNAA 5I66A 4E9LA 4HQQL 4J3XA 4PRBA 4V1DB 5H35A 1OF2B 2YBRA 1NBQA 5EU4B 3U0WH 4ZAKC 4PJ7B 3RPIA 4R6UA 3LV3A 4NQDD 2Z31B 2ICWB 3KYOA 4HC1A 2Q86A 4FXGA 4M7ZB 5L88L 1WZLA 1HYRC 3MRLB 1JCKA 5GZOC 1Y6KR 2LQRA 4ZYKB 3V0WH 3FHQA 4PJIA 5I19H 1INEH 1X44A 1GC1L 3C5SA 2DLFL 2P1YA 4BQ6A 3CFBA 3I50L 2Y7QA 4Z78A 1BFOA 1XGUB 5EOCH 3VGAB 3H6JA 4Y2DB 3ARGA 1B0WA 1I7RA 1U8MA 1OB1B 4PLJD 2FH6A 1W8OA 1Q72H 5E6IB 5I1DA 4NT6A 3NZHL 1DQMH 3PQYA 4BFIA 2O61B 2XWBA 1MFDL 5FGBA 1M7IB 3WIHA 1FZKA 3O4OB 3CPLB 3MBXH 3GRWL 4KQ3H 5CSZB 1TITA 3GMNB 3RVXD 4ZMAT 4FABH 5FM5O 2BNUB 1J5OH 3BYTA 4MCYB 1F4WL 4IOIB 3HG1A 3FB6A 3UP1A 4RX4D 3RVWD 3PGFL 2IGFL 3GUTB 4ONHA 4HUXA 3REWA 1I3GL 5HHNB 1I3RA 3I85A 4QTHB 2BVUA 4F9LC 1MJ7H 3S3JA 4AG4H 4MCZB 3KPRD 4IRZH 1H5BB 1PY4A 4UT9L 3RI5K 4JFDB 4XNYH 3HNTL 3KLAB 1YEKL 3FFDB 3EFDH 3HNVL 4NN6C 5DUPH 3STLA 4HUUB 1LEGA 4Q6IB 5EC2B 3DXAB 5IKCB 3QPXL 1A1NB 5IMKA 5AAWA 3QDGB 4NC2B 3IJHB 5IVXA 3R4DA 4QRRB 4LGPB 2CJUL 1CT8B 1R3IL 1IGIH 2Z4QA 4D9RD 4E0RB 3RY6C 5D96C 2CLVB 1YY8B 5EH1A 3ARTA 3K0WA 5EOQL 4ZAKB 4Z7OF 2BVYA 4PJ5A 5ACLA 4YHYB 1CVSC 1JGVL 2IG2H 4ELKB 4WU7B 1UJ3B 4FQHA 3BEWA 2VWEC 4J3OC 3VFUA 5I8CA 2LAAA 4QRUB 2D31B 1A6TA 2MQ3A 3NA9L 5EU6B 2COQA 5GS2D 1IKFL 5EUKB 4OGYL 4U1SB 4PJ7F 3PWUB 1B88A 4MD4A 3B83A 2VDNH 2EEDA 1YNLL 3D25B 4Z76A 2ZUWA 3VFWA 3PWVB 4EIGB 3QISA 3SDCD 5F21B 2V5YA 1TCRB 4QRQB 3BP4B 4LU5L 3KPQB 1PZ5B 5GGSB 1KN4H 2YA0A 2A73B 4NQEE 1I1YA 4PGEB 2BSRA 1CBVH 3QZWG 3M45A 3BRFA 1TNMA 2R8SH 3QH3B 3LQZA 2NXZB 1SYVA 3QIUC 1I7ZA 5DRZA 1KCUL 2PR4L 1MELA 4LRNH 1RZ8B 3FHAA 4ZPVA 3MRDA 5EFIA 3WDIA 5HGHB 3H0TA 5C0RL 2AV7B 3C6LC 4JFFA 3OQ3B 5IVOA 3FQWB 1JHKL 5JHDB 5LXGH 4KJQD 4DWHA 2JJWA 2V17H 3FB8B 4UDUB 5D93C 4U1NA 1I8IA 4GAYA 5HGDA 1U8IA 3KLHC 1ZA6B 3O3EA 5F1SA 3TYFA 3VE0B 2PXYD 4L5FH 1BD2D 3W5NA 5JDSA 4N0FB 1NFDB 4NUJB 3U9UB 4YDJA 1A7OL 3B9KD 1RUAL 1K5NB 1N3NA 2AAVA 1N2RA 2ZPKH 1KIQB 4HX1A 4U6TA 1K4DB 1PX3A 1ZK9A 4H0GA 4JQXC 3L7EB 3RFZC 1HOCA 2B1HH 3BGAA 4MA8H 3AMKA 1GAFL 4NWUH 3P9MA 5DA4A 4LASL 5BCAA 1FYTD 2OP4L 3MGOB 4N0CD 3TFKC 5BV7L 3FN0H 4U2ZA 1L7TH 3X3GL 3CDGB 3IDNB 2PW2B 4GMSL 2C3XA 2LAGB 5DTFB 3FKUS 2GK0A 2YD9A 3HR5B 3Q3GA 2WBJA 5JQHC 1IEBB 1OSPL 4LHUA 3UO1H 1WWWX 2DJUA 4OLZL 3INUL 1QBAA 5LKNA 1U3HC 3CK0L 4Z7OE 1NAMB 3LKNB 2VQTA 1NCWL 4P3CL 3K8MA 2C7UB 3U0TB 1LNUB 3BEVA 3SKNA 4EUPH 3NVQA 4TUOA 2A9ML 4G6FB 5HYIA 4GXUM 2EC8A 4QRPD 4I13B 3FONA 4S1RH 2V7NA 4PJ7E 1PBYA 3AB0C 1DEEB 4MS8D 4UDTB 2AJUL 3VG9C 3WN5B 1FBIL 5CEXA 4E41D 5DR5L 1T89C 1NC4B 4K3EL 1FVCA 4MDJA 1ZVYA 3N1MC 1QTYT 5AD0B 4Z7VA 3LY6A 2DQJH 2MHAB 4I18A 1ZHKA 1P9MA 1YEFH 3RL1B 3HE7C 4DKAA 4P2QB 4WIQA 4X4ZA 3QHTC 2CDEB 3HTLX 5EO0A 2Z8RA 4DAGL 1HINL 1J05B 3O4LD 1G7LB 3CX5K 5ESAA 4G6JH 3RWJB 1OTUD 2R4RH 4L8SC 4HWBH 3PIQB 4PJDA 1G6RL 1D9KB 1OARH 3NA4A 5CCKH 2CGRL 3UJIH 1W2KT 1IQWL 1MI5B 1QFWM 1YJDL 4I1NB 4KRPC 3SQBA 4MAYD 3QG6A 4G80B 1Q9OA 4PTUB 5CBEB 4HG4K 5F7FA 4FG6C 3HN3A 5ID1B 4NRYB 1NDGA 2CKNA 5C0AA 4LLUA 3G6AA 1NFDF 4FQIH 1V5JA 1CDHA 2V5RA 4MA3A 3UYRH 3OKEA 1FFNA 4HIIB 4DKDC 5L2KB 4OI8A 5KN5B 5MHSD 2AJZA 3BD5A 4NWTL 4K8RD 4XC1L 2Q8BL 1YMMB 3X13B 5FKPA 4OCLC 1RZKH 1B4JL 3WD5L 5GGTL 2X1XR 2NY5C 4MXVF 3B5TA 3F65A 5BRZE 4KTEL 1MIMH 1LDSA 4WI2A 1L0QA 1N7ML 4I77H 5IESH 4P57A 2VIRA 2GKIA 5D1XA 2HG5A 1U3YA 2RGSA 4KU1A 4QRRE 3FT2A 4ODXA 1IARB 3V5HB 5E94A 3QEQE 2C3GA 1EZVX 2A6DA 4GAFB 4Q9RH 1DDHB 1G9NL 2IAMD 3MMEB 2EICA 3AB0B 3KPLA 4F7CA 2Y07H 3WIIL 4APQB 2VYRE 1ORSB 1AXSA 3WFZA 4L8BA 1EEUA 4X7TB 2IAND 5FK9B 5CJQL 1LO2L 1EEYA 4L9LA 4JKPL 5FEBA 1A3LH 1VKXB 4ZUUA 4Y5YA 1MFBL 4N90E 1UWGH 2CO6B 2H41A 3HE7B 1MFEH 3HE6D 4K3GA 3T09A 2K7PA 4IRSD 2RQ8A 3RWFB 1PEZA 3MJ8B 2R4SL 3M07A 1RFDL 2PO6A 4MGXA 2IPTH 4PRNA 2LVEA 4HK0B 1DTUA 2WWMC 3VXQB 1MJJA 5D1ZB 1I85C 4XNUH 1OT1A 4S1QH 1R3LB 3LQMA 4KJWD 4RAHA 9CGTA 4O2EB 1JPGB 3O6FA 5EBMA 4CU8A 3P73B 3NIDE 3C5JA 1RJZA 4QWWD 3DYPA 4FQXA 4UQ3B 1UJTA 4ENED 1YYMH 5C0DA 1A7RL 5LCVH 2BCKA 1FG2B 3VFSA 2VLME 3QWOA 1OAZL 5CD3A 5IW6B 5DJDA 3MJ7A 5CHNB 4C55A 3Q48A 1TQBB 3MCKA 1BLNA 3LEVL 1ZLUH 5T3ZD 4IM8A 4RMSA 1DN0A 3QI9C 2BXZA 1LQSR 5ITBH 2UWEA 3LH2L 1IGCH 3ARPA 4WTXA 3S96B 2HJLA 3MOBL 1WFTA 3F58H 1TFHA 3MV8A 3MRPA 3GMMA 5SV4A 1FGNL 2F54A 1XCQB 4WO4D 3ARSA 2CK2A 4M61B 1LO5A 5CKGA 1H3VA 4PJCE 3N1PC 5EU3A 1CFBA 1O0VA 3CFCL 3GSVB 1KFAL 3OAZK 3QA3A 2EDDA 2J7LA 4M8QB 4ZS7L 3AU1A 4UT7H 5C09B 3JTSA 4L29B 3T08A 1BEYH 3DWTA 4ZUWA 2DDQL 3FO2A 1T5WB 2FBJL 2FEDC 4YBLC 2YA2A 1GOFA 1WEJH 3D1MC 4BH8B 2AK4B 3O2DL 4W6XB 4FMKA 1HCFX 3C08L 1JNLH 4N9GA 1K8IB 3IFPB 3EDFA 2C1OA 2VWEE 2BNQD 4NPYB 1MCNA 5ETUB 1DBBL 5GS1B 2GJ6B 4WW2C 4KV5F 2CMRH 5INCA 1CGXA 1WT5C 4P9HH 2CPCA 1S7TB 3GJFH 4MA1B 5C0GA 1IZKA 3QJFA 5D7JD 1I9RH 2IALB 4HKXB 3OKDA 3NZ8B 3H9SB 2VDPH 4YPGB 4JY6B 4OFPA 1QYGH 4LEOB 5DGQA 5D7SH 1LK3H 3CU1A 1NBYB 1QFWI 5GPRA 4Z7NF 3DUSA 4NQDA 1F4HA 1T1YA 2EDOA 4GBXD 2C1PA 4ZPTA 3QUKB 2Y06H 1K8DA 3QDJE 5D72H 3OV6A 3BSZH 3WO3B 4JO1L 4YE4L 4Z18A 4M6NH 4M5ZL 1KIPB 2X4NB 3CCHA 1JWSB 5HYJE 2UZXB 3DRQA 5GGUB 3T65B 3IDMA 2EKSB 3ULVD 5JA9A 4EUPB 2BMKA 1NC2B 1YPZB 4WI3A 5F7EH 1QLRB 2GSIA 2AQ1A 4JG0L 2WUCH 3P9LA 4HBQA 1DQJB 3AY4C 4P2QE 2E27H 2Y36H 3QI9B 1LK2A 4PJGE 5ISZD 4KI5D 4GO6B 5MEQB 2ORBH 2FX9L 3DIFB 3DPBA 5FYLD 4KMLB 4KK9C 4L4VD 3B9EA 5E9DB 1AD0A 1BVKA 3MNZA 2X4SA 1NMBL 3MLXL 4NZRH 3SDXB 1OOAA 4RDQG 2LFGA 3QCVL 3VGEA 4P5KA 3SDAB 4BQCA 1N6QL 4BZ2L 3QUZC 2RIKA 2QV2A 2YOCA 3O41B 4P48A 4FFWC 4LSTL 3UBXI 4CU7A 1F4XL 3O6MH 5I17A 2V9QA 1A6ZA 3KPRA 4WWKD 3P4NA 4XMPL 2P8PA 3WNPA 1VACA 3MRGA 5GISL 4HIHA 3HC0A 3LQAC 3KYKH 3MRBB 1UADC 2OR7A 4LBEB 1QPXA 4RGOL 4NQSB 1KB5H 4LSDA 5KZCD 4D3CL 3MRRA 4OQTH 4Q74A 4D0DB 1OW0A 3QNZB 5C71A 2ZOLA 1KTLA 4XNZB 5C8JA 1RUPL 4HS8L 1X5AA 3VXPB 3MFFB 3WV0A 4NZTH 3OKNB 4U1LA 2V2WB 4K94L 2R9HC 2X4TA 4JZJC 5EU5A 3MRKB 4LPTA 3TVMB 4N8VA 4X6BA 3BQUB 4TVPL 5E8NA 3X14B 5MEPA 3WS6A 4MSWA 2AK1L 1ZT1A 3B9DA 3TZVB 4A2LA 5BZDA 2E7MA 2Q6WB 1MNUH 5DD5H 5IG7A 2DWDA 3I6LE 1H3PH 1S5HB 4MJID 4HJJH 4YHPA 5HGAA 4DEPB 1BVLB 2ZCLL 3VXSD 1FL3B 2C3VB 5HHVL 3T4AB 3FZUC 2CR6A 3QEGL 4Z7NE 3IDXH 5EO1A 3BX7C 5GSVB 2VZ3A 4S1SH 1J8HB 1CE6A 5DUMH 3UTTE 1R0AL 1F3DJ 1ZLWH 2GSGB 2H2SD 4FP8L 4X9BA 5JORB 1IGJB 1R3KB 2APXA 1FNLA 3OXSB 3SDCA 2CRIA 3ARQA 4IIQA 5GXBB 4M6OL 5GJTL 4ZSOA 3OJDA 4HUWB 3LEYH 4NQXA 5C07E 4PJ9C 2X4RA 1JPSH 1YPZF 4P9HC 1CGWA 1MRFH 4X7CC 3UC0L 1JPTH 3CNKA 3ZDZF 1X5YA 1OAQH 1P2CB 3CLEH 3FOLA 1HH6A 3C87A 4M3JA 1S7QB 2DQEL 4G42B 5DJ6A 3LMJH 4F15C 4EN3D 3SDXF 1MCBA 3TJHD 3BO8B 3EIFA 3UZVB 1A2YA 5HHQB 5F88A 4DGIH 2AV1B 2P8LB 3C09B 3QHZH 3JV6A 3MLWL 5J11B 1P4IH 1OP3H 2QLVB 2PXYA 1BD2A 3CU7A 4GS7C 1AXTL 2ESVD 3DV6A 5EUOA 3JV5A 4JGMA 1MF2L 4D9LH 5FGCB 5IR1A 4ZNCD 3B9KA 1SVZA 4DFIA 1WAAF 1PG7W 2NCMA 2F58L 1YEHH 3BKCH 5SWSE 3QXAB 4B41A 4YFLI 4Y1AD 4GG6E 3ISWA 4PFEA 4Q2ZA 1MRDH 1KPRA 5DEFB 3VXNB 1DSFL 1M7XA 3EJYD 3WFHA 4XHJC 5GIRA 1E4XH 4F9PC 1FE8L 1G1YA 4N8CH 1YEJL 1J10A 4QXGL 2OL3H 1G1CA 3WFDH 4WGVB 1WWAX 5DFVC 4H20H 4OLWL 5LQBH 4WUUB 2AK4E 3S7GA 3UAJC 1M7DB 2ICEA 4X6FA 3HI1A 1EJOL 1ZS8A 3QB7C 2ZCKL 4OLVL 4O4YH 1QLEH 3BP6A 4DQOL 1E27B 1H8OA 1MQKH 3V4UL 3RZCD 2NXYC 4OCSL 3V8CA 3N06B 4WEBH 3T8XB 4LCIH 3HZKB 5C9JB 4Z8FL 3Q0HA 2VDRL 3DSFL 3STBA 3G6JB 2G5RA 4PJBB 4KKCC 2X4QA 5ICZB 5FCUH 5J6HA 1RJLA 1U2CA 5CUSL 1RULL 4PJ9B 4QRPA 3BPOB 3I3EA 1MCJA 1PSKH 3PL6D 4E41A 3GJFB 5HYSG 1Q0YL 3QO1B 4ZDHB 5I1KH 3LEXB 4F37F 1U92B 4HZLB 4K2UH 2RFXB 1A7QH 3QHFH 5FM5M 4XNMA 2V9TA 5EU7C 1EAPA 4F15B 1NFIA 3PWPE 2I27N 4JPVL 3ULSB 2VLLB 5CEZL 3O4LA 4KK8D 1XGPA 2XIDA 1ETZB 1B6DA 1T20B 3ZDZE 4ZUVA 2ATKA 1QA9B 5K9OA 2GIYA 4IJ3B 3TBVB 4Y16B 3EHBC 5E9DE 1J1PL 4JY5L 2GTWA 4ELME 2GCYB 1T1ZB 2LABA 3LKOB 2NY2B 2ENSA 5EN2A 5DURB 4KHXH 3NMEA 3AUVA 3JWNC 2XG4A 3KYAA 2J8HA 3D85B 3I9GH 3PABB 5AYUH 1T0PB 3UMTA 3FQTB 1PKQB 1V7NH 2W9DL 3NFNB 4N0RA 4HFWA 3UEZA 4Z0XA 4OF8A 1U8KA 2XN9D 2ADFH 3MYJB 1R5IA 1HILB 4KPHL 5J3HC 3STZB 1RIVH 1AC0A 1T66C 5DLMH 5IJKA 2OR8A 1BFVH 3D39B 1ED3B 5SWZB 1ZEAH 2FJGB 4TQEL 4Y8AA 2HLFD 4U1GC 3LS4L 5E4EB 4Q0XL 4OV5B 4XPGH 1ONQA 1KB9K 2DD8L 2DRUA 3RWEA 1WISA 4YHOL 5F6HJ 4PBVC 1OGAE 4LPXA 4XBEH 4TNWF 1MLBA 3BISA 3VMOA 5C86A 2NXYB 5K93A 2BFVL 5DDHA 4DZ8A 5E56A 5GRYA 2W92A 1WC7A 4HC1H 1BZ9A 3E2HC 3L3JB 1FO0A 4U1HB 5EOTA 2D4DA 1HIML 2DAVA 4H25A 5FYKL 4TUJA 2Y6SD 1PD6A 4YXLL 4OLEA 2F74B 3GI8H 5T5NG 3H3PH 3RRQA 4G8GE 3SJVA 2HT4C 2IAMA 4XNXH 1Z3GH 1UB5A 3UTOA 5DO2C 4P0DA 3SCMC 3VXUB 4RAVA 3ZTJG 4I0PB 1OPGH 4KJYB 3L3DB 2YZ8A 1KB5B 1KNOB 1MHPL 1X5ZA 2IANA 4UQ2B 1LO0H 3G6JF 12E8H 3HMWL 1T1XB 1A4JA 3Q5TA 4BELD 3UJJH 3WXWL 4RNRA 1XF2A 4X0KA 3EJZD 1JGEB 4X6EA 3BH9A 3HE6A 4IRSA 4OF7A 1Y6MR 3DTXA 1N4XH 2WQ8A 1P4LA 4HIJB 5DJCA 2P8MB 4D8PA 3O6LL 1I1AD 5DHXB 3WKMH 3MJ9A 4X6DA 1C12A 3BH8A 3N50A 5F9WC 1YN6A 3GHBL 3V4PH 1X7QB 3RUGA 3QYCA 4D94A 1PW3A 3WXVH 2R2BB 4QTIL 2DICA 3JTTA 2YK1L 3BP7B 1S3KH 1T0NB 1YNKH 4U31A 3L3IA 2YN5A 1OM3L 1SHMA 3PNWA 1NGXB 5D6CA 3ZT6A 5HD8C 3U4EA 5ID0B 1EAJA 4KMTL 5JOFA 1Q9LB 2BOBB 5BO1H 3BWAB 4OF6A 2C9AA 3OGCB 1FRGH 3WS3B 1ACYH 5EORH 4Z77A 2HFFA 4HKJB 4U1GB 4ISVB 4LQ1A 1QHOA 5I0DA 1DFBL 3S37X 3MROA 2AGJH 3BN3B 3G5XB 3UYPA 1ITBB 3PV6B 4PRIA 1MEXL 3ZKXC 5CP7A 1ES0B 4WO4A 3HUJA 5I75B 1I7TA 4PREB 1CGSL 1G7HB 3TO4D 2FECL 4KZEH 2XRAH 4FMFA 1S8DB 3E2HB 1T2QL 3A67L 3CXDH 2W60B 5TF1H 2E7HA 1X5HA 5E8EA 3F12B 5IQ7L 3HZYB 1J86A 1S9WA 3IU3B 4HZAA 3VJ6B 1EMTL 2V7HA 2SEBB 1BQLH 2Q20A 3DECA 3KXFE 2YSSA 3HAEG 3RWIB 1KCVH 4JO3H 2AXJA 4NQED 2JB6A 4G43A 1UWXK 5J06A 2BNQA 5DK3A 5C2BH 3OKOA 1I1CA 4JZNA 5E00A 2B8OT 4NKMB 4HT1L 1KCSL 1UENA 2R0ZH 4P46D 3SGKA 3BZFA 2OSLB 4UOW0 4AENA 4G8EB 2YPLE 3O8XD 1X6NA 2I07A 2OL3B 3OPZL 2R0LL 3NN8B 1QFOA 2NNAA 4JPIA 1AR1C 3KJ6L 1XGYH 2J6EA 1JFQH 2NY6D 4OM1L 4GBXA 2A74A 2N7BA 3T0ED 3J7HA 5GRJH 2R1YA 3QCUL 4P2OD 1SEBA 2O5YL 4XH2B 1B2WL 1KBGL 1BREA 3RKPA 2VDMH 4N0UA 2YA1A 1NDMA 4JN1H 1A8JH 3RTQD 1TDQA 5I8OH 1Q8MA 3LKRA 1J0YA 4HH9B 4MQ7B 1MHCA 4KVCH 2OR9H 3BPLB 4XAKD 1KCKA 3Q6FA 1NCUA 4PLKD 1YUHB 5CS7A 5ISZA 1NANH 3FL7A 4EI5D 4EDXA 5ADPH 1RY7B 1GL4B 4I8DA 2FATL 2DKSA 5MP6L 4KHTL 2KQNA 4L4VA 5T3XE 1ODAA 1DBAL 2HKHH 2HN7A 3LOWA 4GAJL 1MCEA 3MLRL 4POZC 5EA0L 1Z9SA 1UACH 3O9WD 4HXAH 3EYOB 4ORGB 4XPAL 2EIBA 1INDL 2E9JA 2JJSA 1SJEB 2QQNH 3V6ZB 2VDKH 3A6BL 3DVNB 1PKQE 3GSOB 1PG7X 2OXGA 1QBLL 3EYFB 3I2CH 4ONGL 5CGMA 3TBTB 4WWKA 5EBWA 3V79C 3DVFA 3RGVD 4CW1A 4BM7A 4IRJA 1TJIH 1JUFA 1OAXL 4MXWH 2IADA 1J1OL 1KLFA 4BSVB 2PW1A 5E8PB 2IBGA 5FM4A 1IAIL 4JPWH 4LKXA 2YUWA 1FAIH 2FWOA 4JN2A 3V0VB 1OY3B 4L4TE 4R4FL 2AERT 4DUXA 4Z7WA 2W38A 3C5ZB 4L4JA 1AKJD 3N9GH 1D5MB 5F1KC 2DOCA 5E6ID 1LILA 2O5XH 4XVTL 5ESVB 4EKXA 2EO9A 4WI8A 1SJXA 4G5ZH 1UM4H 3SKOB 4LOUC 3V4VL 5I66B 3PV7A 4DKEL 3BDXA 4KUCD 5H35B 1UQSA 1Q9KA 4PRHE 3U7WL 4X9HA 4MJIA 3RPIB 3BDYH 3LV3B 5JR1H 1W8NA 3EYQD 1R3JA 3IJSA 3KYOB 3VXSA 3T77A 4LLAA 4QRTA 2Q86B 3EO1A 4FXGB 5KVMC 1NCAH 3CH1A 2AXFA 3EO9L 4HS3A 2ADJA 4PJIB 3RU8H 5JW3L 3C9NA 3LVEA 5GRXG 2Y7QB 2WP3T 4Z78B 1JRHI 5A1AA 1BFOB 2IH3A 3O6KL 2BJMH 5CJXC 5IB1A 3ARGB 1FYHB 3DARA 1U8MB 3IXAB 4UINL 3EOBB 1R6VA 3KWWA 2CRZA 1NAKL 4DFHA 1NCBL 2HKFL 3U9PH 4NT6B 5BRZD 2C3HA 3MLVL 3LSOA 4Z5RA 2PCPB 3CFJB 4BFIB 4K7PH 2XWBB 5D7IA 5D7LB 3GSNA 2Z93A 3FO9A 1AQKH 1UG9A 1EA9C 4JQVA 4WHTA 3X3FH 3QEQD 1KT2A 3JUZA 3MV7E 1K9TA 3HG1B 3FB6B 2XA8L 3HLAB 3K4DA 3ZTNH 4M43H 2JE8A 4ONHB 4HUXB 3CFDB 4NRXA 3GBLA 3T3PE 3BE1H 2NY4C 5C0CB 1GZQA 2ESVA 5GGVL 4JDTL 4LGRB 4X80H 4Y5VC 3TESA 1CIDA 3WLBA 1HXMA 1MY5A 1SM3H 1NMCC 4N90D 4FFYL 1QBML 3DX9B 3CC5A 5I30H 5J13C 1BQHG 3CIQA 5DRXA 4OI7A 3STLB 1BAFL 1IGML 4BSJA 4DGVL 3E6HA 6FABL 2HMIC 4MB3A 5GZNC 1JGDA 1WIUA 5IVXB 1JHTA 2UVFA 3WFBH 2Y23A 3GMRA 4WEMB 2B20A 2MCG1 3U46B 2Z4QB 5BXFA 1KC5L 1KENH 3NCYP 5L8LB 2KH2B 2DQTH 4NJAH 3VXRE 4R90L 5IBTH 5BQ7A 3RY4A 5KSBA 5HDBE 3EYSL 4UIKH 3OB0H 2VLMD 4XCEA 3BEWB 2O5ZH 3TPUB 5JLZA 4HIEA 3VFUB 2YRLA 3ILQC 4OZIA 1A6TB 3P9WB 3F6LA 3IJYA 4PGCA 2IPKB 2BRRH 3S36X 5DS8A 1ZKAA 3GO1L 4FZ8H 2WBKA 4JVUA 4ODTL 2FHCA 5J1SC 2WSKA 1U8LB 1IT9H 3X12A 4J3SA 4Z76B 1AIFA 3RX5A 3VFWB 4PJIF 4ZXBC 5F44A 1SMAA 3SGEI 3VWKC 5HYSA 3HI6L 3PL6A 4EOWH 5CAYB 3GMQA 4BQBA 2HAZA 2H9GB 3FTGA 3FN9A 3KYNA 2XZZA 5C0FB 1I1YB 3UTZB 5GJSH 3VFVB 2DQFB 5I1IH 2APVA 2QHLA 3PDDA 5HJ3A 3WO4B 5JIIA 2H32A 1SYVB 4Z95H 1JYVA 1S7VA 1FIGH 1I7ZB 4JVWA 1A1MA 5K9QI 3I02A 3OBAA 4XCCL 3GB7A 2FZ3B 3MRDB 4M7KH 4ZPVB 4F7MA 5EFIB 2XWJB 3H0TB 4PRPA 1BWWA 3BMWA 4JFFB 3TBSA 2EDEA 5FHAH 1UEYA 4K9EL 4P3DB 5JMRA 1BBDL 2EYRB 1HCVA 2Q1EA 1MUJA 1L0XA 1BX2A 2A0LC 1NMCB 1U8IB 5EZLB 3TYFB 5B21A 5J13B 3NACH 5DRNB 3MV11 3U0WL 4YDJB 1TZGH 4MNHB 2QJDA 1N3NB 2VZTA 43C9A 2FJHA 1TZHB 4HX1B 3V0WL 1QRND 5B39G 5I19L 3LB6C 4MB4A 3P9MB 5TH2B 4LSVH 3QDJD 2D9CA 5KTEH 2ED8A 3C8HA 3FO0H 2VLJE 1KELL 3MUY1 1KEGH 3QIUD 5DD0L 4HPYH 4U1KA 1T04A 1Q72L 1UZ6E 2RHEA 1GPOL 1NMAH 5HYJD 3Q3GB 4K23H 1JNJA 5IVXF 3SY0B 1DQML 5I1GH 2WBJB 3C6LD 1MCWW 4LHUB 1T7WA 4KFZC 2VXTH 4MAUH 2NY1B 1AHWC 4P2QD 1RURH 3MBXL 5D6DC 1VFAA 5TDPA 1X5IA 2DI7A 3O3BA 3RIAF 4FABL 3KLHD 5T1MA 1J5OL 1F97A 5BMFH 2E3VA 3TO2B 1CYGA 3SKNB 3U7AA 4ZXBB 2BSSA 4TUOB 4OFIA 4KZDL 3G9VA 4WTZG 3LRHA 2AABH 5HTSA 1MJ7L 3FONB 5E5MA 1CXFA 4IRZL 2V7NB 2YS4A 4Y4FA 3RA7H 1BJ8A 1RZJH 1CXHA 4CVZB 5E5UB 5FYJE 1N5AA 4JHWL 4PJEE 3TFKD 2DN7A 3EFDL 5DUPL 4BH7A 1FVCB 1J0HA 4MDJB 3SEPA 2EO1A 1FL5B 1J18A 4LRIA 2BC4A 5EBLA 1EK3A 2R23A 1B0RB 5M95B 4I18B 4RISH 4ONFL 4TNVF 1ZHKB 2G9HB 1I1AA 4BSWA 3BAEH 5EO0B 1KJVB 2Q7NA 2FX7L 1WFOA 5FF6B 5I1CH 1I7UB 4OFKA 5ESAB 1IGIL 3MCG1 4O02L 3V9FA 1L7IL 5DMKB 2EE9A 4WCYH 3QUMA 1WF5A 3DUUA 4PJDB 1U3HD 4DVBB 1IAKA 5D7LE 3TCLA 3ZKSD 4I2XE 4X8XA 3MA7A 4W4NA 1Q9OB 5IB2B 4U7KA 1YEIH 4LCUA 3SE4C 2M2DA 2QADC 2VABA 3UTQA 2ID5A 4E42A 3B5GA 2VXVH 4X5WB 4NC0B 4LLUB 2Q7YA 1QSEE 3G6AB 1QRKA 1QPPA 1P1ZA 3V95A 2AJVH 5DK0A 1B0GB 1Q94A 4MA3B 3WUWB 4JQIL 4YFLF 2VDNL 2BDNL 5C0CE 4PGZA 1I9IH 5C9KA 4CUCA 5DJXA 2AJZB 3K8KA 3GSWA 4ZG1A 5FKPB 4GT7A 1RUQH 4J23A 1KN4L 1X4ZA 3UTTD 1NKOA 4MZ2A 4N68A 1MRCH 1V05A 4JB9H 1MCFA 4OZFG 1ZLUK 1CBVL 1PYWA 4PIRF 1GGUA 3ES6A 5KSUA 1TCMA 5DMIH 2R8SL 4P57B 1P7KA 2VIRB 5D1XB 1HWGB 4LRNL 5GS2H 3WJLC 5C07D 1CL7I 4NQEA 5HPMA 2APFA 4YUEH 4KRPD 4ODXB 1T6VN 1JHLH 1L6ZA 3SQOH 2A6DB 5ADOH 1JRHH 1OLZA 5LXGL 1ZGLM 4FG6D 3KPLB 4F7CB 3HZVB 2V17L 2Z8VC 4ZO8A 2MQ0A 1R3HA 5IFHH 1AXSB 5KSAC 1ZVSA 4L8BB 4M03A 2QR0B 4P46A 4L5FL 4Y5XA 3O8XA 3I3DA 4L9LB 1VADA 4JFED 4JCLA 3IVKA 4ZUUB 4Y5YB 4YHNA 2FB4H 3F7YB 4PYHA 2CO7B 4R9HA 4POYA 3BN9C 5JQ6H 3IGAA 4BUHA 4HAFA 3L95A 1NEZG 2B1HL 4NWUL 1EO8H 4M9OA 1IAMA 4M62H 1BM3H 3GJFK 1U93A 5SWSD 2PO6B 2YRZA 4PRNB 4OZ4A 4P2OA 4RGNB 3FN0L 4OT1H 3VG0H 4CDGC 3ULUC 5EBMB 1QUNA 1PY9A 3MLUH 3RTQA 2KUTA 1S7XA 1U8NA 1U6AH 5A16A 1LDPH 3F6IA 3CSBA 4FQXB 5C0DB 3S37H 4OLYL 1T1WB 4PJDF 2BCKB 4PJHB 2NY3D 3VFSB 3QULB 3QWOB 3BKYH 3BESR 3H9HA 4M93C 5DJDB 3MJ7B 5DD1H 3R06A 1BECA 3D2UD 1HYSC 4UV4H 4I9WE 1RIUH 5HHOE 1BLNB 1VEOA 4BZ1L 1IC7H 1LO4H 1RSFA 4LLMA 2OS7A 5DUBA 1HKLH 1S7RA 2HJLB 4XPTH 2PYEB 5C0BD 4HS6A 3MV8B 3MRPB 3GMMB 4S1RL 3UDWC 1EHXA 1DQQA 1CR9H 3TA3C 4X7SH 1IM3B 1LO5B 5I71B 1LE9B 5EU3B 1MAJA 4HJ0D 5B3NA 1OF2A 1I4FA 1VPOH 1YYLL 3AU1B 5JOPE 4PJ7A 3LPFA 1OTTC 4ZUWB 5JO5A 3FO2B 2KKQA 3RGVA 4UU9A 5K9JH 4M48H 3MRLA 1YEFL 4UAOB 2V5TA 1CICC 4NO0D 3ARBC 4KC3B 5HVWA 2AEQH 3QR2A 4G6JL 4U1MA 1A9EA 5KSAB 3ECBA 5C7XL 4ZOCA 2R4RL 2C1OB 1ZXQA 3PWPD 4R97B 4P49A 3BKML 5JW4R 5CCKL 4Y2DA 4Q9CA 5DVNA 5BOZG 4P2RD 3WJJC 1AKJA 1YNTA 1OB1A 5E6IA 4WJ5B 3N1GC 1MJUH 4OSUH 5C0GB 3QI9D 3QJFB 4WFEE 5INDB 1MPAH 1K2DA 3OKDB 2PKDA 5E9DD 1IILE 4F7EA 1A6WH 1A5FH 3WSQL 4KGLA 3PWNA 5JIPA 3A6CH 5DI8B 2X10A 3CPLA 3LS5L 2C4FT 3MACH 4FHBD 5CSZA 3UYRL 3GMNA 3DUSB 2BHZA 2D03H 3W9DB 2BNUA 4NQDB 1D7FA 2C1PB 4ZPTB 3VFTA 1K8DB 1X5XA 1RZKL 5HHNA 4KI1A 2FEDD 3O45A 3TN0C 1NGWA 1R24B 3TV3H 2E7LA 3DRQB 4MCZA 4P99A 1CGYA 3IDMB 1SBSL 1DBJL 4I77L 5IESL 5KSVA 2BMKB 5JXEC 4JJ5B 1MCHA 1OWRM 5BRZA 1OGAD 4JVPA 1LK2B 5E8DL 5B3JF 5IKCA 4PJHF 4Q9RL 4ZODA 1AD0B 1JMXA 5IB3A 5IHUH 4KKLC 1BVKB 3FFCE 2F8VA 3MNZB 1ZLWK 4K8RH 3IJHA 4AMKL 1NGQL 2Y07L 3TA3B 4QRRA 1A7PH 1NCDH 3QEQA 2EDTA 4G8GD 2NY7H 5J1TC 4KK5D 1YY8A 5KOMC 4GSDL 4ZAKA 1A3LL 5EDXA 1U3JA 1CE1H 1XGRB 3B4NA 1MCKA 3V7AE 4ELKA 2XQYK 2D7NA 1UWGL 3ILPA 4JFPB 4U0QB 5FO8A 5JZ7C 1FO0H 2X70B 4H26B 4KJQC 1A6ZB 2IPUK 3KPRB 4LHQB 4PJFB 2P8PB 5MEND 2ED9A 3IDYC 4NKQB 1VACB 2R69L 2UVEA 5AYQA 3MRGB 2NTSP 1BQHA 1VHPA 4U1SA 1JZ4A 1JTTA 3HC0B 4HIHB 4XNUL 3LD8B 4LVNB 2DBLH 2NX5E 5KVFH 3SHSA 5FKAA 1GHFL 3D25A 3MRRB 3VRLF 4YZFF 1OP3K 3C8DA 2ZOLB 1KTLB 4QRQA 4KK9D 5GHWH 4U6HA 3BP4A 3CDCA 3KPQA 5LCVL 2XA3A 4WI6A 2A73A 2X4TB 4MB5A 5EU5B 4PGEA 3E6FB 2HH0H 4Y4HD 3VFPA 2AI0H 5E8NB 4J4PC 4MSWB 4UBDC 4MZ3A 1CZ8H 3QUZD 2YD5A 1ZHLA 1J0IA 5I1LB 5IG7B 4FFWD 2DWDB 1T7ZA 3K2MC 5ITBL 4DN3L 3BRGC 1IGCL 3O0RL 4AYFA 5HYQA 4PG9A 4F9LA 5HGAB 2QQQA 3F58L 2FEEI 4OZHE 2AS5M 5H94B 1BP3B 3LKSB 1EEZB 2ZUSA 4DKFH 4HF5H 2R0KL 2VDQL 2BVQA 1KTRL 4UDUA 3EKCA 3WKNA 5EO1B 3TT1H 4XWGH 3FQNB 1ZA6A 4F7TA 4OD3H 3DX6A 4PJAE 4YFDB 3VE0A 3H3KA 4PRAA 4UT7L 3U9UA 5F6IB 1BEYL 4P5TC 2NW2B 4WUKH 2V2TB 4IIQB 3VWJC 4PJCA 1KIRB 2EH8H 5T3ZH 4NQXB 3BVNB 5IJVB 4RGNE 1N64L 3QZWB 1CXIA 4U3XA 4GJTB 3L7EA 3ELAT 1JNLL 1XEDA 3PGCA 1A6AA 3RY6A 2VC2L 3KXFD 1ZHBA 2CMRL 4ZFFA 1HH6B 1DQDH 1UCBH 5MEOB 2NTFA 4PJHE 1CD8A 2BSED 3FAXA 3T0VA 5DJ6B 5DQJA 1KLGA 1DLHA 4LSQH 1CG9A 3O2VL 1I9RL 3QIWC 4ZUTB 3G5ZB 1WZKA 1A2YB 1M6OB 5F88B 4ZNEE 2HT3C 4M1CC 3RL2A 1JMZA 3NPSC 1CXKA 3JV6B 1QYGL 2YD7A 3MODH 3FZUD 4LVHC 5D7SL 3RWHA 1CL7H 1KJ3H 1LK3L 1BD2B 2PXYB 5HBBA 1NAMA 1G7JB 2YPLD 3LKNA 4OV6F 5EUOB 3T0BA 2ARJQ 2YXFA 3B9KB 2PYEE 2F8XC 2C7UA 4MAYC 1U0QA 2Y06L 1OTSC 4OCNC 3V6BR 1CFVH 5D72L 3BSZL 4PJFF 1GGTA 5TFSH 2OCFD 1MAMH 3HNSH 1IJ9A 3HC4H 4M6NL 4Q2ZB 1BGXL 1L9NA 1IBGH 4PJ9D 1FNEA 4U3CA 3WFHB 5D9SA 1FYTB 5GIRB 2VISA 2NLJB 3QDJA 4UDTA 3X17A 5F7EL 5GSRA 3QIUA 3D3VD 5IFAH 1HKFA 2WUCL 4GMTL 1IVLA 5HYJA 2E27L 1OAUH 4W6WB 2N56A 1FLRH 2Q8AH 5AD0A 3C6LA 2W65A 4X6FB 4IEFB 1QR1B 1ZS8B 3MV9D 4RFOL 4OJFH 3SDDD 1URLA 2ZSWA 3BP6B 2HT2C 4NZRL 4P2QA 4WV1C 1YEDA 4HEME 4PJGA 5SX5H 2XNAA 1KPUA 3RNKB 3UJTL 5HVHC 4QT5A 5F89B 2EDRA 3PIQA 5T3XD 1CD9B 5I9QC 3ULVH 3CUPA 4WTZA 3PHOB 4R26H 4LNRA 1XF1A 3O6ML 2X4QB 2YKLH 1BJ1J 1RJLB 4OM0L 4HLJA 1AP2A 4PTUA 4XCNB 3IT8D 4H88L 4QRPB 4R4NC 4OF3A 4JQXA 2HFEB 5ID1A 5FYLH 2A6JB 3MBEC 4XHJD 4E41B 4I5BB 1D6VH 1GZPA 5CILL 5I74C 4KXZH 3KYKL 3OJVC 5SV3A 2EDNA 1KB5L 4R0LC 5DFVD 4OQTL 3SE3C 3UAJD 4PJ8D 3X13A 5ECJE 5C3TA 2YD4A 4NN5B 1RUML 1TVDA 3O4LB 1JZ8A 4NZTL 2QEJA 2EXWC 5A3IC 5FXCH 3AFLA 5FCSH 4L4TD 1UXWA 2ATKB 4ZUVB 1U3HA 3IFLL 5F7YC 3VGBA 5K9OB 4ZOBA 5HVGB 4XNQB 4P23C 2EDFA 2GTWB 1HEZB 5IHZB 4MAYB 5I1EH 1MNUL 3CSYA 5EN2B 5DD5L 3RDTC 1H3PL 4QWWC 4KKCD 3V5HA 4HJJL 1DDHA 4MD0A 4HFWB 1FGVH 4Z0XB 2A6KB 3GMLA 1U8KB 3IDXL 5HI5C 4PRHD 1NKRA 3F7RA 4B53A 3IETA 5B22A 1DQLH 2EDWA 1T89A 2KDGA 1NCCL 4PJFE 1HXYA 5C6TH 1VKXA 4ODVL 5KW9H 2P49B 3VD9A 1ONQB 3RWEB 4Q58C 1EXUA 1KGCD 3UTTA 4GAGH 2AJSH 4NDMA 3HE7A 4MNQB 1MLBB 4FA8A 3TNMA 5DDHB 1KUMA 1MRFL 5GGQH 4LARH 4WNQA 1WC7B 4L8SA 3V0AC 3B8SA 2HLAA 1BZ9B 1OAQL 5C07A 3CLEL 1FO0B 2A1WH 3EHBD 5EZOH 1UCTA 4H25B 5I18H 3KPNA 4D9RE 4UI2A 1JPGA 4QNPF 2J88H 1EERB 3LMJL 2IAMB 1VFBA 1CLYH 1XF4A 1RV6X 1EUUA 2E5EA 3RIAK 1IC4L 3DOSA 3U6RB 2WANA 4DGIL 3DJ9A 2DM3A 3QHZL 2P5WE 4NHUA 3BUTA 4P9ML 5I74B 1P4IL 1OAYL 3MV7D 2I26N 2IANB 5CHNA 4D9LL 5J3HD 3H42H 3RVVC 1YEHL 4RNRB 1T66D 4X0KB 5GRUH 2G5BA 2OZ4H 3LRSB 3P30H 5D7JC 3KPPA 1NEZA 3OX8B 4X6EB 3BH9B 5CMAA 4IRSB 4OI9A 3S96A 2MJWA 3QFJE 1P4LB 5SWSA 5DJCB 1E4XL 3RNQB 1XCQA 4I3GA 4N8CL 4PR5A 4D8PB 5L8KB 4GG6A 4M61A 2OL3L 3WFDL 4TNVK 1C12B 3BH8B 4FNLH 2EDXA 1U58A 4H20L 4YXKL 3OF6D 5LQBL 4MWFA 1YN6B 2YUXA 3RDTB 1NGZB 3NCFB 5I1JH 3RUGB 2JJVA 1LP9B 4DK3A 1NPUA 1T5WA 1HHHA 2HT4D 3KPMB 4J6RH 3QSKB 1LE5A 3JTTB 5C0IA 1QLEL 1NL0H 1QSFD 4F80A 1C1EH 1MQKL 3SCMD 1FL6B 3L3IB 5F3HB 4LMQI 2AK4A 2QSVA 1ITCA 3PNWB 3ULVC 2FX8H 5D6CB 5IMOA 3VXRD 4LSPL 3U4EB 1K8IA 3D2UA 2DJSA 4LCIL 5ETUA 4PS4L 4GW4A 4TPRH 4Z77B 2HFFB 3GM0A 3HPLA 4GRWH 5A2IH 2B4CC 5CP7B 3E8UH 4WO4B 4G6MH 4YPGA 1PSKL 1I7TB 3LKQA 1JTPA 4L9DA 5CINH 1B6UA 5C1MB 5FIEA 2AQ3A 5E8EB 5I1KL 4R4BA 1FZMB 1BQUA 4OQ1A 4K2UL 2AEIT 1A7QL 3O3DA 3QHFL 1FYTE 3QUKA 4YHLH 5L6YH 5GRWA 1FJ1B 2YSSB 3VMPA 5BS0E 2X7LA 3GI9L 3SKMA 1FNGB 4KAQL 1KIPA 2X4NA 4JREC 2JB6B 1JWSA 2HVJA 3ZT5A 3LHPL 4IMLB 1AY1H 2BNQB 3PWPA 3NCEB 3OKOB 3W11C 4O58H 5HD8D 4JZNB 5C08E 3ZE1F 5E00B 1QLRA 3VA6A 1A9BB 2OLDA 1Y18B 4KHXL 3WNMA 3QI9A 2N1KA 5D7JB 5CKAA 3DIFA 3CVHA 4B5EA 4FQJL 2J8OA 3I9GL 4JFHE 2I07B 4UNUA 5E9DA 5AYUL 4XC3H 4U6VH 1V7NL 4ELMA 2M26A 5DMGC 1I8MA 5BW7C 3TH4T 4JPIB 4G6KH 4JANA 4NZDA 4ZOAA 4TTDC 3SDAA 2A74B 3RQ3A 4YHKH 5DLML 4LCCC 1M4KA 3D48R 1BFVL 2R1YB 4P59L 3O41A 2NQCA 5D5MB 2GT9B 3F7VB 4XPGL 4Y2OA 4N0UB 2H3NA 1TJHH 4I4WA 4ODHL 1NDMB 2Q76A 3ZDXF 4HWBA 4XBEL 5FO9A 2MWCA 3CFEA 2EDHA 2VLJD 1CGVA 4LQFH 1ZOXA 1MHCB 4HC1L 2FJFA 4WW2A 3P11H 1G9MH 1K4CA 1OGAA 1LP9F 3WFEH 5ISZB 2YWYA 4ODUB 4EDXB 1WT5A 2P24A 4LLYA 4QYOA 3IYLW 4XCYA 3H3PL 3JWOH 4FQLL 4L4VB 1IFHH 5E2TH 4CRPA 1GYAA 3QAZC 1U8JB 1Q1JL 3CX2A 4P5MB 2HN7B 2RR3A 3QUXC 1J1XH 4JHZA 4XP4L 4G8GA 1LO0L 1DLFH 4X8JB 3TVMA 1AR1D 4YDVA 5HHPA 2WWKT 3AREC 2Q6WA 3ZE0F 3TM6A 4RCAA 1FNSH 3WIHL 4EN3C 2DB8A 4O2CB 3D0VA 4JREB 4WWKB 5EBWB 4WFHE 3SPVA 2VNCA 4H1LG 3LZFH 4NP4H 5FYJD 3T4AA 5JXAL 4KY1H 4HWUA 3CDFA 1JUFB 2BP3A 3WKML 5GSVA 3WMSA 4B7IA 4LKXB 2GSGA 3DURA 3AY4A 2A77L 2FWOB 5DT1H 4MNQE 5ANME 4CN4A 5KZCB 1R3KA 3OZ9H 5IW3A 2O26U 3KS0H 3WXVL 1S3KL 4HUWA 4PGJA 3HI5L 1YNKL 3QEUA 2HTLC 5I6XB 1JJUA 4HUNB 1C16B 4POZD 3WHE1 5BO1L 2CUIA 4JLRA 3DI3B 1A6UH 4IDJL 43CAB 4LCCB 3QUZA 3VW3H 4MD5A 5I76B 1FRGL 5EORL 1TPXB 1QLFA 1UQSB 4NYLB 4MJIB 3ZSSA 2D0GA 2AJXH 2QTEA 2AGJL 3CZFA 3CMOH 1R3JB 4YK4C 3VXSB 1BHGA 3OHXB 4IMKC 1QSED 3QUMH 1A3RH 3B6SA 4PPTA 3RZCC 5HHQA 5ERWA 2LV4A 2AV1A 2AXFB 3CH1B 1NGPH 5IF0A 2D9QB 3UBXG 2ADJB 4EVNB 1KSRA 4KZEL 2IF7A 5C0CD 5D5MF 1EGJA 1TTGA 2EZ0C 3RAJH 3EDDA 2IH3B 5EULV 4WENB 1EO5A 3QXVA 4LDOB 4PV9A 1WLHA 5KS9E 3KWWB 3QAZB 1TQCB 1KCVL 5E0QA 3ULVF 4NUGH 2DM7A 3LSOB 5BVPH 5IT2H 3KAAA 3VXNA 5GS0C 3GSNB 1FFRA 2XXCB 2Z93B 2PTVA 3KXFA 4LDLB 5F1IA 1OGTA 1LP9E 1CK0L 3WNKA 2Y5TA 3U30B 4S1DC 4LOUD 1KT2B 2R0ZL 4RDQF 4EN3B 4J3WA 1NJ9B 4YDIH 5T1LD 2RCSH 1WITA 1KXTB 3WNLA 3SO3C 3UPRA 4CMHB 4OF5A 4NN7C 1AGBB 4JHAL 4NRXB 1EHLH 3HAEH 2J8UB 4S0SD 2XYCA 4GQ9H 4U4BA 3ARWA 1OCWL 1XGYL 2DMBA 2YPLA 3JUYA 4G8FB 3T8XA 1VCAA 4HIXL 1JFQL 1MIEH 4DGYH 1UH3A 4HUMB 3WLBB 4NKDA 1HXMB 4MQSB 1QNZH 5DZNA 3ZLQC 5GRJL 3JZ7A 2Z8SA 5F6HI 4L1HA 3CC5B 4Y1AB 4QXUH 2WIIB 1E4WH 5DRXB 4LDEB 2VDML 3FB5A 2PNDA 4JN1L 4PJ9A 5I8OL 3E6HB 4K71B 1G9MC 3L5WB 3D87B 2YC1A 4C54A 5IB4B 4PGDA 1JGDB 1N6UA 1JNHB 4KVCL 1JHTB 3L5XH 1RK1A 4GRWB 3RX7A 3UZEA 5BXFB 5H8DA 1T21B 3LEXA 5ADPL 4M1GH 1KXQE 1U92A 4HZLA 2RFXA 3ALPA 5J1AA 4AJ0A 1JYNA 5BQ7B 3ME0A 5KSBB 4YK4B 2HKHL 3ULSA 2VLLA 3P0GB 4NGHH 3RZCB 4XCEB 2P46B 4Z0BH 1S7WA 3K74B 4IOSD 2ZKHL 4OZIB 1UACL 4DZBA 3KPSE 2NY4D 4I9WD 5HHOD 3IJYB 2QQNL 4JG1H 3TBVA 4Y16A 4TUKH 5DQ9B 2VDKL 3DMMC 2VL4A 2Y6SC 1GGCH 3VH8G 3I2CL 4U6XB 3IAGC 1AIFB 3O2WL 5C0EA 5HYSB 3FQTA 3BGFB 1PKQA 3PL6B 2X9WA 4NO2B 2YPKA 4FOMA 3GMQB 2HMID 5D5ME 1TJIL 4F9PA 5GZND 4MXWL 3KYNB 3MYJA 5JOPD 1FDLH 3STZA 5AWNH 4JPWL 4MQTB 3F7QA 5HJ3B 4IDLA 1S7VB 3EJZC 3ULVE 15C8H 2FJGA 3I02B 3SO3B 4Y4KC 3GB7B 1NQBA 4H8WH 1G7IB 4F7MB 3N9GL 3E3QC 3TBSB 1PKOA 4YO0A 2O5XL 4JO2H 4L4TA 1I9JH 3QWRD 3U4BH 3ILQD 3H7BB 4FRWA 3DNKA 1BX2B 4Q9QL 4DVRH 1EIBA 4K7PY 5IROC 4HJGA 3ZE2F 3QDHA 4WFED 2F74A 2J8UF 5DVLA 3BDYL 43C9B 3GKWH 2VE6A 2OTWA 3REVA 2HWZH 2V5MA 4Y8DC 3VWKD 2XN9B 4PRHA 3RU8L 4WDIB 2B39A 4RMRA 4G7YH 1N26A 1PAMA 4HQQH 3IAQA 1F42A 3VGHA 1VSCA 5KJRH 2P44B 4JFQB 4RMQA 2BJML 2I9TA 3PE9A 2MTPA 2E9IA 4M7LL 1T04B 1F3DH 1JGEA 5CEYA 2DL9A 4K7PL 2P5ED 4GRWF 2DLFH 4L1DA 4K55A 1WBXB 3TO4C 5FOJA 2P8MA 3I50H 4FTVE 2QQKH 2YD1A 1VFAB 1KULA 1CFTA 2A0LD 3C6SA 1CDIA 4GOSA 1JZ3A 3O3BB 3RJDA 4JGJA 1U8OB 3RBGA 1X7QA 3FFCD 3ZTNL 2E6JA 4JM4H 4M43L 1H15A 4OZIF 1JP5A 2BSSB 4EDWL 1P7QD 2ZCHL 3MV7A 3BE1L 3L5IA 1NGXA 4LSUH 5E5MB 5ID0A 1W0WA 4OTXL 1Q9LA 4X80L 2CKBH 1H3WM 1SM3L 2VERN 1VENA 1KJ2A 4NO3B 2VR9A 3GMOB 3PGFH 4MJ5B 4HKJA 3VGGA 3BW9B 3QNXB 5I15H 3G5XA 25C8H 2VLKE 2BC4B 3NCBB 1WFUA 2R23B 1ES0A 1I1AB 4BSWB 3IF1A 4ALAL 3NIFE 2NX5D 3OF6A 2W60A 2XWTA 1VERA 1U36A 1F90L 3T0EC 1B9ZA 1VEPA 4U7MA 3QUMB 4QCIB 4Y89A 3WE6B 3HZYA 4NJAL 5IBTL 1IAKB 3VJ6A 4JRXE 1HHIA 1MJ8H 2SEBA 4PB9H 4G6AC 3TCLB 3MA7B 3SCMA 1ZAGA 2O5ZL 1H3TA 4LCUB 3VXRA 2A9NL 4E5XA 4E42B 5DXWA 3P0YH 2GTZA 3EOAA 3DSNA 2YMXH 2JTDA 3ZE2E 1P1ZB 5KOVC 4FZ8L 2J8UE 1Q94B 3GSUB 4OLUH 3OKMA 1JGVH 1IT9L 2XZQH 3AXLA 4TTGA 2OSLA 4UIMA 3DVIA 3OGOE 5DJXB 3OG4B 5DD3H 1UEMA 3GSWB 3DBXA 3MRFA 3GBNH 4XP5H 1X5GA 2UUDH 5ALCH 3TO4B 4EOWL 3W2DH 4Y1AE 3O9WC 1PLGL 4OGYH 3FMGL 5GJSL 5F7LB 1ZTXH 5I1IL 1QVOA 1E4KC 3HAEB 1P7KB 4Z95L 1S7UB 4PG2C 1E6JH 4M7KL 4NQEB 3EOTH 5HPMB 3NOIA 1HHKA 5FHAL 4LSSH 5T5NF 4CJ1A 2QADD 1Z9MA 4HBCH 4Z7UE 3G08B 3GIVA 1R3HB 3UX9B 4XB8A 1KCUH 2PR4H 3T0XA 5I1HH 1YUHA 2JCCE 4P46B 2QSCH 1IM9D 5DC4B 1TJGH 3O8XB 1VADB 3IVKB 1J0ZA 1TZGL 2E9WA 5EIQA 4YHNB 2D7OA 3K1DA 3KYMA 3MTRA 2Y4SA 1KTDA 2GEEA 3L95B 2NY6B 3HS0B 1OP9A 2E7CA 4ORGA 4JJHA 4LSVL 3T0EB 3ZKND 1FV1A 2X44D 4OZ4B 4P2OB 5JNYA 3FO0L 3T2NH 3V6ZA 5KTEL 4PJXF 1A7OH 4Q97A 3GSOA 2X1OA 1KEGL 1GC1C 2HP4A 1NMAL 4RWHA 2ERJB 2X4PA 2BHUA 4K23L 3RTQB 1S7XB 1XR9A 5A16B 1WZ1L 2VLJA 1GAFH 1E0OB 4LASH 4MAUL 3GSRA 5BV7H 4EI5B 5MI0C 1KN2H 3H9HB 3X3GH 5IEKA 5E8PA 5AEAA 1P84K 4TOYH 4RFNC 4W6YB 3R06B 3F5WA 3V0VA 5BMFL 4X7FC 3GIZH 1FFPA 1T2JA 3FQRB 4MJ6A 1CTOA 2H8PB 3QEHB 4OCYH 1A4KA 3ARDD 4AH2B 2J2ZA 4LLMB 3SE8H 4OCWH 5DUBB 1F4AA 2AABL 5AZEH 4OLZH 2JELH 1S7RB 3O9WB 5EBGA 1I8KA 1U8PB 3BN9D 5ESVA 5E03A 1DQQB 4GH7B 3RA7L 1RZJL 3SKOA 5I73B 2AXGA 2J5LC 3WHE0 5HYEA 3OKYA 5D1QC 2VDOL 1I4FB 2XN9E 1XGTA 4GG8B 2A9MH 2AW2A 3ULUD 1ACZA 1KCLA 2F5BH 4J8RA 5JO5B 3RGVB 5HHMD 4UU9B 4PJEA 4ODWA 1F58H 3QJHB 3Q6GL 4AK1A 3BAEL 5I1CL 1FBIH 4U1MB 1A9EB 5J8OA 3ECBB 4NNYB 4MVBD 2FO4B 4K3EH 4MHHI 2W0KA 5HYFA 4RWYH 1AKJB 3IXAA 1YNTB 3EOBA 1HYSD 4LCWD 4X98A 2EE6A 1YEIL 3OR7A 2PCPA 3CFJA 2X1PA 1K2DB 4DAGH 4RZCB 5GQBA 5D7LA 2VXVL 1DUYA 2QBWA 4F7EB 4AEIL 3K80A 4NSKB 4XVJH 3IDIB 3PWNB 4I2XA 4GW5A 1G6RH 3MOQA 4HSQA 2CGRH 3TA3D 2AJVL 1IQWH 1YJDH 2FRGP 4XPHL 2R2CA 3RP1A 2WMPA 1I9IL 1J88A 3HLAA 1QSEA 1UM6H 3VFTB 4F3FA 4H5SA 2I5YH 4YGVB 4X99A 3UBXA 3L3KA 1OTTD 3CFDA 1OQXA 4UTBH 3IRPX 1RUQL 3O45B 1T7XA 2GYSA 1NGWB 5C0CA 4MJ2A 1T4KA 4JB9L 1CICD 3TYGH 3ARBD 5MI0B 3E3QE 4PJXE 5DMIL 1LO3H 5KSVB 4RFNB 4L8DB 5J9PA 1HSAB 3DX9A 3IAPA 4NWTH 5BRZB 4XC1H 1V3JA 5ELIA 2Q8BH 4M6MH 4YUEL 1WSST 3IDJA 2CKBB 1B4JH 1JHLL 3WD5H 5GGTH 1MSPA 3TJEH 2NY0C 4EIZC 3SBWC 5ADOL 5IB3B 4NCDA 4M1DH 1UFUA 4XAWL 3LDBC 4LCYA 3PP3K 1C5BL 2WP3O 5IFHL 3QEQB 3U46A 1XFPA 3N1QC 4OZFH 1BOGA 5HDLA 5T1LA 4OGXH 2BY1A 1LGVA 5JW5A 4AL8L 2P5WD 1G9NH 2FB4L 3HB3C 5KANI 4YBHA 5ITFB 1MFAH 1A0QL 3ILPB 4GLRI 3TPUA 5FO8B 5JQ6L 2L0DA 4XXCC 3TN0D 1EO8L 4M62L 1BM3L 2IPKA 1YEEH 3FQXB 2WBWB 1BQHB 5IOPB 4JKPH 5CJXA 3VG0L 1P69B 2DKUA 5JXED 1EFQA 1OAKL 1U8LA 4GQPH 5FKAB 3QFJD 3MLUL 3P3YA 1MCWM 2IH1A 3VI4E 3K2UH 3T2QA 5BV7C 2YD6A 1LDPL 4XGZA 5A2LH 4U6HB 3S37L 1JI2A 2R4SH 2OI9C 2BVEA 4KKLD 2H9GA 1DBKL 4JCMA 5C0FA 3BKYL 3UTZA 3NFPB 3VFPB 3VFVA 2DQFA 5DD1L 3U1SL 5J4MA 1TNNA 2NY5H 2WZPD 4UV4L 8CGTA 1RIUL 2Q3AA 3KR3L 1ZHLB 3NCJL 3DETC 2FZ3A 4OZGF 1LO4L 2XWJA 3R0MA 3FQUB 5DK2B 1HKLL 2ZWLT 1K6QH 5HYQB 4PG9B 4P3DA 4XPTL 4KUCF 5HHOA 5JZ7D 2EYRA 4EI6A 1CR9L 4X7SL 4Y5VA 2BVQB 3VH8A 1F3RB 3LEVH 4F7TB 1ZWIA 5EZLA 3DX6B 5DWUL 5DRNA 4NN6B 4PRAB 4GUPA 1R5WA 4MNHA 5SX5K 4PJCB 3T0EE 2DQDL 4M48L 1TZHA 2KPNA 3FB7A 4LPVA 2J1KA 3P0VH 4Z6AT 4YHMH 1A22B 4U6YA 1KFAH 3PGCB 1A6AB 5TH2A 5JPNA 5D96B 4M4RA 1ZHBB 5BS0D 4NQUA 2ADIA 4ZFFB 4J4PD 4UBDD 4P4KC 4XAKE 2NTFB 1WICA 4WY7L 1MJUL 4LMQE 4OSUL 3EYUH 3T2PA 5DQJB 1KLGB 4RBPH 1DLHB 1WZMA 3SY0A 5IP4A 1CG9B 4XWOD 2VKXA 1MPAL 5C08D 1YJDC 2HFGL 1A6WL 3C08H 1A1OB 3RL2B 3C60C 3A6CL 4L3EE 5CWSB 3RWHB 2EE3A 3MACL 3M8OH 5T5FH 1D5IL 4RIRA 4JFHD 5TDNA 1QFPA 3TO2A 3D0LB 1BQSA 5BV7B 4P5TD 5B39B 4ZXBA 3VWKA 1PVHA 1QRNB 3BZ4B 3ARUA 1CFSA 2V5SA 3VWJD 4LAJH 2X1QA 3TV3L 2QHRH 1FNEB 1ORQB 1RZGA 5D9SB 4X4ME 4YC2C 1DVFD 2VISB 3CVHH 3QDJB 1HQRA 5IGXH 1VGEH 4CVZA 3W9EA 1J0KA 4OIAA 5GSRB 3QIUB 1FLTX 5HYJB 4OIIH 4ONOA 4YE4H 1SJHA 3LN5B 3VXME 1FL5A 4FFVC 3C6LB 2W65B 2H45A 1PG7L 1XGQB 1B0RA 1DUZB 3NIDF 5IHUL 2ZSWB 2G9HA 4K8RL 1VGKB 3VD7A 2EDKA 3QIWD 5K9QG 1KJVA 1YEDB 4PJGB 2HT3D 4M1CD 5FF6A 1I7UA 2XNAB 5D93B 4HUKB 1KPUB 1A7PL 1NCDL 3AS0A 4QOKE 4F8TA 2XZCH 1G9NC 1B90A 5DMKA 4B7LA 2NY7L 1QR4A 4QT5B 5F3BA 3FFCA 1JF1B 4ODSL 4OZGE 5EZJA 4DVBA 2OX5A 3RPKA 3CUPB 2IQAA 3V52H 4LNRB 3VFNB 1P7QA 1OTSD 2VZOA 1IAIM 5IB2A 2F8OA 1AP2B 1FO0L 4Y19E 2G2RB 3FT3A 4FQ1L 3QCTH 3QCVH 3HCVB 4X5WA 1GZPB 4KK6D 1S7SB 1B0GA 2DBLL 3WUWA 3OR6A 4PJCF 1F4XH 4WFHD 1INQA 1G6RB 2EDLA 3SKUD 4UTAH 4DK6A 5GHWL 2NX5A 4MDIB 2PN5A 2HT2D 1JNNH 4MNQD 1UXWB 3O81A 5D6DA 2HH0L 1U3HB 3MLSH 2AI0L 1N0LA 5IB5B 4KWUA 4D3CH 1CZ8L 3QP3A 3LCYA 3CSYB 4S2SA 3TPKA 4QHNB 5CJOH 4HS8H 3MJ9L 4FQCL 2F9BT 3VI3F 5DHVH 4M7LT 4MD0B 4NBZB 1ZMYA 2ZUXA 4R4ND 2NY3C 1BVZA 3UTSE 4BFBD 3TWCH 1UYWH 4X6CB 4DKFL 4HF5L 3E0GA 3HZVA 1CDUA 4KROD 3VG9B 3GMLB 2AK1H 3TT1L 1H0DA 3MBED 4XWGL 4YHZL 4RGMC 5HGGS 2QR0A 4OAWB 4OD3L 3IETB 2CDGA 4OZHA 5DEGB 2BSTA 2XY1A 1HXYB 1UA6L 1UWEH 1I3UA 5KBNC 3TCXA 4LIQL 3F7YA 1FVEB 2EH8L 1C7TA 2ZCLH 1YECL 5HHVH 4OZFB 1EXUB 4NQTA 4X83A 3QIBC 5T3ZL 1M05B 4PJAA 3UTTB 1EH9A 4NDMB 5TE6H 4AQOA 2IPUG 7FABL 4L3CB 2OMBA 3VFMA 3TNMB 1VDGA 4GRLC 1A21A 4XHQA 1S9YA 2EXWD 2VXSH 3WUZA 1ULVA 5A3ID 5F7DA 4LLQA 4M5YL 4L8SB 4WNQB 2HLAB 3SN6N 4HJ0C 1FAKT 5C07B 3LPWA 4I3RL 4GKZA 1DQDL 2XXMB 4Y0GA 1UCBL 3MFGB 4P23D 4KRPB 3KPNB 5DYOB 4XPFH 4CKVX 1VFBB 4LSQL 3RDTD 1EGJH 1XF4B 2DWEB 2I60H 3LQAH 4PJGF 3SE4A 5JIHA 4FFZL 4AY0A 5CIPA 4JFYB 4J7RA 2DQUL 1T1WA 1ZT4A 3BFOA 4NHUB 4PJHA 3OKKB 3MODL 3QULA 3NABL 3U83A 1BMGA 3BXNA 5HI5D 3T0WA 5ENWA 4JFEB 4G9FD 3W0WE 4ZNEA 1LEKA 4I3SL 4OUUA 5C0JA 1MFCH 1CFVL 2G5BB 2G75A 1QQDA 3KPPB 1NEZB 1MAML 1RUKH 3HNSL 3HC4L 3WCYA 5CMAB 4KKBC 2PYEA 5SWSB 2ZUQC 3KHOA 4PR5B 1MF2H 4GG6B 1IM3A 2YR3A 1LE9A 2F58H 5IFAL 1OWWA 1U58B 3WJLA 4DCQB 4MWFB 4M8VA 3BPCB 1FLRL 3S36L 2Q8AL 1CD0A 2J6EL 3QG7L 1DSFH 4OJFL 1HHHB 4HXBH 1LE5B 5C0IB 2NY3B 1KPVB 4UMGA 1FZJB 1CFQB 1JGUH 5IVZB 5IMOB 5JPMA 2V6HA 4BQ9A 5KSAA 5KVGL 3D2UB 3MLYH 1X6LA 3CVIH 4GW4B 4R26L 1SY6A 3RVVD 4MLSA 2YKLL 3VI3E 4WJ5A 1QSZA 1U8HA 3HPLB 1D6EB 2DQGH 4DQOH 4X6CF 3KPSD 2BVTA 5INDA 5C0BB 3MUZ1 2CRMA 3U48A 5FYLL 2GQHA 4NCC2 1U95A 3LKQB 5DI8A 4X4XA 4KK5C 1QRNE 4X4YA 4U2YA 4R4BB 5FHBH 2L7UA 3W9DA 3O3DB 4LLWA 5CUSH 1YDPA 3RI5F 5T3XH 2X7LB 1ZLSH 3SKMB 3AGVA 4NO0B 2BXYA 3IB4A 2PYFA 1FP5A 5C0NC 2Z92A 1R24A 2HVJB 4U1JA 3PWPB 1JN6A 4P2RB 2H6PA 5FECB 4JJ5A 4K94C 3ROLA 4F58L 4JPVH 4R7DB 3CVHB 5D70H 1DJSA 3QRFM 1CS6A 4ELMB 5IMLB 1DCLA 4NRZA 1I8MB 1FGVL 1I9EA 3UDWA 4PY7A 1Z5LA 3TA3A 4MXQC 4Y4HC 2AJYL 5EG6C 4JY5H 4JANB 4U3HA 3Q1SH 4YDKH 3LN4B 1DQLL 3VD3A 2XTJC 4JFZL 4RX4A 5IIEA 4CN6A 5KW9L 1XGRA 2F53E 4K7PX 2B2XH 4OBRA 4LEXL 4YBLB 3BT2H 4JFPA 2H3NB 4I4WB 2AJSL 2Q76B 4EXPX 4GG6F 2X70A 4H26A 5FO9B 1CICA 3ARBA 4PJFA 3CFEB 3MV01 5D4QA 1MWAA 4QHKJ 4KPHH 5GGQL 5DEZA 3ZHLA 5JTWA 3W11D 1JVKA 2R29H 2FJFB 4WW2B 1RIHL 1K4CB 1OGAB 5EZOL 1GVIA 3WJJA 5I18L 1EFXD 2P24B 4LLYB 4QYOB 1ZGLP 2DD8H 4XCYB 5IEHB 2J88L 4YHOH 3ZKMC 1CLYL 4FTVD 1J9CT 1JWMA 4BKLB 1X4YA 3I84A 1D5ZA 3OTTA 2VZUA 3TEUA 4UZGA 2WW8A 2I9LA 5DMGD 4IS6B 4G8GB 1W72A 1XZ0B 3E6FA 3L9RA 4YHIB 4YDVB 5HHPB 3T0AA 3BPNC 4TTDD 4X5XB 3GSNL 2P5WA 1JF6A 5GRUL 4X6CE 3QQ4A 4TN9A 2X2YA 5I1LA 1CLZH 1CFNB 3VFGH 1P6AB 4MNGE 3D0VB 3TN0A 4JGUA 3PUCA 3SPVB 5MENB 2AJ3B 1CU4H 1WTGT 5H94A 5HDQH 3LKSA 4JR9L 1EEZA 3HMWH 2E7BA 2V2XA 2VTFA 3ZYOA 3PJSB 5JXEA 4GFTB 4ZO7A 3MRCB 4A6YA 3FQNA 5DHVB 5CBAA 1G6VK 2VLKD 1QP1A 3QFJA 3DURB 5CGTA 1YZZA 2DTSA 2NW2A 5I16A 3RIFF 2V2TA 3AROA 1CN4A 1KIRA 4TRPL 4J6RL 1NL0L 1U42A 5IJVA 3BVNA 1J0JA 3QEUB 1KJ2H 5E2VH 3QZWA 2VMFA 1E28B 3RKDC 3QUXD 4Y4HB 3MGAA 1AGFB 2Y1VA 1JE6A 4JRXD 4JLRB 4DOHE 3B2VH 3GHBH 1DBML 3QUZB 4MD5B 3B5HA 3KNBB 1QLFB 4PJ5D 1KXVC 5MEOA 3ARED 4ELMF 4QTIH 1T80A 2YK1H 3VCLB 3WNNA 3CZFB 3SDDC 1RZFL 1OM3H 4JFEE 3B6SB 4ZUTA 4CJ0A 3G5ZA 1M6OA 5ERWB 2VXQL 3U0PA 4G6ML 4KMTH 1M71B 3QUYC 5IF0B 4HWNA 2ATPA 3P2TA 4LPCA 5E1AA 3NH7L 4K3DL 1G7JA 3PHSA 4ZTOH 2B1AH 5D2LB 4C83B 3EW3B 5SX4I 1U3ZA 4YHLL 4PV9B 3KDMA 4JM2C 1TMCB 1DP0A 4KKAC 1CIUA 4NM8H 3MUHL 1YMHB 4EQ3A 1CGSH 1WTLA 2GAZA 2HTLD 4WW2F 1AY1L 1FYTA 4JZJB 2NLJA 3KXFB 4O58L 5BS0A 5FUZH 5F1IB 1OGTB 1GIGL 4J4PA 3BPNB 2ZNXA 5CSBA 2Y5TB 3ARFC 1U41A 5DJ2B 2LTQC 1GGIH 4UILH 4PJ8C 4YBQC 5HI4C 1QR1A 5C08A 3RWGA 3UPRB 3MRIA 4XC3L 4C4KT 2ZUUA 1WWCA 1IGFH 2ZNWA 2OYPA 1JI1A 4NQCE 5L7XL 1HI6A 4U33A 4G6KL 4XBPA 2YPLB 3BP5A 3RNKA 2B7DT 4K07A 4LVOC 5F89A 5C0BE 4NKDB 5TGBA 3GNMH 4YHKL 2EZ0D 4XPBL 4P5TA 1QFUH 3PHOA 2EYTA 2GHWB 2R0WH 3OPZH 2R0LH 5ICXA 4LP4A 3VWJA 4NZJA 4YEEA 1U91A 3FB5B 4XCNA 3VFOB 1J7VR 3CFKA 1IGYA 2HFEA 3GK8L 2A6JA 5TE7H 2BX5A 2YC1B 2JKXA 5GS0D 4PGDB 3JBG7 3K3QA 4N0YL 4I5BA 3D3VB 1RK1B 2CQVA 3OAYH 3S97C 5TPWL 3P11L 1XIWC 3MUGA 5LGHH 4YEFA 3LIZL 3WFEL 4C56E 5SWQB 2O5YH 5J1AB 2DMKA 4S1DD 3JWOL 3MV9B 5EIVA 5E2TL 1IFHL 3SDDB 3ZT7A 2VDLH 2Z35A 1FSKC 3HZMB 4P2RE 3QIWA 5IHLB 3B9VA 3ZZ1A 1ZLVH 1S7WB 3K4ZA 1XF5B 1G0YR 1J1XL 4DZBB 5AG9A 2DL2A 3GGWA 1DLFL 4GS7B 3NPZB 3CXHJ 4XNQA 5IHZA 1HEZA 4MAYA 4KRMB 3VXTB 1DL7L 1FNSL 4JM2B 1PGRB 5DFTA 1QSVA 2X89D 1KJMB 2XPGB 5C0EB 1AXIB 3B2UC 4NP4L 1Z6JT 2YPKB 3QXDB 3NTCH 4KY1L 4H0IA 5D2LF 2A6KA 2QKIA 3S9DB 5ILTL 2CDFB 4PRDA 1QEWA 4OIBA 1C5CH 5DT1L 3JV4A 4ONGH 4PB0H 2R1WA 3OZ9L 4PJ8B 5K9KA 2JK5A 1MCRA 5D71H 3QQ3A 3BZEA 3ZMRA 3OKLB 2VZVA 4YO0B 4MNQA 5ANMA 1QFWH 4L4TB 4WV1A 1J1OH 4H1LH 4KJPC 2DQCH 3PP4L 4LVOB 3TGXA 1A6UL 1MAKA 3RWCB 2EYSA 5FYJH 3DHMA 4HJGB 2ADGA 3ZKQD 1X5LA 4KDTC 5T33L 3DMMD 4RAUA 1AO7E 1BFSA 1RHHA 1CDGA 2W0PA 3QUML 2VE6B 4AEEA 5HGBA 1A3RL 2OTWB 3REVB 3U6RA 4NBYB 1BF2A 1NGPL 4PRHB 4QHMB 2MCPH 5C0AD 2VLRE 4UB0H 4DKEH 1XIWB 4CU6A 1P84J 3RAJL 3SE9H 4F57L 3U7WH 4XVUD 4R0LA 5MENE 2I9TB 3R8BB 1FVDA 3SE3A 4HLZG 3C8KA 1FSKB 2FD6H 4LKCB 3LRSA 2AKRA 2CRYA 3OX8A 4Y4KD 5BVPL 5IT2L 3P4MA 4MQXC 5CEYB 4LGSB 1UXSA 4YIQA 5KS9A 2AP2A 3RNQA 3SKJL 4TVPE 4Z7QF 5B8CC 1IZJA 4N5EC 4P23A 1CFTB 3MA9H 1HQ4A 3C6SB 4UINH 3FT4B 1NCBH 4YDIL 3PG2A 3RDTA 1NGZA 2C4XA 1LP9A 1H15B 4HV8A 4LFHD 5FV1L 4J1UA 4ETQA 3KPMA 5FB8A 4LFHG 1MQ8A 1NGYB 4GQ9L 1FL6A 3MV7B 5F3HA 4N8PA 4HCRA 4XZUA 1SEQL 1VEMA 1W0WB 4ZFGH 1MIEL 4DGYL 1DR9A 4JM2F 1IKNC 2GW5A 2BY2A 1QNZL 5KVDL 3MRNB 1KJ2B 1BIIB 3VRJA 4NO5A 2EC9T 2LE9A 1YA5A 1WBYB 3F7PC 4Y7MA 2VAAA 4QKXB 5K33A 5D2LE 4QEGA 5GGVH 3IF1B 3L5XL 3M1BA 3AM8A 1J11A 4FFYH 2XWTB 1BZ7A 3S3SA 4M1GL 1FZMA 4PTTA 5ESQB 3BD3A 4O2FA 1HHGB 4HWEH 2Z31C 1T83C 1HHIB 1FJ1A 4M7ZC 1Z9LA 4QGTA 1QSFB 4ESKA 2J4WH 3SCMB 4NGHL 1FNGA 4Z0BL 4XMLH 3ARRA 4MX7B 3VXRB 3S35X 4LP5A 5CZXC 1EVUA 4E5XB 4IMLA 4NKOA 1RZIA 1FORL 1KC5H 2XICA 2GTZB 2VH5L 3EOAB 4JG1L 1BPVA 2K1MA 4X7DC 3EDKA 1A9BA 4U1IA 1AGCA 2BERA 5IWLC 1GGCL 4QLRA 4R96A 1Y18A 3VD5A 3OKMB 1TTUA 4L3AA 3AXLB 3KPSA 4UIMB 5D7JA 2CLZA 3QDME 4O5LL 3DBXB 3MRFB 3D9AH 4YH6A 2FR4B 3ARXA 1BJ1H 4CMMA 2F54D 3O4OC 3N85L 2XOTA 5AZ2H 1UWXH 3GO1H 1FDLL 3V6FB 1QVOB 4X5LA 3L3HB 5F9WB 1CI5A 1N0XL 4QY8B 2XFXB 5D5MA 2GT9A 4NOBA 4GKSA 4H8WL 3F7VA 4KMQA 3D3VE 3EAKA 4LSRH 2MOVA 4BFGA 1HHKB 3DVGB 4G6AD 2JJTC 3MLTB 4MA7H 3P77A 3VGFA 2XACC 4JO2L 1GSMA 1I9JL 3U36A 1F2QA 2BNRE 4NNPH 4Z7QE 1H5BC 3U4BL 3MV9E 2NPLX 4XXDB 5SX4H 3MO1B 3GIVB 4DVRL 1AJ7H 5J6GB 4XP9L 3JWDL 4XCCH 4ODUA 1P5VA 4Q6IC 2P42B 4I48B 2E6QA 1U8JA 3ZKXB 1BBDH 3MR9A 1I75A 3ALWA 3GMPA 2HWZL 4L3ED 4P5MA 3KYMB 1QO3A 4JAMB 1KTDB 1P5UA 4G7YL 1YC8A 5CGYC 5D2NC 4K3HA 3T3PF 4X8JA 5KJRL 1AD9B 1FV1B 2ZOKA 6CGTA 5JNYB 1N5YL 4YHYC 2X42A 4AEHL 1RI8A 3MREB 2X4PB 1UJ3C 5CEZE 3HHRB 4O2CA 1XR9B 2YEZB 4LL9A 3D69A 2JIXD 2VLJB 2IBBA 2CK0H 4QF1B 3EJJX 5C6PB 5LAXB 2X9YA 2QQKL 4LPYA 5TQ0L 3GSRB 4NIKB 3QNYA 1KELH 4OFVA 1EFXA 4YDLC 4JKMA 3VXMD 5IEKB 5DD0H 5CD5C 1GPOH 3F5WB 1FFPB 4XVSH 2C4FU 3UZQA 4FTVA 4M9PA 4MJ6B 4JM4L 4CVXA 5DHYB 1F6AB 1FFQA 2W07A 1A4KB 2EIDA 4WEUD 4HPOL 5HDBF 5L9DH 4QOKD 5BW7A 5HSFA 1I8KB 1C16A 4LSUL 1RZ7L 4WHYG 4OCXH 3RJQB 1W0VA 3G6DH 2CKBL 4XBGA 43CAA 2NXZC 3MRQA 5DQDL 5IQ9B 4LCCA 2AXGB 5I76A 1Z0NA 1WIPA 1XGTB 4Y19D 4YWGH 4NYLA 4H1LB 4KZDH 5I15L 25C8L 3BDBA 4J8RB 3OHXA 3K8LA 1FCCA 2CLRA 4PJEB 4ODWB 2HYMA 3O3AA 4FS0A 1H8SA 5EU7E 4OGZA 4UOJA 1GOGA 4EVNA 2A83A 1KGCE 4JHWH 2VLKA 4FN0A 2WWKO 4HULB 3S8WA 3L1OH 5FYKE 1J8KA 1PEWA 4KUZL 4O9HL 2DI9A 1X4XA 3H7LA 3HFMH 3PWLA 1MJ8L 1LD9A 2NMSA 4PB9L 2FGWL 5ALBH 5GRZA 4X98B 2GFBA 4ONFH 1S5IH 4NQVB 3QUXA 3OR7B 4OB5H 2OQJA 2FX7H 2JLLA 5F72S 2FDBP 3QO0A 1KCRH 4JRXA 1DUYB 5FYJU 1KLUB 7CGTA 4O02H 1L7IH 5D2NB 3P0YL 2OZ4A 2H1PH 2YMXL 4GW5B 2Q3ZA 4I2XB 5F70A 1D3CA 4EJ1C 1TETH 2DM4A 4YJZL 4N8VG 3AREA 2VL5B 4HKZA 4OLUL 1JL8A 3ORJA 2XZQL 4EN3A 1NJ9A 5D1QD 2IFFH 5B4MC 2JF1A 1QSEB 3IU4L 3I6GA 5DD3L 1F02I 3UTSD 4F3FB 4H5SB 1MFNA 3UBXB 4X99B 3L3KB 1AGBA 3AAZB 3GBNL 4XP5L 2J8UA 1ZGLA 5L2JB 3VFRA 1A7NH 5ALCL 3HMXH 3W2DL 2R2EA 3CX5J 1T4KB 4G8FA 5TF0A 1ZTXL 4YDLB 4FZEL 4JQIH 2QQLL 5KAQF 5L0QC 2BDNH 4HUVB 5J9PB 2UYLA 4Y1AA 3TT3H 1E6JL 2WIIA 2MMXA 3G5VA 4WFGE 3EOTL 3IDJB 2X40A 1UZ6F 4LSSL 4HG4J 3L5WA 5CSGA 3BHBA 1AGEA 2ZG3A 5IB4A 1A14H 4HBCL 1JNHA 5D7KE 3EYVB 4LCYB 3WN5C 2D3VA 4Y88A 1QSFE 4WHDA 5H2BB 5I1HL 4PY8J 4K9EC 1V7MH 1BOGB 2QSCL 1T21A 3NCCB 5T1LB 3KVQA 4OD1L 1TJGL 5KG9A 2DTML 3KG5A 1HWHB 4Z7UA 1UB6A 5DD6A 5JW5B 1A47A 1IAOB 4GKNB 4HGMA 4IMKA 2AEPL 3RZCA 2JCCA 3W82A 1TZIB 1NUFA 2YPVL 2WAHA 4HK3J 4RA0C 5FFLA 3W0WD 5E08L 5DRWA 3QPQD 4A2MA 1D9KC 4NM4H 4RBPK 1WCBA 3T2NL 5DQ9A 2DKMA 5CIPH 4F7PB 4NFCA 3MLZL 4PJEF 4U6XA 2VITB 5BVJB 2IH1B 5BJTA 1NAML 4XGZB 5M7QA 2NY0D 4NO2A 1WIOA 5I8EA 4JFOB 3RIFK 4L8CB 3QXUA 1KN2L 5JA8B 3D5OF 4K3JH 2MQCA 4TOYL 5E2WH 3MXWL 4M00A 3GIZL 2BVPA 2EKJA 4OCYL 3WLWC 2VQ1A 1G7IA 2P7TB 3SE8L 1AE6L 4OCWL 3C2AH 5AZEL 3HB3D 4OLYH 2JELL 2NY4B 5HHOB 4TSCH 4S0TD 4HKBB 3H7BA 4EI6B 3RBSA 1ZA3A 4Y5VB 3VH8B 5EWIH 5FA3A 5L0QB 1NEUA 4POUB 3THMH 1ZWIB 4BZ1H 4JRYE 2X89A 4GUPB 2EIZA 1R5WB 2D7MA 2R1XA 2F5BL 3JV0A 4V1DE 4OD2B 3IS1X 4HGKC 1F58L 3FB7B 2XN9A 5TQ2H 4APQC 1SY6H 3BI9X 4WDIA 1INEL 2IMMA 4M3KB 3DGGB 4WI5A 2EDBA 1NSNH 4U6YB 5LGJA 2YN3A 2ARJA 5JPNB 2WLYA 1YYLH 4JFQA 5T1DH 5EOCL 3WIFA 2ADIB 1MHHA 1PDKA 4XT1C 4RWYL 1KG0A 3WDHA 1CDCA 5ACZA 4TSBH 3DETD 3T4YA 1V3MA 1MREH 3ULUH 3R1GH 1WBXA